5FEEA

Egfr kinase domain t790m mutant in complex with a covalent aminobenzimidazole inhibitor.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
322
structure length
287
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSTVYKGLWIPEGEKVKIPVAIKESPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDEMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
publication title Discovery of (R,E)-N-(7-Chloro-1-(1-[4-(dimethylamino)but-2-enoyl]azepan-3-yl)-1H-benzo[d]imidazol-2-yl)-2-methylisonicotinamide (EGF816), a Novel, Potent, and WT Sparing Covalent Inhibitor of Oncogenic (L858R, ex19del) and Resistant (T790M) EGFR Mutants for the Treatment of EGFR Mutant Non-Small-Cell Lung Cancers.
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 287
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5feeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5feeA01
1SNUA 4HZSA 4LV5A 5A4EA 3UZTA 2XYNA 2JFMA 4L67A 4U6RA 3RKBA 4FIIA 1H28A 4YZMA 1VR2A 4QMOA 3TXOA 4PRJA 3SVVA 3PJCA 2ZDUA 3IPHA 2X2LA 4EYMA 3Q6UA 1FQ1B 2YDJA 2CMWA 2XNEA 3DKCA 3PZHA 3H3CA 5AX9A 4EK6A 4KIPA 1DI9A 1E1VA 3EN9A 4JQ7A 2RG6A 4L7FA 3JY9A 1R78A 3CJGA 3DAKA 5HBEA 3KL8A 3OOMA 4QMWA 4WUAA 4AN9A 2W4KA 2YM8A 4Z7GA 3DS6A 4FL1A 1Q97A 2IJMA 3QHWA 4C35A 1XQZA 4BICA 3S95A 3C4FA 4X3FB 3TTJA 5GJGA 3NUPA 4BDBA 2YIRA 4XG7A 5GHVA 3A4OX 4DFUA 3MN3A 4J8MA 4NKSA 4BB4A 2NPQA 3R02A 4XV3A 4ANOA 4BCOA 1KWPA 1MQBA 2G9XA 3DPKA 3JYAA 2PK9A 3ACKA 4O0VA 4TWPA 2CDZA 4C34A 2FA2A 3EN5A 4YBJA 3LFNA 3OUNB 2WMUA 3TI1A 3FLQA 3CE3A 3RP9A 4DG3E 1OL2A 2WD1A 4NL0A 2P2IA 3FMEA 3R8MA 3ZDIA 1VZOA 4DGNA 2UW3A 4DITA 4S31A 3PY0A 4JLCA 3IDBA 3M11A 2X2MA 3CQWA 4BCIA 5DIAA 4RVKA 1GZNA 2JLDA 5FDXA 4FKVA 4AZTA 3NUXA 3FPMA 3TG1A 4DGMA 5EKNA 3S4QA 2WTJA 5D11A 4J52A 3UP7A 1OL1A 2CNVA 2DQ7X 2ZDTA 2V22A 5K4IA 1XKKA 2C6OA 3I5NA 2QQ7A 4FKGA 1W8CA 4YHJA 5F4NA 2BRGA 1I09A 2RL5A 2UUEA 3MBLA 4PX6A 4RVMA 3ID6C 4IAAA 4TZRA 3DAEA 2WQEA 4F70A 1J7UA 4DFYA 3MYGA 4YNEA 2PVRA 4J98A 1FGKA 4KIQA 1YKRA 4AZEA 2CGUA 1FVRA 3PXYA 4IE9A 3GCVA 2VGPA 2XIZA 3FHRA 5EK7A 4CZTA 3KMMA 4TYHB 3S00A 4EK3A 3HDNA 3PVBA 3SRVB 3A2CA 2YLFA 3VQHA 3A60A 3UGCA 4KIKB 2C6MA 3Q32A 2VTLA 2XK6A 5CF6A 5L2WA 3F2RA 4FTOA 4RQKA 4ZSLA 4O7ZA 5FUTA 4GFOA 5AIRA 4KBAA 3U6JA 4ENXA 3LZBA 1APME 5CVHA 2NRYA 4DEDA 3OVVA 3DXQA 2C6IA 5AUWA 2R7BA 2IVSA 5ANEA 5HTCA 3V6RA 5FRIA 4MYGA 4H05A 5KHWA 4XUFA 2ZYBA 2JKKA 3FKNA 5CTPA 5FXSA 4E4NA 4X2NA 1CTPE 1OIRA 4IVCA 2VO7A 4U79A 4F6UA 3E8EA 3L9NA 2WTCA 2X6EA 4PTEA 2YIWA 5CAVA 4E3CA 2XYUA 5CF4A 4TYIA 2XK4A 3G6HA 4L00A 4O22A 2HXQA 4ZTQA 2YA9A 4BCFA 3E63A 3QC9A 4AGDA 2OZAA 1YW2A 5HORA 3RZBA 2VO6A 5C4KA 5HLNA 3MPTA 3L9PA 4BCNA 2GQSA 3R9HA 4Y83A 4AAAA 4KD1A 5IG1A 4BI2A 5EW9A 5KBRA 1P14A 4HVHA 5IQCA 2PMIA 4X2JA 1OIUA 4F9CA 4IW0A 5DA3A 3HNGA 2YAAA 1GJOA 3OT3A 4JL9A 4RVLA 3AQVA 1VJYA 5IEXA 2OIDA 3H9OA 5EYKA 5HNBA 3FXZA 4RC3A 1KE7A 3NAXA 5EM7A 3R01A 2HW7A 3DFAA 4HNFA 4E5BA 2W99B 4DEAA 5AV4A 3KA0A 2H34A 4EH9A 4XOZA 3T8OA 4ZTRA 5M44A 3QD2B 1UKIA 4D2SA 3EQHA 3TCPA 4CTCA 2VGOA 1KE5A 3IKAA 2PUNA 3VBQA 4CZYB 4GJ3A 3DV3A 4X21A 4CKRA 5E8XA 5AAFA 4ZS0A 4MKCA 2J2IB 2P3GX 3QQFA 2F9GA 2YLEA 3DQXA 3FYJX 4S33A 3RK7A 2BTSA 3MSSA 4O0SA 3HEGA 4L3LA 3UG2A 3SD0A 5HX8A 1XBAA 4UYNA 2XEYA 3LQ8A 4EJNA 4RA4A 1AGWA 4GT4A 3AT2A 2XM8A 3UO5A 4ZOGA 1L8TA 4XBUA 2R0UA 2WOTA 1UV5A 3SOAA 3N4UA 1GIJA 3MV5A 3C0HA 2XF0A 2VTRA 5DMZA 5CZIA 4M15A 3PTGA 3I4BA 1XH8A 4IH8A 5HCZA 3HP2A 2UZDA 5CF5A 3C4CA 1OITA 2IWIA 3R04A 4QMYA 4NIFB 3QD3A 2W5BA 3FLYA 3RALA 5H8EA 2XK8A 3KRLA 5EM5A 5HE2A 4QOXA 3HMPA 4ZLZA 3LLTA 3HZTA 1P5EA 4CV9A 5J1VA 3OCBA 4S34A 1ZZ2A 5AV2A 3VBWA 4D28A 4UYAA 3OY3A 4E6AA 3D7TB 2UW4A 1PY5A 2C0IA 2W5HA 5HG8A 2XEZA 3LW0A 3F3TA 1WVYA 3P7BA 5KMOA 3CJFA 3ORKA 4JI9A 3LQ3A 4QD6A 3AT4A 2HWPA 4PL5A 3DA6A 4TYEA 4E7WA 4EC9A 4GFGA 4OTGA 4NTTA 2VNWA 4YZ9A 2J0KA 1YDSE 4I5MA 4FEWA 1GY3A 2X2KA 5DWRA 4E1ZA 1QPJA 3OZ6A 2BAQA 2E9OA 4J71A 3SW4A 5JQ5A 4WD5A 5H8BA 4AQCA 4MXOA 2QO2A 2YABA 4S32A 4D2TA 1PYEA 2QO7A 5A4TA 4IAFA 3UC3A 5BVOA 3HV3A 3VBVA 3ZXTA 3LHJA 3DCVA 3EFWA 4AT5A 4DCEA 1YWVA 1WBWA 2JDTA 2JD5A 4HGLA 3RPSA 2W1CA 2NP8A 1W83A 4UMTA 4FNZA 4Y85A 2NO3A 2WPAA 3W33A 5L8LA 3Q4CA 4QTDA 2GQGA 4FTKA 4ZMEA 4EEVA 3AXWA 4PF4A 4APCA 1ND4A 4OTIA 5I9UA 3VS7A 4A4LA 3PJ2A 4EKLA 5C26A 3BELA 4DG0E 5M51A 4Y5QA 4JAIA 4P7EA 5I5ZA 3AG9A 4A06A 4ZTSA 1PMVA 4JX3A 2XK7A 2KULA 1REJA 2IZRA 3NW6A 5C03A 2R4BA 2R3LA 3KN5A 4IB3A 1E1XA 4ALVA 4BFMA 5LWNA 4IJPA 2OF2A 5DE2A 5JRSA 3WBLA 4KSPA 3S2PA 4U0IA 5IA5A 1OI9A 2CGWA 4I1ZA 5FWKK 5HG5A 4MD9E 1XJDA 4DHFA 3UDBA 2BFYA 2XH5A 4DA5A 2X8DA 4EONA 4EQMA 3V5JA 3VHEA 5FBNC 2PMNX 4AN2A 2W1IA 3GU7A 4IX4A 1Q8TA 3ZEWA 4BCGA 4ZAUA 2PVYA 3WE8A 3I7BA 4IACA 3V5PA 1R39A 1VEBA 2WEIA 3CXWA 3GOPA 2IVVA 2VWUA 1A9UA 4F1MA 2PZYA 4F09A 3UIXA 3NUNA 3OWJA 1YWNA 2Y8OA 2NNWB 3HMNA 4FTIA 4FT5A 2VTTA 4CKJA 4L6QA 4F1TA 1UKHA 4YJTA 3WF7A 5H2UA 2YIXA 2UZOA 5EI8A 2B9IA 5CT7A 1R0PA 2ITNA 3AGLA 3EOCA 4TWOA 3AGMA 5HE1A 3R9RA 2FB8A 4KKGA 4Y5HA 4KKEA 3CGFA 3I6WA 3W16A 5A14A 4U41A 3O8TA 3K5VA 4X6QC 3VS5A 2EUFB 2OGVA 2Z7QA 3FC2A 4BZNA 2X81A 5EQYA 3ZLSA 3GQIA 1M2QA 5E8YA 3TZ8A 1YDTE 2XS0A 3MJ2A 2QOQA 3GB2A 4RC4A 4FC0A 1BL7A 5CS6A 4U5JA 5FG8A 4C4IA 5I9VA 4FKPA 4XP3A 3TKUA 3TL8A 2VTIA 3QGWA 4W4XA 5ACBC 3ZXZA 4ANNA 2ITYA 5FEDA 2XKEA 4XP0A 1YHVA 3F5PA 2B55A 3R30A 3BHHA 4IAKA 4NW5A 4IM0A 4FG9A 5DR9A 1OKVA 2G2IA 1I44A 1KE6A 5JEBA 3R22A 2I40A 3F9NA 2YAKA 5LMKA 2ZV9A 1ZY4A 2XKFA 4TYJA 4AW0A 4EZ3A 2JDVA 3ANQA 4XG8A 5CANA 3OD6X 5L8JA 3P5KA 1KUTA 4BYIA 4UN0C 3NLBA 4WBOA 4JX7A 2PTKA 5C01A 2CKQA 3TN8A 1YI4A 4CVAA 5DYJA 1ZYDA 4IIRA 3KF4A 3PXFA 4WRGA 4Y95A 3RMFA 2OJIA 4ITJA 2J4ZA 3Q9XA 3TUCA 3HRCA 2VTJA 4O0RA 4FMQA 2OI4X 2PSQA 5G1XA 4L7SA 5TF9A 3RCDA 4RWJA 1LEWA 1WFCA 2WU7A 4EHEA 1SVHA 3A8WA 3OP5A 5AP6A 4F9YA 4J96A 1QPCA 3KEXA 3FZTA 1YXXA 3OS3A 4F1OA 5IUHA 3FI4A 4G3FA 4XYFA 3NVKI 4IWPA 1F0QA 4ZSEA 2EXMA 4I6HA 4JT3A 4TY1A 5C1QB 3GBZA 2VTHA 4QTBA 1KSWA 1W82A 1H4LA 5CAOA 2OLCA 4MNFA 1YVJA 3QZHA 3EQGA 2IPXA 1PXJA 2R3OA 4GU9A 4U3YA 3MJ1A 2NRUA 5CEPA 4IWOA 3BLHA 5HICA 3RK9A 2R3MA 3FI3A 3LFSA 4KNBA 4F7LA 1OBDA 5HO8A 4OTWA 1STCE 3FMKA 4LRKA 3QFVA 2Z2WA 1M52A 4DEGA 2XRUA 3A7GA 2HOGA 3EQIA 5BUIA 5HU9A 5AR7A 4PDYA 5EQPA 4UMRA 2IW9A 2ZMCA 3TT0A 3FE3A 4ZY4A 3COIA 5E1SA 4Y72A 3E92A 3QQKA 4FKTA 5J9ZA 2YM5A 2VAGA 4N6YA 5AR4A 5KMLA 4ENYA 2WMVA 3F5XA 2CGVA 4GVJA 5CSXA 3QYZA 4FKOA 3GFEA 2BMCA 3M2WA 1SM2A 5FXRA 2XM9A 4F99A 4L45A 1LPUA 4FNYA 4TXCA 4D2WA 4X2GA 3UYTA 4CFWA 5I9WA 3F7ZA 2W1ZA 5ITAA 3QL8A 4F08A 1J1CA 4ANQA 3LMIA 3HUCA 2EU9A 2RF9A 3GU8A 1J91A 2J5EA 3C7QA 2HZ0A 3KRRA 5EHYA 2WEVA 3Q5ZA 3RAHA 4L46A 4LYNA 2WMWA 3FQSA 2H8HA 1PMUA 2BHHA 3D5WA 4FKQA 3R2YA 5FM2A 1YDRE 1BUHA 3MVMA 3LJ0A 5A6NA 2EB3A 4M68A 1P4FA 3UMXA 2DWBA 4D9TA 4OR5A 4C58A 3HP5A 5HKMA 4YJNA 4ZP5A 4L9IA 2P4IA 4MNEA 3FAAA 4GVAA 3EFLA 3MIAA 4F0GA 4I22A 5ANGA 5K4JA 3PUPA 3TKIA 2OSCA 4RIYB 4YJOA 3ZO3A 3QCYA 3C4ZA 4TNDA 3FXWA 4BGHA 4D5KA 4IZAA 3SXRA 1UU3A 3EH9A 1Q3WA 4CRSA 4QMXA 4DH3A 2UVXA 3EL8A 5IKWA 5EDRA 3V8TA 4R7BA 3GOKA 2YERA 3OF0A 1UA2A 5AP7A 4NEUA 4EH6A 4JDKA 3SLSA 1LUFA 3DK7A 3GGFA 3FZSA 3PJ1A 3BHVA 3HRFA 4G1WA 5ANIA 2PE1A 2E9PA 3U87A 2UVYA 3UIUA 2F4JA 4KABA 4XV2A 1U54B 3ZSIA 3CLYA 5JZJA 2W1EA 2YIQA 3C5UA 3AT3A 3EKKA 1ZYJA 2Y9QA 3A99A 2LAVA 4BGGA 2VX0A 4QP9A 1KE8A 3II5A 4IXPA 1BL6A 4FOCA 4MBLA 4ZZMA 1JWHA 2XBAA 4BC6A 5E4HA 2UZEA 4RRVA 2PZIA 2XUUA 4XP2A 3SXFA 4PQNA 4OTRA 3KULB 3WZUA 4R7HA 3O7LD 3R73A 2Z60A 2GFCA 3DTCA 5M06A 4Y8DA 4C36A 4A9TA 2PE0A 2J51A 4FKIA 4AG8A 3SA0A 3W8LA 4YLJA 4RX8A 5C4LA 3D0EA 3F3UA 4QP8A 4XG9A 3RGFA 3KN6A 5IDNA 2X4FA 4PNKA 2C4GA 4WUNA 1UNGA 2FVDA 4ZSJA 4DT9A 3DZQA 4QMPA 1P2AA 4W9XA 3LCSA 4FTAA 5IPJA 4GKHA 2XJ0A 3G2FA 3G33A 1Q8WA 4ANBA 4YURA 3CQEA 3D94A 5CLPA 3VUHA 1OVEA 4CCUA 3HX4A 3ORMA 3Q9YA 3QA8A 5J7BA 3Q3BA 4ERWA 4C3PA 2C5YA 2HZIA 4GW8A 4PWNA 3G0FA 2QCSA 1GIIA 4EH3A 2PMOX 2BILB 2C0OA 4P5ZA 3QD4A 3ZC5A 3UBDA 3FKLA 3GU6A 3REPA 4QYYA 5ETIA 2GNHA 3VRZA 4J97A 3DBCA 4C57A 1CMKE 1A06A 2QD9A 3F6XA 4KRDA 4AOIA 4UALA 4GFMA 3VO3A 5L2QA 5JFSA 4Q5HA 2P55A 3Q60A 4O1PA 1DI8A 5AAGA 2WMRA 1SVEA 3D14A 5CQWA 4F7JA 4UWCA 4NJDA 3ENHA 2XNGA 3QTXA 2XMYA 4G6LA 2VTSA 2W1GA 4BWKA 4F63A 2EXEA 4YU2A 1G3NA 5E9EA 3PLAE 3ZZEA 4CLJA 3MESA 1J7LA 5IH6A 4ZK5A 4I20A 3QTIA 4TT7A 4F64A 4O0YA 4O91A 2WO6A 1BYGA 4BIEA 3PP1A 4O84A 4RMZA 1H01A 3NNUA 1OL5A 4U45A 2VO3A 4N70A 1MQ4A 2BRBA 3GNIB 3ZM4A 3UNKA 4JJRA 2OIQA 1U4DA 2VTMA 4EOMA 4XBRA 3EWHA 1YI6A 4BN1A 4IAYA 2O3PA 4CTBA 2J6MA 4QP7A 4XEYA 5BVDA 5L6PA 1PMEA 2Y4PA 3POOA 5GINE 5D9HA 3UQFA 4CMOA 3LFEA 4IX5A 4TTHB 4XNEA 4BY9E 1H0WA 3Q52A 1CKPA 4DBNA 4BKJA 5CEQA 3KRWA 3A7IA 1QPDA 4DINA 3BBWA 3VJNA 3UIBA 2XKCA 3AD4A 4ZJVA 5E8TA 5HG7A 3I1AA 5E8ZA 3AD5A 1PKDA 2ZOQA 3HDMA 4RJ6A 2QVSE 5HHWA 3VW8A 4GUEA 4DFZE 3NUAA 4NZWB 3MH0A 4IVDA 3A7FA 2RIOA 4O7RA 3BEGA 4PPCA 3RK5A 5AR2A 5L8KA 2C47A 5LVOA 4ALUA 4FG7A 4FIHA 3TUBA 3PDTA 3R1YA 3Q2JA 4MBIA 4F7SA 4GV1A 4P5QA 4ZTHA 5K3YA 2C6DA 2YJSA 3LXKA 3U54A 1YXUA 4TN6A 3MH1A 3F2NA 4F9WA 4BKYA 3ORTA 3QXPA 4NKAA 4B0GA 3DB8A 4USFA 1M2PA 3ZU7A 3SAYA 3LXLA 2ZM3A 4ZSGA 1H08A 2YHVA 2Z7RA 4OTHA 3QTWA 3CD8A 3QALE 5DVRA 3LE6A 3SHEA 2XNMA 2ERZE 4F0FA 2BVAA 4IAZA 4RZVA 3R8ZA 4JVGA 5EOLA 5CX9A 2IO6A 4JBQA 1ZLTA 1RQQA 3WZKA 1MUOA 2GS2A 4DGLC 2UZNA 2PVHA 2O2UA 4NJ3A 5J8IA 3R7EA 3NPCA 4UWYA 4FIGA 5TOZA 4O7SA 1YI3A 4W8EA 2QLUA 4WHZA 5DT4A 5BMSA 4JNWA 2OZOA 3OG7A 2JDOA 3UQGA 1FINA 1AQ1A 2PZRA 1WBSA 2A2AA 2JKQA 1JQHA 2LGCA 3FZOA 2V0DA 3BHUA 4NCTA 5LVMA 4PDPA 1OGUA 5L2IA 2X8EA 1BX6A 4D4VA 1OL7A 2B53A 4NCTC 4EOIA 4CGAA 3ALOA 1Q62A 4JAJA 3UOLA 4BDDA 2REIA 3QHRA 2OKRA 4RX7A 4NT4A 1BMKA 1KV2A 2ITUA 4WOVA 4DH8A 4GG7A 3NX8A 4QTAA 3EN7A 5AUVA 3IGOA 4F9AA 2C3JA 3QTZA 2WQMA 4IZYA 4MXZA 3GXLA 3EYHA 3RAWA 2B9HA 4QMUA 4FSQA 4FSWA 3W32A 5TKDA 1XWSA 5CAQA 1PW2A 2HCKA 3PA4A 2PL0A 2J0MB 5KHXA 3PYYA 1P4OA 4RG0A 5LVLA 2BZIB 4ACGA 3TDVA 1QPEA 2Y6MA 3TV4A 4QPSA 4DC2A 2R3KA 2VU3A 2W1FA 2YCFA 4GMYA 5TR6A 4YLKA 2R3RA 4LV8A 3NYXA 5E91A 5HLPA 5HO6A 3RWQA 3RPRA 3T3VA 5FDPA 5HNIX 3LFDA 4C4EA 2GHGA 3PJ8A 5GZ8A 2YJRA 3G90X 4S2ZA 3PFQA 4MXXA 4V04A 3RM6A 4ZTMA 1L3RE 2VN9A 4K0YA 2XNPA 4EKKA 4KS8A 4GK4A 3D4QA 4FKSA 4TRLA 4O96A 5FP6A 5M4IA 4ZTLA 2F7ZE 4O7TA 1JKSA 3EKNA 3R63A 4AZWA 4FZFB 3DNEA 4EHGA 4XCUA 4DGGA 5J79A 2GNFA 4JR7A 2C5OA 2UW9A 4C7TA 3PXQA 3ZMMA 3R7OA 3O50A 4ASDA 3NYOA 5IA4A 3R7UA 4PNIA 5A4CA 3HMMA 1H1WA 1UNHA 2QOLA 3Q6WA 4MQ2A 4CLIA 3HLLA 3TM0A 2JEDA 2UW0A 4AT4A 4H58A 4KS7A 4FV1A 5DN3A 4EOJA 5JMSA 5IQHA 2VWYA 3UNZA 4H3PA 2I7QA 3NAYA 4M13A 4RIXB 2X1NA 5J87A 5A46A 1LP4A 4Z55A 2AC3A 4PMPA 4QQ5A 1QMZA 4HYSA 3GU5A 3TNQB 4M0ZA 4XHKB 4CYIA 2Y7JA 3G0EA 3KXHA 2B54A 1YRPA 1ZXEA 4QQJA 3RVGA 2I1MA 4F9BA 3ODYX 2J50A 5I0BA 2VX1A 1V0PA 1O6LA 2YM7A 4AU8A 2C6KA 4APPA 2C3KA 4RIWA 5KZ0A 2ONLA 1PRYA 3C4XA 4BKZA 4YHFA 4TKSA 3B8RA 4FE2A 5IA0A 2ONLC 4ZLYA 4HCVA 3VQUA 3OEZA 5IA2A 1JPAA 4IQ6A 1JVPP 4QMMA 3BQCA 4FGBA 5BNJA 4M69A 1WMKA 3Q04A 4ZY6A 3KCKA 3G5DA 2UZVA 4ZJJA 4USDA 5AP1A 2WXVA 4HVGA 3RINA 2GPHA 1WCCA 4AW1A 3BX5A 3VS2A 4UXLA 5AP4A 3VHKA 5CXZA 2WAJA 3SV0A 1PXLA 4IC7A 2IW6A 3ODZX 1CDKA 1Q5KA 2QU5A 4CG8A 4AGCA 3GC0A 1XH5A 4UY9A 1GAGA 3GCUA 4FIEA 4PTGA 4FNXA 4K77A 4YO6A 4YUQA 2Q0NA 3R83A 2ITQA 2CN8A 3E64A 4AT3A 4KAOA 4E4XA 3IW8A 3O17A 4QMZA 2FUMA 2OF4A 4FT3A 2W05A 3DK3A 3IDPA 2ZJWA 1Y91A 2A19B 4GL9A 4O2ZA 2HY0A 3QC4A 4PMMA 5CI6A 5CU2A 4FK3A 5TT7A 2FSMX 4G34A 5K0KA 3VULA 3VUGA 4FV4A 5DT0A 5ETCA 4HVSA 5HGIA 3EN4A 2F7EE 3MY1A 1WBNA 4FT7A 3RPVA 2XIRA 1O9UA 3LPBA 4MXYA 1BI8A 1M14A 4ZXTA 2X8IA 5KNJA 3PVWA 3OWPA 3SQQA 5M56A 3NYVA 4FGRA 1ZY5A 2F2UA 5CU6A 3VUKA 4O1OA 5CALA 3NUSA 3F3VA 2W9FB 3MI9A 5AM7A 4ERKA 3NW7A 2HY81 2X7GA 4ITHA 4N57A 3V6SA 4ZJIA 1Y8YA 4FL2A 3B2TA 4DAWA 3TEIA 3HYHA 5GIPE 2QHMA 4YMJA 5BYZA 3ULZA 1H1QA 3KXMA 3GP0A 3WYXA 3PXKA 4YJQA 3RHXA 3CGOA 3K3IA 2QOOA 4D2RA 2B4SB 3VC4A 4BZOA 4HOKA 5DG5A 4DH7A 2B9FA 4GT5A 3FY0A 4QRCA 4IB0A 4O2PA 3U4WA 5ANJA 4ZZNA 4ASEA 2ZM4A 3EQBA 3JUHA 5AMNA 4YC3A 4U9AA 4WIHA 5IUIA 4ZS4A 4GSBA 3W2OA 3PG1A 4AWIA 5IQGA 1OKZA 4FX3A 3WIKA 5JFXA 3U9CA 1ZAOA 3V8SA 4HYHA 4FV7A 3FL5A 5AUTA 3W2CA 4MX9A 5AR3A 4ACMA 2YCRA 4EQUA 5B2KA 4B7TA 3DBFA 5JT2A 5LMBA 5CASA 5IISA 4IVAA 4B9DA 3JVRA 4RJ7A 2GMXA 1OKYA 1M7NA 4BCQA 3QLGA 4E20A 2YDKA 1XH9A 4KSQA 4LRMA 3R8UA 1H1RA 3A7HA 3DJ7A 4OBQA 4X2FA 4BTFA 2FSOX 2EXCX 5A3XA 4O82A 5F20A 4AW2A 4J7BA 1UWHA 2F2CB 4BI0A 4DLIA 4H36A 2VTOA 3NIEA 3C13A 4K33A 4UWBA 1W98A 4BCJA 2W4JA 3OBGA 3AMBA 2BALA 3VAPA 4ACDA 3NZ0A 2AUHA 5HEZA 5LMAA 4DTAA 3AC5A 3UO4A 3F3WA 2C6EA 4FTNA 3WF5A 1UWJA 2BRNA 4FF8A 4U44A 3WILA 1G5SA 3EQRA 4D4SA 4IZ7A 3ZUVA 5E92A 5KKRB 4O38A 1OB3A 3WI6A 4C33A 2J0IA 5KUPA 3TZ7A 3GUBA 3OUKA 1JKTA 3OWLA 4V0GB 1OUYA 3LQ5A 4RJ8A 2QLQA 3BZ3A 4EBVA 3R1NA 4BDCA 4OW8A 4PPBA 4A4OA 4U80A 4C3RA 4H1MA 4YZNA 3H0YA 3E3BX 5EDPA 3FMNA 3OC1A 3UO6A 4C0TA 4B99A 3UPZA 4IC8A 5HIEA 4A9RA 3L8PA 3FZPA 4D0XA 3OXTA 4IEBA 1OPKA 3R7GA 2AYPA 3NDMA 4YTIA 3ATSA 5EYDA 3QRKA 3QQHA 1FMOE 3CTHA 4D9UA 4IADA 2WTVA 4R3RA 3O23A 4OBPA 3ZRLA 2OH4A 2GS6A 5CNNA 3NNVA 2OO8X 4OTFA 4NM5A 3FQEA 4RGJA 3OXZA 2I0EA 2PZ5A 2BHEA 2QONA 4NYEA 4FTRA 3JY0A 1JBPE 4LMNA 4ZIMA 4DEBA 2VWVA 4M67A 5HTIA 2IZSA 1BKXA 2BRHA 3UP2A 1U5QA 3MGYA 5EQEA 4I23A 3V01A 3FMHA 5DH3A 3OY1A 5FXQA 3HGKA 2Q0BA 2UZBA 4G3EA 3P4KA 5HIBA 4FIFA 3CC6A 2JIUA 2BKZA 4DG2E 2XVDA 2JKMA 3S3IA 2OXYA 3QD0A 4JDIA 4D1SA 4IDTA 1RDQE 1PJKA 1Q61A 4U8ZA 2DS1A 2ETKA 2GNIA 4BBMA 4BTJA 1DS5A 2OXDA 4YZDA 4UZHA 4NH1A 1MP8A 1W0XC 3KKVA 1YOMA 3D5XA 4LGGA 4EOQA 1CSNA 2YM3A 4ZSAA 4FSRA 3I6UA 4GIIA 4LRJA 4O0XA 4HPTE 2BZHB 4HZRA 2UW7A 4MQ1A 3NIZA 4DTBA 2B1PA 2JDSA 4GK2A 4PV0A 1GOLA 3G51A 2FYSA 4HJOA 4QO9A 2FGIA 5CEOA 5JRQA 4MD8E 4EOOA 2RFNA 3SC1A 4ARKA 2B0QA 1Y8GA 3FLZA 3CKXA 1O6YA 1J1BA 2W06A 1YOLA 2BTRA 2BROA 2QOHA 3DLZA 3G9NA 2X4ZA 4BBFA 4HVIA 5BUEA 3VRYA 4A9SA 3UC4A 2J7TA 1WAKA 4AOJA 3O0GA 5D10A 2X0GA 2WTKC 3KXZA 3BV3A 5DEWA 3RWPA 4ANLA 4K6ZA 3UG1A 3ORLA 2PMLX 5HVYA 3MWUA 4RJ4A 4CQGA 2IVUA 3OHTA 5BYLA 4G31A 1JKLA 2BDWA 3PE1A 2R3NA 3VUTA 3W2PA 4EOPA 4NUSA 2WFYA 3LMGA 2WTDA 3TZ9A 3DAJA 2XJ1A 2R3FA 1CKIA 2OU7A 3FKOA 3OCSA 4MWIA 3KMWA 5GZ9A 4FTCA 5IEYA 5C8KA 3VS6A 3U6IA 1B38A 5AR5A 4RFZA 3O51A 3QQLA 5AUYA 3BYVA 3H9FA 4FTTA 2GCDA 4FG8A 3R9NA 1FMKA 3E7OA 5LMKC 5EW3A 4QQCA 3BGQA 3ZO2A 3R8PA 4A07A 3U9NA 3BE9A 4OAVB 2QOCA 3TIYA 2A1AB 5TO8A 4EHVA 4EHZA 3UVPA 5J5TA 3RAKA 3LIJA 5M55A 4K11A 1PF8A 4XS2A 3GFWA 3ZZWA 5FQDC 4EWHA 4OTQA 1FOTA 5I4NA 5KMKA 4IM2A 4WKQA 2V55A 5ETFA 4DEEA 2XZSA 4KKHA 2X9EA 3IOPA 4II5A 5EM8A 4W9WA 3PA3A 3MVJA 3ZYAA 4Q5EA 4U97A 5KMIA 4FVPA 4H39A 4O21A 4F4PA 3ZM9A 2O0UA 4OT6A 4O7WA 4FUYA 3D9VA 3PZEA 4X3FA 4JDHA 3HKOA 4D58A 5IMXA 5J9LA 3ZSHA 3A7JA 4RQVA 1PXOA 3QTSA 4X3FC 3AMYA 4UMQA 2B9JA 4I94A 4FK6A 1H8FA 3UZRA 4IVBA 5CU0A 3U51A 2PULA 5DR2A 3RJCA 5ICPA 2ZB0A 5ETAA 5E8VA 4EBWA 2QURA 4G3GA 4M7IA 4G9RA 2C5NA 2ESMA 3FMJA 3QQGA 4D0WA 4DFNA 4RJ3A 5C9CA 4R3CA 3EZVA 5GJFA 3BWJA 3KXGA 3VNTA 4M8TA 5CYIA 1OMWA 3RNIA 5J7HA 1Y57A 3ZTXA 4FA2A 2ITPA 2O63A 1M2RA 2G15A 4FOBA 4ACCA 3P7CA 1M17A 2VX3A 4WG4A 4HW7A 5HBJA 3QUDA 2C68A 3BYMA 3LFFA 3QZGA 3DBQA 3TACA 3BYOA 3QTUA 3L8SA 4CFFA 3VUIA 4G9CA 2X39A 3KREA 1ZWSA 2O64A 5M53A 5B2LA 4B6LA 2XIKA 2YITA 5CT0A 5HCXA 3F69A 1SYKA 1ZYCA 1Y6BA 3PPJA 2EWAA 3FZ1A 5DR6A 5AUZA 4EQCA 2RGPA 5CVFA 5AA9A 4DBXA 2WTWA 4GU6A 4H1JA 1RE8A 5AA8A 2BZJA 2YN8A 1V1KA 3QX2A 2SRCA 2X7OA 4TYHA 3V3VA 4TL0A 5J1WA 3THBA 3CTJA 3SRVA 1UVRA 3KVWA 4EORA 3I5ZA 5FTGA 3BKBA 3DB6A 4KIKA 1BI7A 2QO9A 5HESA 4EL9A 4NW6A 3RTPA 2OH0E 2HWOA 1NY3A 5T6KA 2WIPA 5AIKA 4IWQA 2XBJA 4UV0A 2YZLA 3F5UA 2OZAB 2R3PA 4RLLA 4X0MA 3MH3A 3SX9A 4YZBA 3MY0A 2I0VA 2J9MA 4FTJA 4C59A 3FSKA 3P78A 4YBKA 3BGZA 1PHKA 5LVPA 3KRXA 1CKJA 2WMTA 3ZFXA 2CPKE 2CCHA 3D2KA 3PXZA 5EYMA 5A6OA 3BI6A 3RNYA 2PVNA 2BZKB 4BDEA 4CFVA 3BRBA 5KX8A 1OPJA 1W7HA 3HMOA 5KCVA 2CNQA 3BEAA 3HAMA 3GCPA 2B52A 5IQDA 1FVTA 4MVFA 4ZLOA 2W9ZB 1W84A 1OIYA 2C6TA 4FSTA 4OBOA 3WF9A 2QNJA 3F82A 5BUJA 3CQUA 4R5SA 3R7YA 5L2TA 4DFXE 2YM4A 2Q83A 4OTDA 1PXIA 2W0JA 1KE9A 3DGKA 3HA8A 3MFRA 4FV5A 3WZJA 5I9ZA 4LUDA 4M14A 3PY1A 5IA1A 1WVXA 1OUKA 4QP3A 4ITIA 3P9JA 1ZZLA 5AV3A 3OW3A 2UZLA 2UZTA 2YM6A 3BU3A 3POZA 5B0XA 4AOTA 4U81A 5IA3A 3QRTA 1JLUE 3MFUA 3VVHA 5AAEA 3N4VA 1S9JA 2GS7A 2HELA 4WG5A 2G1TA 5EYCA 1YOJA 4OLIA 1K3AA 5CU3A 5DNRA 4O7YA 2WMQA 1H00A 3DKFA 4G2FA 4LGHA 2JAMA 5AP5A 4NU1A 5H3QA 3V8WA 4I6QA 4G3DA 5L2SA 2WQBA 4L53A 1Q8ZA 1PKGA 4UXQA 4NTSA 2OBJA 2VTQA 2E2BA 4O81A 1XH6A 4I5HA 1WBVA 4RFYA 3RBWA 4AACA 3CR0A 4L01A 3QKKA 4AN3A 2ZV2A 3I60A 2GHMA 3PPZA 2ACXA 3D5VA 3E7VA 5E8UA 4USEA 2C6LA 4I5PA 4D2PA 1A48A 1UU7A 1GZ8A 4H3BA 4BGQA 2YDIA 1U46A 1DAWA 3RAIA 3OOGA 5HNGA 3ROCA 2QI8A 2GNJA 4QMSA 3EQDA 4K9YA 5LCKA 4EI4A 5IZFA 3KC3A 4GH2A 4O0WA 2OJFE 4FV3A 3Q2MA 4XX9A 4U3ZA 1PYXA 4IB5A 2A27A 4O6LA 4CMUA 4OTPA 1TQIA 3F7WA 2GNGA 4L42A 5BPYA 2WQOA 4C61A 2YWPA 3FY2A 1JSTA 2PHKA 4HYIA 4K8AA 3IW5A 3VS0A 5C27A 5AR8A 4BHZA 3ZFMA 3MB7A 1SVGA 5AWMA 3GC8A 3COKA 4DGOA 2WMAA 3E87A 4JQ8A 4NIFA 4EH2A 4I93A 3CKWA 2YFXA 2G2HA 2WOUA 3NUYA 2EVAA 2I0HA 4M84A 4JRVA 2CKPA 3MW1A 3ZHPC 3QXOA 2HK5A 1Z5MA 2JC6A 2Z8CA 4KBKA 3LCKA 4DLJA 3IW4A 1DAYA 5DT3A 2CLQA 1XH4A 3PWYA 4XRLA 2V7AA 4BDHA 2VRXA 3D7TA 4FKWA 3QQJA 3DXPA 4CV8A 2BDJA 4PP9A 4IWDA 5F95A 4FSUA 3QKLA 3COMA 3R21A 2X7FA 4YNOA 1FGIA 5J5SA 4C37A 3C4EA 4LI5A 5IDPA 4G6NA 2JAVA 1PMNA 4DFLA 5HD4A 2JIVA 1V0BA 2OJ9A 3F61A 4I0RA 4IDVA 3VF9A 3R1QA 4UMUA 2QC6A 4RX9A 3ZEPA 2HIWA 5AM6A 3HRBA 3NNXA 4RLKA 2E9NA 5DHJA 2IW8A 5J95A 4EOLA 4B8MA 1GIHA 4IMYA 2C3LA 1JAMA 4QMTA 3DQWA 3MVHA 5FTQA 3QGYA 4HGTA 4E5WA 4WNPA 4AZFA 4D5HA 3D7ZA 2X6DA 3DJ6A 4GRBA 5ANOA 1XR1A 4FVRA 3GCSA 4FODA 4O0UA 4DE4A 3T3UA 4DEIA 3FQHA 3NS9A 4WA9A 3ZS5A 4KUJA 2PVKA 2IN6A 3NSZA 5JGBA 4BR3A 5BVNA 3G9LX 1NVSA 4I5CA 2WGJA 4K2RA 5FTOA 4UMPA 2QOKA 3WE4A 3ZOSA 4LOQA 3KRJA 1M7QA 4RPVA 3R2BA 3FUPA 4FZ7A 1PXMA 3I0QA 2O8YA 4A9YA 2VO0A 5DI1A 3ANRA 3TV7A 4R1VA 1V0OA 4ANSA 1MRYA 4LGDA 2EB2A 3Q4UA 4XOYA 3DNDA 2C0TA 4QMLA 4QYEA 4R5YA 1OPLA 5HD7A 3KVXA 3OROA 3PPKA 3EFKA 3O8PA 4NWMA 5L6OA 3HL7A 4WRSA 3ENMA 3W2SA 3DDQA 3KXNA 4Z7HA 4IAIA 3G6GA 4C8BA 2VD5A 4C02A 2JDRA 4JIAA 3P86A 5CXHA 1CM8A 4L8MA 3LAUA 1UU9A 1YHWA 5AADA 5AJQA 2F49A 1Y6AA 2OICA 4AA5A 2OFVA 4I3ZA 4YJUA 4EK4A 3FC1X 2OXXA 4C62A 3LOKA 3QBNA 5LQFA 4D4YA 4I0SA 5CNOA 1F3MC 4EH8A 3SKCA 1NXKA 4KBCA 3C51A 2WMSA 2BIKB 2C3IB 3C0IA 1R3CA 4QPAA 3GCQA 5AP0A 5M09A 3O2MA 4M0YA 3QU0A 1OZ1A 3CEKA 2HW6A 4JDJA 3BLQA 4AGWA 2BPMA 5K5XA 3CTQA 3FHIA 5CSWA 2VTNA 3AD6A 4FYOA 2UW5A 3WIGA 4AZSA 5M4UA 2ZV8A 4QMQA 3OTVA 2RKUA 3OW4A 3CPBA 4KB8A 3LFBA 4FKJA 2CCIA 2WNTA 4G5JA 3U8WA 2XK3A 1ZMUA 3DU8A 3VS1A 1JSVA 5B2MA 1WVWA 1HCLA 1JKKA 4MHAA 4X2KA 5H8GA 3L9MA 5CF8A 2VTPA 1XBCA 4EK5A 3NR9A 5L3AA 2OFUA 3N9XA 2V62A 3OMVA 3OTUA 3QUEA 3N4TA 3QKMA 3ZLXA 2JGZA 4BCHA 2ZB1A 5IF1A 5CI7A 4G3CA 2FH9A 3E8DA 4FV9A 3CD3A 4Q9ZA 2BUJA 4C4JA 3UVRA 4JBOA 4NSTA 3FSFA 3R0TA 3WZDA 3FMMA 3HAVA 3C9WA 3IS5A 1TQPA 1ZMVA 2GDOA 4YC8A 1IA8A 4HNIA 5L6WL 4AA4A 3PIZA 4UBAA 3HV7A 4F7NA 5JN2A 4J8NA 2PPQA 3O96A 4JR3A 5DLSA 2ZAZA 4BDKA 3HA6A 2C30A 4FV8A 4M66A 3TNHA 4IJ9A 2JIIA 2CHLA 2ETRA 5EOBA 4I4EA 3PP0A 3R28A 4XMOA 5DFPA 3TJDA 2H96A 4E6QA 4GIHA 3Q9ZA 4BHNA 2WQNA 5FEEA 5CSPA 4L43A 4O0TA 4CFXA 4I0TA 2CGXA 1OIQA 1XBBA 3ZH8A 4BDFA 2UVZA 4TWNA 4GK3A 4IX6A 3R8VA 1Q3DA 1ZOHA 4EUTA 3VS3A 4FZDB 2ITTA 2PWLA 5IH4A 3O7LB 1VYWA 4CNHA 4X6RA 4DYMA 2VUWA 3K3JA 2XA4A 4GYGA 4L3JA 5TE0A 4FUXA 2GFSA 5GIOE 1HOWA 2RFEA 3E62A 3C50A 4UEUA 5E7RA 4Y46A 4A9UA 5IMEA 4JQEA 4CQEA 3BU5A 4EH5A 3FJQE 4X3JA 3L1SA 3D2IA 4PDOA 4GG5A 5KMNA 4Z3VA 4DFBA 1URWA 5BQ0A 3FXXA 3OEFX 2J0LA 2XIXA 2WMBA 4IANA 4LMUA 4BDGA 2BKKA 2W5AA 4L68A 1SNXA 4TW9A 5IQFA 5DPVA 2CKEA 2PE2A 5HVJA 5IQAA 5D12A 4LUEA 2XIYA 3S0OA 1Q8UA 2OIBA 4MNEB 4KA3A 3QZIA 2VV9A 3PE2A 4XJ0A 4YZCA 4BBEA 2QG5A 4FTUA 5A9UA 4HCTA 2HENA 1LEZA 4F65A 3KY2A 2BAJA 1LR4A 2FO0A 2RSVA 3BGPA 5BVKA 4N4SA 3FPQA 4XG2A 4AF3A 5HI2A 4EK8A 3ORZA 3Q9WA 4OGRA 4YJVA 3I81A 3AC2A 1OBGA 4X7QA 4DN5A 4EH4A 1IRKA 2QR8A 3MFTA 3R71A 3BYSA 3AC4A 3E3PA 4GYIA 2E9UA 5EDQA 3VBXA 4F6SA 5K0XA 2XP2A 3BYUA 2QODA 2PYWA 2YWVA 4M12A 3ROYA 3W8QA 3ETAA 3R00A 3VF8A 3D83A 3PVUA 4WSYA 4A7CA 3NUUA 5HQ0A 3QCQA 4I6BA 4U40A 4I92A 2QG7A 3EB0A 4FIJA 2VWIA 4B8LA 4QYGA 2PUIA 2A4LA 4BDAA 5AFVA 4YGAA 4QPMA 4FNWA 4JRNA 2W1DA 3W18A 2YZAA 2OJJA 5AV0A 5HX6A 4V01A 4PDSA 4FL3A 4GKIA 4RIYA 5D7AA 5DOSA 1BLXA 3UQCA 4BWPA 1B6CB 1ZRZA 1UNLA 4XG6A 3T9IA 3D15A 4FSMA 4NFMA 1Q99A 5ANKA 4M3QA 4JG7A 2ITXA 4IFGA 4BL1A 3PSDA 4EJ7A 3F3ZA 4OT5A 4RA5A 4WNOA 5FLFA 3LJ1A 2R3GA 5HOAA 4Z9LA 3TTIA 5K5NA 2YCQA 2RG5A 5AUXA 4K1BA 3SXSA 5AEPA 1U5RA 4GJ2A 3NYNA 4F6WA 3UMWA 2QR7A 1QL6A 2H6DA 5D1JA 2QOIA 4O27B 5CQUA 3L9LA 4DCAA 4C4HA 4CYJA 4EWQA 3P23A 4N0SA 3DBDA 4RX5A 5EH0A 3KCFA 3LM0A 3IGGA 3P1AA 1U54A 4WG3A 3AMAA 2QOBA 4YHTA 4W4VA 4LFIA 4YC6A 4BCPA 4P90A 5HCYA 2ZV7A 4IB1A 3PSBA 4RZWA 4AX8A 4ID7A 4C4GA 3D5UA 3M42A 2VWZA 3QWJA 4RVTA 3ATTA 3ET7A 3ACJA 5CWZA 5DEYA 4MH7A 5CEKA 3KULA 2WHBA 4HGEA 1MRVA 3FLWA 4P2KA 3CSVA 5DRBA 3RCJA 3BU6A 4E6CA 3R6XA 3FLNC 5F1ZA 5H9BA 2BRMA 3IW6A 3KU2A 4JXFA 4AW5A 4CXAA 3JS2A 4U7ZA 4G17A 3RPOA 4QQTA 4ZTNA 2QU6A 1IEPA 2QHNA 4QNAA 4YP8A 4EUUA 2ITOA 3DZOA 2VNYA 4FI1A 5JZNA 4EC8A 3NVMB 3CY3A 2C1AA 3QWKA 1ATPE 3CIKA 2JBOA 4F0IA 4O7LA 3DLSA 4YJSA 4NK9A 3IG7A 4G16A 3ZLWA 4MD7E 1XH7A 5DBXA 5GZAA 3ZBFA 5M4FA 5EFQA 5J9YA 3PRIA 3E8NA 2ITWA 3FV8A 2Z7SA 5EHLA 3DK6A 4FV0A 5IQEA 4FYNA 3QYWA 3V5QA 5CENA 3S1HA 3LVPA 3RPYA 2XNOA 2ZM1A 3PXRA 3UNJA 4FSZA 1ZARA 4ONAA 3TZMA 3E5AA 3UODA 5JH6A 3H30A 1J3HA 3A62A 4AE9A 3PIYA 3DBEA 3TNPC 4CG9A 3AC3A 4LOPA 4C38A 2C5VA 3RM7A 3R7VA 2YACA 4YLLA 2R5TA 1PXPA 4YSJA 1JOWB 2JITA 1S9IA 3MS9A 4G6OA 4WBBB 2XCKA 3ELJA 1ZYLA 1WZYA 4FZ6A 3ZC6A 1YQJA 3KB7A 4R77A 2JFLA 2CNUA 3W55A 3LFQA 1R0EA 5IH5A 4JOAA 5HVKA 4O86A 3DXNA 2ERKA 2UZUE 2X9FA 3E8CA 4ASZA 3JR1A 3IK3A 4CT1A 3EHAA 3W1FA 5IUGA 3IQ7A 3TIZA 3VBTA 3AOXA 4O7NA 4J53A 3LFCA 2W4OA 4EH7A 2V5QA 2IZTA 3MIYA 3V5TA 2JBPA 3OCGA 4FV6A 4LL0A 5CU4A 4BF2A 2O65A 2CSNA 4E6DA 4JBVA 3ZDUA 3ORIA 2Z7LA 1UU8A 4AXAA 3MVLA 4E4MA 2OW3A 3BCEA 3EJ1A 4O7VA 4HYUA 1E9HA 4RIOA 1H25A 3GU4A 5C8MA 4MWHA 3IECA 4C3FA 4B4LA 4HPUE 2XRWA 4JG8A 4MCVA 4CCBA 3PSCA 4DTKA 1XO2B 4Y73A 3UJGA 1Z9XA 4E73A 2R64A 2OJGA 2HZNA 3LJ2A 3NW5A 4R6VA 4CD0A 2Y4IC 5JFWA 2C5XA 3VBYA 1IR3A 4BIDA 4PP7A 1PXKA 4BDIA 4DT8A 3UPXA 2QKWB 2HZ4A 2RFDA 5GJDA 4YR8A 2DUVA 4D55A 1JSUA 4CSVA 3P0MA 5DRDA 4R1YA 4XLVA 4E5AX 5BX0A 2R9SA 2GSFA 5I3RA 3MH2A 4XG3A 3UTOA 3ZSGA 4G5PA 3ULIA 5FD2A 2GTNA 4C2WA 2R3JA 4QT1A 2ITZA 5FM3A 4BTMA 3K2LA 3ORNA 1B39A 3QRUA 3L8VA 4AFEA 4UX9A 3ZRKA 2BCJA 5HZNA 5LWMA 5M57A 4CT2A 4KWPA 4MF0A 3R9DA 3TDWA 3UE4A 3CPCA 3BPRA 4CEGA 1IAHA 2VWWA 4BRXA 3SGCA 4IX3A 4XLIA 3HV4A 2XKDA 1GZKA 3W10A 4E26A 2DYLA 1H26A 2GHLA 5I9YA 1NT2A 3DFCB 5ANDA 5BYYA 2UW8A 4BZDA 2PVMA 4MXAA 3R7IA 3UIMA 3MPMA 3SG9A 3ALNA 4PMTA 3MY5A 1NA7A 3PG3A 2HXLA 3GQLA 4J95A 5GNKA 4XV1A 4KINA 3M1SA 3QTRA 2WIHA 5HLWA 3WF6A 4MXCA 2R3IA 2J0JA 2BFXA 3FYKX 3MA6A 4FR4A 4E8AA 2VWBA 2BIYA 1H24A 3BHYA 3NEWA 5CSHA 2WTIA 3IONA 3BIZA 3IO7A 3PA5A 3U4UA 3Q4ZA 3NMUF 3ITZA 3Q4TA 3OCTA 2W1HA 2XB7A 3GVUA 4FEQA 4YSMA 4CKIA 1Q8YA 3NGAA 3T9TA 3NWWA 4QP4A 4RT7A 2GQRA 4QTCA 2PUPA 3H0ZA 4FVQA 4OAUC 4LM5A 3BE2A 3ZRMA 4BIBA 3DOGA 3E88A 4PL3A 4IBMA 4TNBA 3LXPA 5KBQA 2GU8A 2UW6A 4HGSA 5DGZA 3QTQA 2WU6A 5HG9A 5M4CA 3HUBA 3CCNA 3BV2A 5KZIA 4CFUA 4XH6A 3CY2A 3FL4A 3KMUA 4NFNA 3WYYA 4BTKA 2W17A 2VWXA 4GT3A 1OL6A 1YXTA 4YJRA 4YJPA 4YTHA 3V51A 5CEMA 4FV2A 2GTMA 3EQCA 3QQUA 1ZOGA 3O8UA 1FVVA 2F57A 3KXXA 3OT8A 4RWKA 2XK9A 2J90A 4M97A 3WARA 3WF8A 5AP2A 5IEVA 5JGAA 5CEIA 1WBPA 3ZBXA 3P08A 4WO5A 3VWAA 4ALWA 4XV9A 5JQ8A 3PVGA 4FEVA 3HVCA 5G6VA 1H0VA 3IOKA 3QA0A 4FICA 5I9XA 4IFCA 4GEOA 4RFMA 2PY3A 4KRCA 4QP6A 4AGUA 2VTAA 3HECA 2WKMA 3OFMA 3UOJA 3I0OA 3LFAA 5CSVA 4FTQA 4PL4A 2BDFA 1O6KA 2PVJA 3KF7A 5F94A 3BWFA 1Q24A 4W4YA 5JGDA 4WNKA 5D7VA 4E4LA 4J99A 3DKOA 4L52A 2AC5A 3TV6A 3LM5A 3WOWA 4JG6A 3HV5A 5B7VA 1JNKA 3B2WA 3FBVA 4RSSA 4A4XA 3EN6A 3QF9A 1TVOA 4ORKA 4LQMA 3A8XA 4RIWB 4I4FA 5EI6A 3ZO4A 5D41A 5HE0A 3ZFYA 1AD5A 4Z16A 3EL7A 4AFJA 4EOSA 1ZMWA 4MK0A 4IZ5A 3VS4A 2VZ6A 3CBLA 3N51A 4FT9A 4TYGA 5BMMA 3FMLA 5AUUA 4QNYA 3H4JA 3QZFA 2WZJA 3LXNA 4RIXA 5CAPA 1VYZA 4M69B 4RC2A 3K54A 3TKHA 3MPAA 3DDPA 3QRIA 3LMHA 1IAJA 3ORPA 3SW7A 2JKOA 1T46A 5KE0A 3ZUTA 1K9AA 4O83A 1YXVA 2OG8A 3EQFA 3P7AA 3FZRA 1TQMA 4PUZA 3DTWA 3BQRA 5BVEA 5FEQA 3HMIA 3BLRA 1Z57A 1YWRA 4PTCA 4S30A 4RWIA 4IM3A 1RJBA 5IQIA 2YIYA 4YPDA 1GNGA 4FZAB 4I24A 3R8LA 4FEXA 2F7XE 3GEQA 5EW8A 3Q5IA 2H9VA 3Q53A 1NW1A 2WMXA 5JK3A 3UOKA 5A54A 3LLAA 3QCSA 4W8DA 4YTFA 2WELA 3GC9A 5ACKA 2HAKA 4D4RA 1IG1A 4K18A 4BYJA 5KMJA 2GNLA 2IG7A 4NM0A 5HO7A 2ETMA 3QLFA 3VW6A 5M08A 4DH1A 4R8QA 1Q41A 2IVTA 4MAOA 5CY3A 1ZYSA 4D1ZA 4D2VA 2V7OA 3QRJA 2YEXA 4HCUA 5BVWA 4MF1A 3SG8A 4R3PA 4FKUA 3PWDA 4LOOA 5EI2A 4JS8A 4AP7A 4PY1A 4QMVA 1GZOA 1FPUA 5FBOA 4CFNA 4WNMA 2O5KA 4H3QA 3PLSA 5LVNA 4FSYA 2W96B 4XG4A 4YTCA 2BAKA 4C4FA 2Z02A 4R78A 3DY7A 4FT0A 4BVUA 2Y6OA 4R7IA 5JSMA 2G2FA 5E1EA 3QX4A 2XCHA 1REKA 1URCA 2UV2A 3LCTA 3AC1A 2KTYA 4EOKA 1KOAA 4PPAA 4EZ5A 4L44A 2Y0AA 2A0CX 3HV6A 2R3HA 4BI1A 4QTEA 1YHSA 3F66A 3V5LA 4PMSA 4FTMA 1IASA 1QCFA 3DJ5A 3NNWA 2XNNA 5HTBA 3LCDA 1X8BA 2UZWE 3BHTA 4U43A 4BDJA 1PXNA 3W2QA 4Q2AA 1H07A 1MRUA 3E93A 5AP3A 2ITVA 5HIDA 4ZY5A 3C5IA 4WT6A 3NCZA 1Q4LA 2OK1A 3GI3A 2P33A 2PVFA 3Q96A 5I3OA 5HE3A 3F5GA 4MBJA 4ANMA 4EYJA 4AS0A 3IDCA 4MTAA 1RW8A 2PZPA 5CZHA 4QMNA 4RBLA 5LXMA 2I0YA 1OKWA 3PJ3A 4FSNA 3PIXA 4RWLA 5CVGA 4AUAA 3EIDA 3VIDA 1OM1A 3MB6A 5F9EA 3MTFA 4GS6A 1SMHA 2R3QA 2R2PA 3F88A 3FLSA 3W2RA 3PY3A 4O6EA 3ZONA 1TKIA 4UZDA 3ERKA 3UVQA 1XHAA 3R9OA 4AA0A 4IHPA 3KFAA 3EFJA 2C1BA 4TWCA 5A4LA 3TUDA 1G8AA 5AV1A 4CRLA 1EH4A 4ASXA 5CAUA 5C8NA 1H1PA 2B7AA 3JXWA 5EM6A 1G8SA 3PRFA 3QUPA 5L4QA 4GUBA 1YXSA 4P4CA 1K2PA 5KMMA 3JVSA 1IA9A 4FTLA 3VUMA 5BVFA 4N6ZA 4DH5A 1U59A 3RHKA 4EZ7A 3EQPA 4DEHA 4U42A 4CMTA 4OUCA 2XNBA 3LCOA 5HU3A 3LKMA 2ZMDA 4I6FA 2PVLA 1KOBA 2G01A 3KK8A 1FBNA 3U55A 1H27A 1OECA 5IQBA 2CJMA 3L8XA 4JIKA 3VN9A 4RJ5A 2W7XA 1WBTA 3I7CA 4CZUA 3FI2A 1T45A 3ZCLA 4NM7A 1ZOEA 4FBXA 5KKRC 4QP1A 4V0GA 2PU8A 3ZUUA 3F2AA 4TPTA 3FMDA 1DM2A 4UB7A 3UZPA 3ZLYA 2YISA 5AX3A 2R7IA 4V05A 5LOHA 4J1RA 4MEDA 4CFMA 5JFVA 3R1SA 3EMGA 3JPVA 4C2VA 4DF3A 2CN5A 2P2HA 4W4WA 5EG3A 5FP5A 5HBHA 2YCSA 3NCGA 5M07A 3BBTB 3C0GA 3B8QA 4L3PA 4ACHA 4FKRA 3WZEA 5IU2A 3MFSA 4NM3A 2R0IA 3V04A 5LJJA 3FWQA 1HCKA 3IW7A 3K5UA 4AZVA 4LL5A 4WSQA 5E8SA 5A4QA 3VUDA 3U6HA 4QYHA 3EZRA 3GENA 5E90A 2J5FA 3H9RA 2WB8A 3TNWA 4QYFA 2Y4IB 3KK9A 4YO4A 4BWXA 4FEUA 3TNIA 3OBJA 4BCKA 3G15A 2P0CA 4ZZOA 2ZVAA 5T3QA 4LG4A 2I6LA 2QKRA 4AE6A 4ZMFA 3I79A 4YPSA 5KO1A 1H1SA 1WBOA 3OXIA 3TWJA 4JBPA 5K9IA 1ERKA 5EHOA 3ORXA 3C1XA 2IZUA 3FEGA 3DKGA 3EYGA 3C4WA 4D1XA 2OWBA 4QP2A 3TJCA 4ZEGA 4Q9SA 2PUUA 3P79A 3FI8A 1F5QA 3FDNA 1NVQA 2WTKB 3QAME 2XJ2A 3OWKA 5FGKA 1J7IA 2E9VA 4HVDA 2CLXA 2FSLX 3KGAA 1SZMA 3NRMA 4I21A 3DT1A 5EKOA 5LCJA 2CKOA 2RFSA 1NVRA 4FKLA 3AC8A 4GCJA 5JKGA 3VJOA 4KIOA 2BR1A 4BCMA 3RZFA 4E93A 3V5WA 3A61A 4XRJA 3A4PA 2FSTX 3COHA 4I41A 1R1WA 3SOCA 3UOHA 3MDYA 3H10A 5E8WA 1KV1A 2C69A 3GC7A 3SDJA 3UYSA 3ZO1A 3QCXA 5LARA 2QOFA 2HYYA 3GT8A 3O71A 3KQ7A 3RI1A 3MTLA 3MA3A 5T68A 3CS9A 3CP9A
chains in the Genus database with same CATH superfamily
1SNUA 4FRFA 4HZSA 4LV5A 2XAOA 5A4EA 3UZTA 2XYNA 2JFMA 4L67A 4U6RA 3RKBA 4FIIA 1H28A 4YZMA 1VR2A 4QMOA 3TXOA 4PRJA 3SVVA 3PJCA 2ZDUA 3IPHA 2X2LA 4EYMA 3Q6UA 1FQ1B 1G8KA 2YDJA 2CMWA 2XNEA 3DKCA 3PZHA 3H3CA 5AX9A 4EK6A 4KIPA 3BL9A 1DI9A 1E1VA 3EN9A 4JQ7A 2RG6A 4L7FA 3JY9A 1R78A 3CJGA 3DAKA 5HBEA 3KL8A 3OOMA 4QMWA 4WUAA 4AN9A 2W4KA 2YM8A 4JMQA 4Z7GA 3DS6A 4FL1A 1Q97A 2IJMA 3QHWA 4C35A 1XQZA 4BICA 3S95A 3C4FA 4X3FB 3TTJA 5GJGA 3NUPA 4BDBA 2YIRA 4XG7A 5GHVA 3A4OX 4DFUA 3MN3A 4J8MA 4NKSA 4BB4A 2NPQA 3R02A 4XV3A 4ANOA 4BCOA 1KWPA 1MQBA 2G9XA 3DPKA 3JYAA 2PK9A 3ACKA 4O0VA 4TWPA 2CDZA 4C34A 2FA2A 3EN5A 4YBJA 3LFNA 3OUNB 2WMUA 3TI1A 3FLQA 3CE3A 3RP9A 4DG3E 1OL2A 2WD1A 4NL0A 2P2IA 3FMEA 3R8MA 3ZDIA 1VZOA 4DGNA 2UW3A 4DITA 4S31A 3PY0A 4JLCA 3IDBA 3M11A 2X2MA 3CQWA 4BCIA 5DIAA 4RVKA 1GZNA 2JLDA 5FDXA 4FKVA 4AZTA 3NUXA 3FPMA 3TG1A 4DGMA 5EKNA 3S4QA 2WTJA 5D11A 4J52A 3UP7A 1OL1A 2CNVA 2DQ7X 2ZDTA 2V22A 5K4IA 1XKKA 3W0QA 2C6OA 3I5NA 2QQ7A 4FKGA 1W8CA 4YHJA 5F4NA 2BRGA 1I09A 2RL5A 2UUEA 3MBLA 4PX6A 4RVMA 3ID6C 4IAAA 4TZRA 3DAEA 2WQEA 4F70A 1J7UA 4DFYA 3MYGA 4YNEA 2PVRA 4J98A 1FGKA 4KIQA 4DHIB 1YKRA 4AZEA 2CGUA 1FVRA 3PXYA 4IE9A 3GCVA 2VGPA 2XIZA 3FHRA 5EK7A 4CZTA 3KMMA 4TYHB 3S00A 4EK3A 3HDNA 3PVBA 3SRVB 3A2CA 2YLFA 3VQHA 3A60A 3UGCA 4KIKB 2C6MA 3Q32A 2VTLA 2XK6A 5CF6A 5L2WA 3F2RA 4FTOA 4RQKA 4ZSLA 4O7ZA 5FUTA 4GFOA 5AIRA 4KBAA 3U6JA 4ENXA 3LZBA 1APME 5CVHA 2NRYA 4DEDA 3OVVA 3DXQA 2C6IA 5AUWA 2R7BA 2IVSA 5ANEA 5HTCA 3V6RA 5FRIA 4MYGA 4H05A 5KHWA 4XUFA 2ZYBA 2JKKA 4LDTA 3FKNA 5CTPA 5FXSA 4E4NA 4X2NA 1CTPE 1OIRA 4IVCA 2VO7A 4U79A 4F6UA 3E8EA 3L9NA 2WTCA 2X6EA 4PTEA 2YIWA 5CAVA 4E3CA 2XYUA 5CF4A 4TYIA 2XK4A 3G6HA 4L00A 4O22A 2HXQA 4ZTQA 2YA9A 4BCFA 3E63A 1W2CA 3QC9A 2OZAA 1YW2A 4AGDA 5HORA 3RZBA 2VO6A 5C4KA 5HLNA 3MPTA 3L9PA 4BCNA 2GQSA 3R9HA 4Y83A 4AAAA 4KD1A 5IG1A 4BI2A 5EW9A 5KBRA 1P14A 4HVHA 5IQCA 2PMIA 4X2JA 1OIUA 4F9CA 4IW0A 5DA3A 3HNGA 2YAAA 1GJOA 3OT3A 4JL9A 4RVLA 3AQVA 1VJYA 5IEXA 2OIDA 3H9OA 5EYKA 5HNBA 3FXZA 4RC3A 1KE7A 3NAXA 5EM7A 3R01A 2HW7A 3DFAA 4HNFA 4E5BA 2W99B 4DEAA 5AV4A 3KA0A 2H34A 4EH9A 4XOZA 3T8OA 4ZTRA 5M44A 3QD2B 1UKIA 4D2SA 3EQHA 3TCPA 4CTCA 2VGOA 1KE5A 3IKAA 2PUNA 3VBQA 4CZYB 4GJ3A 3DV3A 4X21A 4CKRA 5E8XA 5AAFA 4ZS0A 4MKCA 2J2IB 2P3GX 3QQFA 2F9GA 2YLEA 3DQXA 3FYJX 4S33A 3RK7A 2BTSA 3MSSA 4O0SA 3HEGA 4L3LA 3UG2A 3SD0A 5HX8A 2XANA 4DDGA 1XBAA 4UYNA 2XEYA 3LQ8A 4EJNA 4RA4A 1AGWA 4GT4A 3AT2A 2XM8A 3UO5A 4ZOGA 1L8TA 4XBUA 2R0UA 2WOTA 1UV5A 3SOAA 3N4UA 1GIJA 3MV5A 3C0HA 2XF0A 2VTRA 5DMZA 5CZIA 4M15A 3PTGA 3I4BA 1XH8A 4IH8A 5HCZA 3HP2A 2UZDA 5CF5A 3C4CA 1OITA 2IWIA 3R04A 4QMYA 1ST4A 4NIFB 3QD3A 2W5BA 3FLYA 3RALA 5H8EA 2XK8A 3KRLA 5EM5A 5HE2A 4QOXA 3HMPA 4ZLZA 3LLTA 3HZTA 1P5EA 4CV9A 5J1VA 3OCBA 2A98A 1ZZ2A 4S34A 5AV2A 3VBWA 4D28A 4UYAA 3OY3A 4E6AA 3D7TB 2UW4A 1PY5A 2C0IA 2W5HA 5HG8A 2XEZA 3LW0A 3F3TA 1WVYA 3P7BA 5KMOA 3CJFA 3ORKA 4JI9A 3LQ3A 4QD6A 3AT4A 2HWPA 4PL5A 3DA6A 4TYEA 4E7WA 4EC9A 3KIOC 4GFGA 4OTGA 4NTTA 2VNWA 4YZ9A 2J0KA 1YDSE 4I5MA 4FEWA 1GY3A 2X2KA 5DWRA 4E1ZA 1QPJA 3OZ6A 2BAQA 2E9OA 4J71A 3SW4A 5JQ5A 4WD5A 5H8BA 4AQCA 4MXOA 2QO2A 2YABA 4S32A 4D2TA 1PYEA 2QO7A 5A4TA 4IAFA 3W0OA 3UC3A 5BVOA 3HV3A 3VBVA 3ZXTA 3LHJA 3DCVA 3EFWA 4AT5A 4DCEA 1YWVA 1WBWA 4O4DA 2JDTA 2JD5A 4HGLA 3RPSA 2W1CA 2NP8A 1W83A 4UMTA 4FNZA 4Y85A 2NO3A 2WPAA 3W33A 5L8LA 3Q4CA 4QTDA 2GQGA 4FTKA 4ZMEA 4EEVA 3AXWA 4PF4A 4APCA 1ND4A 4OTIA 5I9UA 3VS7A 4A4LA 3PJ2A 4EKLA 5C26A 3BELA 4DG0E 5M51A 4Y5QA 4JAIA 4P7EA 5I5ZA 3AG9A 4A06A 4ZTSA 1PMVA 4JX3A 2XK7A 2KULA 1REJA 2IZRA 3NW6A 5C03A 2R4BA 2R3LA 3KN5A 4IB3A 1E1XA 4ALVA 4BFMA 5LWNA 4IJPA 2OF2A 5DE2A 5JRSA 3WBLA 4KSPA 3S2PA 4U0IA 5IA5A 1OI9A 2CGWA 4I1ZA 5FWKK 5HG5A 4MD9E 1XJDA 4DHFA 3UDBA 2BFYA 2XH5A 4DA5A 2X8DA 4EONA 4EQMA 3V5JA 3VHEA 5FBNC 2PMNX 4AN2A 2W1IA 3GU7A 4IX4A 1Q8TA 3ZEWA 4BCGA 4ZAUA 2PVYA 3WE8A 3I7BA 4IACA 3V5PA 1R39A 1VEBA 2WEIA 3CXWA 3GOPA 2IVVA 2VWUA 1A9UA 4F1MA 2PZYA 4F09A 3UIXA 3NUNA 3UDSA 3OWJA 1YWNA 2Y8OA 2NNWB 3HMNA 4FTIA 4FT5A 2VTTA 4CKJA 4L6QA 4F1TA 1UKHA 4YJTA 3WF7A 5H2UA 2YIXA 2UZOA 5EI8A 2B9IA 5CT7A 1R0PA 2ITNA 3AGLA 3EOCA 4TWOA 3AGMA 5HE1A 3R9RA 2FB8A 4KKGA 4Y5HA 4KKEA 3CGFA 3I6WA 3W16A 5A14A 4U41A 3O8TA 3K5VA 4X6QC 3VS5A 2EUFB 2OGVA 2Z7QA 3FC2A 4BZNA 2X81A 5EQYA 3ZLSA 3GQIA 1M2QA 5E8YA 3TZ8A 1YDTE 2XS0A 3MJ2A 2QOQA 3GB2A 4RC4A 4FC0A 1BL7A 5CS6A 4U5JA 5FG8A 4C4IA 5I9VA 4FKPA 4XP3A 3TKUA 3TL8A 2VTIA 3QGWA 4W4XA 5ACBC 3ZXZA 4ANNA 2ITYA 5FEDA 2XKEA 4XP0A 1YHVA 3F5PA 2B55A 3R30A 4AXCA 3BHHA 4IAKA 4NW5A 4IM0A 4FG9A 5DR9A 1OKVA 2G2IA 1I44A 1KE6A 5JEBA 3R22A 2I40A 3F9NA 2YAKA 5LMKA 2ZV9A 1ZY4A 2XKFA 4TYJA 4AW0A 4EZ3A 2JDVA 3ANQA 4XG8A 5CANA 3OD6X 5L8JA 3P5KA 1KUTA 4BYIA 4UN0C 3NLBA 4WBOA 4JX7A 2PTKA 5C01A 2CKQA 3TN8A 1YI4A 4CVAA 5DYJA 1ZYDA 4IIRA 3KF4A 3PXFA 4WRGA 4Y95A 3RMFA 2OJIA 4ITJA 2J4ZA 3Q9XA 3TUCA 3HRCA 2VTJA 4O0RA 4FMQA 2OI4X 2PSQA 5G1XA 4L7SA 5TF9A 3RCDA 4RWJA 1LEWA 1WFCA 2WU7A 4EHEA 1SVHA 3A8WA 3OP5A 5AP6A 4F9YA 4J96A 1QPCA 3KEXA 3FZTA 1YXXA 3OS3A 4F1OA 5IUHA 3FI4A 4G3FA 4XYFA 3NVKI 4IWPA 1F0QA 4ZSEA 2EXMA 4I6HA 4JT3A 4TY1A 5C1QB 3GBZA 2VTHA 4QTBA 1KSWA 1W82A 1H4LA 5CAOA 2OLCA 4MNFA 1YVJA 3QZHA 3EQGA 2IPXA 1PXJA 2R3OA 4GU9A 4U3YA 3MJ1A 2NRUA 5CEPA 4IWOA 3BLHA 4O4BB 5HICA 3RK9A 2R3MA 3FI3A 3LFSA 4KNBA 4F7LA 1OBDA 5HO8A 4OTWA 1STCE 3FMKA 4LRKA 3QFVA 2Z2WA 1M52A 4DEGA 2XRUA 3A7GA 2HOGA 3EQIA 5BUIA 5HU9A 5AR7A 4PDYA 5EQPA 4UMRA 2IW9A 2ZMCA 3TT0A 3FE3A 4ZY4A 3COIA 5E1SA 4Y72A 3E92A 3QQKA 4FKTA 5J9ZA 2YM5A 2VAGA 4N6YA 5AR4A 5KMLA 4ENYA 2WMVA 3F5XA 2CGVA 4GVJA 5CSXA 3QYZA 4FKOA 3GFEA 2BMCA 3M2WA 1SM2A 5FXRA 2XM9A 4F99A 4L45A 1LPUA 4FNYA 4TXCA 4D2WA 4X2GA 3UYTA 4CFWA 5I9WA 3F7ZA 2W1ZA 5ITAA 3QL8A 4F08A 1J1CA 4ANQA 3LMIA 3HUCA 2EU9A 2RF9A 3GU8A 1J91A 2J5EA 3C7QA 2HZ0A 3KRRA 5EHYA 2WEVA 3Q5ZA 3RAHA 4L46A 4LYNA 2WMWA 3FQSA 2H8HA 1PMUA 2BHHA 3D5WA 4FKQA 3R2YA 5FM2A 1YDRE 1BUHA 3MVMA 3LJ0A 5A6NA 2EB3A 4M68A 1P4FA 3UMXA 2DWBA 4D9TA 4OR5A 4C58A 3HP5A 5HKMA 4YJNA 4ZP5A 4L9IA 2P4IA 4MNEA 3FAAA 4GVAA 3EFLA 3MIAA 4F0GA 4I22A 5ANGA 5K4JA 3PUPA 3TKIA 2OSCA 4RIYB 4YJOA 3ZO3A 3QCYA 3C4ZA 4TNDA 3FXWA 4BGHA 4D5KA 4IZAA 3SXRA 1UU3A 3EH9A 1Q3WA 4CRSA 4QMXA 4DH3A 2UVXA 4DHJA 3EL8A 5IKWA 5EDRA 3V8TA 4R7BA 3GOKA 2YERA 3OF0A 1UA2A 5AP7A 4NEUA 4EH6A 4JDKA 3SLSA 1LUFA 3DK7A 3GGFA 3FZSA 3PJ1A 4DDIA 3BHVA 3HRFA 4G1WA 5ANIA 2PE1A 2E9PA 3U87A 2UVYA 3UIUA 2F4JA 4KABA 4XV2A 1U54B 3ZSIA 3CLYA 5JZJA 2W1EA 2YIQA 3C5UA 3AT3A 3EKKA 1ZYJA 2Y9QA 3A99A 2LAVA 4BGGA 2VX0A 4QP9A 1KE8A 3II5A 4IXPA 1BL6A 4FOCA 4MBLA 4ZZMA 1JWHA 2XBAA 4BC6A 5E4HA 2UZEA 4RRVA 2PZIA 2XUUA 4XP2A 3SXFA 4PQNA 4OTRA 3KULB 3WZUA 4R7HA 4QDEA 3O7LD 3R73A 2Z60A 2GFCA 3DTCA 5M06A 4Y8DA 4C36A 4A9TA 2PE0A 2J51A 4FKIA 4AG8A 3SA0A 3W8LA 4YLJA 4RX8A 5C4LA 3D0EA 3F3UA 4QP8A 4XG9A 3RGFA 3KN6A 5IDNA 2X4FA 4PNKA 2C4GA 4WUNA 1UNGA 2FVDA 4ZSJA 4DT9A 3DZQA 4QMPA 1P2AA 4W9XA 3LCSA 4FTAA 5IPJA 4GKHA 2XJ0A 3G2FA 3G33A 1Q8WA 4ANBA 4YURA 3CQEA 3D94A 5CLPA 3VUHA 1OVEA 4CCUA 3HX4A 3ORMA 3Q9YA 3QA8A 5J7BA 3Q3BA 4ERWA 4C3PA 2C5YA 2HZIA 4GW8A 4PWNA 3G0FA 2QCSA 1GIIA 4EH3A 2PMOX 2BILB 2C0OA 4P5ZA 3QD4A 3ZC5A 3UBDA 3FKLA 3GU6A 3REPA 4QYYA 5ETIA 2GNHA 3VRZA 4J97A 3DBCA 4C57A 1CMKE 1A06A 2QD9A 3F6XA 4KRDA 4AOIA 4UALA 4GFMA 3VO3A 3TMOA 5L2QA 5JFSA 4Q5HA 2P55A 3Q60A 4O1PA 1DI8A 5AAGA 2WMRA 1SVEA 3D14A 5CQWA 4F7JA 4UWCA 4NJDA 3ENHA 2XNGA 3QTXA 2XMYA 4G6LA 2VTSA 2W1GA 4BWKA 4F63A 2EXEA 4YU2A 1G3NA 5E9EA 3PLAE 3ZZEA 4CLJA 3MESA 1J7LA 5IH6A 4ZK5A 4I20A 3QTIA 4TT7A 4F64A 4O0YA 4O91A 2WO6A 1BYGA 4BIEA 3PP1A 4O84A 4RMZA 1H01A 3NNUA 1OL5A 4U45A 2VO3A 4N70A 1MQ4A 2BRBA 3GNIB 3ZM4A 3UNKA 4JJRA 2OIQA 1U4DA 2VTMA 4EOMA 4XBRA 3EWHA 1YI6A 4BN1A 4IAYA 2O3PA 4CTBA 2J6MA 4QP7A 4XEYA 5BVDA 5L6PA 1PMEA 2Y4PA 3POOA 5GINE 5D9HA 3UQFA 4CMOA 3LFEA 4IX5A 4TTHB 4XNEA 4BY9E 1H0WA 3Q52A 1CKPA 4DBNA 4BKJA 5CEQA 3KRWA 3A7IA 1QPDA 4DINA 3BBWA 3VJNA 3UIBA 3W0SA 2XKCA 3AD4A 4ZJVA 5E8TA 5HG7A 3I1AA 5E8ZA 3AD5A 1PKDA 2ZOQA 3HDMA 4RJ6A 2QVSE 5HHWA 3VW8A 4GUEA 4DFZE 3NUAA 4NZWB 3MH0A 4IVDA 3A7FA 2RIOA 4O7RA 3BEGA 4PPCA 3RK5A 5AR2A 5L8KA 2C47A 5LVOA 4ALUA 4FG7A 4FIHA 3TUBA 2IEWA 3PDTA 3R1YA 3Q2JA 4MBIA 4F7SA 4GV1A 4P5QA 4ZTHA 5K3YA 2C6DA 2YJSA 3LXKA 3U54A 1YXUA 4TN6A 3MH1A 3F2NA 4F9WA 4BKYA 3ORTA 3QXPA 4NKAA 4B0GA 3DB8A 4USFA 1M2PA 3ZU7A 3SAYA 3LXLA 2ZM3A 4ZSGA 1H08A 2YHVA 2Z7RA 4OTHA 3QTWA 3CD8A 3QALE 5DVRA 3LE6A 3SHEA 2XNMA 2ERZE 4F0FA 2AEGA 2BVAA 4IAZA 4RZVA 3R8ZA 4JVGA 5EOLA 5CX9A 2IO6A 4JBQA 1ZLTA 1RQQA 3WZKA 1MUOA 2GS2A 4DGLC 2UZNA 2PVHA 2O2UA 4NJ3A 5J8IA 3R7EA 3NPCA 4UWYA 4FIGA 5TOZA 4O7SA 1YI3A 4W8EA 2QLUA 4WHZA 5DT4A 5BMSA 4JNWA 2OZOA 3OG7A 2JDOA 3UQGA 1FINA 3BLAA 1AQ1A 2PZRA 1WBSA 2A2AA 2JKQA 1JQHA 2LGCA 3FZOA 2V0DA 3BHUA 4NCTA 5LVMA 4PDPA 1OGUA 5L2IA 2X8EA 1BX6A 4D4VA 1OL7A 2B53A 4NCTC 4EOIA 4CGAA 3ALOA 1Q62A 4JAJA 3UOLA 4BDDA 2REIA 3QHRA 2OKRA 4RX7A 4NT4A 1BMKA 1KV2A 2ITUA 4DHZA 4WOVA 4DH8A 4GG7A 3NX8A 4QTAA 3EN7A 5AUVA 3IGOA 4F9AA 2C3JA 3QTZA 2WQMA 4IZYA 4MXZA 3GXLA 3EYHA 3RAWA 2B9HA 4QMUA 4FSQA 4FSWA 3W32A 5TKDA 1XWSA 5CAQA 1PW2A 3O5AA 2HCKA 3PA4A 2PL0A 2J0MB 5KHXA 3PYYA 1P4OA 4RG0A 5LVLA 2BZIB 4ACGA 3TDVA 1QPEA 2Y6MA 3TV4A 4QPSA 4DC2A 2R3KA 2VU3A 2W1FA 2YCFA 2AQXA 4GMYA 5TR6A 4YLKA 2R3RA 4LV8A 3NYXA 5E91A 5HLPA 5HO6A 3RWQA 3RPRA 3T3VA 5FDPA 5HNIX 3LFDA 4C4EA 2GHGA 3PJ8A 5GZ8A 2YJRA 3G90X 4S2ZA 3PFQA 4MXXA 4V04A 3RM6A 4ZTMA 1L3RE 2VN9A 4K0YA 2XNPA 4EKKA 4KS8A 4GK4A 3D4QA 4FKSA 4TRLA 4O96A 5FP6A 5M4IA 4ZTLA 2F7ZE 4O7TA 1JKSA 3EKNA 3R63A 4AZWA 4FZFB 2IF8A 3DNEA 3W0NA 4EHGA 4XCUA 4DGGA 5J79A 2GNFA 4JR7A 2C5OA 2UW9A 4C7TA 3PXQA 3ZMMA 3R7OA 3O50A 4ASDA 3NYOA 5IA4A 3R7UA 4PNIA 5A4CA 3HMMA 1H1WA 1UNHA 2QOLA 3Q6WA 4MQ2A 4CLIA 3HLLA 3TM0A 2JEDA 2UW0A 4AT4A 4H58A 4KS7A 4FV1A 5DN3A 4EOJA 5JMSA 5IQHA 2VWYA 3UNZA 4H3PA 2I7QA 3NAYA 4M13A 4RIXB 2X1NA 5J87A 5A46A 1LP4A 4Z55A 2AC3A 4PMPA 4QQ5A 1QMZA 4HYSA 3GU5A 3TNQB 4M0ZA 4XHKB 4CYIA 2Y7JA 3G0EA 3KXHA 2B54A 1YRPA 1ZXEA 4QQJA 3RVGA 2I1MA 4F9BA 3ODYX 2J50A 5I0BA 2VX1A 1V0PA 1O6LA 2YM7A 4AU8A 2C6KA 4APPA 2C3KA 4RIWA 5KZ0A 2ONLA 1PRYA 3C4XA 4BKZA 4YHFA 4TKSA 3B8RA 4FE2A 5IA0A 2ONLC 4ZLYA 4HCVA 3VQUA 3OEZA 5IA2A 1JPAA 4IQ6A 1JVPP 4QMMA 3BQCA 4FGBA 5BNJA 4M69A 1WMKA 3Q04A 4ZY6A 3KCKA 3G5DA 2UZVA 4ZJJA 4USDA 5AP1A 2WXVA 4HVGA 3RINA 2GPHA 1WCCA 4AW1A 3BX5A 3VS2A 4UXLA 5AP4A 3VHKA 5CXZA 2WAJA 3SV0A 1PXLA 4IC7A 2IW6A 3ODZX 1CDKA 1Q5KA 2QU5A 4CG8A 4AGCA 3GC0A 1XH5A 4UY9A 1GAGA 4O4FA 3GCUA 4FIEA 4PTGA 4FNXA 4K77A 4YO6A 4YUQA 2Q0NA 3R83A 2ITQA 2CN8A 3E64A 4AT3A 4KAOA 4E4XA 3IW8A 3O17A 4QMZA 2FUMA 2OF4A 4FT3A 2W05A 3DK3A 3IDPA 2ZJWA 1Y91A 2A19B 4GL9A 4O2ZA 2HY0A 3QC4A 4PMMA 5CI6A 5CU2A 4FK3A 5TT7A 2FSMX 4G34A 5K0KA 3VULA 3VUGA 4FV4A 5DT0A 5ETCA 4HVSA 5HGIA 3EN4A 2F7EE 3MY1A 1WBNA 4FT7A 3RPVA 2XIRA 1O9UA 3LPBA 4MXYA 1BI8A 1M14A 4ZXTA 2X8IA 5KNJA 3PVWA 3OWPA 3SQQA 5M56A 3NYVA 4FGRA 1ZY5A 2F2UA 5CU6A 3VUKA 4O1OA 5CALA 3NUSA 3F3VA 2W9FB 3MI9A 5AM7A 4ERKA 3NW7A 2HY81 2X7GA 4ITHA 4N57A 3V6SA 4ZJIA 1Y8YA 4FL2A 3B2TA 4DAWA 3TEIA 3HYHA 5GIPE 2QHMA 4YMJA 5BYZA 3ULZA 1H1QA 3KXMA 3GP0A 3WYXA 3PXKA 4YJQA 3RHXA 3CGOA 3K3IA 2QOOA 4D2RA 2B4SB 3VC4A 4BZOA 4LV7A 4HOKA 5DG5A 4DH7A 2B9FA 4GT5A 3FY0A 4QRCA 4IB0A 4O2PA 3U4WA 5ANJA 4ZZNA 4ASEA 2ZM4A 3EQBA 3JUHA 5AMNA 4YC3A 4U9AA 4BJJA 4WIHA 5IUIA 4ZS4A 4GSBA 3W2OA 3PG1A 4AWIA 5IQGA 1OKZA 4FX3A 3WIKA 5JFXA 3U9CA 1ZAOA 3V8SA 4HYHA 4FV7A 3FL5A 5AUTA 3W2CA 4MX9A 5AR3A 4ACMA 2YCRA 4EQUA 5B2KA 4B7TA 3DBFA 5JT2A 5LMBA 5CASA 5IISA 4IVAA 4B9DA 3JVRA 4RJ7A 2GMXA 1OKYA 1M7NA 4BCQA 3QLGA 4E20A 2YDKA 1XH9A 4KSQA 4LRMA 3R8UA 1H1RA 3A7HA 3DJ7A 4OBQA 4X2FA 4BTFA 2FSOX 2EXCX 5A3XA 4O82A 5F20A 4AW2A 4J7BA 1UWHA 2F2CB 4BI0A 4DLIA 4H36A 2VTOA 3NIEA 3C13A 4K33A 4UWBA 1W98A 4BCJA 2W4JA 3OBGA 3AMBA 2BALA 3VAPA 4ACDA 3NZ0A 2AUHA 5HEZA 5LMAA 4DTAA 3AC5A 3UO4A 3F3WA 2C6EA 4FTNA 3WF5A 3TYKA 1UWJA 2BRNA 4FF8A 4U44A 3WILA 1G5SA 3EQRA 4D4SA 4IZ7A 3W0RA 3ZUVA 5E92A 5KKRB 4O38A 1OB3A 3WI6A 4C33A 2J0IA 5KUPA 3TZ7A 3GUBA 4QEBA 3OUKA 1JKTA 3OWLA 4V0GB 1OUYA 3LQ5A 4RJ8A 2QLQA 3BZ3A 4EBVA 3R1NA 4BDCA 4OW8A 4PPBA 4A4OA 4U80A 4C3RA 4H1MA 4YZNA 3H0YA 3E3BX 5EDPA 3FMNA 3OC1A 3UO6A 4C0TA 4B99A 3UPZA 4IC8A 5HIEA 4A9RA 3L8PA 3FZPA 4D0XA 3OXTA 4IEBA 1OPKA 3R7GA 2AYPA 4AXEA 3NDMA 4YTIA 3ATSA 5EYDA 3QRKA 3QQHA 1FMOE 3CTHA 4D9UA 4IADA 2WTVA 4R3RA 3O23A 4OBPA 3ZRLA 2OH4A 2GS6A 5CNNA 3NNVA 2OO8X 4OTFA 4NM5A 3FQEA 4RGJA 3OXZA 2I0EA 2PZ5A 2BHEA 2QONA 4NYEA 4FTRA 3JY0A 1JBPE 4LMNA 4ZIMA 4DEBA 2VWVA 4M67A 5HTIA 2IZSA 1BKXA 2BRHA 3UP2A 1U5QA 3MGYA 5EQEA 4I23A 3V01A 3FMHA 5DH3A 3OY1A 5FXQA 3HGKA 2Q0BA 2UZBA 4G3EA 3P4KA 5HIBA 4FIFA 3CC6A 2JIUA 2BKZA 4DG2E 2XVDA 2JKMA 3S3IA 2OXYA 1ST0A 3QD0A 4JDIA 4D1SA 4IDTA 1RDQE 1PJKA 1Q61A 4U8ZA 2DS1A 2ETKA 2GNIA 4BBMA 4BTJA 1DS5A 2OXDA 4YZDA 4UZHA 4NH1A 1MP8A 1W0XC 3KKVA 1YOMA 3D5XA 4LGGA 4EOQA 1CSNA 2YM3A 4ZSAA 4FSRA 3I6UA 4GIIA 4LRJA 4O0XA 4HPTE 2BZHB 4HZRA 2UW7A 4MQ1A 3NIZA 4DTBA 2B1PA 2JDSA 4GK2A 4PV0A 1GOLA 3G51A 2FYSA 4HJOA 4QO9A 2FGIA 5CEOA 5JRQA 4MD8E 4EOOA 2RFNA 3SC1A 4ARKA 2B0QA 1Y8GA 3FLZA 3CKXA 1XMLA 1O6YA 1J1BA 2W06A 1YOLA 2BTRA 2BROA 2QOHA 3DLZA 3G9NA 2X4ZA 4BBFA 4HVIA 5BUEA 3VRYA 4A9SA 3UC4A 2J7TA 1WAKA 4AOJA 3O0GA 5D10A 2X0GA 2WTKC 3KXZA 3BV3A 5DEWA 3RWPA 4ANLA 4K6ZA 3UG1A 3ORLA 2PMLX 5HVYA 3MWUA 4RJ4A 4CQGA 2IVUA 3OHTA 5BYLA 4G31A 1JKLA 2BDWA 3PE1A 2R3NA 3VUTA 3W2PA 4EOPA 4NUSA 2WFYA 3LMGA 2WTDA 3TZ9A 3DAJA 2XJ1A 2R3FA 1CKIA 2OU7A 3FKOA 3OCSA 4MWIA 3KMWA 5GZ9A 4FTCA 5IEYA 5C8KA 3VS6A 3U6IA 1B38A 5AR5A 4RFZA 3O51A 3QQLA 5AUYA 3BYVA 3H9FA 4FTTA 2GCDA 4FG8A 3R9NA 1FMKA 3E7OA 5LMKC 5EW3A 4QQCA 3BGQA 3ZO2A 3R8PA 4A07A 3U9NA 3BE9A 4OAVB 2QOCA 3TIYA 2A1AB 5TO8A 4EHVA 4EHZA 3UVPA 5J5TA 3RAKA 3LIJA 5M55A 4K11A 1PF8A 4XS2A