5FEEA

Egfr kinase domain t790m mutant in complex with a covalent aminobenzimidazole inhibitor.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
322
structure length
287
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSTVYKGLWIPEGEKVKIPVAIKESPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDEMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Epidermal growth factor receptor
publication title Discovery of (R,E)-N-(7-Chloro-1-(1-[4-(dimethylamino)but-2-enoyl]azepan-3-yl)-1H-benzo[d]imidazol-2-yl)-2-methylisonicotinamide (EGF816), a Novel, Potent, and WT Sparing Covalent Inhibitor of Oncogenic (L858R, ex19del) and Resistant (T790M) EGFR Mutants for the Treatment of EGFR Mutant Non-Small-Cell Lung Cancers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 89
structure length 287
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5feeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5feeA01
3PG3A 4BF2A 4WO5A 5HE2A 3ZLSA 3C13A 2R3KA 3H0YA 1JSVA 3DQWA 4E6AA 1GZNA 3NRMA 2C30A 3O8PA 5HU3A 2YIQA 3DDQA 3UMWA 4DEEA 4EEVA 3G2FA 2Z2WA 4CRSA 1YHWA 2QKRA 3GNIB 3K2LA 3UYTA 3VS5A 2PMLX 3EN5A 3OXTA 1Z57A 3BHUA 4EC9A 2YJSA 2ZMCA 2ITPA 3PP0A 5M06A 3FMHA 2X8EA 4GK3A 5KKRC 1WBOA 3RTPA 4FTRA 4GFMA 4FSQA 4R1VA 4HVGA 2WU6A 5CF5A 5IEVA 2PYWA 3LFAA 4HYIA 5HX8A 4D1SA 3PSDA 4JX3A 3L9NA 3QZGA 3D7ZA 2XRWA 1URWA 1JSTA 3VVHA 3UDBA 2YM4A 1IRKA 4BDBA 4O7LA 1UV5A 4U45A 5DG5A 3R9HA 4CT2A 3D14A 3NEWA 4EZ3A 2WTCA 4DBXA 3HMPA 3RPOA 3KY2A 2O2UA 3GC9A 3GU5A 3OWPA 2J50A 3DKCA 3O2MA 4C2VA 4BBFA 1YI4A 4FG9A 1PKGA 4I24A 3VQUA 4DG3E 5IA4A 5E8SA 1T45A 3POZA 4DLJA 2V0DA 1Q24A 3ZOSA 4AG8A 3AC3A 4RJ6A 5AV1A 2QOQA 2OJFE 4UMQA 3VS1A 3ZBFA 5HBEA 2WGJA 5AP5A 3F9NA 3BWJA 4E20A 2HWOA 2Q0NA 3QL8A 3FKNA 4KKEA 4EOPA 1OBDA 1CKJA 1P4FA 3FMKA 3KMWA 3CJGA 2X7FA 4FT5A 2W1IA 4IZYA 4FKRA 3NUPA 3PA4A 3F2RA 4JG6A 5F4NA 4EBWA 4D2VA 3LFQA 5HQ0A 1MRUA 4GIHA 4O0WA 4W9WA 5CQWA 4FIGA 5HHWA 3U9NA 3VUHA 3GOKA 5CAOA 3JR1A 3LFNA 3QD4A 4GS6A 1OM1A 4FTCA 4U3YA 1O6LA 4EJNA 4G3GA 5H8EA 5D11A 5CNNA 2BPMA 3EH9A 4QP7A 4DEIA 3QA0A 4ZLZA 1JKKA 3PVBA 5HD7A 1W83A 3MY0A 3W2OA 3SD0A 2C3IB 2CGVA 2WTKC 3QXOA 4ZAUA 4K6ZA 4HYSA 3FE3A 4YBJA 2O0UA 1O6YA 3LQ5A 2GHGA 4QQCA 4ZJJA 4USDA 5GIOE 2YERA 3ZSGA 5F1ZA 4O96A 4YGAA 3EOCA 3PUPA 2VUWA 3G5DA 4DG0E 4FTKA 2Z7LA 3RPVA 2P33A 4ZS0A 3W1FA 3FMDA 1WVXA 1UNGA 3HLLA 4GVJA 4FTLA 4C4IA 3G90X 4RIYB 4O21A 4O6LA 4A4OA 3UGCA 4F1TA 4FV7A 2WMXA 5AUXA 3FMJA 4TYHA 4F7LA 3WF7A 2ONLA 2QOIA 3OVVA 2SRCA 2PVHA 2A2AA 4BBEA 2R3IA 2VWYA 4XG7A 2GU8A 4RIWA 4FODA 4F7NA 4PNKA 5CNOA 5TKDA 1ZXEA 3MJ1A 1OMWA 4PMTA 5HCZA 2HAKA 4O22A 1Q97A 5TR6A 4GEOA 4EOQA 5HGIA 2AC5A 2YN8A 3IONA 4IE9A 3IW7A 1OL1A 1IAHA 3W8LA 1L3RE 2C6IA 1E1XA 2UW5A 3R63A 5M4FA 4RBLA 3KFAA 3F5GA 4QTCA 3EL7A 2QO2A 3FY2A 3I6WA 4YURA 4G9RA 3DFAA 5EYMA 3CTHA 5KMLA 1OI9A 3LKMA 5FP5A 2GSFA 2W17A 4FT0A 1M7NA 3BHVA 2VO7A 2G1TA 2QQ7A 2YM6A 3F2NA 3NIZA 4XJ0A 1NVSA 3R9NA 4IDTA 4AOIA 3QAME 4GG7A 2GNFA 4QD6A 3GENA 4RFMA 4KIKB 3ZC6A 5HNIX 3HUBA 5EH0A 4YZBA 5EW3A 4XG2A 4DFBA 3TDWA 4D1XA 3Q4ZA 1P4OA 3VHKA 4GU6A 2PMIA 4J71A 4PL5A 5FP6A 3ZUUA 3LXKA 5AV3A 5BMMA 3VHEA 4F09A 2UZVA 3JVRA 3KEXA 1YWRA 4MVFA 1PXNA 4IAYA 4R5SA 4LFIA 5DN3A 4APPA 4DTKA 4JQ8A 3KK8A 3GVUA 4LYNA 4O7SA 1JNKA 4L45A 4P5QA 3HV7A 4V01A 3UNJA 4EOIA 1ATPE 5M51A 4YJOA 5CSWA 2CN8A 3OF0A 3TKUA 1DM2A 3R22A 3R7UA 4LMUA 3ROYA 3UO4A 4R77A 3BQRA 3TNWA 5DRDA 1Q41A 1XKKA 4L01A 2YZAA 2UW6A 2YIRA 4FTOA 4NWMA 3ZFMA 3C0IA 4CMTA 1WFCA 2X9FA 4BCHA 1OUYA 5JGDA 5L8KA 5GINE 2WTWA 2C6LA 3VUTA 4GUEA 4GIIA 4TRLA 1ZZLA 5BVEA 2HYYA 4XV3A 2WD1A 3VBQA 4YZ9A 3KXGA 5ANEA 4O86A 4B6LA 4IB3A 5E1EA 1W7HA 4Q5EA 4PP9A 4GG5A 2YLFA 3FLSA 4BWPA 4F0FA 4UN0C 2BZIB 4DF3A 5FXQA 4XG4A 3GC7A 3ZU7A 5H2UA 4FTQA 3PZEA 2Z60A 4C0TA 2WU7A 1H4LA 2J5FA 3N4UA 3JYAA 3NDMA 2HY81 2VWUA 3GU7A 4G17A 4HCUA 4LV8A 4BZDA 5D10A 3KVXA 1XBCA 2X81A 5IPJA 1E1VA 3E63A 5L4QA 3RVGA 3ZYAA 5K4JA 4LUEA 2GNIA 3GQIA 4TYJA 5KE0A 1PXKA 1XH4A 3K5VA 4MXYA 5HG7A 3E62A 3FZSA 3UVPA 4R3CA 4AAAA 4EH4A 4CLJA 4XOYA 5LMKA 3EZVA 2VTAA 5C8KA 3IOPA 2QLUA 2W06A 2HZ4A 3KMUA 4I21A 3R8UA 1YKRA 2R5TA 3L8SA 3FPQA 3ORIA 3LMGA 4L44A 2W1ZA 3RNYA 4GSBA 3E87A 3ZO4A 3KL8A 4F9YA 2VZ6A 4APCA 3P08A 2C3LA 5JRQA 3O7LB 4ARKA 2ZV9A 5AV4A 3DXQA 3FL4A 3JVSA 1XH6A 4FIHA 3BBWA 4W4XA 4NUSA 3L9PA 1NY3A 4C61A 4CYIA 1LP4A 4DEDA 3H3CA 3BHHA 3NUAA 3RKBA 4ASZA 2W9FB 4TYGA 4YO6A 4E93A 5E9EA 1MRVA 4WNMA 1TVOA 3R2BA 2WTIA 5CSXA 1CKPA 5EYCA 2XKDA 5BUEA 1ZOEA 5CEKA 5FUTA 2HW6A 5EDPA 4IVDA 4UB7A 4Y83A 3TIYA 4QQTA 3UOKA 5F94A 3ULZA 4YR8A 4FTJA 3I60A 4DFLA 4H3PA 5HO6A 4O7RA 4A9TA 3R02A 2B52A 3DBDA 3QRKA 3OXIA 3R1SA 3TL8A 4BVUA 3RAHA 2VWWA 4DITA 4UYNA 4GUBA 3H9FA 4XLVA 4F6WA 3IECA 5A4TA 4XG3A 4LRKA 2IZTA 5IEXA 4N57A 3A7GA 3QD2B 2YWVA 3TM0A 5HIBA 4HGTA 3C7QA 4IQ6A 3NSZA 5H8GA 4AQCA 4DCEA 4BCGA 3NCZA 2BRNA 2WEIA 2WPAA 5CU6A 2XB7A 3PPZA 4JL9A 1BX6A 2UZTA 3MVHA 1JKLA 2X2MA 3FQHA 4AFEA 3IW6A 2GNJA 4WNKA 5HNBA 5L6WL 3R7EA 2R0UA 3P78A 4JDJA 2W5AA 3LE6A 4ALVA 5J79A 2BRMA 3DKGA 1KUTA 4FSNA 4ZMEA 4CQEA 5HIEA 3VRYA 1PJKA 1XJDA 2GMXA 1DAYA 3NWWA 3PXZA 4O7NA 4QMPA 3WZJA 1MRYA 3QQKA 4IADA 4RT7A 5AP1A 5FEQA 2W1EA 2NRYA 4BCKA 3O8UA 3FKLA 2ITYA 1LEZA 4BI0A 2X4FA 1RDQE 3HMNA 3FAAA 2I6LA 4FL2A 2W1CA 3MWUA 2UV2A 1F5QA 4Y5HA 3F5XA 2VTSA 4BY9E 1PXLA 4MK0A 1BL7A 3LLTA 3SRVB 5DGZA 3BGZA 4FSRA 4QRCA 1UWJA 5FBNC 4YJPA 4ENXA 4F1OA 3QTRA 5DNRA 5FRIA 4ZZNA 4ACGA 4OTRA 4E6DA 2QC6A 2XIXA 5TOZA 5I9ZA 4K1BA 5EI2A 5CVHA 3Q2MA 4LOOA 3OTUA 2UW3A 3EHAA 3DU8A 1W0XC 3UBDA 5HLPA 2JDRA 3PJCA 3HDNA 3K54A 4EHEA 5IQDA 3D5WA 3PP1A 4FG7A 5I0BA 5ETIA 1TQPA 2GNGA 1R0PA 3W33A 4AS0A 4B7TA 3WF9A 3MVMA 2ERKA 3Q6WA 3FLWA 2F49A 1VEBA 2PE1A 4IH8A 5F95A 3RWPA 4CVAA 4FTTA 3HMIA 5E1SA 2CKPA 4YLKA 1OKYA 4N70A 4AZTA 5I9UA 1G8AA 3FV8A 3PE2A 1UU3A 3R2YA 3QA8A 5HI2A 3F3VA 2QOKA 5JT2A 1XHAA 3V8SA 4PMMA 3ZUTA 1YXSA 3CKXA 4G6OA 5BVDA 3FL5A 3IDPA 1U54B 2ITWA 4FKQA 5IQEA 5FEDA 3PJ8A 3F3UA 4G31A 3O8TA 3WYYA 3OC1A 3RM7A 4IVBA 3D94A 1KE8A 4ERKA 3S2PA 1BI7A 1UNLA 2R0IA 4CCUA 4QMMA 5CS6A 4F08A 5J9YA 2FSMX 3BI6A 3CQUA 3KA0A 4QYGA 2XJ1A 2CKQA 4QYFA 2B9IA 3A4OX 3QXPA 4ZY5A 2P2HA 4FKVA 4N4SA 4I5PA 4QYHA 4AGDA 4C4GA 3LXPA 4MD9E 4XG6A 4FIJA 4ANLA 4ASEA 2Z8CA 3Q9ZA 4QP9A 1PXJA 5FQDC 2BTSA 2C6MA 2NPQA 3UVRA 3OWJA 3CE3A 3KULB 5ANDA 4U9AA 3OTVA 3QTUA 4K8AA 2PTKA 4R7BA 4EQCA 2Z7SA 2GQRA 4RQVA 3PRFA 2OKRA 3RPYA 2ZV7A 5HG5A 5CXZA 2Y6MA 4IWPA 4BYJA 4AOJA 3CIKA 4FYOA 3C0GA 2Y4IB 2XIYA 5HTCA 3LPBA 3TV6A 5IUHA 4CFVA 2Q0BA 4ZXTA 3M1SA 4PDSA 4C57A 4EL9A 2HWPA 2JKQA 1IR3A 2OF2A 2VWIA 2WKMA 4K9YA 3DZOA 4YPDA 3KN5A 2PY3A 4NU1A 4MX9A 2BUJA 4NJ3A 1GIJA 2C6DA 3GU8A 3NYNA 2Y9QA 3DXNA 4G2FA 4MCVA 4FV8A 3NAXA 3N4VA 3GB2A 4Y72A 3NPCA 3IOKA 4XYFA 4QT1A 5FXRA 1NXKA 2ZYBA 1P14A 3H30A 4M66A 2UW7A 2BDJA 3V5TA 5BQ0A 5HBJA 5IA0A 2CMWA 4G34A 4HPTE 1WVYA 2JBPA 1GAGA 3QUPA 5LCJA 4ACDA 4FE2A 2VTOA 4YSMA 3HP5A 2PVKA 4NW6A 1GY3A 4IVCA 3Q3BA 2PU8A 4FVPA 2R7IA 1Z9XA 4C38A 3Q60A 3BCEA 2XUUA 5JK3A 5DWRA 4FNXA 4Y73A 5AMNA 1UNHA 4BB4A 2ITTA 2JEDA 2XZSA 5DH3A 4BCJA 2YAAA 5KMMA 3OCGA 5LJJA 5BVOA 5D9HA 2BIYA 2A27A 2W5BA 2YABA 3A99A 3IPHA 4YHTA 3CEKA 3R7VA 2ZV2A 4BDHA 3V5LA 1STCE 1V1KA 4F63A 3QWJA 2BILB 5CASA 2W1GA 2UVZA 4CZYB 2HENA 3EWHA 2YM8A 3FLZA 5D12A 2F57A 4EQMA 5EDRA 4A9SA 1VR2A 1FGKA 1M2RA 3Q9YA 5L3AA 1YOJA 4M68A 4TTHB 2IW9A 3FHIA 2QOHA 4NEUA 3PA3A 4W4VA 1K3AA 4U6RA 1ZY4A 5IA2A 2IVSA 4XS2A 3MFRA 2G01A 3FYJX 3BU6A 4FL3A 3QRUA 3TIZA 2YCQA 4O2ZA 3EQDA 2FB8A 2RSVA 3F66A 4IB1A 1WBVA 3MTFA 4OGRA 5FD2A 3RGFA 5FDPA 3GCUA 2ETRA 4JVGA 1QPEA 2PWLA 4D55A 4H05A 5DYJA 2FSOX 4KBKA 2WIPA 3MV5A 3FPMA 4BI2A 2FUMA 2JBOA 4QYYA 3E92A 2W1HA 2Y4IC 3V51A 4FKWA 5HCYA 4AGWA 3NUXA 1H28A 3LOKA 5LVPA 4IJPA 4U44A 2A0CX 5IH6A 3G0FA 4M8TA 3GQLA 3MGYA 4C4EA 5IISA 3NVMB 1JPAA 3FDNA 3OD6X 4Q5HA 2OIQA 3MB6A 5HNGA 1YWNA 1KE7A 3W2PA 4DEBA 5AP0A 1OL6A 4O0VA 4FTNA 4PV0A 4Z3VA 4JG7A 5AUZA 3QYZA 4DT8A 4FEUA 1H8FA 3E8CA 4EOSA 1PMVA 3CP9A 1XQZA 1M52A 1FVRA 1ZYLA 2AYPA 2RF9A 4WRGA 5CEPA 5KX8A 5A4EA 1HCLA 5LWMA 5A4QA 3UZRA 4CT1A 5JSMA 3O7LD 3M42A 4MF1A 5AP3A 4USEA 3COKA 2UW9A 4RFYA 4ORKA 3Q04A 4U0IA 3E7OA 3DOGA 3P4KA 5HLNA 3Q2JA 2RFNA 3QCXA 4CXAA 3OBJA 3BWFA 5BX0A 3DLZA 3D4QA 4UV0A 1REJA 5KCVA 4O0XA 2Z7RA 2V62A 4MNEA 3HGKA 2PZYA 5CZHA 2CGUA 4Z7HA 3QCQA 4QMOA 3MTLA 4D2RA 5CSPA 4G3DA 4E4NA 5M09A 1OIYA 3FLNC 2QLQA 2ZDTA 4EORA 4FUXA 4QP3A 1I44A 3QX2A 3OOMA 4CFFA 5FEEA 4ZTMA 3QQHA 4QOXA 2BHEA 3DNEA 3WF6A 2CNQA 4JOAA 4ERWA 2RGPA 4MD8E 3JUHA 2GDOA 4I94A 2C0TA 4I41A 4V0GB 3A8XA 3VQHA 3NNVA 4EK3A 3AC8A 3GP0A 2BHHA 2J0JA 3EQBA 5AR3A 4BGGA 2YWPA 3Q4TA 5FLFA 5CEMA 3OBGA 1JOWB 1OGUA 2BTRA 2O63A 1LR4A 2VV9A 3MH0A 4R1YA 4UZHA 3H9RA 5HKMA 3PTGA 4WSQA 1PYXA 3HDMA 1PMUA 4C3PA 1V0BA 4IWDA 2XEYA 3F88A 2JDOA 4L42A 4OLIA 1ZYDA 5FTGA 2OJ9A 4IM2A 2R9SA 2W5HA 4H36A 4QTDA 4RJ5A 4FV0A 4M3QA 3TG1A 4BL1A 2C5OA 2V7AA 2C0IA 3BV3A 3PY0A 5E90A 4BDAA 3C5UA 4FOCA 4F65A 4RJ3A 5M55A 4BTMA 2R3QA 3KREA 5AFVA 3C4FA 4FTUA 2WMVA 5IQBA 3S00A 4L46A 2VTHA 4O7WA 3FI4A 3GFEA 2ZM3A 3KMMA 4PDYA 4L6QA 2RFSA 3ZUVA 3GCQA 5FGKA 3QZIA 2F2UA 3MN3A 3QYWA 4CD0A 3NNUA 4AE6A 2XKCA 3IGGA 3EYHA 5L8JA 3FZ1A 2OI4X 3F3TA 4P4CA 4JX7A 2PVJA 2W4JA 4KD1A 2X4ZA 3EQHA 3O0GA 3HNGA 4X2KA 4BDJA 4BI1A 4BN1A 3R7OA 2QHNA 2HW7A 4XP2A 2EXEA 2IW6A 2WNTA 4J8MA 4TT7A 1PKDA 3D83A 1G8SA 4ZZMA 3SKCA 3DBCA 2OG8A 4ONAA 4NT4A 4BDDA 3RP9A 3EFJA 4EH3A 3V8TA 2XNBA 1FINA 4RIWB 4AOTA 3NX8A 4E5WA 4O2PA 5DR6A 4DFUA 5IA1A 3VUMA 3OHTA 3NYOA 5L2QA 2LGCA 3LIJA 2W4KA 4PL3A 3E88A 4ITHA 4P5ZA 4RIOA 3WIGA 4DG2E 4C59A 2HCKA 3HX4A 2XBAA 4O0TA 5DRBA 3CXWA 3LQ3A 4FEVA 1QMZA 2GPHA 3UIMA 3N4TA 1OL2A 4X2GA 2A4LA 2ACXA 3EN4A 2ZJWA 3U6HA 4DT9A 1ZZ2A 4XRJA 3UMXA 4YTFA 3II5A 3AG9A 1KE9A 2GHMA 2X2KA 3ANRA 1URCA 4PRJA 2HK5A 3GFWA 4YNEA 2XYUA 4M7IA 5HCXA 4USFA 5K5NA 4JAJA 2R3JA 4IAFA 3PLAE 3KCFA 3LMIA 3D7TA 2WMUA 4GU9A 3MH2A 4KBCA 4K0YA 3SW4A 2HZIA 4UXQA 2JFLA 4CRLA 4WKQA 3R01A 2BVAA 2UW4A 5E8YA 1B39A 1HOWA 5IF1A 3PVUA 5EI8A 3W8QA 3ZONA 3EKNA 5BVKA 2GCDA 4OT6A 3P9JA 4PDPA 5AX3A 4FVQA 4KABA 4I1ZA 2JITA 5GHVA 4JT3A 1VYZA 3KK9A 3T8OA 4XUFA 1OZ1A 4G3FA 3P7BA 2C5XA 3I4BA 3QLGA 5LVLA 4QP8A 1R3CA 4QMSA 1GIHA 4C02A 4A9UA 2PSQA 3QWKA 5G6VA 4N6YA 5JH6A 3V5JA 5AAEA 1Q4LA 4PQNA 3Q4UA 4O1OA 4RA4A 4E4XA 2YHVA 4OTHA 5FBOA 4IW0A 4DN5A 1XBBA 5CU4A 4O82A 5E4HA 3OEFX 2OZOA 1WAKA 1J1CA 2QG5A 4YTIA 4PMPA 1YDSE 4DGOA 5CVFA 5FTOA 3MESA 1G3NA 3QQGA 4S2ZA 4ANMA 5AUUA 3BV2A 3OY1A 1U59A 3C4CA 2XH5A 5H3QA 3B2TA 5IQHA 3IDBA 4DC2A 4DGGA 3AD4A 4FL1A 4O38A 4JBQA 3TNQB 4DFZE 1R78A 4EH6A 1WBTA 3VWAA 4KAOA 2JAVA 4YLJA 5EM7A 1Z5MA 1YDRE 1FQ1B 4E4MA 4FT3A 4E6QA 3UTOA 4RLKA 4ZSLA 2J0MB 4YJRA 5BPYA 4RLLA 4D4YA 4UY9A 5G1XA 5EOLA 2VU3A 2X0GA 3ET7A 4BZOA 4HW7A 1OL7A 3R71A 4KRDA 5CU2A 2P2IA 4EK4A 3QTIA 5AX9A 2WQBA 4U3ZA 1YW2A 3EQCA 5EM6A 2YA9A 3D5XA 2WQEA 2CJMA 2VWXA 3CD8A 3O96A 4OAVB 3W32A 2Y6OA 4R7IA 2P4IA 3CY2A 4DH7A 5EOBA 3UO6A 3CSVA 3UODA 4O0RA 4F0IA 4M13A 3Q4CA 4ASDA 5F9EA 2J90A 4RC4A 3MDYA 1Y6AA 2YFXA 3OCSA 2OXYA 3NAYA 4D4RA 3TV4A 3RK9A 4GT4A 2PUPA 3AQVA 4M97A 4N6ZA 2RFEA 1JBPE 5I4NA 1WBWA 5IDPA 5C27A 4IZ7A 3A7JA 4I4EA 4AN3A 1PMEA 3P23A 4HJOA 3VO3A 3TEIA 5B7VA 3AGLA 4EOJA 3VBTA 4FEXA 2YAKA 1XR1A 2CDZA 5LVMA 1QPJA 3KN6A 4AW0A 1YVJA 3QUEA 4FBXA 4MQ1A 3PRIA 4BTKA 3GXLA 3HRBA 1NA7A 2O8YA 2JGZA 4UX9A 1OVEA 4II5A 4TY1A 5M4IA 5DOSA 4D4SA 3HL7A 2QNJA 4FICA 4NIFB 5DEYA 5JFXA 4KUJA 3TNPC 1ZOHA 3TXOA 4JR7A 3I0OA 3HUCA 3QRJA 2J0LA 4HZRA 3RCDA 2XCKA 1YXVA 4K11A 4WG3A 4QO9A 4IX5A 2B0QA 1REKA 1Q99A 3CS9A 1CMKE 5IUIA 4QQ5A 4FF8A 1IG1A 1XH9A 4AZWA 2YZLA 2QHMA 4BIBA 4LMNA 5L6PA 2UVYA 4A7CA 4M69B 1NT2A 4JQ7A 5ITAA 3FZOA 3BYUA 2HY0A 5IKWA 2LAVA 5CAPA 4FEQA 3RWQA 3G9NA 4U97A 3IKAA 3PJ3A 5T68A 1ZRZA 3EN6A 4Z55A 4YC6A 2YCSA 5J9LA 4UXLA 4E7WA 5HX6A 3QKKA 4JJRA 2YACA 3ORKA 4KRCA 3F3ZA 5EKOA 3I81A 3VNTA 2OXXA 4QMXA 3H9OA 3O51A 3ZTXA 3ZDIA 4EH5A 5GZ9A 2QOFA 3CJFA 3QD0A 3HV3A 4FIIA 2BKZA 4XP0A 1A06A 2E9UA 2WTDA 2OU7A 3NYVA 2PVFA 4CFWA 5DBXA 4GT5A 1OIUA 4FR4A 4NCTC 5CYIA 3PWYA 3HV4A 3TZMA 4G1WA 4ZSEA 1Y8YA 3AMYA 2XJ2A 3HEGA 4QPAA 5I9WA 5DA3A 4LQMA 3MFTA 5DT0A 1PHKA 5HTIA 5LMKC 3OW4A 2G15A 5A14A 2WMBA 2ZVAA 5C1QB 2JDSA 3TWJA 4BCQA 2VNYA 2WMAA 3SXSA 2OXDA 1XO2B 2ITOA 3VJNA 5JFWA 1K2PA 1SYKA 1U5RA 2GFSA 4FKLA 1PXMA 3QTZA 4IMYA 4LRMA 4WT6A 3OCBA 2XM9A 5CEQA 3HKOA 4I92A 2PMNX 3TKHA 3SAYA 4DFXE 2C6OA 2ETKA 4HVDA 4RZWA 4U79A 4FGRA 2B9HA 4FNYA 5DFPA 4FSYA 3ZH8A 3UE4A 1SMHA 2BIKB 3U54A 5ANJA 2JKKA 4BTFA 3R1YA 5CTPA 3GU6A 5FDXA 3WZKA 2PE2A 4FK3A 5KBQA 4FV3A 4FKJA 5KMOA 2WELA 3QGWA 5ETAA 2BZHB 3BEAA 1ZLTA 4XCUA 3G6GA 2XNOA 5K5XA 3UPXA 3IO7A 2QR7A 5J8IA 3EFLA 3FSKA 4ZJVA 3IS5A 4DGNA 3TKIA 4ZLOA 2VTJA 4XRLA 3JPVA 2WZJA 3KRWA 4NM0A 5CQUA 5CAVA 4ACHA 4D58A 5CF4A 1OIRA 2OBJA 4JR3A 4ZK5A 2PE0A 5C8MA 3CPBA 2UUEA 4U81A 4BDCA 2X2LA 3TCPA 2C5YA 3KRJA 4MWIA 3F82A 5A6OA 2ITXA 4GFOA 4O7ZA 1SZMA 3BQCA 3ZZEA 4B4LA 1H0VA 5JMSA 3UG2A 2R3FA 3ODZX 4G6NA 2GQGA 4W8EA 5ANIA 4FIEA 1KWPA 3L1SA 3FBVA 4D9UA 5J1WA 4I22A 5DR9A 4IZ5A 3EMGA 1FMOE 3QQUA 4XBRA 4DH1A 2BR1A 5DIAA 2WOUA 4RIYA 1QL6A 4EZ7A 3RK5A 2REIA 2V22A 1XH7A 3SHEA 4RC2A 5CANA 4H58A 3LXLA 3AT2A 1KV1A 3NMUF 2RL5A 1PRYA 1UU8A 3DKFA 3OMVA 3PXRA 4TNBA 2R3PA 3UP2A 4FV5A 3OCTA 2W9ZB 2RFDA 4BR3A 3AC1A 5AP7A 1FVTA 2WXVA 4BDEA 1H0WA 2GQSA 4I3ZA 3ZO3A 3UQCA 3FC1X 4E4LA 2C6TA 4F0GA 1AD5A 5E91A 5E8VA 4BFMA 3PVGA 2IVVA 2VGPA 3Q9WA 2JFMA 3QBNA 4X6RA 5AR8A 3ATSA 5D7AA 1V0OA 1Q8UA 4RJ8A 4DLIA 2BKKA 5ACBC 3MS9A 4GJ3A 3K5UA 4CFNA 3U6JA 1F3MC 2W05A 4L7FA 3LLAA 4LL0A 4BDFA 5AJQA 3JY0A 5HO8A 3VAPA 4MHAA 4KIKA 4X6QC 4CGAA 4BIEA 5K0KA 3E64A 2B9FA 4QMZA 4Y46A 4HVSA 2ITUA 5M53A 3LFSA 4QMUA 4GRBA 3SG8A 1WZYA 4YP8A 3HZTA 1MQBA 2QURA 5AIKA 4YPSA 3NVKI 4FSMA 4O91A 1KV2A 3TDVA 3E7VA 2VTRA 3S0OA 4JG8A 5EW9A 4AW2A 3A4PA 2Y0AA 2ZV8A 4DBNA 4A9YA 2VRXA 4G5JA 3NGAA 4FOBA 3F3WA 1RQQA 3CTJA 3I1AA 3V04A 3GBZA 3KXXA 4QMVA 4XP3A 3RINA 4F70A 5E7RA 4RVMA 4X21A 4Q9SA 2VX3A 3DT1A 4RVTA 4I6QA 2ZOQA 3ORLA 3PWDA 5IQIA 4IANA 1GIIA 3R73A 4MF0A 3COMA 3T3UA 4FSTA 4B8LA 3NR9A 4A4XA 2XIZA 3LJ0A 4EZ5A 4FMQA 5CF8A 3U4UA 2C68A 4LL5A 3TUDA 2XNMA 3G0EA 5TE0A 3ODYX 3RMFA 2XNNA 4FVRA 4NTTA 5DLSA 2F4JA 4C8BA 4LGDA 1OBGA 3PPKA 5KBRA 2FGIA 2IWIA 2YM7A 4RPVA 5DR2A 2IVUA 2BAQA 1UA2A 5L2SA 1JQHA 2WMWA 4KIOA 4BICA 3EQFA 2CGWA 4KKGA 1M2PA 3OZ6A 2V55A 3R9RA 3QC9A 4GW8A 5HVKA 3CKWA 3R30A 4UMPA 2YDIA 1Y57A 5A54A 5EQEA 2XCHA 3RCJA 4CKJA 5KNJA 5AR2A 4FZ7A 4QMYA 4OTDA 5AWMA 2XNPA 4RMZA 1OECA 4K77A 3SX9A 4H1JA 3F61A 3ZXZA 5L2WA 5HVYA 3ZMMA 2XK6A 4D9TA 3R8LA 5HD4A 2XK9A 4R3PA 4FEWA 2BROA 3U8WA 4WRSA 1WCCA 4NM3A 1HCKA 4KWPA 2OSCA 1H08A 1OITA 3TUCA 5K0XA 4YU2A 4UZDA 2X9EA 4NKAA 3MVJA 5AIRA 1YOLA 2C1AA 2EU9A 2P0CA 3EQRA 3MIYA 4TKSA 4BCPA 1YXTA 4U41A 5BYYA 4IXPA 4IX3A 5EHLA 2IPXA 1OPKA 3BGQA 5J7HA 3RAKA 3MI9A 5J9ZA 4RVKA 1ZMUA 2E9OA 4OTGA 4PMSA 3R8MA 3RI1A 3BLHA 4BDIA 1F0QA 4Q2AA 1G5SA 3BE2A 3DNDA 5IA3A 3ZDUA 3VBVA 1CKIA 4BCMA 4X3FB 2EXMA 2XIKA 4I6HA 1UWHA 3R7YA 2W99B 3SA0A 2H34A 3ELJA 4EUUA 1K9AA 3DJ6A 4XH6A 3TI1A 3U87A 2W0JA 3ATTA 2O65A 4AZFA 3LM5A 4JIAA 3V01A 4DFNA 4I93A 1V0PA 1PXOA 4KSPA 2B54A 5HBHA 4BGHA 3MH3A 4FKUA 4NW5A 1P2AA 4NM5A 3W2RA 3RPRA 3GCVA 3QQFA 5GZAA 2I0VA 2PMOX 3MPTA 4ZTLA 4BKJA 3ZLXA 2VWBA 4U80A 1BL6A 4UYAA 4ZTNA 1JWHA 1U4DA 2UZLA 4I20A 2B4SB 4RWJA 4YZMA 5E8ZA 3FXXA 3QU0A 5FTQA 3R7GA 3AMAA 5JKGA 3UIUA 2F7EE 2OO8X 3ZLWA 2C0OA 1VYWA 4IVAA 4RZVA 4AUAA 4C34A 4IWQA 2BFXA 2CGXA 2WMSA 1ERKA 4C4FA 3SQQA 3DQXA 5JGAA 3VS2A 2XYNA 2BMCA 4QMLA 4ANNA 2JAMA 2PZPA 3E8DA 4IFCA 4M15A 5EK7A 4V05A 2YIWA 3WZUA 3EN7A 3W16A 3I5NA 5EKNA 2FH9A 3EYGA 4JBPA 4S30A 3IW4A 3E5AA 5JGBA 4XNEA 3F6XA 3AT4A 3RNIA 5BUJA 4AGCA 4FIFA 4MXCA 1KOBA 3DJ7A 4L68A 3V5QA 3R28A 2QU6A 3SDJA 4Y85A 3FC2A 2JKMA 3KF7A 2JC6A 5JEBA 5TO8A 3U55A 3C4EA 2IVTA 3LXNA 3C4XA 3NUUA 4LG4A 4XG8A 4DHFA 3A8WA 4Q9ZA 1ZARA 5GJGA 3RZBA 3P86A 1SM2A 2W1FA 3WZEA 1AQ1A 3FI3A 4R78A 2YISA 4DTBA 4IX6A 4Y8DA 3FEGA 3WI6A 4EYMA 2R3GA 3DBQA 3G9LX 4DEGA 3Q6UA 4BYIA 5C26A 2V5QA 2XP2A 5AV0A 3MFUA 5AAFA 4BKYA 1J91A 2VTQA 4AF3A 2CLQA 3ROCA 3TUBA 2CNVA 5ACKA 2OZAB 3PXQA 2HELA 5I3RA 3IW5A 3ZM9A 3KQ7A 3DZQA 4A9RA 3CC6A 2J4ZA 3BX5A 3ZBXA 4X3FC 2QD9A 4XEYA 2VTNA 4YJVA 2CKEA 5E8UA 5EI6A 3ALNA 4QP1A 3MFSA 5T3QA 2UVXA 4L9IA 4CZUA 4NK9A 3TZ8A 1SVHA 2C69A 3ZEWA 4AT4A 5I9XA 1GZOA 3SRVA 4TN6A 3TV7A 2VTIA 1TQIA 4IZAA 4TYEA 5D7VA 5A4LA 3UO5A 4RIXA 4K2RA 3RAWA 3QX4A 5AV2A 2VTMA 2FSLX 4I6BA 3EKKA 5HIDA 4BCFA 4AW1A 5KMNA 1MP8A 3BEGA 3RAIA 5IUGA 4GT3A 3BU5A 3RJCA 5EDQA 5B0XA 1YHVA 2DS1A 1J1BA 2VO3A 3L9MA 3OOGA 2JLDA 4EI4A 4GL9A 3REPA 4DA5A 3E3PA 2VTLA 5A9UA 1APME 3MA3A 3MB7A 4NSTA 4PP7A 3L9LA 2E9PA 3EFWA 4GYIA 1XH5A 3CQEA 4BBMA 2GHLA 2P3GX 3BIZA 3IW8A 4BZNA 2XNGA 1KSWA 1R1WA 4FT7A 4ZJIA 5LMAA 3A61A 3BYSA 3HA8A 3KXHA 1IAJA 4ANQA 5CEIA 4KBAA 2J0IA 3S1HA 3PSCA 4XV1A 5HE3A 4ZSJA 3LW0A 3UOJA 2H96A 2UZNA 3P5KA 4TW9A 4JDKA 3MPAA 4J95A 1A48A 3AD5A 1U54A 4PTGA 4LUDA 4C58A 2HXLA 2F2CB 4FV6A 4ZMFA 2Q83A 3D7TB 2XF0A 3RHXA 5L2IA 4OTIA 5DEWA 5AUTA 2ZDUA 4ASXA 3DFCB 1GZ8A 2I40A 4M12A 1Q8ZA 2I0EA 5AP4A 4DEHA 4K18A 4PPCA 2BDWA 4EBVA 2VO0A 3DPKA 4CMUA 4G16A 4IJ9A 4QMQA 5JQ5A 3OEZA 3LHJA 1OKVA 4RSSA 4CTBA 3EFKA 3CQWA 4AT5A 4D4VA 2C5VA 2R7BA 3K3JA 2OK1A 4QYEA 3TZ7A 1GZKA 3FI8A 2X6DA 3WOWA 3LFCA 3HP2A 1H1WA 4FX3A 2I7QA 5FWKK 1UU7A 4HZSA 5HESA 3KULA 5E8XA 1MUOA 4HNIA 3PSBA 4JQEA 5DPVA 4FNWA 2WHBA 1OPJA 3QCSA 4L67A 1KE5A 3FYKX 4AU8A 4G9CA 3IQ7A 2YDKA 3UOHA 2H8HA 4U8ZA 3VULA 4JDHA 3VC4A 2IZRA 1U5QA 2OF4A 3DB8A 3C1XA 3HVCA 1LEWA 4OBPA 1FMKA 4TL0A 3FXWA 4IC7A 4UBAA 5M08A 3ERKA 3UC3A 3IGOA 2ITNA 3OT3A 4EC8A 4ZZOA 2KULA 4Y95A 3TJCA 4BGQA 1OB3A 4ACCA 2F9GA 5HE0A 1OIQA 3ORNA 3CCNA 4OTWA 2JKOA 5BVFA 4GMYA 4KNBA 3UQFA 4QNAA 4RVLA 5AM7A 2YM5A 3HYHA 5IMEA 4MXZA 3R1NA 4TWNA 5LMBA 2CNUA 2XK4A 3A7HA 5DT3A 4WSYA 3EIDA 3FMEA 5DI1A 3VS4A 4BCNA 4DH8A 1PYEA 3BBTB 1UVRA 3ORPA 1Q8WA 1NW1A 2QG7A 2GFCA 4O1PA 3RZFA 2EXCX 3FQEA 3ZXTA 2GNHA 5IMXA 2X8IA 3ORTA 3B8QA 4FV2A 1CDKA 5B2LA 4UMTA 4OBQA 1I09A 2OWBA 2XK7A 4TYIA 1W98A 4W4WA 4IIRA 5M57A 4OBOA 5ICPA 3JS2A 5J7BA 5IH4A 2I0HA 2J2IB 3TTJA 4WNOA 4HCVA 3Q52A 4FKTA 4TYHB 1BI8A 1OUKA 4JNWA 3WIKA 5M56A 4G6LA 4RC3A 5AM6A 5E8TA 4C3FA 5LQFA 5DVRA 3PXKA 1J7UA 4GKHA 1GNGA 1Y91A 4RQKA 2HIWA 1H1RA 1M2QA 3VS7A 3G33A 5JZNA 3VN9A 5KZIA 5C9CA 5HOAA 3ZZWA 3D9VA 4RRVA 3SV0A 5IQAA 3CGOA 3D2IA 2PL0A 4EWHA 5HG8A 1R0EA 2J9MA 4B9DA 2CKOA 2BCJA 4FC0A 4WHZA 4QP6A 2QONA 5CEOA 3CY3A 3MW1A 5FM3A 2DYLA 1WBPA 5HVJA 4F9AA 3QKMA 4PPAA 4RX8A 4FZAB 1DAWA 3RM6A 3TACA 4D28A 4L43A 5JFVA 3HAMA 2CN5A 3FMNA 3OWKA 4DH5A 4F7SA 5EM5A 4M0ZA 3IDCA 3ZO2A 3W2QA 2WQOA 2BFYA 5KMIA 4O83A 2OJJA 4HVIA 2E2BA 5M07A 1OPLA 3VBYA 1PXPA 3M2WA 4CV9A 1LPUA 2C3JA 4O0YA 4WIHA 2QI8A 2Z7QA 3UIXA 5H9BA 1Q8TA 4F9WA 5KUPA 3WILA 4XHKB 4O0SA 3QTSA 4CQGA 3R7IA 4DINA 3A7IA 3QTXA 4ALUA 2GTMA 4XV9A 4RWLA 3OUKA 4C4JA 4HVHA 4IAAA 4YC8A 5ANGA 2XBJA 4AP7A 4E26A 2PK9A 4S32A 2OICA 2R2PA 2X1NA 4OTQA 5GNKA 4S31A 2ITQA 4RA5A 4CFXA 3BGPA 3MH1A 1WBNA 4EONA 5J5TA 4FKGA 5HTBA 4LGHA 3LVPA 3HAVA 4CLIA 1YRPA 4MWHA 4MBLA 4BHZA 4O84A 3V6SA 2HZ0A 4KIPA 4M84A 3ALOA 3KC3A 5L6OA 5LVNA 3LCOA 1VZOA 5C03A 4JDIA 1OKWA 3E8EA 5F20A 3VIDA 3OW3A 3MVLA 3I5ZA 4EKKA 3QHWA 3V6RA 3TZ9A 5LXMA 3DY7A 3L8PA 3IG7A 1MQ4A 1ZAOA 1P5EA 2ONLC 4AZVA 1IA9A 5CSVA 2QO9A 5CVGA 2RG6A 4IACA 4IB0A 4WOVA 3F7WA 3EL8A 2B53A 4EOLA 4PX6A 3PLSA 3R00A 4F99A 2G9XA 3QZHA 5AUVA 2YIXA 4V0GA 3DA6A 3OWLA 5JN2A 5TT7A 2R3HA 2V7OA 3PXFA 4LI5A 3I79A 3BU3A 5AA8A 4WA9A 3AGMA 2C4GA 4MKCA 4CFMA 2XJ0A 4ZS4A 3O17A 4XV2A 1IA8A 2NNWB 3KXZA 2HXQA 4H39A 3OG7A 4HOKA 2DUVA 3FZTA 1SVGA 3E3BX 4FG8A 3VJOA 4EH9A 2IN6A 3V8WA 3NUNA 2XM8A 4W9XA 2QR8A 5A46A 3QQLA 3ORMA 4R6VA 2GS7A 4FUYA 4L3PA 4HYUA 4E8AA 2QOBA 5CWZA 5EQYA 3BE9A 4YJSA 2G2HA 2X7GA 3DBFA 3GCPA 1H25A 2BALA 4HYHA 3HV5A 4KINA 3ITZA 5KHXA 3PXYA 4U42A 4J97A 2B7AA 3NNWA 3T9IA 3V3VA 4I0RA 3SC1A 1JKSA 5M4UA 3BYMA 5BVNA 2WIHA 5I5ZA 4UEUA 3EZRA 2GS6A 3GT8A 5J87A 2HZNA 2VTTA 2XA4A 2I1MA 2OH0E 2VD5A 2XKEA 2F7ZE 2OFVA 4C4HA 1ZOGA 5AAGA 3F5PA 5BNJA 3NW7A 4LM5A 4MBJA 5HEZA 4YO4A 4FZ6A 4PNIA 2HOGA 2IW8A 2WTJA 3U6IA 3THBA 5CALA 4F64A 4J7BA 2A1AB 4IAZA 4X2FA 2WTVA 4FT9A 4BIDA 4NFMA 2WFYA 3SOAA 3DV3A 1WVWA 3VRZA 2WB8A 2ZMDA 3PG1A 2ETMA 1BUHA 3D2KA 2PVNA 4GH2A 3G6HA 4FTIA 4K33A 1ZMWA 1ZWSA 4HGSA 3VUDA 5ETCA 2UZBA 4IEBA 3TJDA 4D5HA 2ITZA 1RJBA 3UVQA 4AW5A 2ESMA 2F7XE 3L8VA 4CKRA 3PE1A 1AGWA 2ZM4A 5HG9A 1L8TA 3LJ2A 3QGYA 3KRRA 4TWCA 5EYDA 4AN2A 4DGLC 2VN9A 4D2TA 3B2WA 3EB0A 4E73A 3PY3A 5AADA 5DHJA 4F9BA 3ZCLA 3DDPA 3HV6A 1WMKA 4MXXA 2C6KA 2O64A 2Y4PA 4XOZA 3GC0A 3W2SA 4DGMA 3KGAA 4S34A 3PA5A 4GVAA 4ZTRA 3JXWA 3W10A 3FJQE 3ACJA 1CM8A 3P7CA 3R04A 4PTCA 2O3PA 4IC8A 5K9IA 4FV9A 4CFUA 4ZSGA 3EQIA 1H00A 5A3XA 4PDOA 4EYJA 4FKOA 5HICA 1Q61A 4EK8A 4HGLA 3C4WA 2BDFA 2W4OA 4FKPA 4J99A 4D2PA 5CZIA 4AXAA 2FYSA 4IBMA 4EH7A 4ZY4A 1Q3DA 5IDNA 2YITA 3PFQA 3N9XA 4JS8A 4YNOA 4G3CA 1XWSA 2UZUE 1UU9A 3OP5A 4I4FA 3V5WA 1YXUA 4EUTA 3UYSA 4KKHA 4J52A 4JIKA 2VWZA 3H0ZA 5CSHA 4EWQA 2ZB1A 4FKIA 4G3EA 3OXZA 3RALA 1J7IA 4FK6A 1M17A 2J0KA 4GYGA 2PZ5A 2W1DA 5TF9A 3MY5A 3UQGA 3HMOA 3CPCA 3ORXA 5CI6A 4YUQA 2XVDA 2UW8A 1S9JA 5AR5A 4DH3A 4FSWA 2X7OA 5HO7A 3KB7A 5IQCA 1KOAA 3FWQA 4IAKA 4KS7A 1PW2A 4XMOA 2JIUA 4IFGA 4P2KA 4C3RA 3KKVA 3WBLA 4YC3A 2JIVA 3FUPA 3GCSA 3AOXA 3HA6A 3PIZA 4NFNA 3FQSA 2CPKE 2I0YA 4JRVA 5CU0A 3LCKA 5AUWA 3SVVA 3QF9A 3UIBA 2EWAA 3DCVA 5FXSA 3WE8A 4AWIA 2XRUA 3BHTA 4JAIA 1QPDA 3G51A 1E9HA 4QP4A 5AA9A 1ND4A 2GTNA 4IX4A 4MNFA 4F6SA 5HORA 2OJIA 3BLRA 1VJYA 5T6KA 4KSQA 4EK6A 3NW5A 4PWNA 1Q3WA 3WF8A 3KF4A 4NCTA 3I7BA 3KRLA 3I7CA 4JBOA 1PY5A 4UWYA 2B1PA 1SVEA 4ENYA 3ZC5A 2H6DA 2FA2A 3NIEA 4YMJA 5AP2A 2JDTA 4C37A 3SG9A 3LCTA 4MBIA 4RJ4A 4S33A 3H4JA 4YLLA 4TXCA 3CTQA 1B38A 2IZSA 2PVYA 3D5UA 4J1RA 4Z16A 3OT8A 4U7ZA 3COHA 2AC3A 2PVMA 2VX0A 1WBSA 3PIYA 5GJFA 4ITJA 5E92A 3VF8A 3EN9A 3KCKA 3KVWA 4XBUA 3PJ2A 4J98A 2YM3A 2QU5A 2XNEA 2O5KA 4L52A 2BAJA 4NH1A 4YZDA 4F6UA 3VW6A 4M67A 3KU2A 3RBWA 4BHNA 5EW8A 3A7FA 3LFDA 3NLBA 3O50A 3OY3A 1JVPP 3QCYA 3BHYA 4MH7A 2PHKA 2IO6A 4H1MA 2WMRA 3D0EA 4I0TA 5IG1A 5DMZA 4YHJA 5C4LA 3R1QA 2NP8A 2WO6A 1QPCA 4F9CA 2OH4A 3Q96A 3S95A 4EHVA 4DEAA 3MA6A 4GKIA 4FV1A 3WE4A 4D2SA 4LOPA 4NM7A 4NIFA 3AD6A 3C51A 3ZHPC 5CAUA 2PUNA 4NL0A 4ZTSA 3NCGA 4QQJA 4ZLYA 3LM0A 2OFUA 3MBLA 4CG9A 4YZNA 2A19B 5JQ8A 3DGKA 4F1MA 3DS6A 1NVQA 4XX9A 4ZIMA 4LOQA 4C36A 4ID7A 3D5VA 4QNYA 4B8MA 1OKZA 1Q62A 4M69A 3SXFA 4JXFA 3ZEPA 5B2MA 4E5AX 2J5EA 3QFVA 5DE2A 5A4CA 4OUCA 4AA5A 1PMNA 3POOA 2OIDA 5AR7A 2VAGA 4M14A 3T3VA 1J7LA 3QLFA 4PL4A 5JRSA 3C4ZA 2ZAZA 5CT7A 3CBLA 4HGEA 2PVLA 2C3KA 3UOLA 1Q8YA 1RE8A 5C8NA 2CSNA 3A2CA 2BZJA 3F2AA 4F7JA 2E9NA 3DAKA 4MEDA 4O7VA 3HMMA 1O9UA 4I5CA 5CF6A 1CTPE 4WG4A 3FY0A 3AXWA 3ZFYA 3ZS5A 5J1VA 4IDVA 4TPTA 3GI3A 4LRJA 5J5SA 3ACKA 4I5MA 3QD3A 4WUAA 5CU3A 4C62A 4GV1A 1FBNA 3UC4A 4JBVA 1H1PA 2B9JA 3QRIA 4B99A 3AT3A 4B0GA 2XK8A 3PYYA 3OFMA 4OR5A 1DI8A 3PVWA 3ZO1A 3ZSIA 5HLWA 5ANKA 3R8PA 1J3HA 1H26A 1X8BA 4FYNA 4QTBA 2YJRA 3HRCA 3P7AA 3OROA 3FHRA 3GOPA 4TZRA 4U43A 4X3JA 2WEVA 5CXHA 5E8WA 3DTWA 3RK7A 4J8NA 4MXAA 1LUFA 2PUUA 4YJTA 4D0XA 5KMKA 1ZYCA 3NW6A 4W4YA 3S4QA 4BC6A 5L2TA 4O7YA 4MAOA 5KZ0A 5CT0A 3V5PA 4RIXB 4AT3A 3GGFA 4F4PA 5H8BA 2ERZE 4AE9A 1SNXA 5AP6A 4TWPA 4E6CA 4L3LA 5EFQA 3BKBA 2H9VA 2XS0A 3M11A 2PPQA 3ETAA 4I5HA 1XH8A 3PPJA 3CLYA 2CHLA 4FA2A 2WQNA 4ZOGA 3W2CA 2NO3A 3G15A 4NZWB 3BYOA 1H27A 2WMTA 2EVAA 2WAJA 3KXMA 3E8NA 3P79A 3F5UA 3CD3A 4GCJA 1UKIA 5GJDA 3O23A 1UKHA 4PTEA 2Z02A 3JY9A 4UMRA 2R4BA 1H07A 3VS3A 3GEQA 4R3RA 2EB3A 2FSTX 2J51A 4MQ2A 3Q5IA 4YJQA 3SGCA 1FVVA 3UG1A 3NUSA 4EKLA 3KRXA 4AA4A 3ZRKA 2QCSA 4GJ2A 4IAIA 3C0HA 3SLSA 4ZY6A 4OTFA 2QO7A 4YZCA 3Q5ZA 3VS0A 3LCSA 2W7XA 3UNZA 4QTAA 2UW0A 2WOTA 1BYGA 4NKSA 3U4WA 4KB8A 3MIAA 5HZNA 3QUDA 3R8ZA 4L53A 2PULA 4H3BA 1YI6A 3I0QA 3Q53A 2BRGA 4UWBA 5CY3A 1PF8A 2AUHA 1TQMA 4P90A 3TTIA 4MNEB 3QKLA 5LVOA 4BTJA 3R0TA 4PY1A 3UZPA 4WG5A 3ORZA 3R21A 3NS9A 3ZM4A 3C5IA 2C6EA 4FKSA 3LFEA 3ZFXA 4CNHA 2XMYA 3MJ2A 3ZSHA 2OW3A 2UZWE 3QQJA 4A4LA 4AZSA 4AZEA 4RX5A 2QOCA 2XKFA 4DAWA 2YCRA 2P55A 3K3IA 5GIPE 5BVWA 5LOHA 2R3NA 4TNDA 3F69A 4ZP5A 4QTEA 1OL5A 3MYGA 3P0MA 4DYMA 4JI9A 1M7QA 5C01A 1YHSA 2C47A 3C50A 3NNXA 4FZFB 3COIA 3T9TA 2CCHA 3QTWA 4O6EA 3VF9A 4NYEA 4JRNA 3FLQA 1NVRA 4CKIA 5KHWA 4DFYA 3U9CA 4L3JA 3R83A 3BYVA 4PF4A 1CSNA 3EJ1A 3EQGA 3MY1A 4M0YA 1JSUA 4U5JA 3A62A 4U40A 1W82A 4D5KA 1W84A 2RG5A 2XEZA 4C2WA 4D0WA 3BZ3A 4Y5QA 4WD5A 4BWXA 4EOOA 4YTCA 5LWNA 1O6KA 1KE6A 1YQJA 4IM3A 4DCAA 4AX8A 5LARA 3BPRA 4MD7E 2OGVA 3R8VA 5HE1A 5EM8A 1FGIA 2DQ7X 2VNWA 4QMWA 3WARA 5JZJA 3E93A 3ENMA 3FZRA 4OT5A 4X0MA 1JAMA 4EOKA 4ANOA 1ZMVA 2W96B 5BMSA 2VO6A 5ETFA 3N51A 2PZRA 3NUYA 2R3RA 3FZPA 5IEYA 5ANOA 4RWIA 4FTAA 2RIOA 4XG9A 4ZEGA 1Q5KA 5AR4A 2R3MA 3SOCA 4KS8A 2PUIA 2B55A 3C9WA 5KO1A 3VS6A 4CG8A 3WYXA 1JLUE 2CLXA 4IHPA 4PPBA 2G2FA 4HPUE 3DXPA 2Y7JA 5IU2A 2JIIA 3IK3A 4RX9A 5HU9A 4OW8A 2UZEA 1EH4A 2PZIA 3GU4A 2YIYA 4RWKA 4YTHA 4CTCA 5GZ8A 3DBEA 3W18A 3DB6A 3H10A 2GNLA 3U51A 1R39A 5AUYA 1PXIA 5D1JA 4BCIA 5A6NA 3OS3A 1JKTA 4IWOA 3QTQA 2JDVA 1Y8GA 3QC4A 3LFBA 4GFGA 2QKWB 3SW7A 3MSSA 4KA3A 1YOMA 4CCBA 3NZ0A 3L8XA 2YEXA 3ZRMA 4X7QA 4R8QA 4ACMA 5BUIA 3VUKA 4EH2A 1H01A 5EYKA 2PVRA 5BYZA 3LZBA 4YSJA 5M4CA 3OUNB 4BRXA 2YLEA 3VUIA 5IQFA 1IASA 1YDTE 4YJUA 3LCDA 4L7SA 3LMHA 3DLSA 1GOLA 4DE4A 4FI1A 4QMTA 4I0SA 4EHGA 4O0UA 4ANSA 3FI2A 4UMUA 2FVDA 2VX1A 4X2NA 1RW8A 1H1SA 4X3FA 3DJ5A 1ZYJA 3A60A 5B2KA 1DI9A 1SNUA 3CR0A 3GUBA 4L8MA 3FXZA 4BCOA 4XLIA 3BELA 4EQUA 4CEGA 3SXRA 4CMOA 2JD5A 2IZUA 1YI3A 2VGOA 1YXXA 2YDJA 4I6FA 4Z7GA 4R5YA 4A07A 4QPSA 3HECA 3FMMA 4V04A 4D2WA 5I9YA 5K4IA 1H24A 1YWVA 4NJDA 2EB2A 3ZRLA 4LV5A 3R6XA 4FV4A 3TNIA 4AA0A 4AGUA 3CGFA 4YHFA 3TNHA 1DS5A 2BRHA 4GK2A 4LGGA 2OJGA 3VBWA 4KIQA 5IZFA 3BLQA 4O7TA 2FO0A 5CAQA 2ITVA 4OAUC 1W8CA 3AMBA 3R9OA 2VWVA 3LQ8A 3DK7A 4QP2A 5JFSA 3UP7A 3I6UA 1S9IA 4J96A 3S3IA 4R7HA 5J95A 3GC8A 2QOLA 4FGBA 4FSUA 4H3QA 4Z9LA 5IH5A 4D1ZA 2J7TA 3UJGA 1QCFA 2CCIA 2EUFB 3PZHA 3PJ1A 1BLXA 3VUGA 2XK3A 3MPMA 3DAJA 3P1AA 5LCKA 5IQGA 4L00A 2C5NA 2QOOA 3LFFA 4OTPA 4WNPA 5EQPA 1H1QA 4C33A 2C1BA 2E9VA 3VBXA 4CYJA 4TWOA 1ZYSA 4RJ7A 1T46A 4E3CA 4EJ7A 1GJOA 3PIXA 3VW8A 5EHOA 4RFZA 2XIRA 4YJNA 3TN8A 4BWKA 4CSVA 1A9UA 2X39A 4FNZA 2R3LA 4J53A 3FLYA 4E5BA 4WUNA 5L8LA 3UNKA 3AC4A 4FZDB 5BYLA 4MXOA 3QRTA 4CZTA 2UZDA 3PY1A 3ENHA 2DWBA 3Q9XA 5CX9A 3DTCA 1BMKA 4BDGA 4BKZA 4FTMA 4AACA 3F7ZA 5EG3A 3RHKA 5KKRB 5K3YA 3Q32A 3ZLYA 4PUZA 4ZSAA 3O71A 2BZKB 4C7TA 4QPMA 2UZOA 4HCTA 3FMLA 4P7EA 4EK5A 2ZB0A 2IG7A 2VTPA 4MTAA 2WMQA 5DT4A 3R9DA 4RGJA 5FM2A 3D15A 4RX7A 4DTAA 3NYXA 3ANQA 1IEPA 3LJ1A 2X8DA 4IB5A 4N0SA 4ITIA 4ZTQA 2OZAA 2QVSE 3FSFA 4G5PA 5CLPA 4UWCA 3WZDA 2X6EA 4AFJA 4YBKA 3QALE 1ZY5A 3PDTA 2Y8OA 4IM0A 4CV8A 4E1ZA 4UALA 5IA5A 3EQPA 1U46A 2WQMA 3HRFA 4ALWA 5I9VA 5I3OA 5KMJA 3DK6A 4BDKA 4GK4A 4X2JA 2QODA 3RPSA 3TT0A 5M44A 1BKXA 3DKOA 4MYGA 1FPUA 1XBAA 4I23A 3LAUA 5CENA 1FOTA 3UPZA 4ANBA 3FKOA 3UZTA 3ULIA 4O81A 3WF5A 4EHZA 5D41A 2J6MA 2R3OA 4FSZA 3DAEA 2KTYA 2RKUA 3BRBA 2IJMA 2R64A 2BRBA 5FG8A 4W8DA 4AN9A 1TKIA 3DK3A 3B8RA 3ID6C 5AEPA 2BAKA 4EH8A 4WBOA 4QMNA 5EHYA 4JLCA 4C35A 4WBBB 2OLCA 1Y6BA 3KXNA 5CI7A 3QZFA 4NTSA 2WTKB 4O27B 2G2IA 2OIBA 2ZM1A 3QHRA 2YCFA 3AC5A 4ZTHA 5C4KA 4HNFA 1B6CB 4EOMA 2GS2A 2NRUA 4RG0A 4A06A 3W55A 1M14A 3AC2A
chains in the Genus database with same CATH superfamily
3PG3A 4BF2A 4WO5A 5HE2A 3ZLSA 3C13A 2R3KA 3H0YA 1JSVA 3DQWA 4E6AA 1GZNA 3NRMA 2C30A 3O8PA 5HU3A 2YIQA 3DDQA 3UMWA 4DEEA 4EEVA 3G2FA 2Z2WA 4CRSA 1YHWA 2QKRA 3GNIB 3K2LA 3UYTA 3VS5A 2PMLX 3EN5A 3OXTA 1Z57A 3BHUA 4EC9A 2YJSA 2ZMCA 2ITPA 3PP0A 5M06A 3FMHA 2X8EA 4GK3A 5KKRC 1WBOA 3RTPA 4FTRA 4GFMA 4FSQA 4R1VA 4HVGA 2WU6A 5CF5A 5IEVA 2PYWA 3LFAA 4HYIA 5HX8A 4D1SA 3PSDA 4JX3A 3L9NA 3QZGA 3D7ZA 2XRWA 1URWA 1JSTA 3VVHA 3UDBA 2YM4A 1IRKA 4BDBA 4O7LA 1UV5A 4U45A 5DG5A 3R9HA 4CT2A 3D14A 3NEWA 4EZ3A 2WTCA 4DBXA 3HMPA 3RPOA 3KY2A 2O2UA 3GC9A 3GU5A 3OWPA 2J50A 3DKCA 3O2MA 4C2VA 4BBFA 1YI4A 4FG9A 1PKGA 4I24A 3VQUA 4DG3E 5IA4A 5E8SA 1T45A 3POZA 4DLJA 2V0DA 1Q24A 3ZOSA 4AG8A 3AC3A 4RJ6A 5AV1A 2QOQA 2OJFE 4UMQA 3VS1A 3ZBFA 5HBEA 2WGJA 5AP5A 3F9NA 3BWJA 4E20A 2HWOA 2Q0NA 3QL8A 3FKNA 4KKEA 4EOPA 1OBDA 1CKJA 1P4FA 3FMKA 3KMWA 3CJGA 2X7FA 4FT5A 2W1IA 4IZYA 4FKRA 3NUPA 3PA4A 3F2RA 4JG6A 5F4NA 4EBWA 4D2VA 3LFQA 3UDTA 5HQ0A 1MRUA 4GIHA 4O0WA 4W9WA 5CQWA 4FIGA 5HHWA 3U9NA 3VUHA 3GOKA 5CAOA 3JR1A 3NFGB 3LFNA 3QD4A 4GS6A 1OM1A 4FTCA 4U3YA 1O6LA 4EJNA 4G3GA 5H8EA 5D11A 5CNNA 2BPMA 3EH9A 4QP7A 4DEIA 3QA0A 4ZLZA 1JKKA 3PVBA 5HD7A 1W83A 3MY0A 3W2OA 3SD0A 2C3IB 2CGVA 2WTKC 3QXOA 4ZAUA 4K6ZA 4HYSA 3FE3A 4YBJA 2O0UA 1O6YA 3LQ5A 2GHGA 4QQCA 4ZJJA 4USDA 5GIOE 2YERA 3ZSGA 5F1ZA 4O96A 4YGAA 3EOCA 3PUPA 2VUWA 3G5DA 4DG0E 4FTKA 2Z7LA 3RPVA 2P33A 4ZS0A 3W1FA 3FMDA 1WVXA 1UNGA 3HLLA 4GVJA 4FTLA 4C4IA 3G90X 4RIYB 4O21A 4O6LA 4A4OA 3UGCA 4F1TA 4FV7A 2WMXA 5AUXA 3FMJA 4TYHA 4F7LA 3WF7A 2ONLA 2QOIA 3OVVA 2SRCA 2PVHA 4DHZA 2A2AA 4BBEA 2R3IA 4LV7A 2VWYA 4XG7A 2GU8A 4RIWA 4FODA 4F7NA 4PNKA 5CNOA 5TKDA 1ZXEA 3MJ1A 1OMWA 4PMTA 5HCZA 2HAKA 4O22A 1Q97A 5TR6A 4GEOA 4EOQA 5HGIA 2AC5A 2YN8A 3IONA 4IE9A 3IW7A 1OL1A 1IAHA 3W8LA 1L3RE 2C6IA 1E1XA 2UW5A 3R63A 5M4FA 4RBLA 3KFAA 3F5GA 4QTCA 3EL7A 2QO2A 3FY2A 3I6WA 4YURA 4G9RA 3DFAA 5EYMA 3CTHA 5KMLA 1OI9A 3LKMA 5FP5A 2GSFA 2W17A 4FT0A 1M7NA 3BHVA 2VO7A 2G1TA 2QQ7A 2YM6A 3F2NA 3NIZA 4XJ0A 1NVSA 3R9NA 4IDTA 4AOIA 3QAME 4GG7A 1W2CA 2GNFA 3GENA 4QD6A 4RFMA 4KIKB 3ZC6A 5HNIX 3HUBA 5EH0A 4YZBA 5EW3A 4XG2A 4DFBA 3TDWA 4D1XA 3Q4ZA 1P4OA 3VHKA 4GU6A 2PMIA 4J71A 4PL5A 5FP6A 3ZUUA 3LXKA 5AV3A 5BMMA 3VHEA 4F09A 2UZVA 3JVRA 3KEXA 1YWRA 4MVFA 1PXNA 4IAYA 4R5SA 4LFIA 5DN3A 4APPA 4DTKA 4JQ8A 3KK8A 3GVUA 4LYNA 4O7SA 1JNKA 4L45A 4P5QA 3HV7A 4V01A 3UNJA 4EOIA 1ATPE 5M51A 4YJOA 5CSWA 2CN8A 3OF0A 3TKUA 1DM2A 3R22A 3R7UA 4LMUA 3ROYA 3UO4A 3VONA 4R77A 3BQRA 3TNWA 5DRDA 1Q41A 1XKKA 4L01A 2YZAA 2UW6A 2YIRA 4FTOA 4NWMA 3ZFMA 3C0IA 4CMTA 3BLAA 4LDTA 1WFCA 2X9FA 4BCHA 1OUYA 5JGDA 5L8KA 5GINE 2WTWA 2C6LA 3VUTA 4GUEA 2XARA 4GIIA 4TRLA 1ZZLA 5BVEA 2HYYA 4XV3A 2WD1A 3VBQA 4YZ9A 3KXGA 5ANEA 4O86A 4B6LA 4IB3A 5E1EA 1W7HA 4Q5EA 4PP9A 4GG5A 2YLFA 3FLSA 4BWPA 4F0FA 4UN0C 2BZIB 4DF3A 5FXQA 4XG4A 3GC7A 3ZU7A 5H2UA 4FTQA 3PZEA 2Z60A 4C0TA 2WU7A 1H4LA 2J5FA 3N4UA 3JYAA 3NDMA 2HY81 2VWUA 3GU7A 4G17A 4HCUA 4LV8A 4BZDA 5D10A 3KVXA 1XBCA 2X81A 5IPJA 1E1VA 3E63A 5L4QA 3RVGA 3ZYAA 5K4JA 4LUEA 2GNIA 3GQIA 4TYJA 5KE0A 1PXKA 1XH4A 3K5VA 4MXYA 5HG7A 3E62A 3FZSA 3UVPA 4R3CA 4AAAA 4EH4A 4CLJA 4XOYA 5LMKA 3EZVA 2VTAA 5C8KA 3IOPA 2QLUA 2W06A 2HZ4A 3KMUA 4I21A 3R8UA 1YKRA 2R5TA 3L8SA 3FPQA 3ORIA 3LMGA 4L44A 2W1ZA 3RNYA 4GSBA 3E87A 3ZO4A 3KL8A 4F9YA 2VZ6A 4APCA 3P08A 2C3LA 5JRQA 3O7LB 4ARKA 2ZV9A 5AV4A 3DXQA 3FL4A 3JVSA 1XH6A 4FIHA 3BBWA 4W4XA 4NUSA 3L9PA 1NY3A 4C61A 4CYIA 1LP4A 4DEDA 3H3CA 3BHHA 3BL7A 3NUAA 3RKBA 4ASZA 2W9FB 4TYGA 4YO6A 4E93A 5E9EA 1MRVA 4WNMA 1TVOA 3R2BA 2WTIA 5CSXA 1CKPA 5EYCA 2XKDA 5BUEA 1ZOEA 5CEKA 5FUTA 2HW6A 5EDPA 4IVDA 4UB7A 4Y83A 3TIYA 4QQTA 3UOKA 5F94A 3ULZA 4YR8A 4FTJA 3I60A 4DFLA 4H3PA 5HO6A 4O7RA 4A9TA 3R02A 2B52A 3DBDA 3QRKA 3OXIA 3R1SA 3TL8A 4BVUA 3RAHA 2VWWA 4DITA 4UYNA 4GUBA 3H9FA 4XLVA 4F6WA 3IECA 5A4TA 4XG3A 4LRKA 2IZTA 5IEXA 4N57A 3A7GA 3QD2B 2YWVA 3TM0A 5HIBA 4HGTA 3C7QA 4IQ6A 3NSZA 5H8GA 4AQCA 4DCEA 4BCGA 3NCZA 2BRNA 2WEIA 2WPAA 5CU6A 3NFFB 2XB7A 3PPZA 4JL9A 1BX6A 2UZTA 3MVHA 1JKLA 2X2MA 3FQHA 4AFEA 3IW6A 2GNJA 4WNKA 5HNBA 5L6WL 3R7EA 2R0UA 3P78A 4JDJA 2W5AA 3LE6A 4ALVA 5J79A 2BRMA 3DKGA 1KUTA 4FSNA 4ZMEA 4CQEA 5HIEA 3VRYA 1PJKA 1XJDA 2GMXA 1DAYA 3NWWA 3PXZA 4O7NA 4QMPA 3WZJA 3PFYA 1MRYA 3QQKA 4IADA 4RT7A 5AP1A 5FEQA 2W1EA 2NRYA 4BCKA 3O8UA 3FKLA 2ITYA 1LEZA 4BI0A 2X4FA 1RDQE 3HMNA 3FAAA 2I6LA 4FL2A 2W1CA 3MWUA 2UV2A 1F5QA 4Y5HA 3F5XA 2VTSA 4BY9E 1PXLA 4MK0A 1BL7A 3LLTA 3SRVB 5DGZA 3BGZA 4FSRA 4QRCA 1UWJA 5FBNC 4YJPA 4ENXA 4F1OA 3QTRA 5DNRA 5FRIA 4ZZNA 4ACGA 4OTRA 4E6DA 2QC6A 2XIXA 5TOZA 5I9ZA 4K1BA 5EI2A 5CVHA 3Q2MA 4LOOA 3OTUA 2UW3A 3EHAA 3DU8A 1W0XC 3UBDA 5HLPA 2JDRA 3PJCA 3HDNA 3K54A 4EHEA 5IQDA 3D5WA 3PP1A 4FG7A 5I0BA 5ETIA 1TQPA 2GNGA 1R0PA 3W33A 4AS0A 4B7TA 3WF9A 3MVMA 2ERKA 3Q6WA 4O4BB 3FLWA 2F49A 1VEBA 2PE1A 4IH8A 5F95A 3RWPA 4CVAA 4FTTA 3HMIA 5E1SA 2CKPA 4YLKA 1OKYA 4N70A 4AZTA 5I9UA 1G8JA 1G8AA 3FV8A 3PE2A 1UU3A 3R2YA 3QA8A 5HI2A 3F3VA 2QOKA 5JT2A 1XHAA 3V8SA 4PMMA 3ZUTA 1YXSA 3CKXA 4G6OA 5BVDA 3FL5A 3IDPA 1U54B 2ITWA 4FKQA 5IQEA 5FEDA 3PJ8A 3F3UA 4G31A 3O8TA 3WYYA 3OC1A 3RM7A 4IVBA 3D94A 1KE8A 4ERKA 3S2PA 1BI7A 1UNLA 2R0IA 4CCUA 4QMMA 5CS6A 4F08A 5J9YA 4DHJA 2FSMX 3BI6A 3CQUA 3KA0A 4QYGA 2XJ1A 2CKQA 4QYFA 2B9IA 3A4OX 3QXPA 4ZY5A 2P2HA 4FKVA 4N4SA 4I5PA 4QYHA 4AGDA 4C4GA 3LXPA 4MD9E 4XG6A 4MUQA 4FIJA 4ANLA 4ASEA 2Z8CA 3Q9ZA 4QP9A 1PXJA 5FQDC 2BTSA 2C6MA 2NPQA 3UVRA 3OWJA 3CE3A 3KULB 5ANDA 4U9AA 3OTVA 3QTUA 4K8AA 2PTKA 3AKJA 4R7BA 4EQCA 2Z7SA 2GQRA 4RQVA 3PRFA 2OKRA 3RPYA 2ZV7A 5HG5A 5CXZA 2Y6MA 4IWPA 4BYJA 4AOJA 3CIKA 4FYOA 3C0GA 2Y4IB 2XIYA 5HTCA 3LPBA 3TV6A 5IUHA 4CFVA 2Q0BA 4ZXTA 3M1SA 4PDSA 4C57A 4EL9A 2HWPA 2JKQA 1IR3A 2OF2A 2VWIA 2WKMA 4K9YA 3DZOA 4YPDA 3KN5A 2PY3A 4NU1A 4MX9A 2BUJA 4NJ3A 1GIJA 2C6DA 3GU8A 3NYNA 2Y9QA 3DXNA 4G2FA 4MCVA 4FV8A 3NAXA 3N4VA 3GB2A 4Y72A 3NPCA 3IOKA 4XYFA 4QT1A 5FXRA 1NXKA 2ZYBA 1P14A 3H30A 4M66A 2UW7A 2BDJA 3V5TA 5BQ0A 5HBJA 5IA0A 2CMWA 4G34A 4HPTE 1WVYA 2JBPA 1GAGA 3QUPA 5LCJA 4ACDA 4FE2A 2VTOA 4YSMA 3HP5A 2PVKA 4NW6A 1GY3A 4IVCA 3Q3BA 2PU8A 4FVPA 2R7IA 1Z9XA 4C38A 3Q60A 3BCEA 2XUUA 5JK3A 5DWRA 4FNXA 4Y73A 5AMNA 1UNHA 4BB4A 2ITTA 2JEDA 2XZSA 5DH3A 4BCJA 2YAAA 5KMMA 3OCGA 5LJJA 5BVOA 5D9HA 2BIYA 2A27A 2W5BA 2YABA 3A99A 3IPHA 4YHTA 3CEKA 3R7VA 2ZV2A 4BDHA 3V5LA 1STCE 1V1KA 4F63A 3QWJA 2BILB 5CASA 2W1GA 2UVZA 4CZYB 2HENA 3EWHA 2YM8A 3FLZA 5D12A 2F57A 4EQMA 5EDRA 4A9SA 2NYAA 1VR2A 1FGKA 1M2RA 3Q9YA 5L3AA 1YOJA 4M68A 4TTHB 2IW9A 3FHIA 2QOHA 4NEUA 3PA3A 4W4VA 1K3AA 4U6RA 1ZY4A 5IA2A 2IVSA 4XS2A 3MFRA 2G01A 3FYJX 3BU6A 4FL3A 3QRUA 3TIZA 2YCQA 4O2ZA 3EQDA 2FB8A 2RSVA 3F66A 4IB1A 1WBVA 3MTFA 4OGRA 5FD2A 3RGFA 5FDPA 3GCUA 2ETRA 4JVGA 1QPEA 2PWLA 4D55A 4H05A 5DYJA 2FSOX 4KBKA 2WIPA 3MV5A 3FPMA 4BI2A 2FUMA 2JBOA 4QYYA 3E92A 2W1HA 2Y4IC 2A98A 4FKWA 5HCYA 3V51A 3NUXA 1H28A 4AGWA 3LOKA 5LVPA 2AQXA 4IJPA 4U44A 2A0CX 5IH6A 3G0FA 4M8TA 3GQLA 3MGYA 4C4EA 5IISA 3NVMB 1JPAA 3FDNA 3OD6X 4Q5HA 2OIQA 3AKLA 3MB6A 5HNGA 1YWNA 1KE7A 3W2PA 4DEBA 5AP0A 1OL6A 4O0VA 4FTNA 4PV0A 4Z3VA 4JG7A 5AUZA 3QYZA 4DT8A 4FEUA 1H8FA 3E8CA 4EOSA 1PMVA 3CP9A 1XQZA 1M52A 1FVRA 1ZYLA 2AYPA 2RF9A 4WRGA 5CEPA 5KX8A 5A4EA 4FJVA 1HCLA 5LWMA 5A4QA 3UZRA 4CT1A 5JSMA 3O7LD 3M42A 4MF1A 5AP3A 4USEA 3COKA 2UW9A 4RFYA 4ORKA 2XALA 3Q04A 4U0IA 3E7OA 3DOGA 3P4KA 5HLNA 3Q2JA 2RFNA 3QCXA 4CXAA 3OBJA 3BWFA 5BX0A 3DLZA 3D4QA 4UV0A 1REJA 5KCVA 4O0XA 2Z7RA 2V62A 4MNEA 3HGKA 2PZYA 5CZHA 2CGUA 4Z7HA 3O5AA 3QCQA 4QMOA 3MTLA 4D2RA 5CSPA 4G3DA 4E4NA 5M09A 1OIYA 3FLNC 2QLQA 2ZDTA 4EORA 4FUXA 4QP3A 1I44A 3QX2A 3OOMA 4CFFA 5FEEA 4ZTMA 5BV3A 3QQHA 4QOXA 2X0OA 2BHEA 3DNEA 3WF6A 2CNQA 4JOAA 4ERWA 2RGPA 4MD8E 3JUHA 2GDOA 4I94A 2C0TA 4I41A 4V0GB 3A8XA 3VQHA 3NNVA 4EK3A 3AC8A 3GP0A 2BHHA 2J0JA 3EQBA 5AR3A 4BGGA 2YWPA 3Q4TA 5FLFA 5CEMA 3OBGA 1JOWB 1OGUA 2BTRA 2O63A 1LR4A 2VV9A 3MH0A 4R1YA 4UZHA 3H9RA 5HKMA 3PTGA 4WSQA 1PYXA 3HDMA 1PMUA 4C3PA 1V0BA 4IWDA 2XEYA 3F88A 2JDOA 4L42A 4OLIA 1ZYDA 5FTGA 2OJ9A 4IM2A 2R9SA 2W5HA 4H36A 4QTDA 4RJ5A 4FV0A 4M3QA 3TG1A 4BL1A 2C5OA 2V7AA 2C0IA 3BV3A 3PY0A 5E90A 4BDAA 3C5UA 4FOCA 4F65A 3UDSA 4RJ3A 5M55A 4BTMA 2R3QA 3KREA 3P5JC 5AFVA 3C4FA 4FTUA 2WMVA 5IQBA 3S00A 4L46A 2VTHA 4O7WA 3FI4A 3GFEA 3UDZA 2ZM3A 3KMMA 4PDYA 4L6QA 2RFSA 3ZUVA 3GCQA 5FGKA 3QZIA 2F2UA 3MN3A 3QYWA 4CD0A 3NNUA 4AE6A 2XKCA 3IGGA 3EYHA 5L8JA 3FZ1A 2OI4X 3F3TA 4P4CA 4JX7A 2PVJA 2W4JA 4KD1A 2X4ZA 3EQHA 3O0GA 3HNGA 2X0QA 4X2KA 4BDJA 4BI1A 3R7OA 2QHNA 2HW7A 4XP2A 4BN1A 2EXEA 2IW6A 2WNTA 4J8MA 4TT7A 1PKDA 3D83A 1G8SA 4ZZMA 3SKCA 3DBCA 2OG8A 4ONAA 4NT4A 4BDDA 3RP9A 3EFJA 4EH3A 3V8TA 2XNBA 1FINA 4RIWB 4AOTA 3NX8A 4E5WA 4O2PA 5DR6A 4DFUA 5IA1A 3VUMA 3OHTA 3NYOA 5L2QA 2LGCA 3LIJA 2W4KA 4PL3A 3E88A 4ITHA 4P5ZA 4RIOA 3WIGA 4DG2E 4C59A 2HCKA 3HX4A 2XBAA 4O0TA 5DRBA 3CXWA 3LQ3A 4FEVA 1QMZA 2GPHA 3UIMA 3N4TA 1OL2A 4X2GA 2A4LA 2ACXA 3EN4A 2ZJWA 3U6HA 4DT9A 1ZZ2A 4XRJA 4FRFA 3UMXA 4YTFA 3II5A 4DDIA 3AG9A 1KE9A 2GHMA 2X2KA 3ANRA 1URCA 4PRJA 2HK5A 3GFWA 4YNEA 2XYUA 4M7IA 5HCXA 4USFA 5K5NA 4JAJA 2R3JA 4IAFA 3PLAE 3KCFA 3LMIA 3D7TA 2WMUA 4GU9A 3MH2A 4KBCA 4K0YA 3SW4A 2HZIA 4UXQA 2JFLA 4CRLA 4WKQA 3R01A 2BVAA 2UW4A 5E8YA 1B39A 1HOWA 5IF1A 3PVUA 5EI8A 3W8QA 3ZONA 3EKNA 5BVKA 2GCDA 4OT6A 3P9JA 4PDPA 5AX3A 4FVQA 4KABA 4I1ZA 2JITA 5GHVA 4JT3A 1VYZA 3KK9A 3T8OA 4XUFA 1OZ1A 4G3FA 3P7BA 2C5XA 3I4BA 3QLGA 5LVLA 4QP8A 1R3CA 4QMSA 1GIHA 4C02A 4A9UA 2PSQA 2IF8A 3QWKA 5G6VA 4N6YA 5JH6A 3V5JA 5AAEA 1Q4LA 4PQNA 3Q4UA 4O1OA 4RA4A 4E4XA 2YHVA 4OTHA 5FBOA 4IW0A 4DN5A 1XBBA 5CU4A 4O82A 5E4HA 3OEFX 2OZOA 1WAKA 1J1CA 2QG5A 4YTIA 4PMPA 1YDSE 4DGOA 5CVFA 5FTOA 3MESA 1G3NA 3QQGA 4S2ZA 4ANMA 5AUUA 3BV2A 3OY1A 1U59A 3C4CA 2XH5A 5H3QA 3B2TA 5IQHA 3IDBA 4DC2A 4DGGA 3AD4A 4FL1A 4O38A 4JBQA 3TNQB 4DFZE 1R78A 4EH6A 1WBTA 3VWAA 4KAOA 2JAVA 4YLJA 5EM7A 1Z5MA 1YDRE 1FQ1B 4E4MA 4FT3A 4E6QA 3UTOA 4RLKA 4ZSLA 2J0MB 4YJRA 5BPYA 4RLLA 4D4YA 4UY9A 5G1XA 5EOLA 2VU3A 2X0GA 3ET7A 4BZOA 4HW7A 1OL7A 3R71A 4KRDA 5CU2A 2P2IA 4EK4A 3QTIA 5AX9A 2WQBA 4U3ZA 1YW2A 3EQCA 5EM6A 2YA9A 3D5XA 2WQEA 2CJMA 2VWXA 3CD8A 3O96A 4OAVB 3W32A 2Y6OA 4R7IA 2P4IA 3CY2A 4DH7A 5EOBA 3UO6A 3CSVA 4AAYA 3UODA 4O0RA 4F0IA 4M13A 3Q4CA 4ASDA 5F9EA 2J90A 1ST0A 4RC4A 3MDYA 1Y6AA 2YFXA 4QEBA 3OCSA 2OXYA 3NAYA 4D4RA 3TV4A 3RK9A 4GT4A 2PUPA 3AQVA 4M97A 4N6ZA 4QDVA 2RFEA 1JBPE 5I4NA 1WBWA 5IDPA 5C27A 4IZ7A 3A7JA 4I4EA 4AN3A 1PMEA 3P23A 4HJOA 3VO3A 3TEIA 5B7VA 3AGLA 4EOJA 3VBTA 4FEXA 2YAKA 1XR1A 2CDZA 5LVMA 1QPJA 3KN6A 4AW0A 1YVJA 3QUEA 4FBXA 4MQ1A 3PRIA 4BTKA 3GXLA 3HRBA 1NA7A 2O8YA 2JGZA 4UX9A 1OVEA 4II5A 4TY1A 5M4IA 3W0PA 5DOSA 4D4SA 4AXCA 3HL7A 2QNJA 4FICA 4NIFB 5DEYA 5JFXA 4KUJA 3TNPC 1ZOHA 3TXOA 4JR7A 3I0OA 3HUCA 3QRJA 2J0LA 4HZRA 3RCDA 2XCKA 1YXVA 4K11A 4WG3A 4QO9A 4IX5A 2B0QA 1REKA 1Q99A 3CS9A 1CMKE 5IUIA 4QQ5A 4FF8A 3W0OA 1IG1A 1XH9A 4AZWA 2YZLA 2QHMA 3W0NA 4BIBA 4LMNA 5L6PA 2UVYA 4A7CA 4M69B 4DHIB 1NT2A 3KIOC 4JQ7A 5ITAA 3FZOA 3BYUA 2HY0A 5IKWA 2LAVA 5CAPA 4FEQA 3RWQA 3G9NA 4U97A 3IKAA 3PJ3A 5T68A 1ZRZA 3EN6A 4Z55A 4YC6A 2YCSA 5J9LA 4UXLA 4E7WA 5HX6A 3QKKA 4JJRA 2YACA 3ORKA 4KRCA 3F3ZA 5EKOA 3I81A 3VNTA 2OXXA 4QMXA 3H9OA 3O51A 3ZTXA 3ZDIA 4EH5A 5GZ9A 2QOFA 3CJFA 3QD0A 3HV3A 4FIIA 2BKZA 4XP0A 1A06A 2E9UA 2WTDA 2OU7A 3NYVA 2PVFA 4CFWA 5DBXA 4GT5A 1OIUA 4FR4A 4NCTC 5CYIA 3PWYA 3HV4A 3TZMA 4G1WA 4ZSEA 1Y8YA 3AMYA 2XJ2A 3HEGA 4QPAA 5I9WA 5DA3A 4LQMA 3MFTA 5DT0A 1PHKA 5HTIA 5LMKC 3OW4A 2G15A 5A14A 2WMBA 2ZVAA 5C1QB 2JDSA 3TWJA 4BCQA 2VNYA 2WMAA 3SXSA 2OXDA 1XO2B 2ITOA 3VJNA 5JFWA 1K2PA 1SYKA 1U5RA 2GFSA 4FKLA 1PXMA 3QTZA 4IMYA 4LRMA 4WT6A 3OCBA 2XM9A 5CEQA 3HKOA 4I92A 2PMNX 3TKHA 3SAYA 4DFXE 2C6OA 2ETKA 4HVDA 4RZWA 4U79A 4FGRA 2B9HA 4FNYA 5DFPA 4FSYA 3ZH8A 3UE4A 1SMHA 2BIKB 3U54A 5ANJA 2JKKA 4BTFA 3R1YA 5CTPA 3GU6A 5FDXA 3WZKA 2PE2A 4FK3A 5KBQA 4FV3A 4FKJA 5KMOA 2WELA 3QGWA 5ETAA 2BZHB 3BEAA 1ZLTA 4XCUA 3G6GA 2XNOA 2XAOA 4BJJB 5K5XA 3UPXA 3IO7A 2QR7A 5J8IA 3EFLA 3FSKA 4ZJVA 3IS5A 4DGNA 3TKIA 4ZLOA 2VTJA 4XRLA 3JPVA 2WZJA 3KRWA 4NM0A 5CQUA 5CAVA 4ACHA 4D58A 5CF4A 1OIRA 2OBJA 4JR3A 4ZK5A 2PE0A 5C8MA 3CPBA 2UUEA 4U81A 4BDCA 2X2LA 3TCPA 2C5YA 3KRJA 4MWIA 3F82A 5A6OA 2ITXA 4GFOA 4O7ZA 1SZMA 3BQCA 3ZZEA 4B4LA 1H0VA 5JMSA 3UG2A 2R3FA 3ODZX 4G6NA 2GQGA 4W8EA 5ANIA 4FIEA 1KWPA 3L1SA 3FBVA 4D9UA 5J1WA 4I22A 5DR9A 4IZ5A 3EMGA 1FMOE 3QQUA 4XBRA 4DH1A 2BR1A 5DIAA 2WOUA 4RIYA 1QL6A 4EZ7A 3RK5A 2REIA 2V22A 2X0PA 1XH7A 3SHEA 4RC2A 5CANA 4H58A 3LXLA 3AT2A 1KV1A 3NMUF 2RL5A 1PRYA 4AXFA 1UU8A 3DKFA 3OMVA 3PXRA 4TNBA 2R3PA 3UP2A 4FV5A 3OCTA 2W9ZB 2RFDA 4BR3A 3AC1A 5AP7A 1FVTA 2WXVA 4BDEA 1H0WA 2GQSA 4I3ZA 3ZO3A 3UQCA 3FC1X 4E4LA 2C6TA 4F0GA 1AD5A 5E91A 5E8VA 4BFMA 3PVGA 4I6LA 2IVVA 2VGPA 3Q9WA 2JFMA 3QBNA 4X6RA 5AR8A 3ATSA 5D7AA 1V0OA 1Q8UA 4RJ8A 4DLIA 2BKKA 5ACBC 3MS9A 4GJ3A 3K5UA 4CFNA 3U6JA 1F3MC 2W05A 4L7FA 3LLAA 4LL0A 4BDFA 5AJQA 3JY0A 5HO8A 3VAPA 4MHAA 4KIKA 4X6QC 4CGAA 4BIEA 5K0KA 3E64A 2B9FA 4QMZA 4Y46A 4HVSA 2ITUA 5M53A 3LFSA 4QMUA 4GRBA 3SG8A 1WZYA 4YP8A 3HZTA 1MQBA 2QURA 5AIKA 4YPSA 3NVKI 4FSMA 4O91A 1KV2A 3TDVA 3E7VA 2VTRA 3S0OA 4JG8A 5EW9A 4AW2A 3A4PA 2Y0AA 2ZV8A 4DBNA 4A9YA 2VRXA 4G5JA 3NGAA 4FOBA 3F3WA 1RQQA 3CTJA 3I1AA 3V04A 3GBZA 3KXXA 4QMVA 4XP3A 3RINA 4F70A 5E7RA 4RVMA 4X21A 4Q9SA 2VX3A 3DT1A 4RVTA 4I6QA 2ZOQA 3ORLA 3PWDA 5IQIA 4IANA 1GIIA 3R73A 4MF0A 3COMA 3T3UA 4FSTA 4B8LA 3NR9A 4A4XA 2XIZA 3LJ0A 4EZ5A 4FMQA 5CF8A 3U4UA 2C68A 4LL5A 3TUDA 2XNMA 3G0EA 5TE0A 3ODYX 3RMFA 2XNNA 4FVRA 4NTTA 5DLSA 2F4JA 4C8BA 4LGDA 1OBGA 3PPKA 5KBRA 2FGIA 2IWIA 2YM7A 4RPVA 5DR2A 2IVUA 2BAQA 1UA2A 5L2SA 1JQHA 2WMWA 4KIOA 4BICA 3EQFA 2CGWA 4KKGA 1M2PA 3OZ6A 2V55A 3R9RA 3QC9A 4GW8A 5HVKA 3CKWA 3R30A 4UMPA 2YDIA 1Y57A 3W0RA 5A54A 5EQEA 2XCHA 3RCJA 4CKJA 5KNJA 5AR2A