5FEEA

Egfr kinase domain t790m mutant in complex with a covalent aminobenzimidazole inhibitor.
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
322
structure length
287
Chain Sequence
EAPNQALLRILKETEFKKIKVLGSTVYKGLWIPEGEKVKIPVAIKESPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDEMDDVVDADEYLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of (R,E)-N-(7-Chloro-1-(1-[4-(dimethylamino)but-2-enoyl]azepan-3-yl)-1H-benzo[d]imidazol-2-yl)-2-methylisonicotinamide (EGF816), a Novel, Potent, and WT Sparing Covalent Inhibitor of Oncogenic (L858R, ex19del) and Resistant (T790M) EGFR Mutants for the Treatment of EGFR Mutant Non-Small-Cell Lung Cancers.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Epidermal growth factor receptor
total genus 89
structure length 287
sequence length 322
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5feeA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5feeA01
2W99B 3DBFA 4NSTA 2W1GA 3K3JA 1XBCA 2WTKC 3IW8A 4NJDA 3ITZA 4C2WA 1OKZA 4YHJA 3KXZA 2BRMA 4GG7A 4DEBA 2GNGA 5IA4A 4EOMA 3NX8A 1M14A 4BIBA 4IVBA 3KRWA 3TXOA 2BDJA 5E9EA 2O63A 2PZRA 2GTNA 3FWQA 3MY0A 2VNWA 3QC4A 4NK9A 4PTEA 5JMSA 4BCPA 2WFYA 3QUPA 1B38A 3KF4A 4M69A 5I9UA 5GHVA 3C0GA 3ZRMA 4ASEA 4I4EA 3VVHA 2UW4A 4RIXA 1XH9A 1RQQA 3V3VA 4IB1A 4C0TA 4BVUA 1H28A 3TUDA 1F5QA 3TNIA 4CVAA 2HZ0A 3LVPA 4WG5A 5KNJA 5I5ZA 2PE1A 3GU6A 3EQBA 3TV6A 3UOLA 3ZO4A 4QP9A 3RK5A 3EZRA 2C47A 5IDPA 3JXWA 3GT8A 3Q6WA 4YTCA 4CQGA 3LQ3A 3MVJA 4CTCA 3GCUA 3LJ2A 4UYAA 2Z60A 2W9ZB 4Y46A 4EOJA 4ZAUA 2Q0NA 3RHKA 4F08A 4TPTA 1B39A 2PK9A 4RJ5A 5I9YA 3F66A 4FE2A 4GT5A 3ELJA 3OROA 3HV7A 2EUFB 2B9IA 2JKMA 4IJ9A 4QTCA 3BV3A 3LFCA 5BYYA 2C0OA 2VTOA 2R0IA 4R3CA 3DZOA 3PVGA 3OD6X 2ZJWA 3D2IA 1WBNA 3SRVA 4E7WA 4ZZMA 4ZMFA 3GQIA 4BCKA 2ITTA 1T45A 3NNVA 4O86A 5CQUA 3ZC5A 1Q8TA 4X7QA 2G2HA 3VNTA 4L9IA 3IDBA 4O38A 3I60A 5EI6A 3HRBA 3W1FA 5CF6A 1G8SA 3UGCA 1FVRA 3EQRA 3ACJA 5HEZA 4RJ3A 4RJ8A 3KCKA 5AM6A 2XK9A 4LL5A 2WB8A 4ZOGA 3MFSA 5CSPA 2CPKE 3LPBA 3VBYA 2PVMA 2PHKA 3L8XA 4UWCA 3ENHA 3GUBA 4AQCA 5KKRC 4I93A 3EQPA 4FKSA 1FMKA 5B0XA 4HGEA 4KA3A 4IB3A 4W4XA 4ZSLA 3V5QA 4CXAA 3R9NA 4WUNA 4DLIA 2ZM4A 4Q9SA 2X8DA 4S30A 2VX1A 4E93A 1OUYA 3DLZA 1RW8A 4KABA 2XEYA 3BLHA 3HV6A 3P5KA 1Z9XA 4OTWA 4U44A 4JQ7A 2ZOQA 4G3CA 4C8BA 4CTBA 2A27A 5JSMA 3OHTA 2F2UA 4TL0A 3DKFA 4QP2A 4WRSA 2BRNA 4I92A 4D2PA 4XBRA 4C33A 4HVIA 2UZDA 4W4VA 3ZMMA 2YIYA 5IU2A 3M42A 3TN8A 4BCJA 2WQBA 3CKXA 4KIPA 5HBHA 2W1IA 3ZLWA 4EBVA 2OF2A 4M3QA 4OR5A 4W8EA 4DGOA 3BE9A 1PYEA 1DAYA 4FKWA 4HOKA 4UY9A 2C5VA 4N57A 3WZUA 2PY3A 2FSLX 4R7HA 4GCJA 4ZTLA 3SD0A 2P2IA 3MA6A 4QQ5A 3TG1A 4BZNA 5IQGA 4J71A 4G31A 3CJFA 2WO6A 2C6DA 4B6LA 4BDDA 3RI1A 3AOXA 3QKLA 5EKOA 4ZLZA 2V22A 2XMYA 3ZM9A 3VJNA 4Y5QA 4BCQA 4CLJA 2WIPA 3VS4A 4BDCA 1OPJA 5LVMA 4C7TA 3EH9A 3I79A 3N51A 4TWPA 5FGKA 4M7IA 3W8QA 3NNUA 4FIHA 3OWLA 3UOKA 4B8MA 3ORPA 3UO6A 5KZIA 2O3PA 1Y6BA 3ODZX 3PXRA 4GJ2A 3F3UA 3CY2A 4K11A 3MSSA 4HZRA 3BIZA 3HMIA 3KVXA 4NKAA 4YZBA 5KE0A 4E5AX 4RZWA 4GIIA 4PMTA 2P55A 1YDTE 2WQEA 4A4XA 1OM1A 2WMVA 3KRJA 3B8RA 4OT5A 2CHLA 2BUJA 1Q3WA 3QTWA 1P14A 5J5TA 2XIZA 4CT2A 4CMUA 3O23A 3RBWA 5C4LA 4GKHA 1XWSA 3NZ0A 4Y8DA 2J2IB 4Z16A 1OIRA 2RFNA 2XNEA 3PZHA 4RA5A 4O7TA 4H1MA 4CMOA 2QLQA 4EC9A 5E4HA 4QOXA 3B8QA 4F64A 3HGKA 1V0BA 1FGKA 2C3LA 4XJ0A 3S00A 5EI2A 3A8XA 3FI2A 1XR1A 2R3NA 2UVXA 3EQHA 3GU7A 3QZIA 1NW1A 5EQYA 3LQ5A 4TWNA 3VUDA 4L44A 1PF8A 1VZOA 2YLFA 4FL2A 4FYNA 3RPRA 3NW7A 3RNIA 3F6XA 1KE8A 2Z7RA 4H3BA 4UB7A 3P7CA 4F7SA 4C62A 1LEWA 4Z7GA 3CY3A 3DA6A 4YLJA 3FXZA 3U4UA 4IDTA 4DGLC 1UWJA 4F63A 4FC0A 3QYZA 4BB4A 2IZUA 4FG7A 5FDPA 4RG0A 3MJ1A 4OTHA 2QOOA 3Q4UA 5L8JA 4U45A 5M51A 5KBRA 3ZUTA 4LFIA 5BYZA 4BTKA 4H05A 3MIAA 2UW6A 3R1NA 2HWPA 4TNDA 3D5WA 1PKDA 3MS9A 4RQKA 1K9AA 4FNYA 2OSCA 3GI3A 1CMKE 3EFJA 5D7VA 5TKDA 3PLAE 5EOBA 3IOKA 4NT4A 3N9XA 3C13A 1H0VA 2GNJA 4OT6A 2XRUA 5EW3A 3UNKA 4C4IA 4FL1A 4ACHA 5D41A 3IGOA 3UG1A 3QGWA 4I24A 3MA3A 5CVGA 3UNZA 5EH0A 1CTPE 3MH3A 3AD5A 3Q2JA 4AZSA 2XNNA 4WKQA 2OGVA 4DTBA 5CXHA 1BLXA 4FF8A 3CSVA 2ZB0A 4FKIA 4GMYA 2HWOA 3QCYA 1J1BA 4FZ7A 4M15A 5M4IA 2YA9A 3KRRA 4QQJA 3E8NA 3NAYA 3QQFA 2P2HA 3GCPA 3P78A 2GU8A 3DV3A 5H8BA 4EK3A 1URWA 2FSMX 4WSQA 4XS2A 3ZZEA 3Q9WA 2Y4IB 3RHXA 3QD2B 3DB8A 4AOJA 5JGBA 4KIOA 4EH4A 2PVKA 4IWQA 4EI4A 5EDPA 4X6RA 2J9MA 4KBCA 3MN3A 4NFNA 5AM7A 3RPSA 3EN5A 3COKA 2X2MA 1H07A 3O8TA 4EOLA 2ZVAA 2R3RA 2UZVA 4I5MA 1H26A 2YCRA 4FSYA 5E1SA 5A6NA 1SNXA 4N6ZA 4BDEA 1ZXEA 3SGCA 4FTTA 2XRWA 4PMPA 5KMIA 5DRBA 5HG8A 1FBNA 2GHLA 4QRCA 4JAJA 3AC8A 3I5ZA 3FBVA 1JKLA 1UKHA 2ITWA 2XK8A 2PULA 5BVNA 1WVXA 3ORIA 4I6BA 4IEBA 2E9PA 3PSDA 2C5OA 4FOCA 4KIKB 3VULA 1QPEA 4EKLA 3NYVA 3OCBA 4IAZA 4JT3A 3HEGA 5ANDA 5ANJA 3VHEA 2BRHA 3PJ8A 4L3LA 4LMNA 4FV7A 1WCCA 4IHPA 4BDIA 2WTDA 3DY7A 4UEUA 3QFVA 4I0TA 3SXFA 3JVRA 4C2VA 5BVFA 4QTDA 1YI4A 4D1ZA 3H9OA 3RPOA 4AW5A 5A4LA 3NPCA 4KBAA 2PVRA 1H27A 1ZOGA 2VWIA 5JRQA 3EOCA 3DTCA 1H0WA 4JQEA 2X7GA 3BYMA 3WZEA 1MRYA 3E7OA 5EM6A 5T6KA 2HZ4A 4FVRA 5DLSA 4AZFA 5JK3A 2OKRA 2R3FA 2XCKA 4RX9A 4X2JA 3DGKA 2ZMDA 5I9WA 4FV8A 1YXSA 3HECA 1O6LA 3BCEA 4CFFA 2GNFA 3ZTXA 1Q8YA 1IASA 2E9OA 4RWLA 4YC6A 2VAGA 2WZJA 3D7ZA 1H01A 5BQ0A 3GOPA 4N0SA 4DH3A 4RT7A 2E9VA 3ORXA 1WAKA 4FGBA 2VNYA 1E1XA 4EK6A 4IC8A 4ZY5A 4RRVA 3E7VA 3G5DA 1JBPE 3KXXA 2Y6MA 4O7LA 4TWOA 4EQCA 5HTIA 1FMOE 4IVDA 4CEGA 4O81A 5LXMA 2WGJA 4XEYA 1Q8UA 4K8AA 3PDTA 4PMMA 2PUPA 4JVGA 2QO9A 3BLRA 3Q5IA 4TWCA 4AG8A 4E20A 2C1BA 3S1HA 1R1WA 3TKUA 4TW9A 3HKOA 5CI7A 4XV2A 5TE0A 2X8IA 4OTQA 3VIDA 2HK5A 4X2KA 3HZTA 3QTXA 3RVGA 1TQMA 4KKGA 1YDSE 1XH5A 2WD1A 4DE4A 4V04A 1W83A 2JFLA 5IEXA 3H9FA 4AZWA 2JAVA 3MY5A 4WBOA 1NXKA 5AAFA 3PWDA 4EOIA 3QU0A 5K0KA 4DCAA 3CE3A 4GU6A 3BU6A 4OBPA 5EG3A 5F9EA 5BX0A 2AC5A 1TKIA 4YZNA 3IOPA 5JFSA 1YHSA 3JY9A 3R9HA 2XUUA 4GVJA 3EN7A 3FLYA 3R63A 5DFPA 3SDJA 4BDBA 4RWIA 4EH7A 3LCDA 4J95A 3DDQA 2OJJA 3IK3A 3PVWA 5KKRB 4TYHB 2XA4A 3CQUA 3VS2A 2C0IA 4FK6A 5HICA 4OBQA 4RJ4A 3KFAA 2PVJA 2J5FA 5IEVA 4MD8E 5D1JA 2OZAA 3BPRA 4MX9A 5FXSA 3LCOA 3LE6A 2VGPA 3C4XA 2AUHA 4I6QA 4PDOA 3PVUA 3KC3A 3KEXA 3OW4A 3HA8A 1J7LA 4A9UA 3DK3A 1TQIA 2QO2A 1Y57A 3TM0A 2Z7QA 2VTQA 1ZMUA 3C5IA 4MWHA 4MBLA 2PVYA 2XIYA 5M4FA 4ORKA 2XH5A 4G3FA 4HYUA 5M4UA 1W0XC 3LCKA 3OT3A 4O7SA 2KULA 3GU8A 1ZYSA 5AJQA 3OXTA 5CAOA 3W10A 4F7JA 2X7FA 4EZ3A 3CC6A 3MVMA 2VRXA 4TT7A 2IVUA 2B1PA 2EB2A 3KKVA 3MV5A 3PXZA 5L6PA 4Z9LA 4LQMA 4G5PA 4Z3VA 4IH8A 4IZYA 1CKJA 3QTZA 4IZ7A 4ENXA 5KHWA 5CVHA 2CN5A 4NZWB 4O22A 4BZDA 4E4LA 5I3RA 3QRKA 3CQWA 1GIHA 3EQFA 3QTQA 5I9VA 2ITXA 2WTCA 2BKKA 3N4VA 5DA3A 5KZ0A 3IQ7A 4MNEA 5HVYA 1ZYJA 5C26A 3UZTA 2PZ5A 2CMWA 2G15A 3W2CA 1NVQA 2IJMA 1OGUA 5D10A 3S95A 3W32A 5JH6A 2WOUA 2BTRA 4JBQA 2J5EA 3QCQA 4IB5A 1IAJA 2CJMA 4IFGA 4IFCA 2VO0A 4AXAA 2VTAA 2XVDA 2XJ1A 3GC8A 3RAHA 5LVLA 4R6VA 3UO4A 3S4QA 5HNGA 4Y95A 2PPQA 3G0FA 4ASZA 1KSWA 5CEKA 5JN2A 3L9LA 4GYGA 1OPLA 2ZDUA 3W2RA 5CNNA 1ZZ2A 3P7BA 5IQHA 3R9DA 5GZAA 1U54A 3A4OX 4F70A 3TNPC 4CV8A 3BYVA 3DCVA 5HE2A 2C1AA 3BHVA 3SVVA 5LVPA 4OGRA 1PXIA 3IS5A 2F7EE 2XIKA 1QMZA 2KTYA 3G15A 3CTJA 3RP9A 2YJSA 1REJA 3O51A 3TUBA 4U41A 5A9UA 5H2UA 2C5XA 2WOTA 4QMMA 4ALUA 3PIXA 2QQ7A 4L45A 4BN1A 4ALVA 4M13A 2Z02A 4O27B 4J8MA 4KS8A 4G3DA 3P79A 3EN6A 5AUTA 4LRMA 4M68A 3O71A 1M2QA 4AA4A 4QP6A 4EOSA 4IW0A 4R5SA 4ZY6A 4D1XA 2WIHA 3Q9ZA 3WE4A 2JBPA 4PMSA 3W8LA 3QTSA 4O7VA 4FSMA 2WTIA 3PIZA 2R5TA 3KMWA 5KUPA 5AP1A 4BCNA 4LG4A 4BDGA 4R3RA 3FLSA 3NIEA 3VBVA 3W2QA 3G90X 4LRKA 4R1VA 1V1KA 2HXQA 3LQ8A 5EM7A 3LFAA 5KMNA 4C36A 5AV3A 2JDTA 5C03A 4M14A 3AQVA 3I0QA 3NW6A 4QMNA 4I4FA 3MY1A 2WTJA 3G6GA 4ZS4A 3HMMA 3DNEA 4QMQA 2RG6A 3LXKA 3D5XA 4QPAA 3UJGA 5CSXA 3KULB 4FTIA 3POZA 4DAWA 1ZYDA 4C3FA 5FEDA 2XYUA 5CF5A 4DF3A 1W84A 3NVMB 4L7SA 3RINA 3BU3A 1GZNA 4YJPA 3QA0A 4CRLA 4FBXA 4ACMA 3S0OA 4OBOA 3HP5A 2AC3A 4G34A 4PL3A 4GG5A 1BYGA 4L00A 5AR8A 4CGAA 5CSHA 3AMBA 1KOBA 2WKMA 3GC0A 3F3ZA 2ITPA 1GIIA 4F9YA 3R28A 3MH2A 3G2FA 3AMYA 5L2TA 4FIGA 2JIIA 2AYPA 5FM2A 1BUHA 4DHFA 2FGIA 2V5QA 3VS0A 4C58A 3DS6A 1FVVA 2PVLA 3ORNA 2QCSA 1PXOA 2BZKB 4EYMA 4C4GA 3OOMA 5CX9A 3ZRKA 3KMUA 2ZB1A 4DTAA 2G9XA 3UYSA 4KSPA 4KIKA 4OUCA 1UU9A 3R30A 4IDVA 4RIYB 2P33A 2YZAA 3DXNA 4JXFA 5JZNA 3ZSIA 4BBMA 4FZ6A 5F4NA 2PYWA 4Y72A 2UZLA 4XG7A 2PMNX 4E1ZA 4EK5A 4CLIA 1YI6A 4DH5A 3HUBA 2YERA 3VW8A 3SAYA 2CCHA 4EONA 5DRDA 4XV1A 3DU8A 2OIDA 2YM4A 1BL7A 1YXUA 2CGVA 4FKPA 4DFYA 4QP4A 1OKYA 3IW4A 4EWQA 4FKUA 3UO5A 1UU7A 2LGCA 3OY1A 4AFEA 3BWFA 2Z7LA 5IQEA 3MB7A 4PL4A 3A62A 1YWNA 3CXWA 2OBJA 4GFGA 4AW2A 5HCZA 2ZYBA 2R9SA 5L6OA 4MQ1A 2YCQA 4AZEA 2J50A 3HLLA 4IM2A 4M12A 5H3QA 4D2RA 4EHZA 5CU2A 1ND4A 4WHZA 3D5UA 4BF2A 3QBNA 4RFZA 4ARKA 4HZSA 5DVRA 3FKLA 1VYWA 3VS5A 4IB0A 5E8SA 1WBTA 4FEWA 5CSWA 5GINE 1ZAOA 2F7ZE 1PMVA 4FVPA 1R0PA 2HAKA 2V7OA 4MCVA 3ET7A 4NWMA 2DQ7X 3MTFA 4II5A 2BZIB 4JAIA 4KAOA 4RX8A 4FODA 5CNOA 3TV4A 4AU8A 1IR3A 3CD8A 1ZLTA 3V51A 3QAME 1G3NA 1M7QA 5L3AA 1YWRA 1OVEA 2B53A 2VWBA 2W1EA 2PMLX 5HG5A 4NTTA 5E8YA 5CANA 2ETRA 3OOGA 5LWNA 3DKGA 3Q4CA 4WNKA 4FMQA 3TDVA 4DN5A 3ZYAA 4FTMA 3I6WA 1YDRE 4GT3A 3BHYA 4M66A 5E8ZA 2WU7A 1IRKA 2VWWA 3PSCA 5DOSA 5FBNC 5LVNA 3U54A 4ZK5A 3GBZA 4QMPA 3T9IA 5HBJA 3LM0A 2OJIA 4QP7A 4UMRA 5HIEA 3U6HA 3ULZA 1OBGA 4ENYA 4JRNA 3FY2A 4XV9A 2VTTA 5L4QA 3FC2A 2WPAA 3A2CA 3TKIA 1DI9A 3R73A 4MXAA 4BIEA 3W55A 4YTHA 2XB7A 4EHEA 2W5AA 1UKIA 3FMNA 1SVEA 3LFFA 1Q3DA 5IPJA 2VU3A 4GW8A 3RK7A 2W4KA 4A9TA 2QOFA 3CKWA 1GZ8A 5A4TA 4XLIA 4O6EA 2WTVA 3EB0A 5IG1A 4YZ9A 2ITQA 3E8CA 3R2YA 2C6TA 4GS6A 4EHVA 2IZRA 4ANOA 4RFMA 3TTJA 4ZY4A 1AQ1A 3R21A 3TJCA 3DDPA 2ITUA 3FMHA 4PQNA 5HNBA 4O21A 4I6FA 5CT7A 4F4PA 4IE9A 4PWNA 4P7EA 4RX7A 4ZTHA 2RG5A 3FE3A 5DT3A 4YP8A 4HNIA 3DPKA 2R7BA 1YXXA 4D1SA 2YJRA 3ZEPA 2IZSA 3VQUA 3OW3A 4XMOA 4QMXA 4EYJA 2FO0A 3W2PA 4BWXA 2WMQA 3I0OA 3CD3A 4FIJA 3A7HA 3QRIA 3PP0A 4V01A 3ZO2A 5JGAA 4DH8A 2BALA 3C7QA 3DOGA 5EHYA 3RWQA 3E62A 4WIHA 2JAMA 3L9MA 2VO3A 5HE3A 4BWPA 2I1MA 2C68A 4EH6A 3EQGA 3FXWA 2B9HA 2R64A 4HGSA 3Q9XA 1JKKA 2BRBA 3R8PA 5TF9A 5I0BA 3FMJA 2XIXA 2R3MA 3O7LB 3NMUF 3D9VA 1MP8A 3FMKA 4LV8A 3D14A 4O0VA 4UBAA 3U8WA 4K9YA 4TY1A 3O96A 4BHZA 4BDAA 3NUAA 4YZMA 5CI6A 4WOVA 3JPVA 4EKKA 4DEEA 3ZBXA 4NYEA 3RTPA 3WYYA 3LW0A 4OTIA 3QZGA 4BCGA 1WVWA 1QPDA 3QWJA 4LI5A 4DEAA 2W5BA 2W4JA 3D7TB 4XG4A 3VHKA 5LOHA 4YPSA 4YLKA 3MBLA 3A8WA 3DBDA 3QUEA 2HXLA 1U54B 2VZ6A 4ZTRA 3ZH8A 2WQNA 3QQLA 3BELA 4O0YA 5HIBA 1UV5A 4U3ZA 2J7TA 2ZMCA 3ZDIA 3PPKA 4H1JA 1PRYA 4S33A 2X9EA 5HD7A 4BHNA 4BDKA 3R00A 4IQ6A 3NGAA 2HCKA 1GAGA 2DUVA 3COHA 3HMOA 5J8IA 3LOKA 4O96A 2IW8A 4WO5A 3ZM4A 4YO6A 2G01A 3WIKA 4YMJA 4FKVA 2QHNA 1B6CB 3HRCA 4AE9A 2W9FB 3UOJA 2PZYA 4FEUA 3GQLA 4FTQA 1A48A 4XG3A 4BGHA 4FTKA 2UZEA 4E4XA 2ERKA 1JKSA 3UQGA 5CAPA 2O65A 4ZMEA 1SNUA 3GCVA 3TNHA 4CCUA 2NRYA 4BL1A 3BYUA 4USFA 3MJ2A 5D12A 3IDCA 5AAGA 5I4NA 4O2PA 2B4SB 3C4CA 4U0IA 3ROYA 2HZNA 3NLBA 4PDPA 3OBJA 2VTIA 1R3CA 3BQRA 1CM8A 1MQBA 1ATPE 3R1SA 4IACA 4ERWA 1OL1A 2YISA 1STCE 3R7UA 4YZCA 3S3IA 4F1TA 5ICPA 5IUGA 4B99A 1H1RA 5JGDA 1RJBA 3HV5A 4DYMA 1GZOA 4D5KA 4O1PA 5LMKC 4D4RA 4GRBA 4EZ7A 3UC3A 2F2CB 5JQ8A 4NM7A 3G9NA 4F1OA 4BBFA 5C1QB 3FYKX 3MW1A 3BGPA 2IZTA 4I6HA 4MTAA 4I1ZA 1QPJA 4FV5A 4XG8A 5LMAA 4V05A 2WEVA 2PZIA 1CSNA 4IJPA 3MH1A 3QLFA 3LFEA 5FEQA 3ULIA 4U81A 4YO4A 3FZOA 3HV4A 5BMMA 3F88A 4A4OA 3H9RA 3WOWA 4JDHA 4C4JA 3SG8A 3KA0A 3QX4A 4H39A 1ZRZA 2VGOA 4H58A 3M2WA 4BZOA 2GSFA 1TVOA 2X4ZA 3L9NA 3SW4A 2OLCA 4OTFA 3LMIA 5AV2A 4FUXA 3Q60A 5EYMA 4DITA 4FKQA 4FKTA 2X7OA 4FSNA 4YBKA 1O6KA 3SRVB 4CZTA 2JKQA 3PRFA 4FK3A 1XHAA 4CKRA 4F9WA 5I9XA 2YABA 4RQVA 4AX8A 5HOAA 3FLZA 2OK1A 4YTIA 4RVLA 3GU5A 4J7BA 2I0HA 3TJDA 1W82A 1XQZA 5B7VA 3EMGA 4FTNA 3LMGA 3QZFA 4JG6A 2Y9QA 3WZJA 3SLSA 3SW7A 2XK7A 1JVPP 5D9HA 2GCDA 3VAPA 3F61A 5AX9A 4F9BA 3R01A 3TDWA 1SM2A 4QMWA 3UODA 1P4FA 3D5VA 5A4QA 5AX3A 3AT4A 2BKZA 1SVHA 2G2IA 2GQSA 4F0GA 3BV2A 2BIYA 5KMJA 3HVCA 5BUJA 5LCKA 2W1ZA 2VWVA 3MFRA 4TNBA 4ZJIA 4OTDA 4FG9A 2YDJA 4CT1A 4ZTMA 2RF9A 3PVBA 1ZMVA 2XKDA 4FA2A 1ZWSA 3PA5A 3QHRA 5IQFA 1KV1A 4RVTA 4C4EA 4MAOA 2CNVA 3LJ1A 3KK9A 3PLSA 2X8EA 3K54A 4DBNA 3UPZA 3GOKA 3C4EA 4CFNA 5CY3A 2A19B 5IF1A 3F3TA 2CDZA 1W98A 2C4GA 3EL8A 3ZLYA 4I3ZA 3TV7A 3OP5A 3Q96A 4JR7A 4L6QA 3FZRA 3D15A 4NUSA 4QMVA 5IA5A 3NW5A 4GU9A 5FP5A 4RVMA 3PXQA 4C37A 4D2SA 4ZJVA 3AMAA 5AUUA 1UNHA 2JBOA 5AA8A 4JG7A 4IWPA 3F2RA 2VTLA 2OG8A 3PA4A 3F2NA 5HG7A 3PJ3A 1VYZA 2ITVA 3KRXA 3AG9A 4FKOA 4FYOA 1R78A 4MF1A 4NM3A 2C6LA 2P3GX 4RWKA 4U43A 5DE2A 3UOHA 4D4SA 4MD7E 2PMOX 2QNJA 2XJ0A 3NUXA 4FKJA 3ORZA 4E4MA 4J97A 2I40A 1OKWA 4QMLA 5C27A 3EL7A 2HELA 2RFDA 1BI8A 1OMWA 3CGOA 4P4CA 4UMTA 1RE8A 4F65A 5GZ8A 5IZFA 5E8TA 3ZFMA 3WF9A 4KD1A 3WIGA 1YQJA 4PUZA 5KBQA 5AP5A 4NH1A 4CD0A 3ZFYA 4BCOA 5HORA 3LAUA 3P0MA 4HPUE 1LEZA 2X39A 5C4KA 3KN6A 1YHVA 3HUCA 5ANKA 2E2BA 4I5CA 4D4YA 4I0RA 4DH1A 5AFVA 1JKTA 2WU6A 1OPKA 3OFMA 4FSRA 4ZZNA 4MKCA 3O7LD 3AGLA 3TTIA 3P1AA 4UZDA 3RMFA 3GVUA 4G9CA 3CQEA 2WMBA 4LGHA 4G17A 5L2IA 4J52A 3VBXA 4IVCA 1DM2A 2PUIA 4YTFA 5AA9A 4O82A 2REIA 4PX6A 5C8KA 5IQIA 5F1ZA 4GV1A 4UXLA 5HCXA 3QCSA 4DGMA 2GNLA 4E8AA 4E26A 3G9LX 2JIVA 5CF8A 2CGXA 2VUWA 3LIJA 3QQHA 4FKRA 3M11A 4ANNA 5AMNA 2X2KA 2QOKA 2YWPA 4QP3A 3V5TA 5DHJA 2EXEA 4NTSA 1L8TA 2QLUA 3NUNA 4ZEGA 2DS1A 2UZWE 3SX9A 2YIWA 4DBXA 4IX3A 1KE6A 3SKCA 4A06A 1YVJA 4ZP5A 3PY3A 5C8MA 2O64A 3TL8A 3K5UA 2UZNA 2F9GA 1K3AA 4XX9A 2W1HA 1J3HA 5EK7A 2R2PA 4LOOA 2BZHB 3KMMA 4IMYA 5GZ9A 3CPBA 3R1QA 5HVJA 3I1AA 3KXGA 4EHGA 3FKNA 2CNQA 1Q8WA 4JNWA 3ZSGA 4EK8A 3O2MA 2Y7JA 4GK3A 4YJVA 4YJOA 2WHBA 5EYCA 4F6UA 4XOYA 3TWJA 4AW0A 4RIXB 1WVYA 4AS0A 3HP2A 3QC9A 4PRJA 4CSVA 2Z7SA 3DZQA 4R78A 4TYJA 4WA9A 1UA2A 5KMMA 1QCFA 4QQTA 1A9UA 4AZVA 3O8UA 3EWHA 4RVKA 3F82A 2F4JA 3RKBA 3KXNA 4FIFA 3SXRA 3LFQA 3MH0A 2WAJA 5K5XA 1YW2A 4RIWA 2YFXA 3RALA 2OH4A 5HCYA 2BAKA 5AEPA 4QYEA 4MXZA 2XZSA 4GH2A 4XRJA 5AR5A 1KUTA 2VN9A 2QU6A 4BI0A 3WF5A 3EYHA 4NCTC 1H08A 4RIYA 4ZTNA 5EQPA 3VQHA 3QTIA 4ACGA 3V8SA 4R8QA 4ASXA 4DTKA 2GHMA 4C3PA 4F7NA 2BHHA 5L8KA 3G6HA 1XH7A 1XO2B 2GFSA 3PRIA 4JDIA 5AP0A 1U4DA 3ALNA 4E73A 3A61A 4YBJA 4AT3A 3UTOA 3UQCA 5CASA 4B9DA 3GNIB 4YR8A 1YRPA 1GOLA 4NCTA 2X4FA 2OXXA 3SOCA 5AUWA 1PMEA 2J90A 4TTHB 4ANQA 5KO1A 4R77A 3WYXA 3LFSA 3PG1A 4IM0A 4L3JA 3CIKA 5E1EA 3VN9A 5CVFA 4RC4A 2IN6A 4FNXA 4J1RA 4ACDA 5J79A 4OAUC 3R7IA 2H6DA 3WZKA 2VWYA 1KE7A 4JBPA 3BYSA 4RLLA 3COMA 1WBPA 4IWDA 1H1WA 4O0XA 5GIPE 4PPCA 2IO6A 4WT6A 2XK3A 4FZAB 1J1CA 4UMQA 3KGAA 4M67A 5CU4A 2W96B 5GJFA 3I81A 3OWKA 3OCSA 4FI1A 4QMTA 2VTMA 3EKKA 5LARA 3H0ZA 4UV0A 5EDQA 5TO8A 4AGWA 1GJOA 1H8FA 3QXOA 4RSSA 4X2GA 3U9CA 1I44A 3DNDA 3NWWA 4Z7HA 2GS6A 5EM8A 4ZIMA 1FGIA 3OTUA 4KIQA 1MRUA 3POOA 3THBA 1QL6A 4N6YA 3F69A 2RIOA 3V5LA 4C4FA 4DG0E 4DEDA 4XP2A 5FD2A 2HW7A 3C50A 3DKCA 4RPVA 5FTQA 2PE2A 3FMEA 3LFBA 4ZSJA 5A46A 4FICA 4AF3A 3PA3A 1P4OA 3D4QA 5FWKK 4PPBA 5DG5A 4C02A 1BX6A 4JI9A 4HCUA 3V6SA 4D2VA 5IQBA 3PYYA 3KL8A 2O8YA 3GB2A 1MUOA 2VO6A 2C30A 4L68A 1YKRA 2LAVA 5ETAA 4ANLA 4O0SA 2IWIA 4FOBA 3ORTA 4YHFA 4ZS0A 2IVVA 5E7RA 1FQ1B 3A7JA 3A99A 4JIAA 4AOTA 4GT4A 5A54A 3ZXZA 5HU3A 3R7GA 4MF0A 4FV3A 4UWBA 4APPA 2QOBA 4FV1A 4MHAA 5K9IA 5IUHA 4YPDA 4J99A 5BPYA 3KCFA 2OXYA 2BR1A 3R04A 5KHXA 1AD5A 2OO8X 5LJJA 3QQUA 3ORKA 5CU0A 1M2RA 5LQFA 4Y83A 2J0KA 4QPMA 1Y6AA 1PJKA 5A4CA 3VBTA 2SRCA 1E1VA 2WQOA 1GZKA 3F5PA 5HESA 4USEA 3R7EA 3PIYA 3F3WA 3H3CA 5H8EA 3RWPA 2BFYA 1OITA 4FT0A 3VF8A 3Q04A 1R0EA 4U40A 5CEMA 3DBCA 4F6SA 3TEIA 1KOAA 3DAJA 4U6RA 3O8PA 4FT9A 5CLPA 3V5WA 1HCLA 2XNBA 3FL4A 3OMVA 2FSOX 3ZO1A 2FA2A 4PNKA 2XIRA 3V01A 3UZRA 4EOOA 3FHIA 5ANIA 3RZFA 1IG1A 5M4CA 3OXZA 5CALA 4YURA 4M0YA 4CYIA 4ZLYA 5AV0A 2BTSA 3V8TA 4AN3A 4FEVA 4HJOA 4ITJA 5FXQA 5HGIA 3OCGA 1BI7A 3ZHPC 4A9SA 3KVWA 4EUTA 2VTRA 2WTKB 2XKFA 2OICA 4K2RA 4OTPA 3RCJA 4BGGA 5IISA 3QGYA 2OJFE 3NVKI 3ZLXA 3MI9A 4X2NA 4L3PA 2W0JA 2WNTA 5JQ5A 2W06A 4BI2A 3I5NA 5EW8A 3I7BA 3ENMA 1PYXA 3K5VA 1H1PA 1JSUA 5LMBA 3FSFA 3N4TA 2HENA 5C8NA 2I6LA 5GIOE 2C3IB 4RJ7A 5KCVA 2C3KA 4AACA 2JDSA 3BYOA 3F5GA 4G16A 3RZBA 3RAKA 3DBEA 3FZSA 5E90A 3QRJA 3VWAA 4BKYA 5AADA 4BWKA 3DJ6A 4E5WA 4LGGA 4KB8A 4LGDA 2GTMA 3CR0A 3Q5ZA 2BILB 4ZTSA 5A6OA 1ZOEA 5DT4A 5J87A 5IH5A 4KS7A 5DNRA 3VF9A 5DR2A 4CQEA 4IX4A 3IW5A 5AR2A 2CGWA 4GVAA 5DEYA 5HLPA 4M84A 2P4IA 2HYYA 1PXNA 2PVFA 3HDNA 4HYHA 4PDSA 4W8DA 4YSMA 3EQCA 3RM6A 5AP7A 5IA3A 1JAMA 4B0GA 3ANRA 2ZV2A 4RC2A 3TNWA 5K3YA 2Z2WA 2FSTX 4CFWA 3TZ9A 3VRYA 2X81A 2YCSA 5D7AA 3H4JA 4CMTA 5JZJA 5EM5A 2PE0A 2WTWA 4DLJA 4EOPA 1Q24A 2B55A 2Y4PA 2I0VA 2PMIA 1BKXA 3OZ6A 3R2BA 2NRUA 2QR8A 4JJRA 4MNEB 2NNWB 5J7HA 3DXPA 2VWXA 2JLDA 3FMMA 3QCXA 4F6WA 3UG2A 2XKEA 2QR7A 5CU6A 3RK9A 4NFMA 4BCHA 3R1YA 1XH6A 3FQEA 4BGQA 3DJ5A 3UNJA 1ZYLA 2GFCA 3FHRA 3ZOSA 3C5UA 3F3VA 4BDFA 5T68A 2QOCA 1OZ1A 4XG9A 3MPTA 1HCKA 3U51A 4O84A 1ZZLA 4LUDA 4E6CA 2E9UA 3I7CA 5F94A 4JOAA 2YIQA 4QT1A 3DKOA 3AT3A 1IA9A 3UC4A 2C3JA 4O7RA 3I6UA 2FYSA 2ONLC 4G5JA 5E92A 2XM8A 2W05A 3T3UA 3G51A 2CLQA 4BKZA 4TKSA 5EKNA 1YXTA 1Z57A 2YDIA 4ID7A 4CG9A 4OW8A 2BZJA 3V6RA 2J0MB 3LXNA 4XOZA 4IAAA 5HHWA 4UN0C 2YHVA 2CNUA 3Q52A 3FSKA 4WRGA 3VUKA 2ERZE 2Y0AA 3BKBA 3CTQA 5BVOA 3PP1A 2RFEA 4H36A 4IAFA 1H1QA 2RSVA 5CZIA 1V0PA 5DPVA 2G2FA 5BUEA 3QX2A 2UW3A 1IEPA 2ONLA 4FNZA 4D5HA 2CN8A 1DI8A 3KF7A 3NIZA 4MXCA 5IMEA 4PNIA 5EYDA 3GGFA 5FM3A 3LCSA 4AOIA 4E5BA 3A60A 1Z5MA 3OEFX 4X0MA 2X1NA 2QOLA 5KX8A 3QWKA 2YIXA 4CFMA 3UIXA 4D2WA 4G1WA 3COIA 4DEHA 3P4KA 4QYYA 5AR3A 3KRLA 1NVSA 2GNHA 1PY5A 3MPMA 2H8HA 3NNWA 4FV9A 5CSVA 4AN9A 4EH9A 3LCTA 3GFWA 3QD4A 5JFVA 4KKEA 4LM5A 4DG2E 3PTGA 4E4NA 2OFVA 3PG3A 4BBEA 5BUIA 4CZYB 2E9NA 5ETIA 2O0UA 2XCHA 4E3CA 3GC9A 3OTVA 3R7VA 4UMPA 3MFTA 5DIAA 4TXCA 2X2LA 4QTBA 1KE9A 4NU1A 2ITOA 4ITHA 5JFXA 1WBOA 5L2QA 2ZV7A 4PPAA 1OL2A 4KWPA 5I9ZA 3NNXA 1PKGA 3VS6A 3QTUA 4QNAA 3PJ1A 3BQCA 2HOGA 4O1OA 1MQ4A 2C6IA 2PSQA 2PVHA 4HYIA 4JRVA 3SQQA 2VX3A 2UW5A 1SVGA 4Y73A 3C4FA 3NR9A 4YGAA 3R71A 1JSVA 5FTOA 5IDNA 4HYSA 3JVSA 1NY3A 2X6DA 3R6XA 5L6WL 4PTGA 2HY81 4JL9A 3BZ3A 5HKMA 5EYKA 5EI8A 3ZO3A 4BTMA 2XK4A 2WMRA 2ITNA 2WMSA 4AGDA 4X3FB 4Y5HA 4CYJA 4ONAA 2QVSE 4ERKA 2HIWA 4ZXTA 4YUQA 2JEDA 5C01A 4FTRA 3U9NA 3FXXA 3F5XA 4XCUA 4D0WA 5HTCA 4O91A 5KMKA 1IA8A 5J1VA 3V5JA 2R3GA 3E63A 4EQMA 4Q2AA 5DI1A 1WBWA 1XJDA 3DB6A 1YXVA 2PUUA 3A7GA 4GSBA 4AT4A 4EZ5A 3BEAA 5AAEA 1Y8YA 5HX8A 3OG7A 2BAQA 2XJ2A 1W8CA 5TR6A 4APCA 4TYHA 5M44A 1YHWA 3R8LA 3VUHA 1JQHA 4RFYA 3FKOA 3GFEA 4FGRA 2QKWB 2H96A 2HY0A 5GNKA 3Q4TA 4C59A 2Z8CA 4YNOA 3V8WA 2VX0A 2WQMA 3L8PA 3UMWA 3PE2A 4EH5A 4EWHA 4C4HA 3ZUVA 3DJ7A 3U6JA 4L7FA 5FG8A 4DEIA 2VTNA 4I5PA 3HV3A 5IH4A 2C0TA 3E88A 4CCBA 5H9BA 2R3QA 1J91A 3S2PA 3T3VA 1OECA 4JQ8A 5K4IA 3CS9A 5GJDA 3OT8A 1WFCA 4DGNA 2WMXA 1H00A 3ERKA 4QMUA 4U9AA 1NA7A 2PUNA 1PXLA 3DFAA 3WZDA 4FNWA 4MBJA 2GDOA 5CXZA 4MBIA 3R02A 5AUXA 2VWZA 5DH3A 4MVFA 2B52A 2OF4A 3AC2A 4NW5A 4XNEA 2W1DA 5B2MA 3JY0A 3Q9YA 4R1YA 3WF7A 4DEGA 1ZMWA 4ANMA 2XK6A 4DFNA 4ANBA 2B9JA 5L2SA 5LMKA 1Q5KA 3Q4ZA 5EQEA 4LRJA 3IECA 3QA8A 1KWPA 1YOMA 4LMUA 3FPQA 3UVRA 5CS6A 1JLUE 4BCMA 4EUUA 2A4LA 3PPJA 3QUDA 3DFCB 3NRMA 5EHOA 5K4JA 3D94A 2JIUA 4N4SA 4JBOA 5DR6A 2VD5A 4ITIA 4IM3A 2UW7A 3VS1A 3TCPA 2OJGA 4O7ZA 3LJ0A 3DQXA 4XRLA 4XBUA 3FI4A 2YCFA 4D2TA 3WE8A 5E91A 1ZYCA 4XYFA 5EW9A 1U46A 4KUJA 3E5AA 1XKKA 4FT5A 4D0XA 4EC8A 5ANOA 2YZLA 1FVTA 2XP2A 2ZAZA 4DFXE 1J7UA 3Q6UA 5HZNA 3C4ZA 1UU8A 2X9FA 5J7BA 3BBTB 1ZY4A 2BVAA 5E8UA 1H25A 3BU5A 1OKVA 5DBXA 3EFWA 4ANSA 2YITA 3PZEA 2GQGA 4BIDA 1O9UA 2CCIA 1WBSA 3ZUUA 2JKOA 5IEYA 1LP4A 4QYHA 4QTEA 3OXIA 1ZY5A 3QRUA 3O17A 3UP2A 4IVAA 3E93A 3QL8A 4JIKA 1M7NA 4DFUA 3UP7A 4EBWA 2V0DA 3FPMA 3HRFA 3OUNB 4FEQA 1Q61A 4HPTE 4AGUA 1J7IA 2VWUA 4HVGA 3DT1A 1SMHA 3PPZA 2QO7A 2YM7A 4YJTA 3RGFA 4TRLA 4FTJA 3RNYA 2OZAB 3PY0A 3Q3BA 4DC2A 2NP8A 3ZLSA 3R83A 4L42A 3UZPA 2VTJA 1XH4A 3P23A 4CRSA 5AP2A 5JT2A 1CDKA 2J0JA 2XNPA 3RAWA 4O0RA 2IVSA 2IG7A 5CENA 3R22A 2UV2A 4U8ZA 3KREA 1T46A 5EDRA 5ITAA 3B2TA 4UMUA 1CKPA 3VUTA 4LYNA 3KXHA 2V7AA 2ZM3A 3UVPA 4D55A 3PWYA 4G2FA 4G9RA 2W5HA 3BE2A 4P90A 3BWJA 3U4WA 5M56A 3C9WA 4U5JA 1E9HA 3I4BA 4XG6A 4W9XA 3OY3A 4AFJA 3L9PA 3KY2A 4LOPA 3VS7A 5M08A 2XBJA 4Y85A 1H1SA 3KULA 3M1SA 1CKIA 3PXYA 5E8WA 5G1XA 2UW0A 2XBAA 3NAXA 4GJ3A 4F9CA 1BMKA 1JSTA 5JEBA 3HNGA 4X21A 4B7TA 2O5KA 2XM9A 3VS3A 3ZFXA 2EVAA 2UZOA 4NL0A 4XG2A 5H8GA 5DGZA 1S9JA 2RGPA 4C35A 2PTKA 4AA5A 1Y8GA 3BRBA 2VTSA 3MB6A 4L67A 4ZLOA 3WI6A 3ZSHA 5JFWA 4M8TA 4J53A 4JDJA 4A7CA 1PMUA 4QP1A 4V0GA 4CNHA 4EOQA 4HW7A 4G3EA 3OEZA 5HD4A 4S34A 5IH6A 3SHEA 2H9VA 4BYIA 4O7YA 3FLWA 4CFVA 5IQDA 3D2KA 1GNGA 5ANEA 3P86A 4CKIA 3BLQA 3TIYA 3UYTA 4DFLA 1WMKA 2WMWA 3D0EA 3EJ1A 5CU3A 3ROCA 5EOLA 3ETAA 4G6OA 2CKQA 2QOIA 3AT2A 4EQUA 4FSTA 4S31A 2PZPA 1Q41A 4AP7A 1P5EA 4K1BA 2G1TA 4HVSA 3UMXA 1OL7A 2CLXA 4UWYA 3EIDA 4PY1A 5C9CA 3IG7A 2QU5A 4XP0A 4YSJA 2C5YA 4ALWA 3FC1X 3DK6A 4RGJA 4GUBA 2HW6A 2R4BA 1UNGA 3K3IA 5AV4A 3EN9A 3F7WA 3FUPA 4GFOA 5F20A 4E6DA 3A4PA 3QZHA 2W7XA 1FINA 1VJYA 4ASDA 3VO3A 4D4VA 2YM6A 3DAEA 4YLLA 5BVWA 4AA0A 4YU2A 2R3PA 3ZZWA 3WARA 4GYIA 2CKPA 4R7BA 3VBQA 1SYKA 4RIOA 4QMYA 4W4YA 3NYNA 3PJCA 3QLGA 2OW3A 1R39A 2QG5A 5HE0A 2X0GA 3II5A 4LOQA 3TZ8A 5BNJA 1VEBA 2VV9A 4ZSGA 3NUSA 2UZBA 1TQPA 4XP3A 4YHTA 4IADA 5IMXA 3ATSA 3MYGA 3LZBA 5HIDA 1APME 4FTCA 1AGWA 2HZIA 4K77A 3H0YA 4NM5A 4QO9A 4EH3A 5HX6A 2I0EA 4EJ7A 3LHJA 4IZ5A 4WNOA 4EH8A 3EQDA 1XBBA 3OVVA 4IAIA 4DH7A 2Y6OA 2YEXA 2FUMA 4FKLA 4HNFA 4RZVA 4YJRA 4YJUA 3ZU7A 3R9RA 1PW2A 5KMLA 3IGGA 2O2UA 5ACKA 4M69B 5M06A 3OWJA 3W16A 3FMLA 2GQRA 3C51A 4IX5A 5DN3A 2JDVA 5E8VA 4F1MA 1JOWB 4TZRA 3T9TA 5HNIX 3RAIA 3VBWA 4QQCA 1ZOHA 5HQ0A 4F99A 3CEKA 4BC6A 1ERKA 1M2PA 3EHAA 3W2OA 2BDFA 2WELA 3UIUA 4MH7A 5L2WA 3GC7A 3FDNA 1URCA 3AD4A 3EKNA 4K33A 2F57A 2BFXA 2EXCX 3BX5A 3Q53A 3TACA 2V55A 4LL0A 1JNKA 5HO8A 1WBVA 2CKEA 3QQKA 4XH6A 5B2LA 4FTUA 2XS0A 4BR3A 3KB7A 2XKCA 3P9JA 4WSYA 4A4LA 3T8OA 1JPAA 3VJOA 4W9WA 4HGLA 3QKKA 4H3PA 4J98A 4RC3A 3UIMA 4CKJA 4KBKA 3IW6A 3OUKA 3TI1A 5FTGA 2QHMA 4MNFA 4LUEA 4R3PA 2C6KA 3OBGA 1UU3A 2I0YA 4MYGA 5DT0A 4GK4A 2JKKA 3L1SA 3EFKA 4RBLA 3FZPA 4FT3A 3VUGA 2I7QA 4NEUA 5AP3A 4WUAA 2R3LA 5J9ZA 1DAWA 3F5UA 3E92A 3C4WA 3GU4A 2ZV9A 5T3QA 3VUMA 2ZDTA 4YJQA 4AT5A 5BVDA 1LR4A 4FT7A 4KRDA 5CEIA 2RKUA 5IA1A 3QXPA 4PV0A 3LMHA 3AC5A 2ZV8A 3FL5A 4B4LA 4O7WA 2WMUA 2ETMA 3FI3A 3KXMA 1F0QA 4P2KA 4QMSA 3KU2A 1OUKA 1OIYA 3GEQA 3HMPA 1PXKA 3BEGA 3E64A 4UZHA 4DT8A 3F9NA 2JFMA 4FSUA 4S2ZA 4BRXA 1XH8A 2FB8A 1P2AA 2VTPA 5HBEA 4DT9A 4JDKA 4C38A 2GS7A 4CFXA 3RCDA 5TOZA 5CTPA 3Q2MA 3FQHA 5IA2A 4EOKA 2IW6A 4FV4A 4AW1A 5AP6A 1BL6A 3TUCA 4CV9A 1Q62A 5AWMA 3WF8A 3FQSA 1JWHA 3QYWA 4C34A 3NDMA 4M97A 3GCSA 3TZ7A 4BICA 3QD3A 4IAKA 4YJSA 3LM5A 3R8ZA 3F2AA 4HVHA 3ANQA 3VW6A 2R3KA 2YAKA 3PJ2A 4IIRA 2BCJA 2R3OA 3BI6A 4XLVA 4ACCA 2OFUA 1H4LA 4QNYA 3ACKA 4F09A 4QTAA 4EK4A 4OLIA 5CZHA 3QD0A 4RX5A 1PHKA 4O2ZA 5DEWA 3ZS5A 1W7HA 2YIRA 3NUPA 4FR4A 3FY0A 4CG8A 1NT2A 2FH9A 3FLNC 4P5QA 4J8NA 4XHKB 2FVDA 4USDA 4GUEA 4U79A 3D7TA 5J1WA 4WNPA 3QKMA 1U5QA 5A3XA 3RM7A 2QI8A 4D9UA 4AAAA 1PXJA 5FBOA 5LVOA 4N70A 4NIFA 4PP7A 4QMOA 3IONA 2JC6A 3OCTA 2IPXA 3HMNA 3RPYA 2BRGA 4DINA 3IPHA 4BDJA 4RWJA 4ZSAA 4XUFA 5FRIA 3AD6A 3CP9A 3HA6A 4TYIA 5AUYA 4B8LA 5HE1A 4HCVA 5EHLA 1OI9A 2ZM1A 3OWPA 1OL5A 5G6VA 3HAMA 4FTAA 3B2WA 3HX4A 4FVQA 3MGYA 3R0TA 4UXQA 4NM0A 4HVDA 5J9YA 4MXOA 5IUIA 3G0EA 3PFQA 3L8SA 3V04A 3ZEWA 4YC3A 4I0SA 4O0TA 3MWUA 4PDYA 2R3HA 5FXRA 5BMSA 2CKOA 2JITA 3VRZA 1Q97A 2JGZA 2OU7A 3QHWA 4FUYA 3AC4A 2OWBA 4I22A 4L46A 2YLEA 3R8MA 1Q99A 2A1AB 3A7IA 3BHTA 3QQJA 3SOAA 3D83A 4FZFB 4E6QA 2PWLA 4EH2A 4GIHA 2JDOA 4X6QC 4O6LA 4FSWA 3QALE 5AIKA 3SG9A 3MPAA 1XBAA 4QYFA 1G5SA 4FV0A 5DR9A 3ORLA 1UWHA 1M17A 1U59A 3MDYA 3RPVA 4G6LA 3PXFA 2UW9A 3GENA 2GS2A 3JUHA 4IX6A 4DFZE 3FV8A 3W2SA 4D9TA 4FSZA 1EH4A 4OTGA 5ETFA 3ZXTA 4K0YA 5A4EA 3E87A 4S32A 2QURA 3NSZA 4AE6A 3O0GA 4IZAA 3ZRLA 4C57A 2PU8A 3UIBA 4FV6A 5JRSA 4JX3A 4QPSA 4NKSA 3R8UA 3NS9A 4IC7A 5A14A 2NPQA 3LFDA 3NCGA 1U5RA 1L3RE 4G6NA 4X3FC 5JKGA 5HG9A 1WZYA 2OIQA 5FDXA 2BAJA 2Q0BA 3R8VA 3LKMA 2YDKA 4L01A 3V5PA 3SXSA 5HI2A 5HTBA 4GL9A 3LXLA 1F3MC 2DYLA 4E6AA 3DK7A 3ZCLA 4DGGA 2UVYA 4I94A 2QONA 4GK2A 2NO3A 3F7ZA 4KNBA 4QMZA 4X3JA 5CAUA 4OAVB 5E8XA 4WG4A 2Y4IC 3LLTA 4X3FA 5CQWA 5AUVA 3FYJX 3KQ7A 5I3OA 4BI1A 5KMOA 2QD9A 2YAAA 3VUIA 3EFLA 3PSBA 2J51A 4PL5A 2H34A 2GMXA 3BHUA 3DTWA 2DWBA 4F0FA 2OXDA 1MRVA 2XNOA 3A7FA 5HO7A 4AWIA 3NUUA 4MXXA 2YM3A 3FMDA 4A9YA 2VO7A 3MTLA 2JD5A 3PY1A 3VC4A 4Q9ZA 3R7OA 4ZTQA 3QQGA 2YWVA 5BVEA 4MXYA 3OS3A 4DCEA 5M55A 1FOTA 4AN2A 5AIRA 3CTHA 3TZMA 2QG7A 5M07A 2YACA 3EQIA 3U87A 3IO7A 3BGZA 3WILA 5CEQA 3CGFA 4JG8A 2R3JA 4R5YA 3H10A 3C0HA 3QRTA 4NW6A 2UZTA 2UW8A 2ITZA 4M0ZA 3NCZA 5HVKA 2WMAA 4YJNA 2C6EA 2ITYA 3E8EA 4CZUA 5FUTA 3CPCA 5TT7A 3DQWA 3HYHA 2GNIA 2QC6A 3JYAA 2C6OA 1I09A 4FL3A 3ZONA 4H3QA 4L53A 3EYGA 5HLWA 3P08A 5CAVA 3DXQA 3KK8A 4BDHA 3AXWA 4O0UA 2XNMA 2OJ9A 3FJQE 4Z55A 2RL5A 3FLQA 2JDRA 5AP4A 2UUEA 2CGUA 3DLSA 4WG3A 5FEEA 3E8DA 4KRCA 1GY3A 3REPA 5J5SA 2W1FA 4RMZA 3FAAA 4FKGA 5AUZA 2W17A 5DMZA 2UVZA 1RDQE 4FTOA 2BDWA 2EB3A 3NYOA 4MQ2A 1PXPA 4BYJA 5AV1A 1OBDA 3C0IA 3ALOA 4JX7A 1KV2A 1IAHA 1H24A 3SC1A 4DG3E 4RLKA 4J96A 4MWIA 4WBBB 2V62A 3GP0A 5AR7A 2YM5A 2OIBA 4IWOA 1ZARA 4GKIA 4I20A 4IANA 4KINA 5ETCA 4KSQA 4BCIA 3H30A 1HOWA 1OIUA 5FLFA 5J9LA 2W1CA 1O6YA 3UQFA 4FTLA 2Q83A 2B7AA 2C69A 3C1XA 5IA0A 1REKA 5GJGA 5BVKA 2XNGA 3IDPA 2XYNA 4UALA 4F0IA 3UE4A 2J6MA 2OH0E 3BBWA 4FX3A 4FZDB 1VR2A 4RJ6A 2P0CA 3DAKA 4U3YA 4MD9E 4LV5A 4RA4A 1Q8ZA 4IBMA 2IW9A 4O83A 2QODA 2IVTA 3NYXA 5J95A 4HGTA 5HLNA 4QD6A 3QF9A 3HL7A 4YNEA 4TN6A 5LWMA 1DS5A 4ZSEA 4Q5EA 4U42A 4MK0A 4EJNA 1KE5A 3G33A 3AC3A 5ANGA 3FI8A 5EFQA 4PF4A 4L52A 3TKHA 3CJGA 2EXMA 5F95A 5M53A 2VTHA 3HAVA 1YOLA 2YM8A 3ODYX 4FV2A 3R7YA 1M52A 3SV0A 1QPCA 2J0LA 2WMTA 5CT0A 5AR4A 4WD5A 3W18A 3WF6A 3HDMA 3UVQA 4AGCA 4KKHA 1GIJA 3TIZA 4BCFA 1UNLA 2QKRA 2R7IA 3Q32A 5IQAA 3FZTA 2B9FA 4F9AA 4OTRA 3E3PA 2PVNA 2B54A 3ORMA 4FEXA 1PXMA 2BMCA 3EZVA 3WBLA 4QYGA 1S9IA 3RJCA 4EL9A 5CF4A 3GXLA 1OIQA 3FEGA 5FP6A 4FIIA 1V0OA 4NJ3A 5FQDC 1NVRA 3JS2A 4FSQA 4I5HA 2WEIA 4JBVA 2GPHA 3PUPA 5IKWA 3LLAA 2R3IA 5B2KA 4BTFA 5K0XA 5HO6A 2OI4X 4GEOA 3TT0A 3CBLA 2W4OA 3K2LA 3L8VA 4O0WA 2ACXA 2CSNA 3LFNA 3ZDUA 4Q5HA 2C6MA 4ZZOA 4HCTA 1FPUA 4XV3A 3U55A 5BYLA 2ESMA 5IQCA 2BIKB 3P7AA 3ZC6A 4FIEA 3DBQA 4G3GA 4O7NA 2UZUE 4U7ZA 4D28A 3JR1A 4YZDA 3MESA 4UYNA 2J0IA 1OB3A 4X2FA 3AC1A 4ZJJA 3ZBFA 3IW7A 5CYIA 4D58A 5CEPA 4MEDA 5ACBC 3NUYA 1OL6A 4QP8A 5L8LA 2BPMA 2YN8A 4V0GB 1YWVA 3UBDA 2QOHA 3IKAA 3ATTA 2J4ZA 5DYJA 2BHEA 2C5NA 4F7LA 3SA0A 5M09A 3CLYA 5D11A 3QTRA 4IAYA 5LCJA 1Q4LA 1X8BA 4L43A 4P5ZA 3U6IA 3UDBA 4WNMA 4C61A 3EN4A 3E3BX 2F49A 4NIFB 4GFMA 3KN5A 3FZ1A 1A06A 3OC1A 1PMNA 3R9OA 4RIWB 5HU9A 5K5NA 3BHHA 2X6EA 4PP9A 3CCNA 4I41A 4EEVA 3O50A 2QOQA 3PXKA 3GCQA 2F7XE 3MFUA 4I23A 4AUAA 4BKJA 4EORA 4DFBA 3BGQA 3AGMA 1LPUA 4R7IA 4YC8A 2XF0A 4AZTA 4A9RA 2RFSA 4PTCA 2A2AA 2BROA 1G8AA 4U97A 4C3RA 1YI3A 2Y8OA 4L8MA 3TNQB 1LUFA 1Y91A 4JS8A 3UPXA 3W33A 3ID6C 2EWAA 5CWZA 4TYEA 4UX9A 4K18A 2GHGA 2A0CX 2B0QA 2R0UA 4BY9E 3MIYA 3LXPA 3NEWA 4BTJA 3MVHA 2EU9A 2XEZA 3PE1A 3N4UA 4BFMA 2WXVA 1UVRA 5DWRA 4A07A 4U80A 4IXPA 2PL0A 2ETKA 4TYGA 5CAQA 4W4WA 5CEOA 3MVLA 4DA5A 1K2PA 2OZOA 4CFUA 4I21A 5M57A 4FG8A 4K6ZA 4JR3A 1SZMA 1YOJA 3OF0A 4JLCA
chains in the Genus database with same CATH superfamily
2W99B 3DBFA 4NSTA 2W1GA 3K3JA 1XBCA 2WTKC 3IW8A 4NJDA 3ITZA 4C2WA 1OKZA 4YHJA 3KXZA 2BRMA 4GG7A 4DEBA 2GNGA 5IA4A 4EOMA 3NX8A 1M14A 4BIBA 4IVBA 3KRWA 3TXOA 2BDJA 5E9EA 2O63A 2PZRA 2GTNA 3FWQA 3MY0A 2VNWA 3QC4A 4NK9A 4PTEA 5JMSA 4BCPA 2WFYA 3QUPA 1B38A 3KF4A 4M69A 5I9UA 5GHVA 3C0GA 3ZRMA 4ASEA 4I4EA 3VVHA 2UW4A 4RIXA 1XH9A 1RQQA 3V3VA 4IB1A 4C0TA 4BVUA 1H28A 3TUDA 1F5QA 3TNIA 4CVAA 2HZ0A 3LVPA 4WG5A 5KNJA 5I5ZA 2PE1A 3GU6A 3EQBA 3TV6A 3UOLA 3ZO4A 4QP9A 3RK5A 3EZRA 2C47A 5IDPA 3JXWA 3GT8A 3Q6WA 4YTCA 4CQGA 3LQ3A 3MVJA 4CTCA 3GCUA 3LJ2A 4UYAA 2Z60A 2W9ZB 4Y46A 4EOJA 4ZAUA 2Q0NA 3RHKA 4F08A 4TPTA 4JMQA 1B39A 2PK9A 4RJ5A 5I9YA 3F66A 4FE2A 4GT5A 3ELJA 3OROA 3HV7A 2EUFB 2B9IA 2JKMA 4IJ9A 4QTCA 3BV3A 3LFCA 5BYYA 2C0OA 2VTOA 2R0IA 4R3CA 3DZOA 3PVGA 3OD6X 2ZJWA 3D2IA 1WBNA 3SRVA 4E7WA 4ZZMA 4ZMFA 3GQIA 4BCKA 2ITTA 1T45A 3NNVA 4O86A 5CQUA 3ZC5A 1Q8TA 4X7QA 2X0QA 2G2HA 3VNTA 4L9IA 3IDBA 4O38A 3I60A 5EI6A 3HRBA 3W1FA 5CF6A 1G8SA 3UGCA 1FVRA 3EQRA 3ACJA 5HEZA 4RJ3A 4RJ8A 1XMLA 3KCKA 5AM6A 2XK9A 4LL5A 2WB8A 4ZOGA 3MFSA 5CSPA 2CPKE 3LPBA 3VBYA 2PVMA 2PHKA 3L8XA 4UWCA 3ENHA 3PUFC 3GUBA 4AQCA 5KKRC 4I93A 3EQPA 3PFYA 4FKSA 1FMKA 5B0XA 4HGEA 4KA3A 4IB3A 4W4XA 4ZSLA 3V5QA 4CXAA 3R9NA 4WUNA 4DLIA 2ZM4A 4Q9SA 2X8DA 4S30A 2VX1A 4E93A 1OUYA 3DLZA 1RW8A 4KABA 2XEYA 3BLHA 3HV6A 3P5KA 1Z9XA 4OTWA 4U44A 4JQ7A 2ZOQA 4G3CA 4C8BA 4CTBA 2A27A 5JSMA 3OHTA 2F2UA 4TL0A 3DKFA 4QP2A 4WRSA 2BRNA 4I92A 4D2PA 4XBRA 4C33A 4HVIA 2UZDA 4W4VA 3ZMMA 2YIYA 5IU2A 3M42A 3TN8A 4BCJA 2WQBA 3CKXA 4KIPA 5HBHA 2W1IA 3ZLWA 4EBVA 2OF2A 4M3QA 4OR5A 4W8EA 4DGOA 3BE9A 1VLRA 1PYEA 1DAYA 4FKWA 4HOKA 4UY9A 2C5VA 4N57A 3WZUA 2PY3A 2FSLX 4R7HA 4GCJA 4ZTLA 3SD0A 2P2IA 3MA6A 4QQ5A 3TG1A 4BZNA 5IQGA 4J71A 4G31A 3CJFA 2WO6A 2C6DA 4B6LA 4BDDA 3RI1A 3AOXA 3QKLA 5EKOA 4ZLZA 2V22A 2XMYA 3ZM9A 3VJNA 4Y5QA 4BCQA 4CLJA 2WIPA 3VS4A 4BDCA 1OPJA 5LVMA 4C7TA 3EH9A 3I79A 3N51A 4TWPA 5FGKA 4M7IA 3W8QA 3NNUA 4FIHA 3OWLA 3UOKA 4B8MA 3ORPA 3UO6A 5KZIA 2O3PA 1Y6BA 3ODZX 3PXRA 4GJ2A 3F3UA 3CY2A 4K11A 3MSSA 4HZRA 3BIZA 3HMIA 3KVXA 4NKAA 4YZBA 5KE0A 4E5AX 2ZFYA 4RZWA 4GIIA 4PMTA 2P55A 1YDTE 2WQEA 4A4XA 1OM1A 4FJVA 2WMVA 3KRJA 3B8RA 4OT5A 2CHLA 2BUJA 1Q3WA 3QTWA 1P14A 5J5TA 2XIZA 4CT2A 4CMUA 3O23A 3RBWA 5C4LA 4GKHA 1XWSA 3NZ0A 4Y8DA 2J2IB 4Z16A 1OIRA 2RFNA 2XNEA 3PZHA 4RA5A 4O7TA 4H1MA 4CMOA 2QLQA 4EC9A 5E4HA 4QOXA 3B8QA 4F64A 3HGKA 1V0BA 1FGKA 2C3LA 4XJ0A 3S00A 5EI2A 3A8XA 3FI2A 1XR1A 2R3NA 2UVXA 3EQHA 3GU7A 3QZIA 1NW1A 5EQYA 3LQ5A 4TWNA 3VUDA 4L44A 1PF8A 1VZOA 2YLFA 4FL2A 4FYNA 3RPRA 3NW7A 3RNIA 3F6XA 1KE8A 2Z7RA 3AKJA 4H3BA 4UB7A 3P7CA 4F7SA 4C62A 1LEWA 4Z7GA 3CY3A 3DA6A 4YLJA 3FXZA 3U4UA 4IDTA 4DGLC 1UWJA 4F63A 4FC0A 3QYZA 4BB4A 2IZUA 4FG7A 5FDPA 4RG0A 3MJ1A 4OTHA 2QOOA 3Q4UA 5L8JA 4U45A 5M51A 5KBRA 3ZUTA 4LFIA 5BYZA 4BTKA 4H05A 3MIAA 2UW6A 3R1NA 2HWPA 4TNDA 3D5WA 1PKDA 3MS9A 4RQKA 1K9AA 4FNYA 2OSCA 3GI3A 1CMKE 3EFJA 5D7VA 5TKDA 3PLAE 5EOBA 3IOKA 4NT4A 3N9XA 3C13A 1H0VA 2GNJA 4OT6A 2XRUA 5EW3A 3UNKA 4C4IA 4FL1A 4ACHA 5D41A 3IGOA 3UG1A 3QGWA 4I24A 3MA3A 5CVGA 3UNZA 5EH0A 1CTPE 3MH3A 3AD5A 3Q2JA 4AZSA 1TZDA 2XNNA 4WKQA 2OGVA 4DTBA 5CXHA 1BLXA 4FF8A 3CSVA 2ZB0A 3P5JC 4FKIA 4GMYA 2HWOA 3QCYA 1J1BA 4FZ7A 4M15A 5M4IA 2YA9A 3KRRA 4QQJA 3E8NA 3NAYA 3QQFA 2P2HA 3GCPA 3P78A 2GU8A 3DV3A 5H8BA 4EK3A 1URWA 2FSMX 4WSQA 4XS2A 3ZZEA 3Q9WA 2Y4IB 3RHXA 3QD2B 3DB8A 4AOJA 5JGBA 4KIOA 4EH4A 2PVKA 4IWQA 4EI4A 5EDPA 4X6RA 2J9MA 4KBCA 3MN3A 4NFNA 5AM7A 3RPSA 3EN5A 3COKA 2X2MA 1H07A 3O8TA 4EOLA 2ZVAA 2R3RA 2UZVA 4I5MA 1H26A 2YCRA 4FSYA 5E1SA 5A6NA 1SNXA 4N6ZA 4BDEA 1ZXEA 3SGCA 4FTTA 2XRWA 4PMPA 5KMIA 5DRBA 5HG8A 1FBNA 3AKLA 2GHLA 4QRCA 4JAJA 3AC8A 3I5ZA 3FBVA 4DHIB 1JKLA 1UKHA 2ITWA 2XK8A 2PULA 5BVNA 1WVXA 3ORIA 4I6BA 4IEBA 2E9PA 3PSDA 2C5OA 4FOCA 4KIKB 3VULA 1QPEA 4EKLA 3NYVA 3OCBA 4IAZA 4JT3A 3HEGA 5ANDA 5ANJA 3VHEA 2BRHA 3PJ8A 4L3LA 4LMNA 4FV7A 1WCCA 4IHPA 4BDIA 2WTDA 3DY7A 4UEUA 3QFVA 4I0TA 3SXFA 3JVRA 4C2VA 5BVFA 2XANA 4QTDA 1YI4A 4D1ZA 3H9OA 3RPOA 4AW5A 5A4LA 3NPCA 4KBAA 2PVRA 1H27A 1ZOGA 2VWIA 5JRQA 3EOCA 3DTCA 1H0WA 4JQEA 2X7GA 3BYMA 3WZEA 1MRYA 3E7OA 5EM6A 5T6KA 2HZ4A 4FVRA 5DLSA 4AZFA 5JK3A 2OKRA 2R3FA 2XCKA 4RX9A 4X2JA 3DGKA 2ZMDA 5I9WA 4FV8A 1YXSA 3HECA 1O6LA 3BCEA 4CFFA 2GNFA 3ZTXA 1Q8YA 1IASA 2E9OA 4RWLA 4YC6A 2VAGA 2WZJA 3D7ZA 1H01A 5BQ0A 3GOPA 4N0SA 4DH3A 4RT7A 2E9VA 3ORXA 1WAKA 4FGBA 2VNYA 1E1XA 4EK6A 4IC8A 4ZY5A 4RRVA 3E7VA 3G5DA 1JBPE 3KXXA 2Y6MA 4O7LA 4TWOA 4EQCA 5HTIA 1FMOE 4IVDA 4CEGA 4O81A 5LXMA 2WGJA 4XEYA 1Q8UA 4K8AA 3PDTA 4PMMA 2PUPA 4JVGA 2QO9A 3BLRA 3Q5IA 4TWCA 4AG8A 4E20A 2C1BA 3S1HA 1R1WA 3TKUA 4TW9A 3HKOA 5CI7A 4XV2A 5TE0A 2X8IA 4OTQA 3VIDA 2HK5A 4X2KA 3HZTA 3QTXA 3RVGA 1ST0A 1TQMA 4KKGA 1YDSE 1XH5A 2WD1A 4DE4A 4V04A 1W83A 2JFLA 5IEXA 3H9FA 4AZWA 2JAVA 3MY5A 4WBOA 1NXKA 5AAFA 3PWDA 4EOIA 3QU0A 5K0KA 4DCAA 3CE3A 4GU6A 3BU6A 4OBPA 5EG3A 5F9EA 5BX0A 2AC5A 1TKIA 4YZNA 3IOPA 5JFSA 1W2DA 1YHSA 3JY9A 3UDZA 3R9HA 2XUUA 4GVJA 3EN7A 3FLYA 3R63A 5DFPA 3SDJA 4BDBA 4RWIA 4EH7A 3LCDA 4J95A 3DDQA 2OJJA 3IK3A 3PVWA 5KKRB 4TYHB 2XA4A 3CQUA 3VS2A 2C0IA 4FK6A 5HICA 4OBQA 4RJ4A 3KFAA 4MUQA 2PVJA 2J5FA 5IEVA 4MD8E 5D1JA 2OZAA 3BPRA 4MX9A 5FXSA 3LCOA 3LE6A 2VGPA 3C4XA 2AUHA 4I6QA 4PDOA 3PVUA 3KC3A 3KEXA 3OW4A 3HA8A 1J7LA 4A9UA 3DK3A 1TQIA 2QO2A 1Y57A 3TM0A 2Z7QA 2VTQA 1ZMUA 3C5IA 4MWHA 4MBLA 2PVYA 2XIYA 5M4FA 4ORKA 2XH5A 4G3FA 4HYUA 5M4UA 1W0XC 3LCKA 3OT3A 4O7SA 2KULA 3GU8A 1ZYSA 5AJQA 3OXTA 5CAOA 3W10A 4F7JA 2X7FA 4EZ3A 3CC6A 3MVMA 2VRXA 4TT7A 2IVUA 2B1PA 2EB2A 3KKVA 3MV5A 3PXZA 5L6PA 4Z9LA 4LQMA 4G5PA 4Z3VA 4IH8A 4IZYA 1CKJA 3QTZA 4IZ7A 4ENXA 5KHWA 5CVHA 2NYAA 2CN5A 4NZWB 4O22A 4BZDA 4E4LA 5I3RA 3QRKA 3CQWA 1GIHA 3EQFA 3QTQA 5I9VA 2ITXA 2WTCA 2BKKA 3N4VA 5DA3A 5KZ0A 3IQ7A 4MNEA 5HVYA 1ZYJA 5C26A 3UZTA 2PZ5A 2CMWA 2G15A 3W2CA 1NVQA 2IJMA 1OGUA 5D10A 3S95A 3W32A 5JH6A 2WOUA 2BTRA 4JBQA 2J5EA 3QCQA 4IB5A 1IAJA 2CJMA 4IFGA 4IFCA 2VO0A 4AXAA 2VTAA 2XVDA 2XJ1A 3GC8A 3RAHA 5LVLA 4R6VA 3UO4A 3S4QA 5HNGA 4Y95A 2PPQA 3G0FA 4ASZA 1KSWA 1W2FA 5CEKA 5JN2A 3L9LA 4GYGA 1OPLA 2ZDUA 3W2RA 5CNNA 1ZZ2A 3P7BA 5IQHA 3R9DA 5GZAA 1U54A 3A4OX 4F70A 3TNPC 4CV8A 3BYVA 3DCVA 5HE2A 2C1AA 3BHVA 3SVVA 5LVPA 4OGRA 1PXIA 3IS5A 2F7EE 2XIKA 1QMZA 2KTYA 3G15A 3CTJA 3RP9A 2YJSA 4DHZA 1REJA 3O51A 3TUBA 4U41A 5A9UA 5H2UA 2C5XA 2WOTA 4QMMA 4ALUA 3PIXA 2QQ7A 3VONA 4L45A 4BN1A 4ALVA 4M13A 2Z02A 4O27B 4J8MA 4KS8A 4G3DA 3P79A 3EN6A 5AUTA 4LRMA 4M68A 3O71A 1M2QA 4AA4A 4QP6A 4EOSA 4IW0A 4R5SA 4ZY6A 1G8JA 4D1XA 2WIHA 3Q9ZA 3WE4A 2JBPA 4PMSA 3W8LA 3QTSA 4O7VA 4FSMA 2WTIA 3PIZA 2R5TA 3KMWA 5KUPA 5AP1A 4BCNA 4LG4A 4BDGA 4R3RA 3FLSA 3NIEA 3VBVA 3W2QA 3G90X 4LRKA 4R1VA 1V1KA 2HXQA 3LQ8A 5EM7A 3LFAA 5KMNA 4C36A 5AV3A 2JDTA 5C03A 4M14A 3AQVA 3I0QA 3NW6A 4QMNA 4I4FA 3MY1A 2WTJA 3G6GA 4QEBA 3HMMA 3DNEA 4QMQA 2RG6A 3LXKA 3D5XA 4QPAA 3UJGA 4ZS4A 5CSXA 3KULB 4FTIA 3POZA 4DAWA 1ZYDA 4C3FA 5FEDA 2XYUA 5CF5A 4DF3A 1W84A 3NVMB 4L7SA 3RINA 3BU3A 1GZNA 4YJPA 3QA0A 4CRLA 4BJJA 4FBXA 4ACMA 3S0OA 4OBOA 3HP5A 2AC3A 4G34A 4PL3A 4GG5A 1BYGA 4L00A 5AR8A 4CGAA 5CSHA 3AMBA 1KOBA 2WKMA 3GC0A 3F3ZA 2ITPA 1GIIA 4F9YA 3R28A 3MH2A 3G2FA 3AMYA 5L2TA 4FIGA 2JIIA 2AYPA 5FM2A 1BUHA 4DHFA 2FGIA 2V5QA 3VS0A 4C58A 3DS6A 1FVVA 2PVLA 3ORNA 2QCSA 1PXOA 2BZKB 4EYMA 4C4GA 3OOMA 5CX9A 3ZRKA 3KMUA 2ZB1A 4DTAA 2G9XA 3UYSA 4KSPA 4KIKA 4OUCA 1UU9A 3R30A 4IDVA 4RIYB 2P33A 2YZAA 3DXNA 4JXFA 5JZNA 3ZSIA 4BBMA 4FZ6A 5F4NA 2PYWA 4Y72A 2UZLA 4XG7A 2PMNX 4E1ZA 4EK5A 4CLIA 1YI6A 4DH5A 3HUBA 2YERA 3VW8A 3SAYA 2CCHA 4EONA 5DRDA 4AXDA 4XV1A 3DU8A 2OIDA 2YM4A 1BL7A 1YXUA 2CGVA 4FKPA 4DFYA 4QP4A 1OKYA 3IW4A 4EWQA 4FKUA 3UDSA 3UO5A 1UU7A 2LGCA 3OY1A 4AFEA 3BWFA 2Z7LA 5IQEA 3MB7A 4PL4A 3A62A 1YWNA 3CXWA 2OBJA 4GFGA 4AW2A 5HCZA 2ZYBA 2R9SA 5L6OA 4MQ1A 3ML1A 2YCQA 4AZEA 2J50A 3HLLA 4IM2A 4M12A 5H3QA 4D2RA 4EHZA 5CU2A 1ND4A 4WHZA 3D5UA 4BF2A 3QBNA 4RFZA 4ARKA 4HZSA 5DVRA 3FKLA 1VYWA 3VS5A 4IB0A 5E8SA 1WBTA 4FEWA 5CSWA 5GINE 1ZAOA 2F7ZE 1PMVA 4FVPA 1R0PA 2HAKA 2V7OA 4MCVA 3ET7A 4NWMA 2DQ7X 3MTFA 4II5A 2BZIB 4JAIA 4KAOA 4RX8A 4FODA 5CNOA 3TV4A 4AU8A 1IR3A 3CD8A 1ZLTA 3V51A 3QAME 1G3NA 1M7QA 5L3AA 1YWRA 2A98A 1OVEA 2B53A 2VWBA 2W1EA 2PMLX 5HG5A 4NTTA 5E8YA 5CANA 2ETRA 3OOGA 5LWNA 3DKGA 3Q4CA 4WNKA 4FMQA 3TDVA 4DN5A 3ZYAA 4FTMA 3I6WA 1YDRE 4GT3A 3BHYA 4M66A 5E8ZA 2WU7A 1IRKA 2VWWA 3PSCA 5DOSA 5FBNC 5LVNA 3U54A 4ZK5A 3GBZA 4QMPA 3T9IA 5HBJA 3LM0A 2OJIA 4QP7A 4UMRA 5HIEA 3U6HA 3ULZA 1OBGA 4ENYA 4JRNA 3FY2A 4XV9A 2VTTA 5L4QA 3FC2A 2WPAA 3A2CA 3TKIA 1DI9A 3R73A 4MXAA 4BIEA 3W55A 4YTHA 2XB7A 4EHEA 2W5AA 1UKIA 3FMNA 1SVEA 3LFFA 1Q3DA 5IPJA 2VU3A 4GW8A 3RK7A 2W4KA 4A9TA 2QOFA 3CKWA 1GZ8A 5A4TA 4XLIA 4O6EA 2WTVA 3EB0A 5IG1A 4YZ9A 2ITQA 3E8CA 3R2YA 2C6TA 4GS6A 4EHVA 2IZRA 4ANOA 4RFMA 3TTJA 4ZY4A 1AQ1A 3R21A 3TJCA 3DDPA 2ITUA 3FMHA 4PQNA 5HNBA 4O21A 4I6FA 5CT7A 4F4PA 4IE9A 4PWNA 4P7EA 4RX7A 4ZTHA 2RG5A 3FE3A 5DT3A 4YP8A 4HNIA 3DPKA 2R7BA 1YXXA 4D1SA 2YJRA 3ZEPA 2IZSA 3VQUA 4AXEA 3OW3A 4XMOA 4QMXA 4EYJA 2FO0A 3W2PA 4BWXA 2WMQA 3I0OA 3CD3A 4FIJA 3A7HA 3QRIA 3PP0A 4V01A 3ZO2A 5JGAA 4DH8A 2BALA 3C7QA 3DOGA 5EHYA 3RWQA 3E62A 4WIHA 2JAMA 3L9MA 2VO3A 5HE3A 4BWPA 2I1MA 2C68A 4EH6A 3EQGA 3FXWA 2B9HA 2R64A 4HGSA 3Q9XA 1JKKA 2BRBA 3R8PA 5TF9A 5I0BA 3FMJA 2XIXA 2R3MA 3O7LB 3NMUF 3D9VA 1MP8A 3FMKA 4LV8A 3D14A 4O0VA 4UBAA 3U8WA 3NFGB 4K9YA 4TY1A 3O96A 4BHZA 4BDAA 3NUAA 4YZMA 5CI6A 4WOVA 3JPVA 4EKKA 4DEEA 3ZBXA 4NYEA 3RTPA 3WYYA 3LW0A 4OTIA 3QZGA 4BCGA 1WVWA 1QPDA 3QWJA 4LI5A 4DEAA 2W5BA 2W4JA 3D7TB 4XG4A 3VHKA 5LOHA 4YPSA 4YLKA 3MBLA 3A8WA 3DBDA 3QUEA 2HXLA 1U54B 2VZ6A 4ZTRA 3ZH8A 2WQNA 3QQLA 3BELA 4O0YA 5HIBA 1UV5A 4U3ZA 2J7TA 2ZMCA 3ZDIA 3PPKA 4H1JA 1PRYA 4S33A 2X9EA 5HD7A 4BHNA 4BDKA 3R00A 4IQ6A 3NGAA 2HCKA 1GAGA 2DUVA 3COHA 3HMOA 5J8IA 3LOKA 4O96A 2IW8A 4WO5A 3ZM4A 4YO6A 2G01A 3WIKA 4YMJA 4FKVA 2QHNA 1B6CB 3HRCA 4AE9A 2W9FB 3UOJA 2PZYA 4FEUA 3GQLA 4FTQA 1A48A 4XG3A 4BGHA 4FTKA 2UZEA 4E4XA 2ERKA 1JKSA 3UQGA 5CAPA 2O65A 4ZMEA 1SNUA 3GCVA 3TNHA 4CCUA 2NRYA 4BL1A 3BYUA 4USFA 3MJ2A 5D12A 3IDCA 5AAGA 5I4NA 4O2PA 2B4SB 3C4CA 4U0IA 3ROYA 2HZNA 3NLBA 4PDPA 4AXFA 3OBJA 2VTIA 1R3CA 3BQRA 1CM8A 1MQBA 1ATPE 3R1SA 4IACA 4ERWA 1OL1A 2YISA 1STCE 3R7UA 4YZCA 3S3IA 4F1TA 5ICPA 5IUGA 4B99A 1H1RA 5JGDA 1RJBA 3HV5A 4DYMA 1GZOA 4D5KA 4O1PA 5LMKC 4D4RA 4GRBA 4EZ7A 3UC3A 2F2CB 2X0PA 5JQ8A 4NM7A 3G9NA 4F1OA 4BBFA 5C1QB 3FYKX 3MW1A 3BGPA 2IZTA 4I6HA 4MTAA 4I1ZA 1QPJA 4FV5A 4XG8A 5LMAA 4V05A 2WEVA 2PZIA 1CSNA 4IJPA 3MH1A 3QLFA 3LFEA 5FEQA 3ULIA 4U81A 4YO4A 3FZOA 3HV4A 5BMMA 3F88A 4A4OA 3H9RA 3WOWA 4JDHA 2AEGA 4C4JA 3SG8A 3KA0A 3QX4A 4H39A 3TYKA 1ZRZA 2VGOA 4H58A 3M2WA 4BZOA 2GSFA 1TVOA 2X4ZA 3L9NA 3SW4A 2OLCA 4OTFA 3LMIA 5AV2A 4FUXA 3Q60A 5EYMA 4DITA 4FKQA 4FKTA 2X7OA 4FSNA 4YBKA 1O6KA 3SRVB 4CZTA 2JKQA 3PRFA 4FK3A 1XHAA 4CKRA 4F9WA 5I9XA 2YABA 4RQVA 4AX8A 5HOAA 3FLZA 2OK1A 4YTIA 4RVLA 3GU5A 4J7BA 2I0HA 3TJDA 1W82A 1XQZA 5B7VA 3EMGA 4FTNA 3LMGA 3QZFA 4JG6A 2Y9QA 3WZJA 3SLSA 3SW7A 2XK7A 1JVPP 5D9HA 2GCDA 3VAPA 3F61A 5AX9A 3W0SA 4F9BA 3R01A 3TDWA 1SM2A 4QMWA 3UODA 1P4FA 3D5VA 5A4QA 5AX3A 3AT4A 2BKZA 1SVHA 2G2IA 2GQSA 4F0GA 3BV2A 2BIYA 5KMJA 5BV3A 3HVCA 5BUJA 5LCKA 2W1ZA 2VWVA 3MFRA 4TNBA 4ZJIA 4OTDA 4FG9A 2YDJA 4CT1A 4ZTMA 2RF9A 3PVBA 1ZMVA 2XKDA 4FA2A 1ZWSA 3PA5A 3QHRA 5IQFA 1KV1A 4RVTA 4C4EA 4MAOA 2CNVA 3LJ1A 3KK9A 4QDVA 3PLSA 2X8EA 3K54A 4DBNA 3UPZA 3GOKA 3C4EA 4CFNA 5CY3A 2A19B 5IF1A 3F3TA 2CDZA 1W98A 2C4GA 3EL8A 3ZLYA 4I3ZA 3TV7A 3OP5A 3Q96A 4JR7A 4L6QA 3FZRA 3D15A 4NUSA 4QMVA 5IA5A 3NW5A 4GU9A 5FP5A 4RVMA 3PXQA 4C37A 4D2SA 4ZJVA 3AMAA 5AUUA 1UNHA 2JBOA 5AA8A 4JG7A 4IWPA 3F2RA 2VTLA 2OG8A 3PA4A 3F2NA 5HG7A 3PJ3A 1VYZA 2ITVA 3KRXA 3AG9A 4FKOA 4FYOA 1R78A 4MF1A 4NM3A 2C6LA 2P3GX 4RWKA 4U43A 5DE2A 3UOHA 4D4SA 4MD7E 2PMOX 2QNJA 2XJ0A 3NUXA 4FKJA 3ORZA 4E4MA 4J97A 2I40A 1OKWA 4QMLA 5C27A 3EL7A 2HELA 2RFDA 1BI8A 1OMWA 3CGOA 4O4BB 4P4CA 1RE8A 4UMTA 4F65A 5GZ8A 5IZFA 5E8TA 3ZFMA 3WF9A 4KD1A 3WIGA 1YQJA 4PUZA 5KBQA 5AP5A 4NH1A 4CD0A 3ZFYA 4BCOA 5HORA 3LAUA 3P0MA 4HPUE 1LEZA 2X39A 5C4KA 3KN6A 1YHVA 3HUCA 5ANKA 2E2BA 4I5CA 4D4YA 4I0RA 4DH1A 5AFVA 1JKTA 2WU6A 1OPKA 3OFMA 4FSRA 4ZZNA 4LDTA 4MKCA 3O7LD 3AGLA 3TTIA 3P1AA 4UZDA 3RMFA 3GVUA 4G9CA 3CQEA 2WMBA 4LGHA 4G17A 5L2IA 4J52A 3VBXA 4IVCA 1DM2A 2PUIA 4YTFA 5AA9A 4O82A 2REIA 4PX6A 5C8KA 5IQIA 5F1ZA 4GV1A 4UXLA 5HCXA 4O4DA 3QCSA 4DGMA 2GNLA 4E8AA 4E26A 3G9LX 2JIVA 5CF8A 2CGXA 2VUWA 3LIJA 3QQHA 4FKRA 3M11A 4ANNA 5AMNA 2X2KA 2QOKA 2YWPA 4QP3A 3V5TA 5DHJA 2EXEA 4NTSA 1L8TA 2QLUA 3NUNA 4ZEGA 2DS1A 2UZWE 3SX9A 3W0MA 2YIWA 4DBXA 4IX3A 1KE6A 3SKCA 4A06A 3O5AA 1YVJA 4ZP5A 3PY3A 5C8MA 2O64A 3TL8A 3K5UA 2UZNA 2F9GA 1K3AA 4XX9A 2W1HA 1J3HA 5EK7A 2R2PA 4LOOA 4LV7A 2BZHB 3KMMA 4IMYA 5GZ9A 3CPBA 3R1QA 5HVJA 3I1AA 3KXGA 4EHGA 3FKNA 2CNQA 1Q8WA 4JNWA 3ZSGA 4EK8A 3O2MA 2Y7JA 4GK3A 4YJVA 4YJOA 2WHBA 5EYCA 4F6UA 4XOYA 3TWJA 4AW0A 4RIXB 1WVYA 4AS0A 3HP2A 3QC9A 4PRJA 4CSVA 2Z7SA 3DZQA 4R78A 4TYJA 4WA9A 1UA2A 5KMMA 1QCFA 4QQTA 1A9UA 4AZVA 3O8UA 3EWHA 4RVKA 3F82A 2F4JA 3RKBA 3KXNA 4FIFA 3SXRA 3LFQA 3MH0A 2WAJA 5K5XA 1YW2A 4RIWA 2YFXA 3RALA 2OH4A 5HCYA 2BAKA 5AEPA 4QYEA 4MXZA 2XZSA 4GH2A 4XRJA 5AR5A 1KUTA 2VN9A 2QU6A 4BI0A 3WF5A 3EYHA 4NCTC 1H08A 4RIYA 4ZTNA 5EQPA 3VQHA 3QTIA 4ACGA 3V8SA 4R8QA 4ASXA 4DTKA 2GHMA 4C3PA 4F7NA 2BHHA 5L8KA 3G6HA 3W0QA 1XH7A 1XO2B 2GFSA 3PRIA 4JDIA 5AP0A 1U4DA 3ALNA 4E73A 3A61A 4YBJA 4AT3A 3UTOA 3UQCA 5CASA 4B9DA 3GNIB 4YR8A 1YRPA 1GOLA 4NCTA 2X4FA 2OXXA 3SOCA 5AUWA 1PMEA 2J90A 4TTHB 4AQKA 4ANQA 5KO1A 4R77A 3WYXA 3LFSA 3PG1A 4IM0A 4L3JA 3CIKA 5E1EA 3VN9A 5CVFA 4RC4A 2IN6A 4FNXA 4J1RA 4ACDA 5J79A 4OAUC 3R7IA 2H6DA 3WZKA 2VWYA 1KE7A 4JBPA 3BYSA 4RLLA 3COMA 1WBPA 4IWDA 1H1WA 4O0XA 5GIPE 4PPCA 2IO6A