5FEEA

Egfr kinase domain t790m mutant in complex with a covalent aminobenzimidazole inhibitor.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
322
structure length
287
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSTVYKGLWIPEGEKVKIPVAIKESPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDEMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Discovery of (R,E)-N-(7-Chloro-1-(1-[4-(dimethylamino)but-2-enoyl]azepan-3-yl)-1H-benzo[d]imidazol-2-yl)-2-methylisonicotinamide (EGF816), a Novel, Potent, and WT Sparing Covalent Inhibitor of Oncogenic (L858R, ex19del) and Resistant (T790M) EGFR Mutants for the Treatment of EGFR Mutant Non-Small-Cell Lung Cancers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 89
structure length 287
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5feeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5feeA01
1B39A 2BRHA 3BHHA 3ERKA 3FQEA 4FG8A 4ZTHA 5HG8A 5HGIA 4OBQA 3WIKA 1MRUA 4AZWA 4YC6A 2XJ2A 3F2AA 4YU2A 2C68A 5BVOA 4FV6A 3P23A 5EOBA 1WBSA 1J3HA 2Z2WA 2OH4A 3ODYX 3R1SA 3TNIA 2EXEA 2QOLA 4R7HA 4MHAA 3PXYA 4BGHA 4GKHA 5JSMA 4H05A 4DE4A 3JVRA 4KA3A 3NPCA 5KBRA 5CSWA 5L8JA 4PTGA 4YO4A 3FC2A 3OWKA 4FSTA 1WCCA 5ETIA 2ACXA 1JLUE 4RBLA 3A7HA 2XCKA 4IZAA 1PXOA 3R2YA 5HE3A 2BRGA 3FMNA 1FBNA 3ORPA 3TZMA 2F7ZE 1PJKA 2UZVA 2Z7LA 3ZSHA 1P4FA 5IH4A 2FVDA 4QMVA 3Q4CA 3ZU7A 5DI1A 4AWIA 4EK5A 4X3FC 1S9IA 3TZ9A 4FIHA 4TTHB 3QLGA 1OECA 3BV3A 3RKBA 4R6VA 1AQ1A 3CD8A 2VTIA 4L44A 4QP9A 4GW8A 4TYHB 3MFUA 3OG7A 1RE8A 4MF1A 3PY3A 4F09A 3UQFA 3ZO2A 4O83A 4QP6A 3PXKA 2PL0A 3IW8A 3TNQB 3C0IA 3NUXA 4OUCA 4ACHA 4TY1A 4EL9A 4BTJA 2FH9A 2J4ZA 3NUUA 3P4KA 4MD9E 4ZTNA 5IQEA 1M7NA 5CI6A 2H8HA 2REIA 4FOCA 3C51A 2XVDA 3R9HA 5HTCA 4KRCA 4WHZA 3VF9A 3VS6A 4FBXA 4F0IA 5B2LA 4DFXE 3SC1A 4D9UA 3DQWA 2ITWA 3T8OA 2Q83A 5LVMA 4MNEA 4M12A 4FKRA 3G15A 3FAAA 2YM7A 1FQ1B 1ZMWA 1NVQA 3VBYA 4B7TA 3FEGA 2J5EA 4M15A 4XNEA 1HCLA 5HIEA 4A7CA 1M2RA 4E6CA 3KRLA 1GZNA 5FQDC 1BL6A 2HY81 2RIOA 3KULA 5EK7A 3O0GA 3EKKA 3R22A 3EHAA 3KU2A 5A4TA 5CEQA 4HYUA 4CFUA 4XP2A 5JFXA 3HUCA 1OBDA 4Y85A 4P4CA 4BWXA 4ENYA 5JQ5A 3R02A 3KREA 2YIQA 3P86A 2XNMA 2X7GA 2VTQA 4YBJA 1GIJA 2VWZA 3DAKA 5AM7A 1E9HA 1W7HA 4IB3A 4DYMA 5KCVA 3BV2A 3G51A 4EUUA 3BLQA 3EH9A 4CRLA 2ZM3A 5GZ9A 4ASDA 4PMPA 4K6ZA 3DFCB 4J99A 2OGVA 3CPCA 1OKWA 2BTRA 4FZ7A 3OCSA 4EHVA 2R9SA 3HLLA 1K9AA 2QOIA 5E8YA 3P79A 3FZOA 3SX9A 3ZONA 4RC2A 2XJ1A 2BTSA 1ZYCA 3VHEA 1PXKA 3CD3A 3F3UA 4FA2A 3E8DA 5HCZA 2Q0BA 3M11A 2PMOX 1W98A 5CASA 5E7RA 3BWFA 3KEXA 3UGCA 4LGDA 4I0RA 4JG6A 5CALA 5C9CA 5HICA 3R7GA 3OOGA 4AFEA 3TIYA 2CJMA 2XNBA 4U44A 1OGUA 2F57A 2JD5A 4HYHA 4IC8A 4O0TA 1ZOEA 3U4WA 4QP3A 4CMTA 5AFVA 4JIKA 4FL2A 4U45A 4QP2A 4AAAA 3QQUA 1JKTA 4G6OA 4C7TA 5ACBC 3GXLA 4HYSA 5EHLA 2BIYA 3OY3A 3AMAA 3MTLA 3PY0A 4N6ZA 2BAQA 1U54B 4DEBA 4X6RA 4A9UA 2WTCA 3P7BA 2O64A 4JX3A 4KIKB 4XG4A 5TF9A 3SXFA 5L2QA 1XWSA 5ANEA 4OT5A 4LM5A 3VS1A 3Q96A 3OW4A 4D0WA 4DFZE 5HX8A 5IKWA 2YM6A 2RFDA 4XS2A 5D7AA 4C62A 5BUEA 1OBGA 4C59A 4QMNA 1SVHA 1V0PA 1M2QA 3F6XA 2QO2A 2QNJA 4H39A 4EC8A 3G5DA 2J2IB 4N57A 3PZHA 2BILB 3FJQE 2CNUA 5EQEA 3MVMA 4CEGA 2BAKA 4C37A 4UWBA 4F7SA 3R7EA 1XH7A 3LMGA 5DEWA 4NTSA 5I9XA 3BE2A 3LCSA 4AGCA 2CKEA 2QURA 3K54A 3C4XA 2GMXA 3QA8A 4DG3E 3O8UA 2VAGA 4BDIA 3EQIA 5ANKA 3H30A 3EQBA 5A4QA 4ZZNA 1KE7A 4MXAA 1U46A 5IQGA 2QR7A 3PJCA 4KBKA 3WZDA 3HV4A 3O71A 3SRVB 2O0UA 5IQDA 3NNWA 1MRYA 1SZMA 4NIFB 3MH3A 5AUTA 2CNQA 4IFCA 4QQCA 1UU7A 4BI2A 4ACGA 3HAVA 3R9DA 3TTIA 4O7ZA 5J79A 4U8ZA 2J7TA 4FVPA 2J90A 3JYAA 3GQIA 2C0OA 3RHKA 3LMIA 2YCSA 2NRYA 2YCQA 3C4WA 1V1KA 1OUYA 3MN3A 2VTRA 2GNIA 3VHKA 3V01A 3S4QA 3V8SA 1P2AA 3JY0A 2YDKA 3FKNA 3OXTA 4X2JA 4EK8A 5LJJA 3UQCA 2GCDA 4WBOA 2R3RA 2P2IA 4HZSA 4CZTA 3FY2A 4GIIA 4O0VA 3Q2MA 4RIXA 3QTIA 3V5WA 5LARA 2QOBA 3R8PA 4ZY6A 1OPLA 3SOCA 3PPZA 5HQ0A 3ZXZA 1E1VA 1OIQA 5AP1A 4BKJA 1H25A 5EOLA 4Y8DA 2PE0A 3W55A 2XK3A 4FV2A 2WU7A 2XK4A 1GAGA 3N4TA 3RGFA 4D1SA 4LQMA 3UO6A 3QQFA 5H2UA 4KIQA 1YXTA 2A1AB 3UODA 5GINE 4IB5A 4X3FB 4FKPA 4UMTA 3CTHA 3FE3A 2F4JA 2WMWA 4IH8A 5E9EA 4ERKA 4C4JA 5CU0A 2WPAA 2ZJWA 5IG1A 5M4FA 4PX6A 4V04A 4GVAA 3QTZA 3WE8A 3EFKA 3QWJA 5M4CA 2QOKA 2RL5A 2YABA 3D5XA 3NUSA 1Q8WA 4LOQA 4YJRA 1OMWA 4EOLA 4G5JA 3HX4A 4JS8A 2BFXA 4QMYA 4GYGA 3R8LA 3C4CA 1KUTA 4ITHA 4FKGA 3DBQA 3FL5A 4H3QA 4K77A 3PSBA 4N6YA 5JRSA 2Q0NA 4FV9A 4XG9A 1UNHA 2PMIA 1YOLA 5DWRA 5M55A 4B0GA 2NNWB 4FV1A 5LCJA 4JAJA 2VNYA 3D5WA 2FSMX 5EM6A 5HE0A 4OGRA 2UZLA 4O22A 3L8SA 4GFOA 3SGCA 3E92A 4FTAA 5AIKA 2P4IA 4E73A 4I22A 3KRJA 2XKEA 3OEZA 3P78A 4K2RA 4OTWA 3R7VA 5FEQA 5HBEA 1WZYA 3BGPA 2C6TA 2W4JA 3PXQA 4GJ3A 1XHAA 3RNIA 4BZOA 2C5YA 4XLVA 2X4FA 4TNDA 3CGFA 2PVNA 5KO1A 3AGLA 4KNBA 3TZ7A 4YMJA 3I0OA 4J71A 4PV0A 3VF8A 1GNGA 1AD5A 1YHVA 1WAKA 4C02A 3E93A 4U79A 4AZSA 4FKOA 5CZHA 3UOHA 5F4NA 4FIGA 3DBCA 5BVKA 3PSCA 4MVFA 3DAJA 3K3JA 3NAYA 4LFIA 5IUGA 2Y8OA 1O6YA 2X81A 4EK6A 4DH7A 3LCKA 2QU5A 5HE1A 4AW0A 3CJFA 4KB8A 4TT7A 4ZZMA 3ZZWA 4IX3A 3ULIA 4F99A 5DA3A 2R4BA 4L7FA 1T46A 4PWNA 4E20A 2ERZE 4ID7A 5EDRA 1IRKA 2GTMA 5CY3A 3CE3A 3LFAA 5HU9A 3N4VA 2W5HA 1JWHA 3QALE 4I5PA 5BMMA 4BDAA 3GUBA 3LXKA 1WFCA 2ZV8A 4IM3A 4EH2A 5BX0A 3QYZA 4M84A 3WZEA 3EMGA 5HZNA 3JVSA 3A61A 2IN6A 3KA0A 3QQJA 2OICA 3OUNB 2IO6A 2VRXA 2XS0A 3HL7A 4PL5A 2W7XA 4CSVA 2UW4A 1F5QA 2XIRA 3FI3A 3NWWA 1REJA 2B53A 2VX3A 4AN2A 4B99A 4H1JA 4BTMA 3CQUA 1M17A 4W4WA 5E1EA 3C7QA 3BYVA 3MY5A 3BYSA 2E9OA 5CU3A 3TUBA 4MXOA 3ATSA 3EIDA 1XH6A 3OT8A 3OEFX 2J0KA 1FINA 2XK7A 3NDMA 3QUEA 3RAHA 5JGAA 4GFMA 3VBQA 4FIJA 2X8IA 5IMEA 4S33A 2I0HA 4S31A 5FTOA 4HW7A 1URWA 4ANSA 2Z60A 1LEWA 3PIXA 4CXAA 3AOXA 1Y6AA 2EVAA 3F66A 3RZBA 5CF6A 3UPZA 4R1YA 3TACA 3FDNA 5EH0A 2KULA 2WMUA 5HVKA 5JH6A 2ZMCA 3E3BX 3S3IA 4WIHA 5I9VA 3I1AA 4M69B 3I6UA 2V7AA 4RX9A 3LCOA 3VS3A 4EOOA 4B8MA 2GQRA 4FTCA 4D55A 4QYYA 5L8KA 3Q52A 3ORIA 5C8KA 4EJ7A 3QBNA 5CENA 3W2QA 1OPJA 2ZDTA 2A2AA 3OOMA 4U7ZA 3WILA 3GCQA 2WELA 1UVRA 1IG1A 1NY3A 5G1XA 5JKGA 1WBNA 2QOHA 1R78A 3EQPA 3ALNA 4YZBA 1XH4A 3DBDA 4QT1A 5AM6A 4BZDA 1SYKA 1YXXA 4J95A 3C9WA 3QF9A 5AR8A 5I3OA 2AC3A 5BVDA 3PFQA 2BMCA 2WGJA 2QG7A 1DAYA 1G3NA 3NW5A 1KV2A 2FYSA 3BGQA 3EN4A 3ZM9A 5HO6A 1SNUA 3AD6A 3RAKA 2OZAA 1Q24A 4ANBA 4IAZA 1U4DA 3ANQA 3I0QA 4V05A 5AUVA 3KXNA 1H00A 4IM2A 4H3PA 3ZFYA 4RFZA 2FB8A 3QUDA 4G6LA 4QMWA 5J87A 3FLZA 4BCHA 5E92A 2V7OA 4IX5A 4XG2A 3C4FA 5GJDA 4E5AX 4I4EA 1JAMA 5EG3A 1FOTA 2JAMA 3R1NA 4JI9A 5AV1A 3LOKA 3R8UA 3RCJA 2XM8A 4D28A 5A4LA 5I4NA 4L53A 5LCKA 4XG7A 4C3RA 4NSTA 4U6RA 2JIVA 3G6HA 4UY9A 3G0FA 3NX8A 4CNHA 3KK8A 2UZDA 2NO3A 2JIUA 4G9RA 4U3YA 2OWBA 3UMWA 3DB8A 4M68A 4FNZA 5IUHA 3EKNA 5KBQA 3ATTA 4U40A 2JKKA 3ZOSA 2YDJA 1ZYDA 4D2VA 4YP8A 3SAYA 3LFDA 4JBPA 2X2LA 4AX8A 4BDBA 1O6LA 4IVDA 5L6OA 3WZKA 2H96A 4EHEA 4CG8A 4FK3A 5CAQA 2QONA 4JG8A 1H27A 4PMTA 5HESA 4GUBA 3EQCA 4R5SA 5BPYA 3OHTA 1P4OA 1XR1A 4MKCA 4BYIA 1BKXA 2CKQA 3C1XA 3UC4A 4BFMA 1UNGA 1OKYA 2OZOA 2BALA 2E9NA 4C0TA 5DEYA 4CLIA 2XNGA 3UNKA 2WQOA 5GIOE 1W0XC 4M3QA 5HG7A 4D4VA 3NR9A 4YZMA 3DJ5A 5CU6A 3DXQA 3NYXA 3DK3A 2VTSA 2VTJA 3RPYA 3FV8A 5HNGA 5J7HA 3I7BA 4NJ3A 3ORMA 2Y4PA 4IWDA 3V5TA 4O82A 3QRKA 3VQUA 5AUYA 3RI1A 4XUFA 3LFNA 4QNYA 4KIPA 4I6HA 4JIAA 2OJ9A 2XKCA 3F5XA 3QHWA 4OR5A 4U80A 3BLRA 3RPRA 2R3IA 4WSYA 4AU8A 1SVEA 1YVJA 3HRFA 3LCDA 2VWYA 3PJ3A 4EOMA 3H9OA 4BCOA 2WNTA 2R2PA 2W5BA 4EQCA 3EFLA 4ANNA 4LOOA 3TEIA 3VNTA 3U54A 3FZTA 3CTQA 2VO3A 3NNXA 4RQKA 2XP2A 4L67A 3EQRA 4V0GB 4AA5A 3VAPA 4FTMA 4U5JA 4EBWA 1J91A 3I79A 4E6QA 4I5CA 3R2BA 3V3VA 3GFWA 3G0EA 2XYUA 3BIZA 3KF7A 1TQPA 4PPAA 2I7QA 3DZQA 5AIRA 4ITJA 2WD1A 1Y91A 4RLKA 2ETMA 4QTDA 2OI4X 3WBLA 1DAWA 2UVXA 4O86A 2LAVA 5C8NA 1MP8A 1W82A 3LE6A 2R3NA 3D7TB 3MFTA 3OXIA 4EOSA 4LV5A 3MA6A 3MVLA 4UMPA 4HJOA 4HNIA 5JMSA 1R1WA 3NW7A 3PG3A 4D1ZA 5M07A 5B2KA 4QYEA 4YNOA 4I0SA 4GH2A 4LRMA 1QPEA 2OBJA 4AGWA 1WVXA 2PVKA 2O65A 4IZ7A 4WG5A 2V62A 2QCSA 5HOAA 3ZO4A 1PMNA 2OLCA 3QYWA 2QD9A 2GPHA 4G17A 4FGBA 4RFMA 4N4SA 1KE6A 2XNPA 1YWVA 2X9FA 3ODZX 4RWJA 4YC3A 4KUJA 1UU9A 4QTAA 3GCSA 4TYHA 2W9FB 5CT7A 5L8LA 3LQ8A 5EKOA 4TYGA 3EZVA 5EDQA 1OL2A 2WFYA 3A2CA 4YJPA 2GNFA 2W1FA 4NK9A 4C3FA 4QYFA 4RX8A 4KABA 5H8GA 5KUPA 4DITA 2BDFA 4IWPA 4CKJA 1OITA 2ITXA 3K5UA 3RWPA 3CEKA 4RVLA 3S1HA 2QI8A 2RG5A 2HOGA 2RFNA 4FX3A 4ZSJA 3UDBA 3R63A 3VO3A 5CF4A 4XG3A 1CKPA 3VBXA 5AP0A 2H34A 3POZA 3ZEPA 4CMOA 1PYXA 1J1CA 2QKRA 2IZRA 3E5AA 3EWHA 4TPTA 4BGGA 3FLSA 5HKMA 4CTBA 4IANA 3S95A 4FV3A 5FGKA 3BGZA 4ZLYA 3U6IA 4AZFA 3R83A 4EI4A 5CEOA 5HBHA 2YLFA 4UZHA 3QD3A 3CP9A 4RFYA 4YJSA 2ITYA 4YZ9A 5HTBA 3LFCA 4FV0A 5K5XA 5AEPA 2IVTA 2FO0A 1I44A 2BVAA 1WBVA 3MB7A 5EYMA 3R0TA 4XH6A 3DFAA 1CKJA 4BC6A 3V5JA 5LVNA 4IJ9A 3F5UA 2J0MB 3CBLA 3E3PA 4I93A 3R9OA 2RSVA 4YJUA 3F88A 4GUEA 1GZOA 5AWMA 2VTAA 5ETCA 5CU2A 5CAVA 1JSUA 3ZFMA 4QTBA 3MDYA 3QX2A 4WRSA 4PDPA 3NUPA 3E87A 1ZY5A 2R7BA 1RJBA 4IWQA 5F94A 4CTCA 4IB1A 5HHWA 3G6GA 4OT6A 5HCYA 4D2WA 3BYOA 5A14A 5HLWA 4W8DA 1YDSE 4UX9A 3PE2A 3BU6A 2YJSA 4J96A 2VWBA 3R8MA 5C4LA 1M52A 2QOQA 1PXNA 3AT4A 5DHJA 4A07A 4FF8A 3B2TA 2B9HA 4HCTA 4DFUA 4M14A 4F4PA 4ZIMA 1G8SA 2JAVA 5BVWA 4DBNA 4KINA 1PYEA 3R9RA 2JFLA 3BKBA 2W05A 4C38A 4DBXA 4CFNA 4YURA 4XJ0A 3E62A 2GNHA 4TN6A 3VVHA 4K11A 1CKIA 4YLLA 5LMKA 3UG2A 1NA7A 4BKYA 3IGGA 2PK9A 3EB0A 3COMA 3VRYA 4TXCA 4EK4A 3PXFA 3PRFA 5C27A 1ZAOA 5JT2A 1U54A 2FUMA 3PVBA 2QVSE 3BZ3A 3MYGA 2XZSA 4EK3A 4RLLA 1OL7A 4WOVA 3DB6A 4ORKA 2OIDA 4YTHA 5E90A 3GCUA 4OTPA 1YRPA 3MY0A 4DTKA 3ALOA 3OBJA 3UVQA 1WVWA 1PKGA 3F5GA 4XG6A 4LRJA 5DRBA 1YHSA 5GZAA 3MS9A 3FQSA 5AAGA 4R7BA 4R8QA 3W16A 3OBGA 4G16A 4NM3A 3HGKA 4UMQA 4IW0A 3PJ2A 3ORKA 1W8CA 3JR1A 4ZLZA 3C50A 5LXMA 3AGMA 1PMEA 3H3CA 4IB0A 2J6MA 3PYYA 5EI6A 2X8EA 4L9IA 4EQMA 3F82A 3IOKA 5GHVA 3R30A 4DINA 2HAKA 4QMQA 4FUYA 1YOMA 4D5HA 4HCVA 2OF4A 1JVPP 2YACA 2YDIA 3SV0A 3GNIB 5HVJA 3A4PA 1EH4A 5CX9A 2F7EE 3Q5ZA 4AN3A 3K2LA 4BCFA 5I9YA 2R0IA 2ITNA 3V8WA 2PSQA 3FC1X 2FGIA 3KF4A 1Q97A 4AGDA 3SRVA 2GDOA 2X7FA 1Q3DA 4NIFA 4RRVA 3TV7A 2X1NA 3R6XA 5HIBA 4A9YA 3UPXA 3DK6A 3FHIA 4O96A 3IDPA 4KIOA 2J50A 3ZC5A 5IPJA 4UN0C 5CF5A 5FTGA 4CG9A 1H0VA 1PXIA 1Q8TA 3PWDA 4FNXA 4FR4A 5DLSA 5FM3A 3LKMA 1F3MC 3E7OA 2IVUA 3LZBA 4EQUA 2GHGA 3OUKA 4EH5A 3OF0A 2VO7A 3BE9A 5BYYA 2W1DA 5KMKA 2GFCA 5E1SA 3Q4TA 4D2PA 4WBBB 1CDKA 4OW8A 3IECA 4QMZA 4IHPA 1YXVA 4YHJA 4ACDA 5M53A 3RPVA 4O84A 3M1SA 2Y6MA 3HDNA 2C5XA 4II5A 5IA3A 4R5YA 2PULA 2UZBA 2OSCA 2IW8A 3PZEA 3R01A 5M09A 2BCJA 5I3RA 3NUYA 5LOHA 3NYVA 4G2FA 3F2RA 2C6DA 2IPXA 2GSFA 2YISA 2W06A 3E8NA 2XK6A 3GP0A 5M51A 2C5NA 2YAAA 4FTIA 2VTPA 4A4LA 2O8YA 4GIHA 1ZZLA 4FT7A 1RW8A 1PMUA 4J53A 4CT1A 4EOIA 5ICPA 3OY1A 2EB3A 3A8WA 4CCBA 3GEQA 4YTCA 4FSRA 3PPJA 5HG5A 2CKPA 3UYSA 4DGLC 3MH0A 5CVGA 4YTFA 4AUAA 5JK3A 3IOPA 3QQKA 4CZUA 1ZYSA 2C4GA 2YM4A 3RNYA 4NJDA 3IW7A 2YN8A 4ZXTA 5GIPE 2VTMA 3OWJA 3GC0A 4U41A 1ND4A 4NFMA 2YM5A 1UV5A 3FKOA 1R0PA 4IVAA 4HGTA 3ENHA 3AG9A 2E9PA 3VUDA 2QHMA 5KMNA 3K5VA 4XP3A 2PVHA 3QZGA 2I0VA 2UV2A 2WTJA 3IK3A 3RM6A 2ZM1A 1XH5A 1H8FA 2IZUA 4NEUA 5J8IA 4JT3A 3VUTA 1W83A 2FSTX 4X6QC 3UBDA 3KY2A 3VW8A 2YWVA 5K0KA 4H1MA 4DHFA 4AW5A 3DS6A 5KZIA 4MXZA 1Q5KA 3D2IA 5A6NA 5IDNA 4NL0A 5AMNA 2YZLA 3QGWA 2B7AA 3ORTA 4I5HA 5HO8A 4S2ZA 5CEIA 3PPKA 4PDYA 2C1AA 2PZ5A 4ENXA 3UOLA 4EKKA 1J7IA 2UW3A 3U8WA 2PVRA 4TW9A 3UP7A 3MVJA 3A7FA 4TWOA 4E1ZA 1UU3A 4FV8A 1Q8YA 4O38A 4O1OA 2CCHA 5H8BA 4OTHA 3SKCA 4EKLA 3MW1A 5CNNA 4JRNA 4USDA 4D2RA 1V0BA 3Q5IA 5IQHA 1Q62A 3ZFXA 4OAVB 4WD5A 5J5TA 2VNWA 3FI4A 4CD0A 4BGQA 3Q4UA 3UYTA 4G6NA 4FV4A 1WBWA 1IASA 2BDWA 3RMFA 4D2SA 5A4EA 2ITOA 3QC9A 4KS8A 3GC7A 4NW5A 4EYJA 4FYOA 3UVPA 1MQBA 4MX9A 4Y95A 4AN9A 2Z02A 3SA0A 2OU7A 2W1CA 3FLNC 3TWJA 4O91A 3NSZA 2XB7A 4G31A 4QMTA 4BI1A 2XNOA 4PPCA 5BMSA 2R3JA 3ZHPC 1KE8A 3GC9A 3QCSA 4C58A 5FP5A 3QFVA 4BTFA 2WTVA 4TNBA 5HNIX 4ALWA 3K3IA 4MNFA 3MV5A 5EKNA 4YNEA 2WKMA 1VR2A 1WBOA 3DQXA 4CYIA 3I6WA 3T9IA 1WBPA 3A7JA 3C5UA 3WARA 2YERA 3HVCA 2UVZA 3L1SA 3NYOA 3O7LB 4FSNA 3B8RA 3LJ2A 3TN8A 4USEA 3TUDA 2OW3A 2VO0A 2JDOA 4EUTA 4R77A 2CGWA 3F7ZA 3PVGA 1QPJA 3HV5A 3IO7A 5KMJA 2CMWA 4UZDA 2R64A 5LVLA 4YJQA 3S2PA 1NVSA 2BRMA 4XBUA 4PNKA 5CTPA 1YI3A 5LVPA 4ZOGA 4F6UA 3FMEA 1HCKA 5E8TA 3U4UA 5AV4A 4U81A 4NT4A 3CSVA 4RJ8A 3QZIA 5KX8A 2C0IA 1QPDA 4JR3A 3FXZA 5D1JA 2WAJA 1H0WA 2JFMA 2WMQA 4L7SA 4NWMA 4AT3A 2OJFE 5EM7A 5IA1A 3FMHA 1H1QA 3VS2A 1ZYJA 4BDFA 2VTHA 1JKKA 5CVHA 5AUWA 2HZ0A 4M69A 3V6SA 3ITZA 3KXHA 5BYLA 3KRWA 4FKJA 4CV8A 3DV3A 4O7RA 3FMLA 3DDQA 4I94A 4ZJVA 2GQGA 2HELA 4WO5A 3MY1A 3TJDA 3D5UA 5FBOA 2GS7A 1FGIA 4ACCA 1YI6A 3BHTA 3CGOA 3CY3A 3GU8A 4J8MA 1BYGA 2BDJA 4CKRA 3OFMA 2PE1A 4QPSA 4UXQA 4HPTE 2JITA 5TT7A 3ZEWA 2XJ0A 1PKDA 1VYWA 1H1RA 3G33A 3TUCA 4IWOA 3TL8A 3LLTA 5H8EA 4O0UA 2R3PA 4V01A 3NLBA 1CSNA 1YWRA 3E7VA 1B6CB 2QU6A 3AC4A 2SRCA 3LM5A 3R00A 1JKSA 4GT4A 3PVWA 4APCA 1PMVA 3VN9A 2J0JA 4LG4A 5KE0A 3RK7A 5J1VA 3NAXA 4YPSA 4ZK5A 4O7YA 4GG5A 3MESA 4Q2AA 3AT2A 2UZWE 3KCKA 4KD1A 4GT5A 3TT0A 4O2PA 1Q4LA 4FI1A 4AP7A 2FSLX 3OD6X 4I24A 4I6QA 4WKQA 5J9YA 4E7WA 3NRMA 4WRGA 5GJFA 2VTLA 2YWPA 3FLWA 3NIZA 4A9RA 4BZNA 5IEXA 1NW1A 2ERKA 3UQGA 4MH7A 3V8TA 4PP7A 4UMUA 3PE1A 4PPBA 3TXOA 2R3MA 4XRLA 2Z7SA 4O0XA 5E4HA 4I23A 3NMUF 3ZDUA 4EH4A 3QKLA 3BX5A 3MPAA 3R04A 4O1PA 5CT0A 4ZZOA 3BPRA 4G5PA 3TNPC 4DTAA 4J8NA 4F9YA 3P7CA 3QXOA 3LCTA 3V6RA 2PZIA 4L42A 2X7OA 4F9AA 4ZTLA 5FXRA 3V5QA 4NCTC 4XHKB 3F5PA 4FT0A 4X7QA 1OUKA 3D5VA 4MNEB 4YJTA 2ZYBA 4F64A 4A9TA 2IVVA 4FSQA 4FVRA 5H3QA 3FI8A 1QCFA 2W96B 3HP5A 3QKKA 4JJRA 4JX7A 4L01A 1O9UA 5JFVA 4C4GA 5DT0A 2XKFA 2CCIA 2EXCX 3D15A 4R3CA 5KMOA 1DI9A 2LGCA 3KULB 4E5BA 2JEDA 5CYIA 1VZOA 4JR7A 4YGAA 2P3GX 3NW6A 3VUMA 4C57A 3T3UA 4Q9SA 3WF6A 4EHGA 4GKIA 4NM0A 1YXSA 3P7AA 5M08A 4FSWA 5TR6A 4TWPA 2BHHA 3QLFA 4L00A 1DS5A 2BROA 5K4JA 3OTVA 4AOJA 3O96A 4BCGA 3H9FA 3O7LD 3FI2A 2X8DA 4DEIA 1H24A 1H01A 3Q6WA 2H6DA 5EQPA 4CQGA 2JBOA 4C3PA 4NW6A 4AQCA 2WQBA 2OH0E 4RQVA 4ZMFA 2A19B 4K8AA 4QRCA 2PTKA 2O63A 3HZTA 1TKIA 3ORLA 4CT2A 3ZLYA 2P55A 2ZV9A 3GENA 4PDOA 1H08A 5E8VA 1NXKA 1FMOE 3DKGA 5BUIA 4MWIA 4YSMA 3ZUVA 3MIYA 4K9YA 1STCE 5DIAA 4EORA 3IW4A 4DT9A 3LW0A 3PRIA 2Z7RA 1H26A 1GZKA 2BHEA 3KL8A 5K0XA 4R1VA 4TWCA 3ZCLA 2OXXA 5AA8A 4GU9A 4P90A 2F7XE 5EI2A 3U87A 3PG1A 4UYNA 3CPBA 1GY3A 4IACA 4RIWA 2HENA 1OIRA 4JQ7A 4MAOA 4O7SA 2YA9A 2G01A 3H9RA 3LXPA 3QXPA 4GCJA 1WVYA 2B55A 2DQ7X 2WU6A 3QRJA 4AXAA 3O8TA 4UXLA 3GC8A 2C47A 3QTWA 4KSQA 3ZRKA 4YR8A 2ZOQA 4RC4A 5IF1A 5C03A 3D0EA 2UZUE 3QCXA 3A7GA 3MVHA 3WF8A 4EWQA 3M42A 4R3PA 5IQFA 5AUXA 3D7TA 4M66A 4DFYA 5D9HA 4BDKA 4E26A 2UW7A 4F1MA 3HNGA 4O81A 3WF9A 2E9UA 4AZVA 5DPVA 4ASEA 4X2GA 4CCUA 1BLXA 2PPQA 2WXVA 4E5WA 3HRBA 2R3FA 1NVRA 5I0BA 1FGKA 2YIYA 3EYHA 3QTRA 3V5PA 5IQCA 3OWPA 4O0RA 3Q9ZA 3ZO1A 2Y6OA 1MQ4A 2WMTA 2WZJA 4L45A 3ZUTA 2BRBA 4ZJIA 3MPTA 2PVYA 4NTTA 2Z7QA 1JPAA 3G9LX 4F6WA 5FDPA 3SW7A 4CRSA 5L2SA 4IVCA 4ASXA 3UO4A 2ITUA 3GOPA 3ZLWA 3FXXA 3BHUA 3QAME 3RINA 4KBAA 5DH3A 3CCNA 3QL8A 4Y72A 5C01A 4DAWA 3MFRA 3MPMA 3R73A 4QMOA 5AV2A 4CFXA 5AP3A 5TO8A 1Q99A 1TQIA 4GT3A 3P0MA 5AAFA 4O6EA 1OB3A 1ATPE 4ALVA 3D4QA 2QLQA 2UZNA 3COKA 3QD2B 4P7EA 3VS0A 4ANMA 4AW2A 3SVVA 4J98A 5CWZA 2V0DA 5JQ8A 3RHXA 4UALA 3DKFA 3A4OX 3KVWA 2J0IA 4HOKA 5DRDA 3E8EA 2WMXA 3CQWA 3BBWA 3O23A 4M0YA 4MWHA 2YCRA 4HVHA 4F9BA 4AT4A 4HGEA 4M67A 4O0SA 4GSBA 2OKRA 3FLQA 3LFFA 4C34A 2IW6A 3BHYA 4O0WA 3KGAA 4RA4A 3LJ1A 5J5SA 4LI5A 1SVGA 3PUPA 4DA5A 2R0UA 2OK1A 4YZNA 3VW6A 3RAWA 4BI0A 4Y83A 1Y8YA 2F49A 1U5QA 3C4EA 3DA6A 1M7QA 3KMUA 3PIZA 3UIXA 3RCDA 3ZZEA 3WYYA 3NUNA 3C0GA 4MK0A 4Z16A 4F7NA 3MGYA 4GK4A 2JKOA 2JKQA 3FSFA 5CSHA 1JSTA 2ITQA 5IQAA 4BCNA 5CANA 3AD5A 5CXHA 3P5KA 2DS1A 4EOQA 1XQZA 2HWPA 3ZO3A 2EUFB 5D11A 2XIYA 3ZRLA 4DCAA 1YDRE 2BZHB 3FLYA 5JN2A 2C6IA 3DK7A 4BBFA 4GL9A 2YIXA 2XEZA 2X6EA 1OL6A 1REKA 1Q3WA 2ITPA 2QODA 3GOKA 3Q53A 5GZ8A 1JQHA 1OVEA 2R3QA 5T6KA 4HVGA 3R28A 5ANDA 4QMMA 4PQNA 4EOKA 5JGBA 1UU8A 1ZRZA 2G2FA 2VX0A 3HV6A 4CMUA 4CQEA 4F1OA 4DG0E 3O8PA 3L8XA 3QTUA 3FMJA 3PLSA 4G9CA 4PP9A 3MTFA 3AXWA 3ZLSA 3GBZA 1GJOA 2ITTA 3VS4A 3HAMA 1LUFA 2XK9A 5JRQA 2QOOA 3DBFA 4HNFA 3MBLA 5GJGA 4RA5A 3ZBXA 3RWQA 2X39A 5D12A 3FZSA 4FEVA 4Y46A 3WF5A 4KRDA 4FT5A 2OXDA 4JOAA 3TNHA 4BDDA 3O51A 5FTQA 4IJPA 4Z9LA 4PF4A 5AJQA 3ETAA 4GK3A 3FPQA 2O5KA 5FM2A 4HYIA 3W8LA 3B8QA 3BI6A 4DN5A 4K18A 4FODA 4H3BA 4GMYA 5HO7A 3RP9A 1NT2A 3TKIA 3EN6A 4GVJA 4NUSA 1ERKA 4C4FA 2PZRA 3NS9A 3SG8A 2WHBA 2YEXA 2E9VA 3N51A 1Y57A 3LVPA 5FEEA 2IG7A 2J0LA 2PMNX 2CNVA 1G5SA 3H0YA 4W4VA 2RKUA 2WEIA 4L3PA 2R5TA 3KKVA 2X2MA 3HMMA 1H28A 3DLSA 2ONLC 4JDKA 4S30A 4ZP5A 3RALA 5AA9A 5J1WA 5BVNA 3V51A 2B4SB 2YCFA 1YWNA 1UNLA 4FMQA 3VUGA 3BHVA 3RPSA 3BEGA 3F9NA 4IZYA 4BDHA 3DDPA 4BKZA 1R0EA 4P2KA 3UNZA 3OT3A 3DY7A 4AW1A 1R3CA 5HU3A 5CAPA 2ITZA 3ORXA 4W4YA 2CDZA 2B9JA 3DAEA 4XLIA 4EOJA 2VWIA 2CGUA 2CHLA 4EZ5A 2AUHA 4BDCA 4JDIA 2CGVA 4RSSA 4QNAA 4U42A 3W2CA 3LAUA 4XV3A 4OTRA 3VRZA 3PP0A 2JDTA 2WOTA 2BIKB 2GNGA 2PVMA 4FKVA 3W1FA 3A99A 1U59A 4IBMA 4ZMEA 2CPKE 3OTUA 3SLSA 3NGAA 3UZRA 2HW7A 3QRUA 2UUEA 2J5FA 5EW9A 3THBA 3UIMA 2C6LA 5A46A 5A6OA 4HVIA 4S34A 4ZSLA 4LYNA 4F0FA 3TM0A 3ZM4A 2PHKA 4JG7A 5J7BA 2WTDA 4BIEA 4E4MA 2DWBA 3GI3A 4FV7A 3FZRA 4B8LA 4D0XA 3RK5A 4F63A 4QPMA 3W8QA 2X2KA 3LIJA 4YSJA 3MWUA 2UZOA 3FYJX 4BWKA 2C30A 3ORZA 1DM2A 4FYNA 3EYGA 3HP2A 3QRTA 4ALUA 3NVMB 1M14A 3FZPA 3MJ2A 2B0QA 3FYKX 4I6BA 4FE2A 4J52A 2OFUA 5DBXA 5DGZA 4C4IA 4I92A 4RC3A 5B0XA 1FMKA 4FKLA 5BNJA 4O7VA 2Z8CA 4DLJA 5AR3A 4BCIA 3Q9YA 4FTOA 3GCPA 3HECA 1V0OA 4NKSA 3SW4A 3TCPA 4K1BA 3MFSA 4FZFB 1BMKA 2QG5A 2UW9A 3LXLA 3H4JA 4GEOA 4I0TA 2XBAA 4RT7A 5AR7A 3UC3A 3VS7A 4ANLA 3UTOA 4D58A 4DTBA 1Y8GA 3KB7A 1XO2B 4RWKA 1OPKA 3QTXA 4BHNA 5CSPA 3I60A 2CLXA 3LPBA 4NFNA 3R1QA 5EFQA 3A60A 2W0JA 3BWJA 2XF0A 3BBTB 3PTGA 3NNVA 2VTTA 2VZ6A 4FZAB 2I40A 5C8MA 4IFGA 3W2OA 3L8VA 3BLHA 2VV9A 3QRIA 4L46A 5JFWA 1YOJA 3MI9A 4BVUA 4RJ3A 4UEUA 5F95A 4JAIA 2G9XA 2J9MA 5T3QA 3FL4A 5IISA 3FSKA 3Q60A 3VC4A 1FVVA 4AA4A 3SHEA 3D7ZA 2VTNA 3UVRA 3W10A 5DR9A 4BCPA 4ZSGA 3EQDA 1ZOGA 3HV3A 2R3LA 3MA3A 4QTCA 2W99B 4TWNA 1LR4A 4X2FA 3RAIA 3BYUA 1JBPE 1PY5A 2W4KA 2W1IA 4IAAA 4KIKA 3WYXA 4MXCA 2EB2A 5AR5A 5HLNA 2O3PA 3QZFA 2EU9A 3AQVA 4UYAA 2BKZA 2FSOX 3AC1A 2WMSA 4A4OA 1XKKA 4A9SA 4BIDA 3PDTA 3ROCA 4M8TA 4ZY5A 2YZAA 2G2HA 3QGYA 4CFMA 1U5RA 4FTNA 3RVGA 5CU4A 4RZVA 4C4EA 2JDRA 2XMYA 4DGNA 2YITA 4GFGA 1WBTA 2PWLA 3EQHA 4KKEA 3IW5A 1A9UA 4RJ5A 4A06A 4Q9ZA 5IDPA 2KTYA 3WZUA 4ZLOA 2IZTA 4U0IA 4USFA 1ZZ2A 3L9NA 1P5EA 3KMMA 4GRBA 4EHZA 4YJVA 3VJNA 5CEKA 2RFSA 1CTPE 3HMNA 4MBJA 4BHZA 4M97A 4FNYA 1JKLA 4DH8A 1B38A 4YPDA 2WIPA 3UG1A 5JZJA 2WEVA 3L8PA 1W84A 4C33A 4JBVA 4E3CA 3D14A 5BYZA 2C0TA 3PA3A 4K33A 1KOAA 3QCQA 5FG8A 3E64A 4MD8E 2XIKA 4XYFA 4DFNA 2PUPA 2CLQA 2I0EA 2J51A 2JBPA 1K2PA 4BY9E 1ZMUA 5BQ0A 3AC8A 3PSDA 3I4BA 3DLZA 1VEBA 3R21A 3TTJA 2UW5A 4F08A 3NYNA 5ETAA 3FUPA 3UOKA 4RGJA 5E8UA 3F3VA 4AOTA 2YLEA 5F9EA 2YHVA 2PZPA 4UBAA 2QR8A 2OJIA 5AV3A 2BZKB 4OBOA 5M56A 2YJRA 4LGGA 5E91A 2Y0AA 3PA5A 5CVFA 4J1RA 4ZJJA 2PZYA 4FT3A 2Y7JA 3EZRA 3EFJA 1XH8A 3KN6A 4EH8A 3R8VA 4QYHA 5C26A 5BVFA 3CLYA 5A9UA 2QO7A 2VX1A 4FTKA 4JVGA 2B9FA 4RX5A 4FSYA 5M4IA 3DGKA 4GJ2A 4QP8A 4FSMA 4PL3A 3UIBA 4X2KA 3RBWA 2WTIA 5HEZA 4DH5A 5FUTA 4X3FA 2W17A 5AAEA 4HGLA 4CVAA 1A06A 1IA8A 4HCUA 3GU6A 4DLIA 1BI8A 4E8AA 2QO9A 4CFVA 3QTQA 3EL7A 5KMMA 4LL5A 5A54A 2XEYA 3O17A 5M44A 2W1ZA 3IQ7A 3VULA 5LWNA 2BPMA 2XIZA 4AFJA 3C5IA 1YDTE 2C3KA 1LPUA 4JNWA 1L8TA 2C6MA 2JLDA 3WE4A 3JY9A 3AMBA 4YUQA 2C5OA 3UMXA 4AZEA 3BU3A 4IAYA 4PL4A 3V04A 4PMSA 4QMUA 2QKWB 4MXYA 4DH3A 2HIWA 3TZ8A 2IZSA 2UVYA 3KK9A 4KS7A 3WZJA 4OBPA 3IS5A 5L6WL 4FIEA 5K3YA 4F1TA 4I20A 3T3VA 3TI1A 3VBTA 4JBQA 5DNRA 3TKUA 3ZSGA 4QQ5A 4L68A 4ZY4A 3BQRA 3CTJA 3N9XA 4YTIA 3KCFA 2I0YA 1ZY4A 4BDEA 4FSUA 3OW3A 3R7OA 4H36A 4RJ7A 1CMKE 2YM3A 3AMYA 3OCTA 3W18A 3MH1A 3VBVA 4MF0A 4RVTA 2X6DA 4L43A 3OC1A 4AE6A 4L8MA 4X21A 1UKHA 3U9NA 2WOUA 4O7LA 2AYPA 3OWLA 3ROYA 3DNEA 3FY0A 4XMOA 2V5QA 3DTCA 4IQ6A 4QD6A 1F0QA 4DEDA 2IWIA 3F69A 4ERWA 4DEEA 2ETRA 1UKIA 3D83A 4IE9A 2YIRA 4ITIA 3SXRA 3NCZA 4BF2A 4BDGA 5IH5A 3QHRA 3CKXA 4I21A 5DOSA 3TG1A 4YZCA 4WNMA 1UWJA 3OCGA 3DKOA 4EEVA 4AF3A 5IQIA 4ZTSA 2OJJA 2P2HA 4XP0A 3DJ7A 2XRUA 4RMZA 1XH9A 3E63A 5LMAA 3W33A 2F9GA 3AC2A 5CNOA 3PJ8A 3REPA 3KRRA 3OVVA 4Q5HA 1A48A 3GU5A 3VQHA 4O2ZA 1ZARA 4C61A 4MCVA 4R3RA 2JDSA 5CZIA 1SM2A 2X9EA 4D5KA 3S0OA 3A62A 3BCEA 3JS2A 4Q5EA 3LQ3A 3OCBA 3WI6A 3P1AA 4AT5A 2PVJA 2ZB1A 4ARKA 5ANOA 3QWKA 3IPHA 4PMMA 3QQLA 5JEBA 2PE2A 3HRCA 2W1EA 2B54A 3C4ZA 3HA6A 5C1QB 4WA9A 4FVQA 5EW3A 3UZPA 3MH2A 3JUHA 5KKRC 1PXPA 3FPMA 2C69A 3QD0A 3I7CA 5EYCA 5A4CA 2W4OA 3Q3BA 4RIYB 3U6JA 3BU5A 3FMMA 2HZIA 4GK2A 2H9VA 1BL7A 5AR4A 2F2CB 2OG8A 3HMPA 2W1HA 2O2UA 3C13A 4XOYA 4DFBA 3EQGA 3FXWA 3HKOA 1RDQE 4HGSA 4Z7HA 1TVOA 4BWPA 3DXPA 4YZDA 4Y5HA 4E4LA 2C6KA 3OROA 4KKHA 5LWMA 3DJ6A 4FEQA 4WG3A 4N0SA 2V55A 3ELJA 4ANOA 2B1PA 4TYEA 1GIHA 3NUAA 2ZVAA 5DT3A 2VWWA 3EN7A 4XV9A 3BELA 5ACKA 3PP1A 5EI8A 3VUHA 2WMRA 4LV8A 5CS6A 4U43A 4F9CA 4G1WA 4IDTA 4ZS0A 5KMIA 3RPOA 4PNIA 4I6FA 5E8ZA 4BTKA 5FBNC 2W5AA 1QPCA 2CSNA 4YHFA 5CAUA 5AP2A 4DG2E 2VWXA 4D1XA 4DCEA 1BUHA 2QC6A 4PUZA 3F3TA 2XKDA 3NNUA 1H1WA 4FZDB 4IVBA 4S32A 2XH5A 4RVKA 4WG4A 5FRIA 4EOPA 5AP6A 1OZ1A 4JDJA 3ID6C 2P33A 3GU7A 5AP5A 4O27B 4JL9A 3OZ6A 3IGOA 4L3LA 4UB7A 1FPUA 5AR2A 3GVUA 4YO6A 2GHLA 2ZV2A 4A4XA 2WQMA 3HEGA 5CEPA 4H58A 4EONA 3R9NA 1ZXEA 2RGPA 4BDJA 4Z55A 1P14A 3Q6UA 3OS3A 4XV2A 3OXZA 4E6DA 4N70A 5AUZA 4MXXA 3KC3A 3W2RA 4OTIA 4UWCA 4LUEA 1YXUA 2BRNA 2WTKC 2GNJA 3TDWA 4PDSA 2Y9QA 3P9JA 5K4IA 4TL0A 4DT8A 1GOLA 2C6EA 2B9IA 1KE5A 3LMHA 5I5ZA 4JLCA 4KKGA 3G2FA 1OL1A 2WMBA 4WUAA 5EM5A 4XG8A 4DGMA 2YIWA 2PUIA 4FKWA 4WNOA 3B2WA 3PIYA 4QPAA 2JC6A 4BB4A 1OL5A 3Q9XA 2NPQA 2CKOA 1IA9A 3R8ZA 5DG5A 4FL3A 4QMPA 3FHRA 4JQEA 5ANIA 3VS5A 3ACKA 3EN9A 3FZ1A 3L9PA 4TZRA 4WT6A 5FXQA 2XNNA 1J7UA 4FEWA 4FG9A 3R71A 5L2TA 4NKAA 2RG6A 2IW9A 2VWVA 3H0ZA 4XEYA 5AADA 4X3JA 2BAJA 2FA2A 4CKIA 5CQWA 3UP2A 1RQQA 5F1ZA 3EFWA 2XRWA 1KE9A 1VYZA 1SMHA 4GS6A 4RIOA 3SXSA 3VUIA 2PY3A 3JPVA 1DI8A 2ESMA 4XX9A 3SOAA 4AA0A 4YLJA 3KXZA 4EZ7A 5A3XA 5I9ZA 3DOGA 3Q04A 5DN3A 4IX4A 3ENMA 4FTQA 4CV9A 2HZNA 3KQ7A 3R7YA 2AC5A 4FKTA 4NCTA 2X0GA 4ZTQA 5H9BA 1PF8A 4B4LA 4E4XA 5IA4A 2NRUA 5IUIA 4R78A 2A27A 4PRJA 5AX9A 3QC4A 3UOJA 2WMVA 4BRXA 4G3EA 2PMLX 2QHNA 5HD7A 2HW6A 2P0CA 2C1BA 4EZ3A 4FTUA 3CJGA 3KMWA 1URCA 3QA0A 4QYGA 3UNJA 5GNKA 4FKSA 3ORNA 3ZDIA 3G9NA 4FKUA 4UV0A 4O7WA 2IVSA 4MBLA 2YM8A 5CXZA 4FTRA 4DFLA 4JXFA 3VBWA 3D9VA 3NEWA 5HD4A 1YHWA 4ZSAA 3S00A 4G3DA 4B6LA 3NVKI 5CEMA 3O50A 3F3ZA 3L9LA 4FT9A 2C3LA 4LUDA 3UJGA 3TNWA 5I9UA 3ULZA 2VGOA 5M57A 4HVDA 2XYNA 3Q32A 5HCXA 3LLAA 2VN9A 3ACJA 1J1BA 1XJDA 1Z57A 3EQFA 3GT8A 3LXNA 4XRJA 1LEZA 1Y6BA 2UZTA 2JIIA 4ZTMA 2BFYA 4V0GA 3GGFA 2Y4IC 3MB6A 4FOBA 4MTAA 5T68A 5IEVA 1O6KA 5L6PA 3DPKA 4IDVA 3CY2A 4P5ZA 4QP7A 5B7VA 4I4FA 5D10A 1OIYA 3CQEA 2G1TA 5IA2A 3ZBFA 4QP4A 4FTTA 4ANQA 4F9WA 5ETFA 1PHKA 2RF9A 4FTLA 4NU1A 4RJ4A 5IQBA 4IM0A 5KHXA 3EOCA 3QUPA 4OTGA 4IIRA 2C6OA 2EWAA 2ZDUA 3GQLA 3HDMA 2GU8A 2ZMDA 3LFEA 5BUJA 3WF7A 4I1ZA 3SD0A 1KSWA 5E8SA 4XBRA 2R3OA 4W9XA 2ETKA 4IAKA 5K9IA 2I6LA 4WUNA 5KKRB 2BZIB 3D94A 3I5ZA 1IAJA 2XNEA 1S9JA 2XIXA 4WSQA 4OTFA 1T45A 4Y73A 1HOWA 4DEAA 3KVXA 3ET7A 2BR1A 3R7IA 3PXRA 4F70A 3LHJA 4BN1A 4YHTA 1GIIA 3F61A 1J7LA 3NIEA 5C4KA 3LQ5A 2HXLA 3GFEA 4IEBA 4RWLA 4IZ5A 4CFWA 4FGRA 5HTIA 4KSPA 4AE9A 3KFAA 1Q8ZA 1JOWB 3LFBA 4BBMA 3CS9A 4DF3A 4FEXA 3HMOA 4TRLA 2G15A 5E8XA 3I81A 4JBOA 5CQUA 1YKRA 2YAKA 3PA4A 4G34A 4C2VA 4IAFA 2BUJA 4OTQA 3KXGA 5DT4A 2F2UA 4QOXA 3Q2JA 4LGHA 3COHA 3ZTXA 4BBEA 3F3WA 4QTEA 2DYLA 4Z7GA 1QMZA 4RVMA 3BYMA 4K0YA 2VUWA 5IA5A 4EYMA 1FVTA 4PTCA 5FP6A 4EH7A 4GU6A 4RIXB 1ZOHA 3OP5A 4WNPA 3GCVA 3ANRA 5IU2A 3QZHA 4FL1A 3DBEA 3EN5A 3RJCA 4FIFA 2OIQA 4CZYB 3EL8A 4QP1A 4W8EA 3H10A 3IG7A 4JRVA 3IDCA 4GYIA 3G90X 4P5QA 3ZC6A 3OMVA 4OAUC 3C0HA 3PJ1A 4EBVA 3QU0A 3MIAA 4QQTA 1WMKA 3CXWA 2PVLA 2XCHA 3W32A 5IMXA 4J7BA 3BEAA 2HXQA 2HWOA 3Q4ZA 3IKAA 2GFSA 3DXNA 5FLFA 4YBKA 5EYDA 3IONA 4FUXA 3HA8A 3IW6A 3ZYAA 4O7TA 4MQ1A 2GNLA 2WMAA 2WTKB 4GG7A 3BQCA 3A7IA 3T9TA 5J9ZA 1R39A 5L2IA 5HBJA 2PUNA 3POOA 4M0ZA 3U55A 3FQHA 4MQ2A 4J97A 2YFXA 5KMLA 4X0MA 4APPA 2GHMA 1Z9XA 4RZWA 4AGUA 4AZTA 2OJGA 2PVFA 3PVUA 4NM7A 4MEDA 4W9WA 1PXJA 3DU8A 5HNBA 2R3HA 5AP4A 4QQJA 4BCJA 3CKWA 4U9AA 5HI2A 3F7WA 4FIIA 4O6LA 3VJOA 3LFSA 4C2WA 4O7NA 2W1GA 2OF2A 3DNDA 4YC8A 1XBAA 5TKDA 2QOCA 4NYEA 3SG9A 1Q41A 4F6SA 1XBBA 4BR3A 4ZS4A 4FICA 5AP7A 2GS6A 2G2IA 4CFFA 4EH9A 2ZB0A 5M06A 1JNKA 2XBJA 3II5A 5D41A 4HPUE 1KV1A 2JKMA 4LMUA 2E2BA 2V22A 3E8CA 3TV4A 2VWUA 4QO9A 1UA2A 4IXPA 2JDVA 5HG9A 1Z5MA 5L2WA 1H1SA 3AC3A 2QQ7A 3COIA 4MBIA 1MUOA 4QMSA 2UW8A 1YQJA 2IJMA 4JDHA 3ZUUA 4CLJA 3E88A 5CI7A 5EHOA 5F20A 5HVYA 2ZAZA 5TE0A 1ZYLA 4BIBA 4Y5QA 4F65A 5K5NA 3F2NA 2XUUA 4LMNA 5EHYA 5FDXA 1IAHA 1IR3A 4U3ZA 5CF8A 4F0GA 2R7IA 4AOIA 4FKQA 1PW2A 4M13A 1OKZA 3AT3A 4XOZA 3ZXTA 4TKSA 4FV5A 4FNWA 4PTEA 3HMIA 2HK5A 2UW0A 1H1PA 4AG8A 3PY1A 4RG0A 4F7JA 4G3FA 1L3RE 5FWKK 3R7UA 3VWAA 2A4LA 3AD4A 4D9TA 5EW8A 5BVEA 4BCKA 1XBCA 5LMBA 5HX6A 3A8XA 4DGGA 3D2KA 3DKCA 5ANJA 2ZM4A 3FBVA 2CN8A 2DUVA 3DCVA 4ZSEA 1M2PA 2C5VA 4YJOA 4MYGA 4LRKA 4OLIA 4LOPA 3M2WA 1OIUA 5IEYA 5KNJA 2Y4IB 5LQFA 3QTSA 5IZFA 4QMLA 1UWHA 1YW2A 3U6HA 4RJ6A 5EM8A 5AUUA 4C36A 4RIWB 4DEGA 3QQHA 5AX3A 4NM5A 4BCQA 4EWHA 1KWPA 3UE4A 4L3JA 4RPVA 2GTNA 3ZSIA 4AS0A 5JGDA 4I41A 2GQSA 2ONLA 2VTOA 3FKLA 4IAIA 4TYIA 3KXXA 4NH1A 5L3AA 1JSVA 4G3CA 2C3IB 4GV1A 1VJYA 2UW6A 4JQ8A 5CAOA 3QQGA 4IADA 2R3KA 3RTPA 5DFPA 2XM9A 2C3JA 2ZV7A 3P08A 4W4XA 5JZNA 3CIKA 4UWYA 4XV1A 2OO8X 3DTWA 2XK8A 1SNXA 4ZAUA 4BICA 1PRYA 3TJCA 4G3GA 2OIBA 2CGXA 3FWQA 1TQMA 1APME 3FMKA 2WQEA 4FSZA 5ANGA 4FC0A 4HZRA 2VGPA 4KWPA 1KOBA 3TV6A 4CYJA 4WNKA 3AC5A 1OM1A 1BI7A 3KRXA 3O2MA 4LL0A 5AV0A 2B52A 5EDPA 3RM7A 5B2MA 3IDBA 2I1MA 4R7IA 5EYKA 4X2NA 3HYHA 3KN5A 3WOWA 5CSVA 5KHWA 3SQQA 3W2PA 4U97A 2HCKA 3W2SA 3ZH8A 3WIGA 5DR2A 2PYWA 2ITVA 4EC9A 5G6VA 4I3ZA 4FTJA 5IH6A 1LP4A 2PUUA 4D4SA 3VUKA 4IMYA 4L52A 3HUBA 2OZAB 3R1YA 3MSSA 2WIHA 2R3GA 3Q9WA 1E1XA 4OTDA 4PY1A 5J9LA 5DVRA 4ONAA 2HZ4A 4D4YA 2A0CX 3TIZA 4C4HA 4DEHA 5EQYA 1GZ8A 3DT1A 1CM8A 2WQNA 3FMDA 1OKVA 4BYJA 3RK9A 2OFVA 3DZOA 4YJNA 4E93A 1YI4A 3UO5A 2JGZA 3HV7A 4RX7A 5M4UA 1G8AA 4XCUA 2HYYA 3QD4A 2UZEA 1Q8UA 3RZFA 1MRVA 3LFQA 1K3AA 2WTWA 3ZRMA 2HY0A 2BKKA 3LJ0A 4D2TA 3GU4A 4KAOA 3N4UA 3UZTA 4F7LA 5HLPA 2XA4A 1X8BA 2VU3A 3I5NA 4L6QA 5E8WA 3TDVA 1QL6A 4Z3VA 2OXYA 4O21A 3PLAE 2NP8A 4EH3A 4YLKA 4ZTRA 5LMKC 4FEUA 2X4ZA 3QKMA 4UMRA 5HIDA 3VIDA 4E6AA 1PXLA 2EXMA 1H07A 3BRBA 4B9DA 3NCGA 5TOZA 4FKIA 1OI9A 3CR0A 1Q61A 5DE2A 3UIUA 5ITAA 3U9CA 4EJNA 2WB8A 3GB2A 3L9MA 4FZ6A 5JFSA 5D7VA 4E4NA 1ZWSA 4O0YA 4AACA 4MD7E 3ZS5A 2QLUA 5DR6A 5FEDA 5LVOA 2QOFA 3NZ0A 4ACMA 3ZLXA 4NZWB 5KZ0A 3SDJA 2W9ZB 3JXWA 5FXSA 4I5MA 4HVSA 5I9WA 4BL1A 4FK6A 1BX6A 1PXMA 5CSXA 3ZMMA 4ASZA 1AGWA 2PU8A 3MJ1A 1I09A 1ZLTA 3QX4A 5DMZA 3PXZA 4FG7A 3KXMA 4DH1A 2CN5A 3CC6A 2VO6A 4RIYA 5J95A 3V5LA 4M7IA 4D4RA 2VD5A 5CLPA 4DGOA 3TKHA 5FD2A 1ZMVA 3U51A 2RFEA 5HE2A 4C35A 4RWIA 1FVRA 3EJ1A 2BZJA 4QMXA 4ZEGA 5DYJA 3LM0A 4TYJA 5HORA 4IC7A 3PWYA 2WO6A 3QCYA 5L4QA 4C8BA 4KBCA 1IEPA 4DC2A 4EH6A 4BCMA 5IA0A 2GS2A 1H4LA 4CGAA 4IX6A
chains in the Genus database with same CATH superfamily
1B39A 2BRHA 3BHHA 3ERKA 3FQEA 4FG8A 4ZTHA 5HG8A 5HGIA 4OBQA 3WIKA 1MRUA 4AZWA 4YC6A 2XJ2A 4AXEA 3F2AA 4YU2A 2C68A 5BVOA 4FV6A 3P23A 5EOBA 1WBSA 1J3HA 2Z2WA 2OH4A 3ODYX 3R1SA 3TNIA 2EXEA 2QOLA 4R7HA 4MHAA 3PXYA 4BGHA 4GKHA 5JSMA 4H05A 4DE4A 3JVRA 4KA3A 3NPCA 5KBRA 5CSWA 5L8JA 4PTGA 4YO4A 3FC2A 3OWKA 4FSTA 1WCCA 5ETIA 2ACXA 1JLUE 4RBLA 3A7HA 2XCKA 4IZAA 1PXOA 3R2YA 5HE3A 2BRGA 3FMNA 1FBNA 3ORPA 3TZMA 2F7ZE 1PJKA 2UZVA 2Z7LA 3ZSHA 1P4FA 5IH4A 2FVDA 4QMVA 3Q4CA 3ZU7A 5DI1A 4AWIA 4EK5A 4X3FC 1S9IA 3TZ9A 4FIHA 4TTHB 3QLGA 1OECA 3BV3A 3RKBA 4R6VA 1AQ1A 3CD8A 2VTIA 4L44A 4QP9A 4GW8A 4TYHB 3MFUA 3OG7A 1RE8A 4MF1A 3PY3A 4F09A 3UQFA 3ZO2A 4O83A 4QP6A 3PXKA 2PL0A 3IW8A 3TNQB 3C0IA 3NUXA 4OUCA 4ACHA 4TY1A 4EL9A 4BTJA 2FH9A 2J4ZA 3NUUA 3P4KA 4MD9E 4ZTNA 5IQEA 1M7NA 5CI6A 2H8HA 2REIA 4FOCA 3C51A 1G8JA 2XVDA 3R9HA 5HTCA 4KRCA 4WHZA 3VF9A 3VS6A 4FBXA 4F0IA 5B2LA 4DFXE 3SC1A 4D9UA 3DQWA 2ITWA 3T8OA 2Q83A 4F78A 5LVMA 4MNEA 4M12A 4FKRA 3G15A 3FAAA 2YM7A 1FQ1B 1ZMWA 1NVQA 3VBYA 4B7TA 3FEGA 2J5EA 4M15A 4XNEA 1HCLA 5HIEA 4A7CA 1M2RA 4E6CA 3KRLA 1GZNA 5FQDC 1BL6A 2HY81 2RIOA 3KULA 5EK7A 3O0GA 3EKKA 3R22A 3EHAA 3KU2A 5A4TA 5CEQA 4HYUA 4CFUA 4XP2A 5JFXA 3HUCA 1OBDA 4Y85A 4P4CA 4BWXA 4ENYA 5JQ5A 3R02A 3KREA 2YIQA 3P86A 2XNMA 2X7GA 2VTQA 4YBJA 1GIJA 2VWZA 3DAKA 5AM7A 1E9HA 1W7HA 4IB3A 4DYMA 5KCVA 3BV2A 3G51A 4EUUA 3BLQA 3EH9A 4CRLA 2ZM3A 5GZ9A 4ASDA 4PMPA 4K6ZA 3DFCB 4J99A 2OGVA 3CPCA 1OKWA 2BTRA 4FZ7A 3OCSA 4EHVA 2R9SA 3HLLA 1K9AA 2QOIA 5E8YA 3P79A 3FZOA 3SX9A 3ZONA 4RC2A 2XJ1A 2BTSA 1ZYCA 3VHEA 1PXKA 3CD3A 3F3UA 4FA2A 3E8DA 5HCZA 2Q0BA 3M11A 2PMOX 1W98A 5CASA 5E7RA 3BWFA 3KEXA 3UGCA 4LGDA 4I0RA 4JG6A 5CALA 5C9CA 5HICA 3R7GA 3OOGA 4AFEA 3TIYA 2CJMA 2XNBA 4U44A 1OGUA 2F57A 2JD5A 4HYHA 4IC8A 4O0TA 1ZOEA 3U4WA 4QP3A 4CMTA 5AFVA 4JIKA 4FL2A 4U45A 4QP2A 4AAAA 3QQUA 1JKTA 4G6OA 4C7TA 5ACBC 3GXLA 4HYSA 5EHLA 2BIYA 3OY3A 3AMAA 3MTLA 3PY0A 4N6ZA 2BAQA 1U54B 4DEBA 4X6RA 4A9UA 2WTCA 3P7BA 2O64A 4JX3A 4KIKB 4XG4A 5TF9A 3SXFA 5L2QA 1XWSA 5ANEA 4OT5A 4LM5A 3VS1A 3Q96A 3OW4A 4D0WA 4DFZE 5HX8A 5IKWA 2YM6A 2RFDA 4XS2A 5D7AA 4C62A 5BUEA 1OBGA 4C59A 4QMNA 1SVHA 1V0PA 1M2QA 3F6XA 2QO2A 2QNJA 4H39A 4EC8A 3G5DA 2J2IB 4N57A 3PZHA 2BILB 3FJQE 2CNUA 5EQEA 3MVMA 4CEGA 2BAKA 4C37A 4UWBA 4F7SA 3R7EA 1XH7A 3LMGA 3W0NA 5DEWA 4NTSA 5I9XA 3BE2A 3LCSA 4AGCA 2CKEA 2QURA 3K54A 3C4XA 2GMXA 3QA8A 4DG3E 3O8UA 2VAGA 4BDIA 3EQIA 5ANKA 3H30A 3EQBA 5A4QA 4ZZNA 1KE7A 4MXAA 1U46A 5IQGA 2QR7A 3PJCA 4KBKA 3WZDA 3HV4A 3O71A 3SRVB 2O0UA 5IQDA 3NNWA 1MRYA 1SZMA 4NIFB 3MH3A 5AUTA 2CNQA 4IFCA 4QQCA 1UU7A 4BI2A 4ACGA 3HAVA 3R9DA 3TTIA 4O7ZA 5J79A 4U8ZA 2J7TA 4FVPA 2J90A 3JYAA 3GQIA 2C0OA 3RHKA 3LMIA 2YCSA 2NRYA 2YCQA 3C4WA 1V1KA 1OUYA 3MN3A 2VTRA 2GNIA 3VHKA 3V01A 3S4QA 3V8SA 1P2AA 3JY0A 2YDKA 3FKNA 3OXTA 4X2JA 4EK8A 5LJJA 3UQCA 2GCDA 4WBOA 2R3RA 2P2IA 4HZSA 4CZTA 3FY2A 4GIIA 4O0VA 3Q2MA 4RIXA 2XALA 3QTIA 3V5WA 5LARA 2QOBA 3R8PA 4ZY6A 1OPLA 3SOCA 3PPZA 5HQ0A 3ZXZA 1E1VA 1OIQA 5AP1A 4BKJA 1H25A 5EOLA 4Y8DA 2PE0A 3W55A 2XK3A 4FV2A 2WU7A 2XK4A 1GAGA 3N4TA 3RGFA 4D1SA 4LQMA 3UO6A 3QQFA 5H2UA 4KIQA 1YXTA 2A1AB 3UODA 5GINE 4IB5A 4X3FB 4FKPA 4UMTA 3CTHA 3FE3A 2F4JA 2WMWA 4IH8A 5E9EA 4ERKA 4C4JA 5CU0A 2WPAA 2ZJWA 5IG1A 5M4FA 4PX6A 4V04A 4GVAA 3QTZA 3WE8A 3EFKA 3QWJA 5M4CA 2QOKA 2RL5A 2YABA 3D5XA 3NUSA 1Q8WA 4LOQA 4YJRA 1OMWA 4EOLA 4G5JA 3HX4A 4JS8A 2BFXA 4QMYA 4GYGA 3R8LA 3C4CA 1KUTA 4ITHA 4FKGA 3DBQA 3FL5A 4H3QA 4K77A 3PSBA 4N6YA 5JRSA 2Q0NA 4FV9A 4XG9A 1UNHA 2PMIA 1YOLA 5DWRA 5M55A 4B0GA 2NNWB 4FV1A 5LCJA 4JAJA 2VNYA 3D5WA 2FSMX 5EM6A 5HE0A 4OGRA 2UZLA 4O22A 3L8SA 4GFOA 3SGCA 3E92A 4FTAA 5AIKA 2P4IA 4E73A 4I22A 3KRJA 2XKEA 3OEZA 3P78A 4K2RA 4OTWA 3R7VA 5FEQA 5HBEA 1WZYA 3BGPA 2C6TA 2W4JA 3PXQA 4GJ3A 1XHAA 3RNIA 4BZOA 3UDTA 2C5YA 4XLVA 2X4FA 4TNDA 3CGFA 2PVNA 5KO1A 3AGLA 4KNBA 3TZ7A 4YMJA 3I0OA 4J71A 4PV0A 3VF8A 1GNGA 1AD5A 1YHVA 1WAKA 4C02A 3E93A 4U79A 4AZSA 4FKOA 5CZHA 3UOHA 5F4NA 4DHJA 4FIGA 3DBCA 5BVKA 3PSCA 4MVFA 3DAJA 3K3JA 3NAYA 4LFIA 5IUGA 2Y8OA 1O6YA 2X81A 4EK6A 4DH7A 3LCKA 2QU5A 5HE1A 4AW0A 3CJFA 4KB8A 4TT7A 4ZZMA 3ZZWA 4IX3A 3ULIA 4F99A 5DA3A 2R4BA 4L7FA 1T46A 4PWNA 4E20A 2ERZE 4ID7A 5EDRA 1IRKA 2GTMA 5CY3A 3CE3A 3LFAA 5HU9A 3N4VA 2W5HA 1JWHA 3QALE 4I5PA 5BMMA 4BDAA 3GUBA 3LXKA 1WFCA 2ZV8A 4IM3A 4EH2A 5BX0A 3QYZA 4M84A 3WZEA 3EMGA 5HZNA 3JVSA 3A61A 2IN6A 3KA0A 3QQJA 2OICA 3OUNB 2IO6A 2VRXA 2XS0A 3HL7A 4PL5A 2W7XA 4CSVA 2UW4A 1F5QA 2XIRA 3FI3A 3NWWA 1REJA 2B53A 2VX3A 4AN2A 4B99A 2X0OA 4H1JA 4BTMA 3CQUA 1M17A 4W4WA 5E1EA 3C7QA 3BYVA 3MY5A 3BYSA 2E9OA 5CU3A 3TUBA 4MXOA 3ATSA 3EIDA 1XH6A 3OT8A 3OEFX 2J0KA 1FINA 2XK7A 3NDMA 3QUEA 3RAHA 5JGAA 4GFMA 3VBQA 4FIJA 2X8IA 5IMEA 4S33A 2I0HA 4S31A 5FTOA 4HW7A 1URWA 4ANSA 2Z60A 1LEWA 3PIXA 4CXAA 3AOXA 1Y6AA 2EVAA 3F66A 3RZBA 5CF6A 3UPZA 4R1YA 3TACA 3FDNA 5EH0A 2KULA 2WMUA 5HVKA 5JH6A 2ZMCA 3E3BX 3S3IA 4WIHA 5I9VA 3I1AA 4M69B 3I6UA 2V7AA 4RX9A 3LCOA 3VS3A 4EOOA 4B8MA 2GQRA 4FTCA 4D55A 4QYYA 5L8KA 3Q52A 3ORIA 5C8KA 4EJ7A 3QBNA 5CENA 3W2QA 1OPJA 2ZDTA 2A2AA 3OOMA 4U7ZA 3WILA 3GCQA 2WELA 1UVRA 1IG1A 1NY3A 5G1XA 5JKGA 1WBNA 2QOHA 1R78A 3EQPA 3ALNA 4YZBA 4DHIB 1XH4A 3DBDA 4QT1A 5AM6A 4BZDA 1SYKA 1YXXA 4J95A 3C9WA 3QF9A 5AR8A 5I3OA 2AC3A 5BVDA 3PFQA 2BMCA 2WGJA 2QG7A 1DAYA 1G3NA 3NW5A 1KV2A 2FYSA 3BGQA 3EN4A 3ZM9A 5HO6A 1SNUA 3AD6A 3RAKA 2OZAA 1Q24A 4ANBA 4IAZA 1U4DA 3ANQA 3I0QA 4V05A 5AUVA 3KXNA 1H00A 4IM2A 4H3PA 3ZFYA 4RFZA 1VLRA 2FB8A 3QUDA 4G6LA 4QMWA 5J87A 3FLZA 4BCHA 5E92A 2V7OA 4IX5A 4XG2A 3C4FA 5GJDA 4E5AX 4I4EA 1JAMA 5EG3A 1FOTA 2JAMA 3R1NA 4JI9A 5AV1A 3LOKA 3R8UA 3RCJA 2XM8A 4D28A 5A4LA 5I4NA 4LDTA 4L53A 5LCKA 4XG7A 4C3RA 4NSTA 4U6RA 2JIVA 3G6HA 4UY9A 3G0FA 3NX8A 4CNHA 3KK8A 2UZDA 2NO3A 2JIUA 4G9RA 4U3YA 2OWBA 3UMWA 3DB8A 4M68A 4FNZA 5IUHA 3EKNA 5KBQA 3ATTA 4U40A 2JKKA 3ZOSA 2YDJA 1ZYDA 4D2VA 4YP8A 3SAYA 3LFDA 4JBPA 2X2LA 4AX8A 4BDBA 1O6LA 4IVDA 5L6OA 3WZKA 2H96A 4EHEA 4CG8A 4FK3A 5CAQA 2QONA 4JG8A 1H27A 4PMTA 5HESA 4GUBA 3EQCA 4R5SA 5BPYA 3OHTA 1P4OA 1XR1A 4MKCA 4BYIA 1BKXA 2CKQA 3C1XA 3UC4A 4BFMA 1UNGA 1OKYA 2OZOA 2BALA 2E9NA 4C0TA 5DEYA 4CLIA 2XNGA 3UNKA 2WQOA 5GIOE 1W0XC 4M3QA 5HG7A 4D4VA 3NR9A 4YZMA 3DJ5A 5CU6A 3DXQA 3NYXA 3DK3A 2VTSA 2VTJA 3RPYA 3FV8A 5HNGA 5J7HA 3I7BA 4NJ3A 3ORMA 2Y4PA 4IWDA 3V5TA 4O82A 3QRKA 3VQUA 5AUYA 3RI1A 4XUFA 3LFNA 4QNYA 4KIPA 4I6HA 4JIAA 2OJ9A 2XKCA 3F5XA 3QHWA 4OR5A 4U80A 3BLRA 3RPRA 2R3IA 4WSYA 4AU8A 1SVEA 1YVJA 3HRFA 3LCDA 2VWYA 3PJ3A 4EOMA 3H9OA 4BCOA 2WNTA 2R2PA 2W5BA 1TZDA 4EQCA 3EFLA 4ANNA 4LOOA 3TEIA 3VNTA 3U54A 3FZTA 2VO3A 3CTQA 3NNXA 4RQKA 2XP2A 4L67A 3EQRA 4V0GB 4AA5A 3VAPA 4FTMA 4U5JA 4EBWA 1J91A 3I79A 4E6QA 4I5CA 3R2BA 3V3VA 3GFWA 3G0EA 2XYUA 3BIZA 3KF7A 1TQPA 4PPAA 2I7QA 3DZQA 5AIRA 4ITJA 2WD1A 1Y91A 4RLKA 2ETMA 4QTDA 2OI4X 3WBLA 1DAWA 2UVXA 4O86A 2LAVA 5C8NA 1MP8A 1W82A 3LE6A 2R3NA 3D7TB 3MFTA 3OXIA 4EOSA 4LV5A 3MA6A 3MVLA 4UMPA 4HJOA 4HNIA 5JMSA 1R1WA 3NW7A 3PG3A 4D1ZA 5M07A 5B2KA 4QYEA 4YNOA 4I0SA 4GH2A 4LRMA 1QPEA 2OBJA 4AGWA 1WVXA 2PVKA 2O65A 4IZ7A 4WG5A 2V62A 2QCSA 5HOAA 3ZO4A 1PMNA 2OLCA 3QYWA 2QD9A 2GPHA 4G17A 4FGBA 4RFMA 4N4SA 1KE6A 2XNPA 1YWVA 2X9FA 3ODZX 4RWJA 4YC3A 4KUJA 1UU9A 4QTAA 3GCSA 4TYHA 2W9FB 5CT7A 5L8LA 3LQ8A 5EKOA 4TYGA 3EZVA 5EDQA 1OL2A 2WFYA 3A2CA 4YJPA 2GNFA 2W1FA 4NK9A 4C3FA 4QYFA 4RX8A 4KABA 5H8GA 5KUPA 4DITA 2BDFA 4IWPA 4CKJA 1OITA 2ITXA 3K5UA 3RWPA 3CEKA 4RVLA 3S1HA 2QI8A 2RG5A 2HOGA 2RFNA 4FX3A 4ZSJA 3UDBA 3R63A 3VO3A 5CF4A 4XG3A 1CKPA 3VBXA 5AP0A 2H34A 3POZA 3ZEPA 4CMOA 1PYXA 1J1CA 2QKRA 2IZRA 3E5AA 3EWHA 4TPTA 4BGGA 3FLSA 5HKMA 4CTBA 4IANA 3S95A 4FV3A 5FGKA 3BGZA 4ZLYA 3U6IA 4AZFA 3R83A 4EI4A 5CEOA 5HBHA 2YLFA 4UZHA 3QD3A 3CP9A 4RFYA 4YJSA 2ITYA 4YZ9A 5HTBA 3LFCA 4FV0A 5K5XA 5AEPA 2IVTA 2FO0A 1I44A 2BVAA 1WBVA 3MB7A 5EYMA 3R0TA 4XH6A 3DFAA 1CKJA 4BC6A 3V5JA 5LVNA 4IJ9A 3F5UA 2J0MB 3CBLA 3E3PA 4I93A 3R9OA 2RSVA 4YJUA 3F88A 1TFFA 4GUEA 4O4DA 1GZOA 5AWMA 2VTAA 5ETCA 5CU2A 5CAVA 1JSUA 3ZFMA 4QTBA 3MDYA 3QX2A 3PUFC 4WRSA 4PDPA 3NUPA 3E87A 1ZY5A 2R7BA 1RJBA 4IWQA 5F94A 4CTCA 4IB1A 5HHWA 3G6GA 4OT6A 5HCYA 4D2WA 3BYOA 5A14A 5HLWA 4W8DA 1YDSE 4UX9A 3PE2A 3BU6A 2YJSA 4J96A 2VWBA 3R8MA 5C4LA 1M52A 2QOQA 1PXNA 3AT4A 5DHJA 4A07A 4FF8A 3B2TA 2B9HA 4HCTA 4DFUA 4M14A 4F4PA 4ZIMA 1G8SA 2JAVA 5BVWA 4DBNA 4KINA 1PYEA 3R9RA 2JFLA 3BKBA 2W05A 4C38A 4DBXA 4CFNA 4YURA 4XJ0A 3E62A 2GNHA 4TN6A 3VVHA 4K11A 1CKIA 4YLLA 5LMKA 3UG2A 1NA7A 4BKYA 3IGGA 2PK9A 3EB0A 3COMA 3VRYA 4TXCA 4EK4A 3PXFA 3PRFA 5C27A 1ZAOA 5JT2A 1U54A 2FUMA 3PVBA 2QVSE 3BZ3A 3MYGA 2XZSA 4EK3A 4RLLA 1OL7A 4WOVA 3DB6A 4ORKA 2OIDA 4YTHA 5E90A 3GCUA 4OTPA 1YRPA 3MY0A 4DTKA 3ALOA 3OBJA 3UVQA 1WVWA 1PKGA 3F5GA 4XG6A 4LRJA 5DRBA 1YHSA 5GZAA 3MS9A 3FQSA 5AAGA 4R7BA 4R8QA 3W16A 3OBGA 4G16A 4NM3A 3HGKA 4UMQA 4IW0A 3PJ2A 3ORKA 1W8CA 1W2DA 4ZLZA 3JR1A 3C50A 5LXMA 3AGMA 1PMEA 2A98A 3H3CA 2J6MA 3PYYA 4IB0A 2X8EA 5EI6A 4L9IA 4EQMA 3F82A 3IOKA 5GHVA 3R30A 4DINA 2HAKA 4QMQA 4FUYA 1YOMA 4D5HA 4HCVA 2OF4A 1JVPP 2YACA 2YDIA 3SV0A 3GNIB 5HVJA 3A4PA 1EH4A 5CX9A 2F7EE 3Q5ZA 4AN3A 3K2LA 4BCFA 3ML1A 5I9YA 2R0IA 2ITNA 3V8WA 2PSQA 3FC1X 2FGIA 3KF4A 1Q97A 4AGDA 3SRVA 2GDOA 2X7FA 1Q3DA 4NIFA 4RRVA 3TV7A 2X1NA 3R6XA 5HIBA 4A9YA 3UPXA 3DK6A 3FHIA 4O96A 3BLAA 3IDPA 4KIOA 2J50A 3ZC5A 5IPJA 4UN0C 5CF5A 5FTGA 4CG9A 1H0VA 1PXIA 1Q8TA 3PWDA 4FNXA 4FR4A 5DLSA 5FM3A 3LKMA 1F3MC 3E7OA 2IVUA 3LZBA 4EQUA 2GHGA 3OUKA 4EH5A 3OF0A 4FRFA 2VO7A 3BE9A 5BYYA 2W1DA 5KMKA 2GFCA 5E1SA 3AKLA 3Q4TA 4D2PA 4WBBB 1CDKA 4OW8A 3IECA 4QMZA 4IHPA 1YXVA 4YHJA 4ACDA 5M53A 3RPVA 4O84A 3M1SA 2Y6MA 3HDNA 2C5XA 4II5A 5IA3A 4R5YA 2PULA 2UZBA 2OSCA 2IW8A 3PZEA 3R01A 5M09A 2BCJA 5I3RA 2NYAA 3NUYA 5LOHA 3NYVA 4G2FA 3F2RA 2C6DA 2IPXA 2GSFA 2YISA 2W06A 3E8NA 2XK6A 3GP0A 5M51A 2C5NA 2YAAA 4FTIA 2VTPA 4A4LA 2O8YA 4GIHA 1ZZLA 4FT7A 1RW8A 1PMUA 4J53A 4CT1A 4EOIA 5ICPA 3OY1A 2EB3A 3A8WA 4CCBA 3GEQA 4YTCA 4FSRA 3PPJA 5HG5A 2CKPA 3UYSA 4DGLC 3MH0A 5CVGA 4YTFA 4AUAA 5JK3A 3IOPA 3QQKA 4CZUA 1ZYSA 2C4GA 2YM4A 3RNYA 4NJDA 3IW7A 2YN8A 4ZXTA 5GIPE 2VTMA 3OWJA 3GC0A 4U41A 1ND4A 4NFMA 2YM5A 1UV5A 3FKOA 1R0PA 4IVAA 4HGTA 3ENHA 3AG9A 2E9PA 3VUDA 3W0MA 2QHMA 5KMNA 3K5VA 4XP3A 2PVHA 3QZGA 2I0VA 2UV2A 2WTJA 3IK3A 3RM6A 2ZM1A 1XH5A 3UDZA 1H8FA 2IZUA 4NEUA 5J8IA 4JT3A 3VUTA 1W83A 3W0PA 2FSTX 4X6QC 3UBDA 3KY2A 3VW8A 2YWVA 5K0KA 4H1MA 4DHFA 4AW5A 3DS6A 5KZIA 4MXZA 1Q5KA 3D2IA 5A6NA 5IDNA 4NL0A 5AMNA 2YZLA 3QGWA 2B7AA 3ORTA 4I5HA 5HO8A 4S2ZA 5CEIA 1W2CA 3PPKA 4PDYA 2C1AA 2PZ5A 4ENXA 3UOLA 4EKKA 1J7IA 2UW3A 3U8WA 2PVRA 4TW9A 3UP7A 3MVJA 3A7FA 4TWOA 4E1ZA 1UU3A 4FV8A 3AKJA 1Q8YA 4O38A 4O1OA 2CCHA 5H8BA 4OTHA 3SKCA 4EKLA 3MW1A 5CNNA 4JRNA 4USDA 4D2RA 1V0BA 3Q5IA 5IQHA 1Q62A 3ZFXA 4OAVB 4WD5A 5J5TA 2VNWA 3FI4A 4CD0A 4BGQA 3Q4UA 3UYTA 4G6NA 4FV4A 1WBWA 1IASA 2BDWA 3RMFA 4D2SA 5A4EA 2ITOA 3QC9A 4KS8A 3GC7A 4NW5A 4EYJA 4FYOA 3UVPA 1MQBA 4MX9A 4Y95A 4AN9A 2Z02A 3SA0A 2OU7A 2W1CA 3FLNC 3TWJA 4O91A 3NSZA 2XB7A 4G31A 4QMTA 4BI1A 2XNOA 4PPCA 5BMSA 2R3JA 3ZHPC 1KE8A 3GC9A 3QCSA 4C58A 5FP5A 3QFVA 4BTFA 2WTVA 4TNBA 5HNIX 4ALWA 3K3IA 4O4BB 4MNFA 3MV5A 5EKNA 4YNEA 2WKMA 1VR2A 1WBOA 3DQXA 4CYIA 3I6WA 3T9IA 1WBPA 3A7JA 3C5UA 3WARA 2YERA 3HVCA 2UVZA 3L1SA 3NYOA 3O7LB 4FSNA 3B8RA 3LJ2A 3TN8A 4USEA 3TUDA 2OW3A 2VO0A 2JDOA 4EUTA 4R77A 2CGWA 3F7ZA 3PVGA 1QPJA 3HV5A 3IO7A 5KMJA 2CMWA 4UZDA 2R64A 5LVLA 4YJQA 3S2PA 1NVSA 2BRMA 4XBUA 4PNKA 5CTPA 1YI3A 5LVPA 4ZOGA 4F6UA 3FMEA 1HCKA 5E8TA 3U4UA 5AV4A 4U81A 4NT4A 3CSVA 4RJ8A 3QZIA 5KX8A 2C0IA 1QPDA 4JR3A 3FXZA 5D1JA 2WAJA 1H0WA 2JFMA 2WMQA 1ST0A 4L7SA 4NWMA 4AT3A 2OJFE 5EM7A 5IA1A 3FMHA 1H1QA 3VS2A 1ZYJA 4BDFA 2VTHA 1JKKA 5CVHA 5AUWA 2HZ0A 4M69A 3V6SA 3ITZA 3KXHA 5BYLA 3KRWA 4FKJA 4CV8A 3DV3A 4O7RA 3UDSA 3FMLA 3DDQA 4I94A 4ZJVA 2GQGA 2HELA 4WO5A 3MY1A 3TJDA 3D5UA 5FBOA 2GS7A 1FGIA 4ACCA 1YI6A 3BHTA 3CGOA 3CY3A 3GU8A 4J8MA 1BYGA 2BDJA 4CKRA 3OFMA 2PE1A 4QPSA 4UXQA 4HPTE 2JITA 5TT7A 3ZEWA 2XJ0A 1PKDA 1VYWA 1H1RA 3G33A 3TUCA 4IWOA 3TL8A 3LLTA 5H8EA 4O0UA 2R3PA 4V01A 3NLBA 1CSNA 1YWRA 3E7VA 1B6CB 2QU6A 3AC4A 2SRCA 3LM5A 3R00A 1JKSA 4GT4A 3PVWA 4APCA 1PMVA 3VN9A 2J0JA 4LG4A 5KE0A 3RK7A 5J1VA 3NAXA 4YPSA 4ZK5A 4O7YA 4GG5A 3MESA 4Q2AA 3AT2A 2UZWE 3KCKA 4KD1A 4GT5A 3TT0A 4O2PA 1Q4LA 4FI1A 4AP7A 2FSLX 3OD6X 4I24A 4I6QA 4WKQA 5J9YA 4E7WA 3NRMA 4WRGA 5GJFA 2VTLA 2YWPA 3FLWA 3NIZA 4A9RA 4BZNA 5IEXA 1NW1A 2ERKA 3UQGA 4MH7A 3V8TA 4PP7A 4UMUA 3PE1A 4PPBA 3TXOA 2R3MA 4XRLA 4QDVA 2Z7SA 4O0XA 5E4HA 4I23A 3NMUF 3ZDUA 4EH4A 3QKLA 3BX5A 3MPAA 3R04A 4O1PA 5CT0A 4ZZOA 3BPRA 4G5PA 3TNPC 4DTAA 4J8NA 4F9YA 3P7CA 3QXOA 3LCTA 3V6RA 2PZIA 4L42A 2X7OA 4F9AA 4ZTLA 5FXRA 3V5QA 4NCTC 4XHKB 3F5PA 4FT0A 4X7QA 1OUKA 3D5VA 4MNEB 4YJTA 2ZYBA 4F64A 4A9TA 2IVVA 4FSQA 4FVRA 5H3QA 3FI8A 1QCFA 2W96B 3HP5A 3QKKA 4JJRA 4JX7A 4L01A 1O9UA 5JFVA 4C4GA 3BL9A 5DT0A 2XKFA 2CCIA 2EXCX 3D15A 4R3CA 5KMOA 1DI9A 2LGCA 3KULB 4E5BA 2JEDA 5CYIA 1VZOA 4JR7A 4YGAA 2P3GX 3NW6A 3VUMA 4AAYA 4C57A 3T3UA 4Q9SA 3WF6A 4EHGA 4GKIA 4NM0A 1YXSA 3P7AA 5M08A 4FSWA 5TR6A 4TWPA 2BHHA 3QLFA 4L00A 1DS5A 2BROA 5K4JA 3OTVA 4AOJA 3O96A 4BCGA 3H9FA 3O7LD 3FI2A 2X8DA 4DEIA 1H24A 1H01A 3Q6WA 2H6DA 5EQPA 4CQGA 2JBOA 4C3PA 4NW6A 4AQCA 2WQBA 2OH0E 4RQVA 4ZMFA 2A19B 4K8AA 4QRCA 2PTKA 2O63A 3HZTA 1TKIA 3ORLA 4CT2A 3ZLYA 2P55A 2ZV9A 3GENA 4PDOA 1H08A 5E8VA 1NXKA 1FMOE 3DKGA 5BUIA 4MWIA 4YSMA 3ZUVA 3MIYA 4K9YA 1STCE 5DIAA 4EORA 3IW4A 4DT9A 3LW0A 3PRIA 2Z7RA 1H26A 1GZKA 2BHEA 3KL8A 5K0XA 4R1VA 4TWCA 3ZCLA 2OXXA 5AA8A 4GU9A 4P90A 2F7XE 5EI2A 3U87A 3PG1A 4UYNA 3CPBA 1GY3A 4IACA 4O4EA 4RIWA 2HENA 1OIRA 4JQ7A 2AQXA 4MAOA 4O7SA 2YA9A 2G01A 3H9RA 3LXPA 3QXPA 4GCJA 1WVYA 2B55A 2DQ7X 2WU6A 3QRJA 4AXAA 3O8TA 4UXLA 3GC8A 2C47A 3QTWA 4KSQA 3ZRKA 4YR8A 2ZOQA 4RC4A 5IF1A