4NFMA

Human tau tubulin kinase 1 (ttbk1)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
293
structure length
293
Chain Sequence
DILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWEKAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Tau-tubulin kinase 1
publication title The structure of human tau-tubulin kinase 1 both in the apo form and in complex with an inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 293
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4nfmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4nfmA01
5LMAA 2UW9A 4YJTA 2WU6A 3VS7A 4I0TA 4A9SA 4AN3A 4YZ9A 4RWLA 2ZMCA 4I41A 5KMJA 4ZTQA 4AT3A 5BYLA 3REPA 4NTSA 3LCKA 4U3YA 2XVDA 1H24A 3VQUA 5IUHA 2P3GX 2WTKB 3ZLYA 4AGUA 4RA5A 2PE0A 5H3QA 2Y0AA 4BBFA 4QQTA 5BUEA 3W33A 5CT7A 4DYMA 4FV7A 4WNOA 3BWFA 5LVOA 1CSNA 3MY1A 4C4IA 5IMXA 1PXPA 2IWIA 5L6WL 5JFVA 2GFCA 1QPJA 3Q2MA 4DH1A 5L8JA 2CGWA 4FKSA 4FA2A 2ITXA 2O63A 3LAUA 2ZMDA 1PXIA 2OG8A 4GT5A 3R7YA 2OFUA 2W9ZB 3M42A 4CMOA 5FUTA 5I0BA 4I21A 1ZOGA 4N57A 4U7ZA 2IO6A 1TQMA 2IW8A 4ZTNA 4AUAA 2QC6A 5EW9A 3AG9A 5FTGA 1LR4A 3ZLSA 2WTDA 3PJ3A 5LCKA 4BCIA 3SC1A 3PP0A 3QTWA 4Q5EA 1Q3WA 5HTIA 3UC4A 1Q4LA 3MPMA 2UVXA 4XH6A 2EB3A 4PMSA 3GVUA 4HNIA 4X2JA 5AP6A 1UKHA 3PXYA 5AR3A 4CEGA 5CANA 4ZMFA 2BPMA 2ITNA 1B6CB 4GSBA 5M09A 3A4PA 3PA4A 3EQIA 4JQ8A 4NW5A 4FSZA 4KIPA 2CDZA 3I79A 4GS6A 2PY3A 3RAIA 4G3EA 4IAYA 2BTRA 4IJ9A 4IWOA 5D10A 4ZJIA 5DEWA 4HVHA 3SD0A 4EOQA 5HBJA 5DR2A 5EHLA 1PHKA 5LWNA 4N4SA 2J4ZA 2DS1A 5AV3A 1W82A 4DFBA 5KKRB 3OW3A 5CYIA 3IONA 3VIDA 3D83A 1OMWA 4WRGA 1ZRZA 4G6NA 4BDIA 1YWRA 1R78A 3QCSA 4ZXTA 1W8CA 3A7JA 4CYIA 4OAUC 4EOLA 3RALA 5KMIA 3N51A 4L7FA 2GNGA 3FZRA 2YCFA 4QQCA 4EH8A 4K1BA 4TPTA 2C5NA 3TKUA 4AN2A 3CY3A 3WI6A 4Y8DA 3F9NA 3R7VA 4K9YA 4DGMA 5A46A 2OIDA 2X8IA 3PRFA 4XLIA 5DPVA 3EB0A 5AV4A 4H1MA 5HE1A 3EHAA 4F9CA 5AV0A 3C13A 2CSNA 4JJRA 4FEVA 4GJ2A 1ZYJA 2B9IA 1H0WA 4G17A 4EK6A 5AP1A 4ZSJA 3LMHA 1YOJA 3HAMA 4KS8A 3CD8A 5E8TA 4CLIA 4I0SA 4G2FA 4G5JA 2FSTX 4D0WA 5C27A 3TV7A 3OF0A 3VS0A 3GC0A 4QMPA 3W55A 1NT2A 4ERKA 3PPJA 4BDKA 4EOSA 1ERKA 5C1QB 4HPTE 3QRIA 2HWOA 5AP7A 4MF1A 2XB7A 3R02A 4EBWA 2JAVA 1QMZA 3S00A 5IEXA 1M2QA 3QCYA 4CG9A 2Q83A 2VWUA 3PXQA 3PVGA 4F1OA 3PUPA 2Z7RA 5I9WA 3DXQA 4FT0A 4I5PA 4FVRA 4JG6A 4RQKA 2UUEA 3MI9A 2I0VA 4DT9A 4FTKA 3BKBA 4WSQA 2ZV8A 3VS4A 2CNQA 2C5XA 3TUCA 3SXFA 5AM7A 3KULA 3NYOA 4J99A 3RHKA 3UG1A 4RWKA 3KN5A 4FZDB 4HVSA 4UMPA 2P2IA 2SRCA 2G15A 1NXKA 4GW8A 3DK3A 3V5WA 3GCUA 5EDQA 4RWJA 3MTLA 5A9UA 4IX4A 3Q6WA 2W7XA 4WNPA 4F99A 3BLQA 4BIEA 5DI1A 5CF8A 4BF2A 5JRSA 3ZFYA 4GFOA 1BKXA 4U3ZA 5IDNA 4AW5A 3NNXA 3A62A 4NTTA 4NK9A 2Y6OA 2UZLA 3MBLA 4E4MA 1G5SA 4KD1A 4EOMA 2UVZA 5HKMA 3DTWA 4TXCA 4H1JA 4BDHA 4X6RA 3BLHA 2J5EA 3OOMA 2WMTA 4TYEA 3ID6C 4YPDA 2PZ5A 4B6LA 4ITHA 4O7WA 3NCGA 2R3KA 1H8FA 3RHXA 1P14A 3HA8A 4I1ZA 2XNEA 1L3RE 5HG9A 4UX9A 4AA4A 5JGAA 1FVTA 4FTJA 3R9NA 5ANGA 1J7UA 4S2ZA 2ZYBA 4WT6A 3BV3A 4XV1A 4EOOA 3NS9A 3MYGA 4KWPA 4HVDA 1UU7A 4ANQA 4M68A 1UVRA 4BCGA 2XRUA 3TKHA 4FTRA 4AG8A 4KA3A 4UWYA 3OP5A 5HBEA 1KUTA 3LQ8A 3UIXA 2B9FA 3AC1A 3LFEA 2W1EA 4D2PA 4QYEA 3C4EA 2CHLA 4EHVA 4G5PA 3IW4A 4EHEA 2JKQA 2X7GA 3PY1A 3V6RA 2BHEA 4AGDA 4I94A 1URWA 1ZWSA 2BRMA 1XR1A 2RFDA 1J7IA 2PE2A 4HYHA 4FTQA 2JKKA 1WMKA 3SKCA 3RTPA 3ZO2A 5EQYA 4FE2A 3ZUUA 5TOZA 2C6DA 4M97A 5H8BA 4F08A 4GVJA 1H1RA 4AGWA 2VAGA 2VO3A 2R0IA 2XK9A 3Q4ZA 3UIUA 5AJQA 1OPKA 4ALUA 4EH2A 4RC2A 3F6XA 3FXZA 2PUIA 3QUDA 2X6EA 4O0TA 4KIOA 2W1IA 1R0EA 3HMPA 4LOPA 4L68A 2VTHA 3LKMA 4AT4A 4YJUA 1Z5MA 2HENA 4EC8A 5AR7A 4GCJA 3BHUA 3FE3A 2CPKE 2ZV2A 4NIFA 4G3DA 3R30A 4G9CA 4I0RA 3MWUA 4DH7A 3MGYA 2VTAA 3UYSA 4JBQA 4FKLA 4O96A 4LRKA 4QP8A 4XS2A 5AP0A 3BLRA 3R83A 4GKHA 3QZFA 2WMXA 2XIKA 1UWJA 4KABA 1YXVA 4R7IA 5M4CA 1YWNA 4ZOGA 2HY0A 3L8SA 3QRJA 3E7VA 1FQ1B 4PL3A 2PSQA 4O7VA 2G2IA 4XG2A 2B55A 3GUBA 4XV9A 4IM3A 4KKHA 1PXNA 2CKOA 3D7TB 3KMMA 4GU9A 3O7LD 2YHVA 4RJ4A 3L8VA 2W05A 4NM0A 4QNYA 4RJ8A 4QTDA 3SOAA 3TNHA 2X2KA 2BRBA 3GB2A 4X7QA 5AUTA 1ATPE 1IASA 3EQHA 3O8PA 2YZAA 1S9IA 4AW1A 4EYMA 3EYGA 3PWDA 1OZ1A 2VTLA 3PIYA 2WMWA 4RIXA 4ACMA 1OIUA 3OVVA 5L8LA 1YOMA 3OCBA 4CFVA 3VUHA 3DJ5A 4QO9A 5DT4A 2XK6A 2Y6MA 1VYWA 3V01A 2B53A 4C8BA 4XBUA 2QHMA 3NCZA 4BRXA 4J1RA 5T6KA 1FMOE 3HUBA 5GIPE 3R04A 4TY1A 4FZ6A 3BQCA 5DIAA 3PIXA 3U8WA 3L9LA 4CD0A 2OW3A 3DBFA 3E63A 5L2QA 5BVNA 4YSMA 4D1SA 3GXLA 1U54A 2W9FB 3R8VA 5B7VA 2O3PA 4JL9A 3HDMA 2YABA 3ORTA 4FSYA 1PXOA 2JAMA 3UQFA 4R1VA 1YKRA 2YWPA 1V0BA 5JEBA 3BEAA 5A6OA 2UV2A 4U42A 4E4LA 1V1KA 1GZNA 5AUUA 4MNEA 2WQMA 3RPVA 4NJ3A 3TJDA 3C9WA 5EDRA 5IA0A 3MA3A 4EZ5A 2Y4IC 4M0YA 5KNJA 3D0EA 3GENA 4Y85A 4DGOA 4WRSA 2NRYA 4NFNA 3QBNA 1UKIA 2R3GA 1ZOEA 3AC2A 5FRIA 3QTUA 4AP7A 2QHNA 1ZOHA 4QYHA 4DH8A 3F3ZA 4FUYA 4RQVA 3CJGA 3FC2A 2FUMA 4RX8A 4TZRA 2GS6A 4UMQA 5BMSA 3C4FA 4MD9E 2HYYA 4R5YA 3S3IA 3WE8A 4E5AX 3UZRA 5KMMA 4D2WA 1UU3A 2C0OA 3SOCA 2YCQA 4KBKA 4CMUA 4D4VA 1ZZLA 4IWPA 2XKFA 3VS3A 4A4LA 5J9LA 4DHFA 4MXOA 4PF4A 4PL5A 2W5AA 3FMEA 3NMUF 4J7BA 4DFUA 5ITAA 5E7RA 4AW0A 1U4DA 1YOLA 2JITA 2UZVA 4RC4A 4C33A 5DMZA 3PFQA 5HO7A 2XNMA 3VS5A 5IMEA 1Y6BA 3E8NA 4ANBA 3UG2A 5A4CA 3KC3A 2AUHA 2JDOA 4E8AA 3E5AA 4U6RA 2RFSA 4QTBA 4WKQA 4YTIA 3L9MA 1GNGA 4JRVA 5ETAA 5IQEA 1QPCA 3W18A 2DQ7X 2WMUA 2WMQA 2QQ7A 3OXZA 4D28A 5EQEA 2G9XA 3AMYA 4FKVA 3A99A 4LV8A 3SG8A 1FPUA 4X3FB 1KSWA 2UZWE 5EM5A 3Q4CA 2F7XE 4D2VA 4AE6A 2CLXA 2UW5A 3OWPA 1M14A 4Z7GA 2V7OA 2X8DA 3BIZA 3ZXZA 4N6YA 4JBVA 4OT5A 5F4NA 2R3PA 2PVRA 4XV3A 4BDAA 2QCSA 2W0JA 3EL8A 4QT1A 2W96B 3SA0A 2O64A 4DINA 5J7BA 4R1YA 4PPAA 4U80A 3EZRA 4RC3A 5DEYA 2OXXA 3BU3A 4OTPA 3DXPA 3B2WA 1PYEA 2UZBA 4D4RA 2I1MA 3H9OA 2XCKA 2RFEA 2Z8CA 3R7GA 1OL2A 5C4LA 3ET7A 1B38A 2QOQA 3TNQB 5CY3A 4M66A 4BGQA 2A1AB 2C47A 1CKPA 2BDFA 2ZJWA 4U9AA 4O7LA 2HW7A 4PDYA 1Z9XA 3BEGA 4NH1A 4QTAA 4O6EA 4F1TA 3LFDA 3OUKA 2OU7A 3GQIA 3P7CA 4D0XA 5JGDA 5BNJA 4KUJA 2BDWA 4IB5A 1YDRE 4IZAA 4BCFA 4HGLA 4IZ5A 2IN6A 1J1CA 5IISA 2J5FA 3R1SA 3AC8A 1E9HA 3Q04A 4S30A 3DZQA 4M69A 1MRYA 2WHBA 4V0GA 5LVLA 3MVJA 2FO0A 5IH5A 4UZHA 1PMNA 4E6AA 3T3UA 2ETRA 4ITIA 4KB8A 2X0GA 3S2PA 2PYWA 4I5HA 4MQ2A 3D5XA 3H0ZA 5E1SA 2CNUA 4PV0A 4BWKA 3O2MA 4R3RA 2G2FA 2YLFA 4ANOA 1F5QA 5HNBA 4L3JA 4GYIA 2NP8A 4KKEA 5M53A 1H1QA 3SDJA 4P2KA 5L8KA 3OTUA 3KRJA 3IOPA 3WYYA 3DS6A 3IW5A 2F7EE 5EQPA 3UQCA 4DTAA 2I7QA 4NKAA 4YHTA 4FV4A 3VRZA 4RX5A 2JD5A 3MJ1A 4NT4A 2X2LA 3U4UA 3DLSA 4A9YA 4WBBB 4E6DA 3LJ0A 2GHMA 2NPQA 3CQUA 4ZSGA 4BL1A 3HAVA 3CP9A 4NUSA 3RGFA 2OWBA 2WTJA 3HA6A 4FTNA 3EWHA 4FTTA 3ZSGA 3O17A 2PUPA 5CSXA 4AOTA 5K3YA 4F1MA 3MJ2A 3BBWA 3OWLA 4MEDA 4P5ZA 5G6VA 3WF7A 3FI3A 4I20A 4HVGA 5BVOA 3UO5A 4ASXA 4BCMA 3QL8A 4FG7A 5GNKA 3FWQA 4RG0A 4ZSEA 2FSMX 3G6HA 4RJ7A 2PZPA 2YM8A 2ZDTA 3AMAA 4G6OA 3DB6A 4QRCA 2JDSA 2XYUA 4FTUA 2R2PA 4TWCA 1STCE 3FZ1A 3VBWA 3WF9A 3RJCA 3TXOA 4JLCA 3VN9A 5F94A 4BI2A 5K4IA 3FJQE 4I4EA 2HZ0A 5J95A 3OCTA 4ZZMA 2KTYA 3AGLA 2C69A 2BDJA 3GC9A 4ZY6A 5BQ0A 4K2RA 2REIA 3COIA 4XG8A 3AD4A 5EI2A 3FLYA 5E92A 2O8YA 4E5BA 4EWHA 4EZ7A 3H30A 3TZ8A 3HX4A 3KMUA 4O0YA 2XM8A 3AC3A 4CT1A 4D4SA 4E7WA 1KE7A 2WQNA 3WIKA 1ZLTA 3ODZX 3UO4A 2X2MA 2ZV9A 1OBDA 4PWNA 4AGCA 3C5UA 4WG5A 3A7HA 4B0GA 1MQ4A 5EH0A 5HIDA 4E93A 3ORMA 4FNYA 1PMVA 3P08A 1PXJA 3BZ3A 5DT3A 3BQRA 5EYKA 3ZS5A 2XCHA 3DDQA 2VTNA 4O1PA 4NZWB 5CF5A 3QRTA 5D9HA 4I5CA 4ZIMA 5C9CA 5AA8A 5AP3A 5K0XA 4PDPA 2Q0BA 2X6DA 4JBOA 4IE9A 2IPXA 5JH6A 2BCJA 5HESA 4MYGA 5JKGA 3U55A 3I60A 3EZVA 4LYNA 2PMOX 1WBNA 3CPCA 3QA8A 5BUJA 2DUVA 2YWVA 5CEMA 1U5RA 3K3IA 1BLXA 3RINA 2Y4IB 3KVXA 4PQNA 4IZYA 2XKDA 4BZOA 1OUYA 2R3HA 2YISA 3K5UA 1H27A 1YQJA 5KMOA 2VD5A 3PXFA 4MXCA 3BCEA 3ALNA 4RVLA 4WO5A 4WOVA 5FBNC 5IZFA 3E8DA 4FZAB 4IXPA 4O0VA 2RG5A 2BFXA 4QP2A 4MKCA 2ZB1A 2X81A 2WB8A 3C4CA 3AD5A 1XH6A 2IVSA 4WUAA 5EKNA 3DDPA 2O65A 3FLZA 3GOKA 3ATTA 1UU8A 5CWZA 3LQ3A 1BI8A 4FSNA 5AA9A 1W84A 2VWIA 3QC4A 5I4NA 1UWHA 2OK1A 2PVKA 4IAFA 3PA5A 4D9TA 2PMLX 2BTSA 3WARA 3EYHA 4TKSA 5EHYA 2XF0A 5JT2A 3O71A 3QHWA 3D94A 5M08A 5CQUA 3ZM9A 4EH4A 2FVDA 4IWQA 4QPSA 3VVHA 3ZOSA 2XJ0A 2J50A 4JS8A 4FV2A 5F95A 4RIYB 1Y91A 5E90A 2VX0A 4LRMA 2W5BA 4G1WA 4UWCA 4CFNA 5JMSA 3ORIA 2C3IB 3W2SA 4YUQA 4CVAA 1GJOA 3UP7A 4DGLC 4QYGA 4TWNA 2C0IA 1OITA 4PNIA 4BWXA 4BGGA 4X21A 3FYKX 1K9AA 1YHWA 4IZ7A 5HD4A 3DB8A 2H96A 3KB7A 3P0MA 3R0TA 2CN8A 4O21A 4Y5QA 4R7BA 2WEVA 1GAGA 3NNUA 4AOIA 2PTKA 3I6WA 4BCNA 4BI1A 2YJRA 3DKOA 1MRVA 2X7FA 5M57A 4AU8A 1Q97A 4LGGA 1FINA 5JFWA 5JSMA 1ZY5A 4PNKA 4FT5A 2E9VA 4V04A 5AM6A 5AEPA 5DRDA 1ND4A 3IGGA 3ZDIA 4JR3A 2E9NA 3QTQA 3GU5A 3QU0A 4X2FA 4HW7A 4GT3A 2E9PA 5IQFA 2VTQA 4YZDA 4K6ZA 1YHSA 4BC6A 4F9BA 4EONA 5GZAA 4U97A 3CQEA 4YJQA 3BWJA 5CVFA 4O1OA 2BR1A 2C5OA 5K5NA 5DGZA 3VBVA 1FGKA 4JR7A 5A14A 2YCSA 2F49A 3U87A 3R2YA 4IM2A 4ERWA 3TJCA 2QODA 2B4SB 4C4HA 4ZS4A 3QTRA 4FIHA 4DFXE 4LL0A 4A9UA 2WELA 3V5JA 5IEYA 3EOCA 2OIBA 4RJ5A 2ZM4A 4RGJA 2XH5A 5A4QA 4BB4A 3BI6A 5CU3A 2FSLX 3BYOA 3PXZA 2PHKA 4D1XA 3E88A 2YLEA 2YIYA 3F7ZA 4YHFA 2YACA 2ITYA 1JKKA 3TV4A 3PVUA 3ACKA 3TIYA 3WYXA 5HU3A 4BCPA 2PE1A 3V04A 2OJGA 2PU8A 2YAAA 4AZSA 5HICA 4DC2A 5EK7A 4HCUA 4LV5A 5IUIA 1QPEA 5KHXA 5H8GA 3R73A 3A60A 4JDHA 3F2AA 3G90X 1J1BA 3I0OA 5ANIA 3WZEA 5HIBA 4DG2E 2OF2A 2GNHA 2HK5A 3RK7A 4W4XA 1PKGA 5HG5A 3HV5A 2A2AA 4KBAA 4C02A 1APME 1BMKA 3MPAA 4UXLA 4YJRA 3IKAA 2B9HA 5CLPA 4CKIA 3GCSA 3GNIB 5JQ8A 4AOJA 4MD7E 3A7FA 4FTMA 3GU7A 3NRMA 3FV8A 3OY1A 4LGDA 4CZTA 3N4VA 3QHRA 4FODA 2JBPA 5EYMA 2BALA 3BHYA 3MV5A 2W1FA 3QTXA 1ZMWA 4L7SA 4PP9A 2E2BA 1S9JA 5E8SA 2E9OA 3GEQA 3GFEA 3TM0A 3NPCA 3KRLA 3R71A 1B39A 3FUPA 3HP5A 4JVGA 4BDJA 3VULA 3H4JA 4I23A 4CV8A 2Z7QA 4XX9A 1OGUA 4EOKA 1WVXA 3K5VA 2XZSA 1SZMA 2UVYA 2XNNA 4FKGA 3EL7A 4UB7A 3ULZA 3UPXA 3DNEA 4TYIA 3UNZA 3MFTA 5BYZA 4D4YA 5B2KA 3WILA 2A4LA 3OHTA 1J91A 2LGCA 2RG6A 4PTGA 3JR1A 2QO2A 1RW8A 2Z2WA 3MFSA 3MTFA 3C4WA 4PMTA 3PG1A 5HI2A 4A7CA 1X8BA 5IA3A 5JRQA 1UNHA 2GPHA 3C7QA 5CF6A 5FDXA 1W7HA 4TYHB 3QTIA 4GG7A 3CPBA 5KZ0A 2WTCA 4CQGA 3FQSA 3QQFA 3O50A 4AA5A 1OUKA 4FNZA 3OROA 4YBKA 4TN6A 4I92A 5E9EA 1E1XA 4FYOA 2VO0A 3JYAA 4PMMA 3S4QA 4HZRA 3KXGA 4RFMA 3L9PA 1YVJA 4YC6A 4M12A 2C1BA 3KRXA 1BI7A 5CT0A 3EFJA 2CMWA 2QOOA 3RBWA 4G31A 4QMWA 2BHHA 4ZTMA 1J7LA 4A9RA 4FL3A 4MBIA 3Q5IA 2WU7A 3PLSA 3AXWA 2GQGA 5DWRA 4QMSA 4GUEA 5GJDA 5AAGA 5CF4A 4IBMA 4YTHA 4ZZNA 1L8TA 3R63A 3GU4A 4C62A 4HCVA 4FYNA 4YJVA 4AWIA 4DH3A 3QD3A 4E6CA 5CENA 2XBJA 4RIXB 3GOPA 1WBWA 3ROYA 5HTCA 5CI6A 4FT3A 1Y8YA 4L44A 1RJBA 1Y8GA 2R3QA 3ITZA 4QMZA 2C3KA 3ULIA 4DAWA 2VTIA 4DCAA 3GT8A 3THBA 2QLUA 5FM2A 4QQJA 1ZMUA 4ANSA 2YDKA 3ZO3A 2VGOA 4BYJA 3E3BX 3R01A 4LGHA 3PG3A 5J9ZA 4D2RA 4TWPA 4H3QA 4MTAA 3QLFA 5J5TA 2VTOA 2PVLA 1YHVA 2VWXA 1YWVA 3DK7A 4CFMA 3OWKA 1H07A 2JLDA 3SVVA 4FSQA 3SLSA 3EQFA 4M7IA 5AR5A 4FEXA 1XHAA 3I5ZA 5CS6A 5I3OA 3OY3A 4W4YA 4Y46A 3ZEWA 3MFRA 5FTQA 2YAKA 3Q4UA 1JOWB 3RKBA 2UW8A 4MNEB 1NVQA 1U5QA 1UA2A 4C61A 2OH4A 5KMLA 4TW9A 5EI6A 5HO8A 4YZBA 2AC3A 1WVYA 4X3FC 3AT3A 3FHRA 2XEYA 2OFVA 4OBOA 3LFCA 2HWPA 2F57A 4M13A 5IQIA 3RZBA 3FHIA 1ZXEA 2BAJA 2VO7A 3Q32A 4DTBA 2QO9A 3NVKI 3LOKA 5KHWA 4IAZA 1AQ1A 4KIKA 5FQDC 4TNBA 2GSFA 1XH5A 2ITUA 3VUMA 3UMWA 3NSZA 3FI4A 2PWLA 3P9JA 4IFGA 4JDIA 3POOA 4I3ZA 3KY2A 5M56A 1R0PA 5AUWA 4LOQA 5A6NA 3P78A 2OBJA 4FR4A 2Q0NA 3BGQA 4DEIA 1NY3A 1PXKA 1WCCA 4MBJA 3ERKA 4S34A 4B8MA 2B54A 3GQLA 3PJ8A 5LMKC 2R3NA 4AQCA 4V05A 4ACCA 3JXWA 3MESA 2ZVAA 3V8WA 4DLJA 4YNEA 4DF3A 4QMUA 3C4XA 3R7OA 2W5HA 3IPHA 3DKFA 3DZOA 4UXQA 5AV2A 3TUDA 3FMNA 4IFCA 4I6QA 5DRBA 4ZLZA 3AMBA 4ARKA 4YSJA 4FMQA 2PULA 3AQVA 2C3JA 4MHAA 4D58A 4GK4A 4O7TA 2W1ZA 3GBZA 1VR2A 4IIRA 3BELA 4QPMA 3KRRA 3G9LX 1WBSA 5H2UA 1PXMA 1YI6A 4F6WA 3HV6A 5BVKA 4F9YA 5A54A 2V7AA 4HJOA 3LXKA 3C1XA 3W2CA 3Q53A 4FV6A 2EXEA 4F64A 3ZRLA 1JKTA 2QOKA 4GU6A 3WZKA 4LG4A 2W4JA 3DK6A 3HZTA 3L1SA 5IUGA 4U40A 4JXFA 2XP2A 2ZB0A 3CBLA 3NAXA 4KSQA 4OLIA 4RLKA 4YJNA 4AZTA 3MVHA 4J98A 4QTEA 2C0TA 5D1JA 4B9DA 5C4KA 4R78A 3S1HA 1OKWA 4EK8A 5I9VA 5IU2A 4CGAA 4P7EA 2HZIA 2BVAA 3KCKA 2JKOA 3DNDA 4FGBA 4XLVA 3DAJA 4O0WA 4FTCA 3UVRA 4H36A 3TDWA 3LXLA 5FLFA 3OW4A 3VWAA 2C1AA 5BPYA 4XHKB 1OIRA 1P4OA 4BR3A 2XIZA 2QOFA 1IA8A 3D2IA 5CXHA 3R9OA 4FKQA 3D4QA 5JFSA 4O7ZA 2IVUA 4X2KA 4TT7A 5ANDA 5AFVA 1M7NA 3PY3A 3EQPA 5GZ8A 3P7BA 2CKEA 4PP7A 3MIAA 5M06A 3WF5A 4JAIA 4M69B 4OW8A 4V0GB 4BGHA 4LMUA 3QQGA 3F88A 1PY5A 4XV2A 1PXLA 3PPKA 3O51A 4QP1A 5FEQA 4FG9A 4DA5A 4KS7A 3UGCA 4MXXA 3I6UA 3Q96A 4NW6A 5L3AA 3VNTA 3WE4A 4BDBA 4IACA 5CXZA 2XNPA 3PYYA 3UOKA 5CAPA 3QQJA 4ORKA 5GINE 4C2WA 1KE5A 2R3MA 3MW1A 4ENXA 3OZ6A 3BX5A 3TUBA 5TE0A 2GMXA 1MRUA 2YM3A 3MVMA 4EH6A 5HVKA 3IG7A 3LIJA 2V5QA 3A61A 4PTEA 5IDPA 3VBYA 3C4ZA 1G8SA 2J90A 2R3OA 3W1FA 4EKLA 2XBAA 4MXAA 4FZ7A 2JDVA 3HGKA 3JVRA 4IH8A 5FEDA 3ANRA 2W4KA 3LMGA 3DBEA 3NDMA 3KFAA 4IVAA 3C0GA 3R8MA 4DBNA 4UMUA 3MH1A 3BGPA 2UW0A 5B2LA 2NNWB 3DFAA 3A4OX 4NM7A 2OZAA 3OWJA 2BFYA 1BYGA 4XP3A 2QLQA 3O8TA 3PA3A 5IF1A 4H3BA 5KE0A 2OJFE 3D14A 4LUEA 1SNXA 2F9GA 2YM4A 3GP0A 4BHNA 3VJOA 1GZOA 2R3RA 3CQWA 4OR5A 2X9FA 3RNYA 3VC4A 4O82A 1M52A 3JVSA 3OS3A 2BIKB 4XMOA 2OO8X 4QD6A 4RZWA 1FVRA 4M3QA 2CN5A 4BCJA 2E9UA 3OXTA 4BCKA 4C57A 5FG8A 5HU9A 2ETKA 3BU5A 4E4XA 4K18A 5LOHA 4BCHA 4E4NA 2Z7SA 2V62A 4NYEA 4J95A 3IDBA 5DNRA 3IW8A 3HRBA 3D15A 4AA0A 1KV2A 3EFWA 2YM5A 2A19B 1P2AA 3CR0A 4LQMA 4CV9A 2C6OA 2VWWA 3ACJA 3IQ7A 3VBTA 4FSRA 4YLJA 1TKIA 4C38A 4RVKA 3KVWA 1XH8A 2HELA 3EH9A 3P79A 3V8TA 4ZLYA 4EJ7A 5HE0A 2RGPA 3BHTA 1SM2A 2PMNX 4M14A 5HHWA 3H10A 2XYNA 5FWKK 4C3FA 3UIMA 4TL0A 5FDPA 5EG3A 1XBAA 2EXMA 3LE6A 1IAHA 4FVPA 3QTSA 4IB1A 2PZYA 2WPAA 4PY1A 4D1ZA 5KBQA 2I6LA 3KF7A 3TNPC 4Z16A 2WTIA 5D7VA 5K0KA 1LUFA 3NW7A 4NKSA 4MX9A 2GTMA 3Q4TA 2XNBA 2XM9A 2OSCA 4A4OA 2OIQA 4FIJA 3Q60A 3V5QA 2VTTA 2W17A 3ZLXA 5HORA 2HIWA 5A4EA 1NA7A 2FB8A 4IX5A 2W1DA 3HV3A 4L53A 4FZFB 4Y72A 4RIWA 3QCQA 1Z57A 4GG5A 3NIZA 5CAVA 5K5XA 2HY81 4JOAA 4DGGA 4M0ZA 5HVJA 4XG6A 3I7BA 4NEUA 3FKNA 5HCYA 1GIIA 1SVEA 2GHGA 4GL9A 3UO6A 3RPYA 5CTPA 3QGYA 3AOXA 2GTNA 2Z60A 2XK3A 4YMJA 3QXOA 4MNFA 4ZTSA 1R3CA 3UOLA 4O7SA 2GNIA 3VBQA 2QKWB 3R7IA 3EJ1A 2GDOA 2ESMA 2VTJA 3F82A 4FKWA 3ELJA 3ZC5A 1NVSA 4M84A 1QPDA 2CNVA 2IVTA 3EKKA 3ODYX 5K4JA 4LRJA 4DEEA 2Z02A 3EFLA 4EK3A 3R8ZA 2QU5A 5JQ5A 2WOUA 3RPSA 3LJ1A 4GIIA 2YZLA 3BRBA 3FMMA 4FK6A 4IX6A 4GMYA 5FD2A 4YO4A 5JK3A 3LCSA 4BDFA 5LVMA 4FTLA 4JIAA 2YITA 2XS0A 2QOCA 2XIXA 4YJPA 3ZZWA 5L2TA 1LPUA 1DI9A 4BDGA 1H4LA 5DH3A 3RI1A 2CGUA 1A9UA 4BIDA 1XWSA 3NVMB 5E8WA 3UJGA 2C4GA 3R1NA 2X8EA 4FIIA 5D7AA 3WZDA 5I5ZA 4FEUA 3PJ2A 3V51A 4WG3A 4E5WA 4MD8E 5HCZA 5HLNA 4BFMA 4M8TA 3FSFA 4KAOA 4ITJA 4BVUA 2J0LA 3DKCA 2HOGA 1OECA 5L6OA 1YXTA 4IJPA 1TQPA 5A3XA 2R64A 4AFJA 4ZSLA 4Z3VA 2B0QA 4IC7A 1PRYA 5L2SA 4GRBA 4TYJA 3F3TA 4GVAA 1F0QA 2EXCX 3TZMA 3OEFX 4FKTA 4AF3A 3TKIA 3W32A 2QOLA 5IG1A 1KWPA 3JY9A 4BCOA 3PJCA 4UN0C 3QKKA 2JDRA 2B52A 1NVRA 3DOGA 4FV9A 4ZJJA 2WO6A 4LFIA 4RRVA 5ETFA 3DT1A 4OT6A 4XOYA 3KU2A 4YLKA 4EH5A 3CSVA 3PTGA 3ORKA 3DTCA 4GK2A 3EKNA 3V5LA 2QU6A 3LM0A 4PPCA 4L00A 4ASEA 5CEKA 1K3AA 4FV8A 3UNKA 2VTSA 2C6KA 3QZIA 5CI7A 5E91A 4BBEA 2UW7A 2BRNA 2VNWA 3L8XA 4MVFA 1SMHA 3PY0A 4XEYA 3ZCLA 4IDTA 4MAOA 3EIDA 5HQ0A 2KULA 2RF9A 4DFNA 4G16A 1WBPA 5E8UA 3RP9A 4EJNA 3HRCA 2FYSA 5KMNA 5C01A 4QMMA 3D7TA 3P5KA 1IAJA 5EW8A 5KMKA 4XG7A 1XBCA 4TNDA 1CTPE 3QWJA 4HVIA 3BU6A 4QP3A 5IQHA 2YA9A 2OICA 4ZP5A 5I3RA 3M2WA 4RPVA 4ALWA 3C0IA 2HZNA 2CLQA 2VZ6A 4IW0A 4YTFA 5IQDA 3HEGA 4LM5A 4G34A 5HZNA 5E8ZA 1XBBA 4X0MA 2BZJA 5EM6A 3IGOA 3Q3BA 5CU6A 2FA2A 2XIRA 5DG5A 3LFAA 1DM2A 2BKZA 5CQWA 5H9BA 1MP8A 3NAYA 4RFZA 3JUHA 4RFYA 5IA5A 4ANNA 5IQBA 2DYLA 3V8SA 2YIXA 1A06A 4G9RA 3R8PA 2BIYA 2C30A 3EMGA 4J71A 4FKJA 5CSWA 5ETIA 1BX6A 5CU2A 1OKYA 2JDTA 2OF4A 4NL0A 5D41A 5B0XA 4RA4A 1A48A 5ANOA 4II5A 2H34A 4GYGA 4JI9A 4MXYA 4OTFA 4YNOA 4AW2A 4BWPA 4F65A 3UVQA 5ANJA 5CEOA 4UMTA 4WBOA 1SYKA 1BL6A 4C37A 2UZOA 1LEZA 3QXPA 2ONLA 3R9DA 3TV6A 2QOIA 1IG1A 5JN2A 3SX9A 3U6IA 5CNOA 1O9UA 3HDNA 4P90A 2C6MA 4JG8A 4D5KA 2WFYA 1T46A 4D9UA 1JSTA 4BICA 3NNWA 3NNVA 3O96A 5CAQA 1PJKA 3VQHA 5LJJA 3LCOA 3MY0A 4E1ZA 2W1GA 3PXKA 1KE8A 4PX6A 4XP2A 3U54A 3GGFA 3MPTA 4XRLA 1OL6A 4MXZA 1OPJA 3S95A 4L43A 4CYJA 1H08A 4QMVA 4EUUA 4B4LA 3R8UA 5AX3A 2F4JA 3MY5A 4E6QA 5AAFA 3ANQA 4XUFA 4FK3A 2PVMA 4O91A 4EHZA 3VUIA 4FVQA 3FC1X 3VUDA 3IW6A 3IDPA 4IVDA 4LMNA 3TTJA 4QMXA 2OZOA 4Y83A 1FBNA 3AC4A 2YIRA 5TF9A 3VHEA 2OLCA 3W2PA 2WQOA 3U9NA 3F5XA 3PE1A 4FT9A 3RM7A 3EFKA 5FM3A 4TRLA 1OL1A 5LXMA 1DAYA 2QNJA 3SV0A 4XRJA 1O6KA 3TT0A 4CNHA 4Q2AA 3EQCA 5CU0A 4M67A 1I44A 3TACA 4OBPA 1GOLA 2PZIA 2R0UA 3QUEA 2HCKA 4I6FA 3QYWA 4JDKA 4BDDA 3GCVA 3OXIA 2XJ2A 4BY9E 5IH4A 4BTFA 5EOBA 3D5WA 4WHZA 1URCA 3KGAA 4RLLA 4OTRA 5CZHA 5E8YA 2RSVA 3LJ2A 1RQQA 1XQZA 2B9JA 4FKPA 4IMYA 2WXVA 3A8XA 4PMPA 4C34A 3FYJX 4GJ3A 3OD6X 5AUXA 4HGEA 1ZARA 1AGWA 3FI2A 2LAVA 4QOXA 3F5PA 1ZAOA 3PVBA 2XK7A 4QP9A 3EQBA 2BZHB 4YZMA 2BKKA 2P33A 3NUPA 4NM3A 3VBXA 5J5SA 4O86A 2VV9A 4ACHA 4XG4A 1JKSA 3H3CA 5AV1A 2P55A 2HAKA 3HV7A 3QZGA 4W4WA 5D12A 2GCDA 5C03A 3VW8A 4DGNA 2XA4A 4YZNA 4ANLA 5ACBC 3EN6A 5F20A 3RAWA 4EEVA 2QOHA 4ZY4A 2IZSA 5CNNA 3SW4A 3DFCB 3BE9A 4HOKA 4GV1A 1VZOA 2R7IA 4P4CA 1PF8A 3UZPA 5FGKA 2ETMA 3NX8A 4EUTA 1OL7A 5E8XA 4GK3A 4F9AA 3A8WA 2J7TA 1M17A 4DEAA 2PMIA 4JQ7A 2V55A 3FI8A 3CY2A 3F3UA 4JX7A 4N6ZA 4R8QA 3FAAA 1GZ8A 4BIBA 4F7NA 1KE6A 3KULB 4M15A 3C51A 2C68A 4FBXA 2Y9QA 4USEA 4FSUA 5AR4A 3CGOA 4O27B 1O6YA 2ZAZA 4FKUA 1H26A 4JAJA 4Z9LA 5H8EA 1YXSA 4UEUA 3R7UA 3VS1A 5HNIX 5M4FA 5DLSA 2VNYA 3VJNA 2WIPA 5J79A 5AP2A 3NYVA 4QNAA 2JBOA 4KIKB 2EWAA 2P0CA 2J0MB 2QD9A 2X39A 3SXSA 4ZTRA 2ITPA 4OTGA 4GEOA 2YIQA 1E1VA 3QCXA 4JX3A 4C59A 1OKZA 4EOJA 4IM0A 3MH0A 4CZUA 2A0CX 3UVPA 2I0YA 4BZNA 4HGSA 4WNKA 2ITVA 3S0OA 4IHPA 1T45A 4PPBA 2ITOA 3FKLA 3OCGA 4EL9A 4L6QA 4A06A 4DCEA 2PUNA 1YI4A 3ORNA 2AC5A 2FGIA 4L52A 3TNIA 2UZEA 3K2LA 1UNGA 4O6LA 4AXAA 2ITTA 4YU2A 2AYPA 4C58A 4RBLA 4F0GA 5EM7A 1WBTA 3P7AA 3BPRA 4RZVA 1Q5KA 4WIHA 2ZM1A 3NWWA 4AZWA 3QQLA 4RWIA 3W2OA 1Q8UA 3F3VA 1IA9A 4MQ1A 3LM5A 5K9IA 2QONA 5AIRA 3RZFA 3ZC6A 2PVHA 4QP4A 1GIJA 2JEDA 3B8RA 2WOTA 2VO6A 5IA4A 3FLNC 2VUWA 5JZJA 3RMFA 5IA2A 1BL7A 3F69A 2VWYA 2YJSA 1XJDA 3NEWA 3NR9A 3ZH8A 3TEIA 4R6VA 4ZAUA 2QURA 4EH7A 4O7NA 4NJDA 2R3JA 1JVPP 4N0SA 3ZM4A 3COHA 3GCPA 3M11A 3QYZA 1Q24A 3CCNA 5HGIA 3DBCA 3MB7A 2OH0E 3SAYA 4XNEA 2Y4PA 3H0YA 3QUPA 1DAWA 3OEZA 3COMA 4L46A 3RCJA 2C6LA 3QD2B 1OL5A 4FSTA 4HNFA 3ZXTA 4C7TA 4A9TA 3QALE 1WZYA 3FXXA 1AD5A 4C35A 4ZTLA 4CLJA 4DT8A 4XOZA 3G2FA 4YHJA 2YERA 1JPAA 2WMSA 4WNMA 4B8LA 5BX0A 2C3LA 2EVAA 2V22A 5HX6A 4AN9A 5HE3A 4NIFB 3NUXA 4DFYA 1JSUA 1JBPE 1W83A 5EOLA 1JQHA 1FMKA 2WIHA 3PVWA 4CFXA 1H25A 1VYZA 3CEKA 1F3MC 1FOTA 5AIKA 2XMYA 3F2NA 4U45A 1U46A 5C26A 3LHJA 4IAKA 4LI5A 2BILB 3U9CA 3SG9A 2X4FA 3ZDUA 2BAKA 3HVCA 2YDIA 4JIKA 3SXRA 3FPMA 4O7RA 4IX3A 3V5TA 3FSKA 4WA9A 4FV1A 5LVPA 3ZFMA 5AUZA 5AP4A 4EKKA 3FZTA 5C8MA 2QKRA 5L2IA 3E62A 4NWMA 4ONAA 3FY0A 2VTPA 4EOPA 3PSBA 5IQAA 2XKEA 2UZNA 4C4GA 3E92A 4ASZA 3G0FA 3PLAE 4USDA 4RVMA 3HNGA 3U6JA 3R21A 3DA6A 3LXNA 4PUZA 2GFSA 3G9NA 4D55A 1H00A 3HRFA 2BRHA 3CLYA 2WQEA 4EK5A 4F6UA 4BN1A 2ONLC 4D2SA 2RIOA 1ZY4A 4O22A 4TYGA 3H9FA 4WD5A 1TQIA 3FEGA 5A4TA 2WAJA 3NLBA 4MH7A 3SRVA 2HXLA 3JPVA 3OG7A 4O0XA 5LVNA 4U41A 5BMMA 2CKPA 4FICA 3EN9A 4L01A 4OTHA 1H28A 2NRUA 4CT2A 4JRNA 2RFNA 4NCTA 3LFSA 3LPBA 1U54B 3I81A 4BZDA 1H1SA 2P2HA 3RAHA 2OZAB 3KXZA 4YGAA 4ID7A 4H05A 3PPZA 3NW5A 3KXXA 4LOOA 3KXNA 1SNUA 4R3CA 4C4EA 5TR6A 4RIYA 1KOBA 2PVFA 4QQ5A 3FXWA 4K11A 2R3FA 2JFMA 4XG3A 4YO6A 5LQFA 3H9RA 5LWMA 3RM6A 4OTQA 4APCA 1G8AA 4IVBA 4J53A 5KBRA 3KEXA 1I09A 3FQHA 3I0QA 3K54A 1OPLA 3IDCA 1RE8A 2XEZA 3OBJA 4QMYA 4BKJA 2J6MA 4DBXA 2WMVA 3OOGA 3POZA 3ZTXA 3HMIA 4RIOA 5ACKA 3HECA 1V0OA 3TTIA 4YJOA 3MFUA 3RCDA 3FY2A 3U51A 3W2QA 1QCFA 4R5SA 4UBAA 3VUKA 1WFCA 1YRPA 4XYFA 1WAKA 3O23A 4K33A 3N9XA 3G0EA 3LLTA 4CMTA 5M51A 4EH9A 4XP0A 5LARA 1H0VA 3EQGA 5ICPA 4EZ3A 3VF9A 1MUOA 3QRKA 4CTBA 3UOJA 4FV3A 2XK8A 3OCSA 4RX9A 5FP6A 2HZ4A 3CXWA 2FH9A 3CIKA 3NUUA 5DE2A 2ZV7A 3EN7A 1Y6AA 4RJ6A 2WMAA 3NUNA 4IB0A 5EDPA 4YURA 5IQGA 3NUYA 4CG8A 3UIBA 3TZ7A 2WKMA 4JDJA 4BCQA 3VW6A 2XKCA 3ALOA 3MDYA 3Q52A 3HP2A 4FI1A 2VGPA 3SQQA 4AZVA 5KCVA 1DS5A 3IW7A 5DBXA 2ITQA 2VWVA 2WEIA 2VWBA 3Q6UA 2IZTA 3BV2A 4HCTA 3II5A 3PWYA 4USFA 5M44A 4K0YA 2PVJA 2XNGA 4JG7A 4X2GA 5AX9A 1ZMVA 2JGZA 3HMMA 2H9VA 4H39A 4RIWB 5KZIA 2J51A 4ASDA 4C3PA 5L6PA 5IQCA 3T3VA 3PZHA 4WSYA 3BYMA 5E8VA 2R3LA 4K77A 4GUBA 5HTBA 1K2PA 3GC7A 5C8KA 3VS2A 5IA1A 3ORZA 5AR2A 4YJSA 3P1AA 5HEZA 3F3WA 4XG9A 4AZEA 3OBGA 3QWKA 4L9IA 3G5DA 4JT3A 2H6DA 5FTOA 2EU9A 3HYHA 3V6SA 4DEBA 2J0KA 2R4BA 4FKIA 5BVEA 4E26A 1H1PA 3U6HA 5M55A 1VEBA 1OB3A 1JNKA 1Q41A 3BYVA 1PYXA 3DQXA 3GC8A 3L8PA 3QD4A 3FMLA 2VX3A 4W4VA 3P23A 3ZU7A 3NYNA 2ACXA 2CCIA 2B7AA 4HGTA 2XNOA 5CEQA 4UMRA 5CSHA 4U0IA 5J87A 3P4KA 1YXXA 2WTWA 5GIOE 3UODA 4F63A 4RJ3A 4E3CA 4PL4A 3ZFXA 3ORLA 5FXSA 3QX4A 3IS5A 1XH9A 5CSVA 5T68A 1CKJA 2C6TA 2YDJA 4WG4A 4PTCA 3R6XA 4XCUA 4EHGA 5CAUA 1ZYCA 2F7ZE 5HD7A 4ACDA 4FTAA 5F9EA 4I22A 4YR8A 3RPRA 4GKIA 5G1XA 3UNJA 2W06A 1V0PA 3LQ5A 1P4FA 4F7SA 5KO1A 4QTCA 1J3HA 2PZRA 3KKVA 3RPOA 4I5MA 4N70A 4F7JA 2VTRA 3BYUA 4U5JA 3SHEA 4C4JA 4L3PA 1EH4A 4C2VA 5I9ZA 4S33A 4TYHA 4YP8A 5J1WA 4JNWA 3UQGA 4ACGA 4CCUA 4GFGA 5DT0A 2W99B 4IWDA 3WIGA 3ZBFA 3GFWA 3QFVA 3LFFA 1IR3A 2OI4X 2WMRA 4I6HA 3DBQA 2QI8A 4EYJA 2IZRA 5CVHA 3MH2A 1OKVA 4F7LA 2JFLA 3FZPA 3QTZA 4R7HA 4OBQA 1YDSE 3KK8A 3PJ1A 3DCVA 4ZSAA 4F9WA 5BVFA 2O2UA 3I1AA 3TI1A 4I4FA 3UMXA 3W2RA 3HL7A 1UNLA 5BVWA 3DLZA 5E1EA 4CRSA 3BE2A 1W98A 4IAAA 4ZEGA 4EK4A 4EQCA 4MK0A 2QG7A 5FBOA 4KINA 5ANEA 5FXRA 4KRDA 2GHLA 2X7OA 2EB2A 3MH3A 5CU4A 3A2CA 3L9NA 4IVCA 5GJGA 2YIWA 3ATSA 5HVYA 4O0RA 3FLQA 1TVOA 2O5KA 3RK5A 3R28A 5HOAA 5HO6A 4XBRA 4TWOA 2R7BA 3D5UA 4DEHA 3NIEA 4OGRA 2G01A 3LXPA 4QMTA 2RKUA 3B2TA 2UW4A 3ZEPA 1JKLA 4A07A 2DWBA 1REJA 3EN5A 2PL0A 3ZRMA 4L3LA 2XJ1A 3TDVA 3DGKA 2XIYA 4YLLA 4C0TA 4D2TA 1ZYLA 3NW6A 3KF4A 3KRWA 5JZNA 3DBDA 4FG8A 3HUCA 4PRJA 5AMNA 4UZDA 4O2ZA 3R8LA 4BKYA 4F70A 5AADA 2YN8A 3DAEA 1OVEA 3LFQA 4G3GA 3GCQA 5EHOA 2XRWA 5M4UA 3BHVA 1OIQA 3QC9A 3QF9A 4OAVB 4CKJA 3AD6A 4GH2A 2Z7LA 1VJYA 5EKOA 2BZKB 3O0GA 4C36A 2UZTA 3LFNA 3ZRKA 4I93A 1UV5A 3FMKA 1GZKA 4QYFA 1O6LA 3T9IA 3QD0A 4UV0A 2OXDA 3I4BA 4R77A 1Y57A 5EYCA 5EFQA 2H8HA 3MIYA 2FSOX 4O0SA 4G6LA 4NU1A 3ZZEA 3ZONA 3E93A 4IQ6A 3OC1A 4EH3A 4DFLA 4OTIA 5AUVA 4IAIA 2GS7A 5HLWA 4O38A 2ZOQA 3NZ0A 4L8MA 4YTCA 4YPSA 5DFPA 4IC8A 3W16A 2WQBA 4CTCA 4FTOA 4AE9A 5J1VA 2QR7A 2CKQA 1WBOA 4NSTA 4O7YA 3HMOA 4ZZOA 2J9MA 1Q8WA 2VTMA 4BBMA 3CD3A 3Q9YA 4E20A 4QMOA 3FQEA 5HBHA 3W10A 5E4HA 3DKGA 4X6QC 5FEEA 5T3QA 2OXYA 3EN4A 4J8NA 3WOWA 3IECA 3DJ7A 3KQ7A 1FGIA 3D2KA 4O2PA 2GQSA 2J2IB 4DG0E 4NCTC 2WTVA 4W9WA 4UYNA 3AGMA 3TIZA 1MQBA 1OIYA 3PP1A 3TL8A 4RSSA 5B2MA 5JGBA 3UOHA 3Q2JA 4BHZA 4WUNA 5DYJA 4CFUA 3IK3A 3CKXA 2PPQA 3G33A 5J9YA 5CSPA 5CALA 3HKOA 3CTQA 3FL5A 4KBCA 4FSWA 3ZUTA 4S31A 3F5GA 1XH4A 3VO3A 4ZLOA 5I9YA 1KE9A 3PDTA 4O83A 3RWPA 5M07A 4KSPA 3UPZA 4U44A 3O8UA 3AT4A 4RVTA 2OJJA 2XUUA 1CM8A 3Q5ZA 4FEWA 3F7WA 2CJMA 2R3IA 2X1NA 2VN9A 3ORPA 2J0JA 1OBGA 2VU3A 4CFWA 5AR8A 2C5VA 2IJMA 3C0HA 3MN3A 4LUDA 4QMLA 3ZBXA 2VWZA 3FL4A 3ENHA 4FNWA 4DFZE 2XK4A 4CXAA 4I24A 4FV5A 4Z7HA 2BZIB 3ZSIA 3PRIA 4ALVA 3ZYAA 5KX8A 4RMZA 2R5TA 2RL5A 5TO8A 2F2UA 1M2RA 1ZZ2A 1UU9A 3E7OA 1CDKA 3KL8A 4FC0A 4IANA 1M2PA 4L45A 5CX9A 3DV3A 3LVPA 4CFFA 2I0HA 3Q9XA 4IEBA 4ZK5A 1PMEA 2GNJA 4RT7A 2G1TA 4BDEA 5J8IA 1Q61A 3QA0A 4MWHA 1JLUE 1QL6A 4CRLA 4Y73A 4F09A 2X9EA 1PKDA 3GI3A 4FL1A 4HZSA 4J8MA 4CQEA 3FLWA 1HCLA 4ZY5A 4FL2A 2YM6A 5AAEA 3C50A 2G2HA 3Q9ZA 3WF6A 1H1WA 2OJ9A 3MS9A 3CTHA 3JS2A 1IRKA 4JBPA 3R9HA 3ROCA 4F0IA 3RNIA 2JIUA 3COKA 5BUIA 3LFBA 1GY3A 3BBTB 3I5NA 4DN5A 1ZYDA 3QRUA 3FZSA 4LL5A 2ITZA 4AACA 3MB6A 3R22A 5HIEA 1FVVA 3E3PA 5TKDA 2YM7A 4JQEA 3ETAA 1R39A 3OFMA 3QGWA 4K8AA 4B99A 3C5IA 3KREA 5IKWA 4BDCA 3ZMMA 4J96A 2W1CA 2GNLA 2QOBA 2B1PA 4MBLA 2BUJA 4FEQA 1JSVA 4F0FA 3U4WA 3VUGA 3QQHA 4V01A 4FIEA 4G3CA 3LCDA 4ANMA 2WGJA 5HG8A 3D5VA 1U59A 2EUFB 2WTKC 5DN3A 3M1SA 2Y8OA 3PSCA 3T8OA 3VUTA 5LMBA 4X2NA 3FMDA 4CZYB 3BYSA 3LMIA 4Q9ZA 1XO2B 2OJIA 4L42A 2JIIA 1W0XC 2R9SA 1Q8TA 1R1WA 3HMNA 3R00A 4DEDA 5TT7A 5DA3A 3E64A 3OUNB 2QO7A 3V3VA 5F1ZA 1Q8YA 3VAPA 5CASA 1REKA 4H58A 3UDBA 4BKZA 3D7ZA 3FDNA 5GZ9A 3CC6A 3G15A 1BUHA 3CS9A 4O84A 2ITWA 3FPQA 3E87A 3ENMA 2IW9A 3W8LA 4O81A 5CEPA 3PZEA 5HCXA 4YC8A 3DQWA 1RDQE 3MVLA 3LLAA 3ZSHA 3TWJA 4APPA 5BVDA 4FKRA 1XH7A 5L4QA 2C6IA 3CKWA 2GNFA 3FBVA 2QG5A 2YEXA 3DJ6A 2I40A 3QAME 4MCVA 1KV1A 2J0IA 3RWQA 4MWIA 4W8DA 1XKKA 3B8QA 2CCHA 3OTVA 3FZOA 2PK9A 3CGFA 3DY7A 2PUUA 3QKLA 4KIQA 3FMHA 3A7GA 3WBLA 5AP5A 1HOWA 4EBVA 5IEVA 3NUSA 3QKMA 3G51A 4J97A 3F61A 3UE4A 2ERZE 1WVWA 3LCTA 4FOCA 2GU8A 3CTJA 4EI4A 5KKRC 4DITA 2OKRA 1Q99A 4FX3A 4QP6A 2WMBA 1KOAA 4D5HA 5HG7A 2IG7A 5CEIA 3UP2A 4DG3E 3HLLA 4EOIA 4Y5HA 4QYYA 5HNGA 2V0DA 4GFMA 5LCJA 3F5UA 4FKOA 4EQUA 2UZUE 2IW6A 3VHKA 4YC3A 3KXHA 4Y95A 3SW7A 4G3FA 4UY9A 3D9VA 3IO7A 2PVYA 3R1YA 3DU8A 4YBJA 4AZFA 4R3PA 3UBDA 4C4FA 4F6SA 4QMNA 5KUPA 3F2RA 3NGAA 2IZUA 4ZTHA 4J52A 4ZS0A 2W4OA 1ZYSA 3W8QA 1GIHA 4HPUE 1Q3DA 4CCBA 1JAMA 4NFMA 1DI8A 4DEGA 1NW1A 4IADA 2ZM3A 3UC3A 4P5QA 4FIFA 3LZBA 4FNXA 4XJ0A 5IH6A 2A27A 4DE4A 4UYAA 4GIHA 2BAQA 3HV4A 3QLGA 4U79A 4FT7A 5M4IA 4AFEA 3RAKA 3R9RA 2O0UA 1SVHA 3FLSA 2YCRA 2BRGA 4OTDA 1OI9A 3DXNA 4HYUA 4FOBA 3VS6A 4S32A 1P5EA 1G3NA 4W8EA 3ZO1A 5ANKA 3ZO4A 3KCFA 4X3FA 2HXQA 2ERKA 5JFXA 3EQDA 3Q9WA 2NO3A 4KKGA 4AT5A 4BI0A 1PW2A 3JY0A 1IEPA 5HLPA 5J7HA 2VX1A 4EC9A 2UZDA 1OM1A 2BROA 3P86A 3QQUA 4BTMA 5DOSA 4FSMA 5GJFA 5EW3A 4DTKA 4ZMEA 3WZUA 3LW0A 3QX2A 2UW6A 4HYSA 3A7IA 3PIZA 3UZTA 1H01A 1M7QA 3FKOA 4UALA 3AC5A 5CVGA 5EI8A 1SVGA 2OGVA 3SRVB 3TG1A 3VF8A 4BTJA 3N4TA 4AS0A 3F66A 5DVRA 4MF0A 3MA6A 4ZJVA 1Q8ZA 4Z55A 1YI3A 2W1HA 3PXRA 4A4XA 5ETCA 3DPKA 4AAAA 3KA0A 2JIVA 3R2BA 4U81A 5I9UA 3QZHA 4CKRA 4TTHB 2P4IA 1YXUA 2F2CB 1HCKA 5EM8A 4FTIA 5DR6A 4CSVA 5CAOA 4FGRA 3TZ9A 3EQRA 4AX8A 5LMKA 4EWQA 4KNBA 2X4ZA 3UTOA 3CE3A 4X3JA 4Q5HA 4GT4A 4BTKA 3BHHA 4L67A 3K3JA 3TN8A 4BYIA 2Y7JA 3GU6A 2I0EA 3KK9A 3MSSA 4QP7A 4NM5A 3R7EA 4O0UA 3TCPA 3ZHPC 4QPAA 1LP4A 3KMWA 4YZCA 3UYTA 2UW3A 4RX7A 3ORXA 4H3PA 1Q62A 3WF8A 4OTWA 2JKMA 2C5YA 3RK9A 2WD1A 3VRYA 3E8CA 4B7TA 5DR9A 3T9TA 3OT3A 4DLIA 3NUAA 3O7LB 2C6EA 2YFXA 3GU8A 4EQMA 2WNTA 1CKIA 2GS2A 3G6GA 2WZJA 3TNWA 3ZUVA 3DAKA 3N4UA 5HE2A 4C3RA 4IB3A 5BYYA 4HYIA 2GQRA 2BMCA 3BGZA 4OUCA 3SGCA 1PMUA 4Q9SA 3KN6A 2VRXA 3IOKA 4E73A 3PSDA 3E8EA 3AT2A 4W9XA 3NYXA 2QR8A 4QMQA 4ENYA 3KXMA 4KRCA 1YW2A 5GHVA 4U43A 4PDSA 3ZLWA 4I6BA 3V5PA 2CGVA 5FP5A 2JC6A 4FF8A 5DHJA 5AWMA 3PE2A 5FXQA 4EORA 5A4LA 3QQKA 4FIGA 1YDTE 2CGXA 5IPJA 5CZIA 3RVGA 2QVSE 5D11A 5AUYA 1LEWA 1JWHA 2IVVA 5I9XA 1WBVA 5EYDA 5HX8A 3I7CA 3OT8A 3CJFA 4FV0A 3FMJA 3R1QA 4PDOA 5L2WA 2HW6A 5C8NA 4F4PA 3OMVA 4FUXA 3WZJA 1CMKE 2PVNA 4UWBA 4IDVA 4U8ZA 2ZDUA 4DH5A
chains in the Genus database with same CATH superfamily
5LMAA 2UW9A 4YJTA 2WU6A 3VS7A 4I0TA 4A9SA 4AN3A 4YZ9A 4RWLA 2ZMCA 4I41A 5KMJA 4ZTQA 4AT3A 5BYLA 3REPA 4NTSA 3LCKA 4U3YA 2XVDA 1H24A 3VQUA 5IUHA 2P3GX 2WTKB 3ZLYA 4AGUA 3ML1A 4RA5A 2PE0A 5H3QA 2Y0AA 4BBFA 4QQTA 5BUEA 3W33A 5CT7A 4DYMA 4FV7A 4WNOA 3BWFA 5LVOA 4MUQA 1CSNA 3MY1A 4C4IA 5IMXA 1PXPA 2IWIA 5L6WL 5JFVA 2GFCA 1QPJA 3Q2MA 4DH1A 5L8JA 2CGWA 4FKSA 4FA2A 2ITXA 2O63A 3LAUA 2ZMDA 1PXIA 2OG8A 4GT5A 3R7YA 2OFUA 2W9ZB 3M42A 4CMOA 5FUTA 5I0BA 4I21A 1ZOGA 4N57A 4U7ZA 2IO6A 1TQMA 2IW8A 4ZTNA 4AUAA 2QC6A 5EW9A 3AG9A 5FTGA 1LR4A 3ZLSA 2WTDA 3PJ3A 5LCKA 4BCIA 3SC1A 3PP0A 3QTWA 4Q5EA 1Q3WA 5HTIA 3UC4A 1Q4LA 3MPMA 2UVXA 4XH6A 2EB3A 4PMSA 3GVUA 4HNIA 4X2JA 5AP6A 1UKHA 3PXYA 5AR3A 4CEGA 5CANA 4QDVA 4ZMFA 2BPMA 2ITNA 1B6CB 4GSBA 5M09A 3A4PA 3PA4A 3EQIA 4JQ8A 4NW5A 4FSZA 4KIPA 2CDZA 3I79A 4GS6A 2PY3A 3RAIA 4G3EA 4IAYA 2BTRA 4IJ9A 4IWOA 5D10A 4ZJIA 5DEWA 4HVHA 3SD0A 4EOQA 5HBJA 5DR2A 5EHLA 1PHKA 5LWNA 4N4SA 2J4ZA 2DS1A 5AV3A 1W82A 4DFBA 5KKRB 3OW3A 5CYIA 1XMMA 3IONA 3VIDA 3D83A 1OMWA 4WRGA 1ZRZA 4G6NA 4BDIA 1YWRA 1R78A 3QCSA 4ZXTA 1W8CA 3A7JA 4CYIA 4OAUC 4EOLA 3RALA 5KMIA 3N51A 4L7FA 2GNGA 3FZRA 2YCFA 4QQCA 4EH8A 1G8JA 4K1BA 4TPTA 2C5NA 3TKUA 4AN2A 3CY3A 3WI6A 4Y8DA 3F9NA 3R7VA 4K9YA 4DGMA 5A46A 2OIDA 2X8IA 3PRFA 4XLIA 5DPVA 3EB0A 5AV4A 4H1MA 5HE1A 3EHAA 4F9CA 5AV0A 3C13A 2CSNA 4JJRA 4FEVA 4GJ2A 1ZYJA 2B9IA 1H0WA 4G17A 4EK6A 5AP1A 4ZSJA 3LMHA 1YOJA 3HAMA 4KS8A 3CD8A 5E8TA 4CLIA 4I0SA 4G2FA 4G5JA 2FSTX 4D0WA 5C27A 3TV7A 3OF0A 3VS0A 3GC0A 4QMPA 3W55A 1NT2A 4ERKA 3PPJA 4BDKA 4AXEA 4EOSA 1ERKA 5C1QB 4HPTE 3QRIA 2HWOA 5AP7A 4MF1A 2XB7A 3R02A 4EBWA 2JAVA 1QMZA 3S00A 5IEXA 1M2QA 3QCYA 4CG9A 2Q83A 2VWUA 3PXQA 3PVGA 4F1OA 3PUPA 2Z7RA 5I9WA 3DXQA 4FT0A 4I5PA 4FVRA 4JG6A 4RQKA 4LDTA 2UUEA 3MI9A 2I0VA 4DT9A 4FTKA 3BKBA 4WSQA 2ZV8A 3VS4A 2CNQA 2C5XA 3TUCA 3SXFA 5AM7A 3KULA 3NYOA 4J99A 3RHKA 3UG1A 4RWKA 3KN5A 4FZDB 4HVSA 4UMPA 2P2IA 2SRCA 2G15A 1NXKA 4GW8A 3DK3A 3V5WA 3GCUA 5EDQA 4RWJA 3MTLA 5A9UA 4IX4A 3Q6WA 2W7XA 4WNPA 4FRFA 3BLQA 4F99A 4BIEA 5DI1A 5CF8A 4BF2A 5JRSA 3ZFYA 4GFOA 1BKXA 4U3ZA 5IDNA 4AW5A 3NNXA 3A62A 4NTTA 4NK9A 2Y6OA 2UZLA 3MBLA 4E4MA 1G5SA 4KD1A 4EOMA 2UVZA 5HKMA 3DTWA 4TXCA 4H1JA 4BDHA 4X6RA 3BLHA 2J5EA 3OOMA 2WMTA 4TYEA 3ID6C 4YPDA 2PZ5A 4B6LA 4ITHA 4O7WA 3NCGA 2R3KA 1H8FA 3RHXA 1P14A 3HA8A 4I1ZA 2XNEA 1L3RE 5HG9A 4UX9A 4AA4A 5JGAA 1FVTA 4FTJA 3R9NA 5ANGA 1J7UA 4S2ZA 2ZYBA 4WT6A 3BV3A 4XV1A 4EOOA 3NS9A 3MYGA 4KWPA 4HVDA 1UU7A 4ANQA 4M68A 1UVRA 4BCGA 2XRUA 3TKHA 4FTRA 4AG8A 4KA3A 4UWYA 3OP5A 5HBEA 1KUTA 3LQ8A 3UIXA 2B9FA 3AC1A 3LFEA 2W1EA 1TFFA 4D2PA 4QYEA 3C4EA 2CHLA 4EHVA 4G5PA 3IW4A 4EHEA 2JKQA 2X7GA 3PY1A 3V6RA 2BHEA 4AGDA 4I94A 1URWA 1ZWSA 2BRMA 1XR1A 2RFDA 1J7IA 2PE2A 4HYHA 4FTQA 2JKKA 1WMKA 3SKCA 3RTPA 3ZO2A 5EQYA 4FE2A 3ZUUA 5TOZA 2C6DA 4M97A 5H8BA 4F08A 4GVJA 1H1RA 4AGWA 2VAGA 2VO3A 2R0IA 2XK9A 3Q4ZA 3UIUA 5AJQA 1OPKA 4ALUA 4EH2A 4RC2A 4BJJB 3F6XA 3FXZA 2PUIA 3QUDA 2X6EA 4O0TA 4KIOA 2W1IA 1R0EA 3HMPA 4LOPA 4L68A 2VTHA 3LKMA 4AT4A 4YJUA 1Z5MA 2HENA 4EC8A 5AR7A 4GCJA 3BHUA 3FE3A 2CPKE 2ZV2A 4NIFA 4G3DA 3R30A 4G9CA 4I0RA 3UDSA 3MWUA 4DH7A 3MGYA 2VTAA 3UYSA 4JBQA 4FKLA 4O96A 4LRKA 4QP8A 4XS2A 5AP0A 3BLRA 3R83A 4GKHA 2A98A 3QZFA 2WMXA 2XIKA 1UWJA 4KABA 1YXVA 4R7IA 5M4CA 1YWNA 4ZOGA 2HY0A 3L8SA 3QRJA 3E7VA 1FQ1B 4PL3A 2PSQA 4O7VA 2G2IA 4XG2A 2B55A 3GUBA 4XV9A 4IM3A 4KKHA 1PXNA 2CKOA 3D7TB 3KMMA 4GU9A 3O7LD 2YHVA 4RJ4A 3L8VA 2W05A 4NM0A 4QNYA 4RJ8A 4QTDA 3SOAA 3TNHA 2X2KA 2BRBA 3GB2A 4X7QA 5AUTA 1ATPE 1IASA 3EQHA 3O8PA 2YZAA 1S9IA 4AW1A 4EYMA 3EYGA 3PWDA 1OZ1A 2VTLA 3PIYA 2WMWA 4RIXA 4ACMA 1OIUA 3OVVA 5L8LA 1YOMA 3OCBA 4CFVA 3VUHA 3DJ5A 4QO9A 5DT4A 2XK6A 2Y6MA 1VYWA 3V01A 2B53A 4C8BA 4XBUA 2QHMA 3NCZA 4BRXA 4J1RA 5T6KA 1FMOE 3HUBA 5BV3A 5GIPE 3R04A 4TY1A 4FZ6A 3BQCA 5DIAA 3PIXA 3U8WA 3L9LA 4CD0A 2OW3A 3DBFA 3E63A 5L2QA 5BVNA 4YSMA 4D1SA 3GXLA 1U54A 2W9FB 3R8VA 5B7VA 2O3PA 4JL9A 3HDMA 2YABA 3ORTA 4FSYA 1PXOA 2JAMA 3UQFA 4R1VA 1YKRA 2YWPA 1V0BA 5JEBA 3BEAA 5A6OA 2UV2A 4U42A 4E4LA 1V1KA 1GZNA 5AUUA 4MNEA 2WQMA 3RPVA 4NJ3A 3TJDA 3C9WA 5EDRA 5IA0A 3MA3A 4EZ5A 2Y4IC 4M0YA 5KNJA 3D0EA 3GENA 4Y85A 4DGOA 4WRSA 2NRYA 4NFNA 3QBNA 1UKIA 2R3GA 1ZOEA 3AC2A 5FRIA 3QTUA 4AP7A 2QHNA 1ZOHA 4QYHA 4DH8A 3F3ZA 4FUYA 4RQVA 3CJGA 3FC2A 2FUMA 4RX8A 4TZRA 2GS6A 4UMQA 5BMSA 3C4FA 1ST4A 4MD9E 2HYYA 4R5YA 3S3IA 3WE8A 4E5AX 3UZRA 5KMMA 4D2WA 1UU3A 2C0OA 3SOCA 2YCQA 4KBKA 4CMUA 4D4VA 1ZZLA 4IWPA 2XKFA 3VS3A 4A4LA 5J9LA 4DHFA 4MXOA 4PF4A 4PL5A 2W5AA 3FMEA 3NMUF 4J7BA 4DFUA 5ITAA 5E7RA 4AW0A 1U4DA 4FJVA 1YOLA 2JITA 2UZVA 4RC4A 4C33A 5DMZA 3PFQA 5HO7A 2XNMA 3VS5A 5IMEA 1Y6BA 3E8NA 4ANBA 3UG2A 5A4CA 3KC3A 2AUHA 2JDOA 4E8AA 3E5AA 4U6RA 2RFSA 4QTBA 4WKQA 4YTIA 3L9MA 1GNGA 4JRVA 5ETAA 5IQEA 1QPCA 3W18A 2DQ7X 2WMUA 2WMQA 2QQ7A 3OXZA 4D28A 5EQEA 2G9XA 3AMYA 4FKVA 3A99A 4LV8A 3SG8A 1FPUA 4X3FB 1KSWA 2UZWE 5EM5A 3Q4CA 2F7XE 4D2VA 4AE6A 2CLXA 2UW5A 3OWPA 1M14A 4Z7GA 2V7OA 2X8DA 3BIZA 3ZXZA 3NFGB 4N6YA 4JBVA 4OT5A 5F4NA 2R3PA 2PVRA 4XV3A 4BDAA 2QCSA 2W0JA 3EL8A 4QT1A 2W96B 3SA0A 2O64A 4DINA 5J7BA 4R1YA 4AXCA 4PPAA 4U80A 3EZRA 4RC3A 5DEYA 2OXXA 3BU3A 4OTPA 3DXPA 3B2WA 1PYEA 2UZBA 4D4RA 2I1MA 3H9OA 2XCKA 2RFEA 2Z8CA 3R7GA 1OL2A 5C4LA 3ET7A 1B38A 2QOQA 3TNQB 5CY3A 4M66A 4BGQA 2A1AB 2C47A 1CKPA 2BDFA 2ZJWA 4U9AA 4O7LA 2HW7A 4PDYA 1Z9XA 3BEGA 4NH1A 4QTAA 4O6EA 4F1TA 3LFDA 3OUKA 2OU7A 3GQIA 3P7CA 4D0XA 5JGDA 5BNJA 4KUJA 2BDWA 4IB5A 1YDRE 4IZAA 4BCFA 4HGLA 4IZ5A 2IN6A 1J1CA 5IISA 2J5FA 3R1SA 3AC8A 1E9HA 3Q04A 4S30A 3DZQA 4M69A 1MRYA 2WHBA 4V0GA 5LVLA 3MVJA 2FO0A 5IH5A 4UZHA 1PMNA 4E6AA 3T3UA 2ETRA 4ITIA 4KB8A 2X0GA 3S2PA 2PYWA 4I5HA 4MQ2A 3D5XA 3H0ZA 5E1SA 2CNUA 4PV0A 4BWKA 3O2MA 4R3RA 2G2FA 2YLFA 4ANOA 1F5QA 5HNBA 4L3JA 4GYIA 2NP8A 4KKEA 5M53A 1H1QA 3SDJA 4P2KA 5L8KA 3OTUA 3KRJA 3IOPA 3WYYA 3DS6A 3IW5A 2F7EE 5EQPA 3UQCA 4DTAA 2I7QA 4NKAA 3P5JC 4YHTA 4FV4A 3VRZA 4RX5A 2JD5A 3MJ1A 4NT4A 2X2LA 3U4UA 3DLSA 4A9YA 4WBBB 4E6DA 3LJ0A 4O4EA 2GHMA 2NPQA 3CQUA 4ZSGA 4BL1A 3HAVA 3CP9A 4NUSA 3RGFA 3UDZA 2OWBA 2WTJA 3HA6A 4FTNA 3EWHA 4FTTA 3ZSGA 3O17A 2PUPA 5CSXA 4AOTA 5K3YA 4F1MA 3MJ2A 3BBWA 3OWLA 4MEDA 4P5ZA 5G6VA 3WF7A 3FI3A 4I20A 4HVGA 5BVOA 3UO5A 4ASXA 4BCMA 3QL8A 4FG7A 5GNKA 3FWQA 4RG0A 4ZSEA 2FSMX 3G6HA 4RJ7A 2PZPA 2YM8A 2ZDTA 3AMAA 4G6OA 3DB6A 4QRCA 2JDSA 2XYUA 4FTUA 2R2PA 4TWCA 1STCE 3FZ1A 3VBWA 3WF9A 3RJCA 3TXOA 3AKJA 3BL9A 4JLCA 3VN9A 5F94A 4BI2A 5K4IA 3FJQE 4I4EA 2HZ0A 5J95A 3OCTA 4ZZMA 2KTYA 3AGLA 2C69A 2BDJA 3GC9A 4ZY6A 5BQ0A 4K2RA 2REIA 3COIA 4XG8A 3AD4A 5EI2A 3FLYA 5E92A 2O8YA 4E5BA 4EWHA 4EZ7A 3H30A 3TZ8A 3HX4A 3KMUA 4O0YA 2XM8A 3AC3A 4CT1A 4D4SA 4E7WA 1KE7A 2WQNA 3WIKA 1ZLTA 3ODZX 3UO4A 2X2MA 2ZV9A 1OBDA 4PWNA 4AGCA 3C5UA 4WG5A 3A7HA 4B0GA 1MQ4A 5EH0A 5HIDA 4E93A 3ORMA 4FNYA 1PMVA 3P08A 1PXJA 3BZ3A 5DT3A 3BQRA 5EYKA 3ZS5A 2XCHA 3DDQA 2VTNA 4O1PA 4NZWB 5CF5A 3QRTA 5D9HA 4I5CA 4ZIMA 5C9CA 5AA8A 5AP3A 5K0XA 4PDPA 2Q0BA 2X6DA 4JBOA 4IE9A 2IPXA 5JH6A 2BCJA 5HESA 4MYGA 5JKGA 3U55A 3I60A 3EZVA 4LYNA 2PMOX 1WBNA 3CPCA 3QA8A 5BUJA 2DUVA 2YWVA 5CEMA 1U5RA 3K3IA 1BLXA 3RINA 2Y4IB 3KVXA 4PQNA 4IZYA 2XKDA 4BZOA 1OUYA 2R3HA 2YISA 3K5UA 1H27A 1YQJA 5KMOA 2VD5A 3PXFA 4MXCA 3BCEA 3ALNA 4RVLA 4WO5A 4WOVA 5FBNC 5IZFA 3E8DA 4FZAB 4IXPA 4O0VA 2RG5A 2BFXA 4QP2A 4MKCA 2ZB1A 3C4CA 2WB8A 2X81A 3AD5A 1XH6A 2IVSA 4WUAA 5EKNA 3DDPA 2O65A 3FLZA 3GOKA 3ATTA 1UU8A 5CWZA 3LQ3A 1BI8A 4FSNA 5AA9A 1W84A 2VWIA 3QC4A 5I4NA 1UWHA 1G8KA 2OK1A 2PVKA 4IAFA 3PA5A 4D9TA 2PMLX 2BTSA 3WARA 3EYHA 4TKSA 5EHYA 2XF0A 5JT2A 3O71A 3QHWA 3D94A 5M08A 5CQUA 3ZM9A 4EH4A 2FVDA 4IWQA 4QPSA 2X0QA 3VVHA 3ZOSA 2XJ0A 2J50A 4JS8A 4FV2A 5F95A 4RIYB 1Y91A 5E90A 2VX0A 4LRMA 2W5BA 4G1WA 4UWCA 4CFNA 5JMSA 3ORIA 2C3IB 3W2SA 4YUQA 4CVAA 1GJOA 3UP7A 4DGLC 4QYGA 4TWNA 2C0IA 1OITA 4PNIA 4BWXA 4BGGA 4X21A 3FYKX 4JMQA 1K9AA 1YHWA 4IZ7A 5HD4A 3DB8A 2H96A 3KB7A 3P0MA 3R0TA 2CN8A 4O21A 4Y5QA 4R7BA 2WEVA 1GAGA 3NNUA 4AOIA 2PTKA 3I6WA 4BCNA 4BI1A 2YJRA 3DKOA 1MRVA 2X7FA 5M57A 4AU8A 1Q97A 4LGGA 1FINA 5JFWA 5JSMA 1ZY5A 4PNKA 4FT5A 2E9VA 4V04A 5AM6A 5AEPA 5DRDA 1ND4A 3IGGA 3ZDIA 4JR3A 2E9NA 3QTQA 3GU5A 3QU0A 4X2FA 4HW7A 4GT3A 2E9PA 5IQFA 2VTQA 4YZDA 4K6ZA 1YHSA 4BC6A 4F9BA 4EONA 5GZAA 4U97A 3CQEA 4YJQA 3BWJA 5CVFA 4O1OA 2BR1A 2C5OA 5K5NA 5DGZA 3VBVA 1FGKA 4JR7A 5A14A 2YCSA 2F49A 3U87A 3R2YA 4IM2A 4ERWA 3TJCA 2QODA 2B4SB 4C4HA 4ZS4A 3QTRA 4FIHA 4DFXE 4LL0A 4A9UA 2WELA 3V5JA 5IEYA 3EOCA 2OIBA 4RJ5A 2ZM4A 4RGJA 2XH5A 5A4QA 4BB4A 3BI6A 5CU3A 2FSLX 3BYOA 3PXZA 2PHKA 4D1XA 3E88A 2YLEA 2YIYA 3F7ZA 4YHFA 2YACA 2ITYA 1JKKA 3TV4A 3PVUA 3ACKA 3TIYA 3WYXA 5HU3A 4BCPA 2PE1A 3V04A 2OJGA 2PU8A 2YAAA 4AZSA 5HICA 4DC2A 5EK7A 4HCUA 4LV5A 5IUIA 1QPEA 5KHXA 5H8GA 3R73A 3A60A 4JDHA 3F2AA 3G90X 1J1BA 3I0OA 5ANIA 3WZEA 5HIBA 4DG2E 2OF2A 2GNHA 2HK5A 3RK7A 4W4XA 1PKGA 5HG5A 3HV5A 2A2AA 4KBAA 4C02A 1APME 1BMKA 3MPAA 4UXLA 4YJRA 3IKAA 2B9HA 5CLPA 4CKIA 3GCSA 3GNIB 5JQ8A 4AOJA 4MD7E 3A7FA 4FTMA 3GU7A 3NRMA 3FV8A 3OY1A 4LGDA 4CZTA 3N4VA 3QHRA 4FODA 2JBPA 5EYMA 2BALA 3BHYA 3MV5A 2W1FA 3QTXA 1ZMWA 4L7SA 4PP9A 2E2BA 1S9JA 4AAYA 5E8SA 2E9OA 3GEQA 3GFEA 3TM0A 3NPCA 3KRLA 3R71A 1B39A 3FUPA 3HP5A 4JVGA 4BDJA 1TZDA 3VULA 3H4JA 4I23A 4CV8A 2Z7QA 4XX9A 1OGUA 4EOKA 1WVXA 3K5VA 2XZSA 1SZMA 2UVYA 2XNNA 4FKGA 3EL7A 4UB7A 3ULZA 3UPXA 3DNEA 4TYIA 3UNZA 3MFTA 5BYZA 4D4YA 5B2KA 3WILA 2A4LA 3OHTA 1J91A 2LGCA 2RG6A 4PTGA 3JR1A 2QO2A 1RW8A 2Z2WA 3MFSA 3MTFA 3C4WA 4PMTA 3PG1A 5HI2A 4A7CA 1X8BA 5IA3A 5JRQA 1UNHA 2GPHA 3C7QA 5CF6A 5FDXA 1W7HA 4TYHB 3QTIA 4GG7A 3CPBA 5KZ0A 2WTCA 4CQGA 3FQSA 3QQFA 3O50A 4AA5A 1OUKA 4FNZA 3OROA 4YBKA 4TN6A 4I92A 5E9EA 1E1XA 4FYOA 2VO0A 3JYAA 4PMMA 3S4QA 4HZRA 3KXGA 4RFMA 3L9PA 1YVJA 4YC6A 4M12A 2C1BA 3KRXA 1BI7A 5CT0A 3EFJA 2CMWA 1XMLA 2QOOA 3RBWA 4G31A 4QMWA 2BHHA 4ZTMA 1J7LA 4A9RA 4FL3A 4QDEA 4MBIA 3Q5IA 2WU7A 3PLSA 3AXWA 2GQGA 5DWRA 4QMSA 4GUEA 5GJDA 5AAGA 5CF4A 4IBMA 4YTHA 4ZZNA 1L8TA 3R63A 3GU4A 4C62A 4HCVA 4FYNA 4YJVA 4AWIA 4DH3A 3QD3A 4E6CA 5CENA 2XBJA 4RIXB 3GOPA 1WBWA 3ROYA 5HTCA 4O4BB 5CI6A 4FT3A 1Y8YA 4L44A 1RJBA 1Y8GA 2R3QA 3ITZA 4QMZA 2C3KA 3ULIA 4DAWA 2VTIA 4DCAA 3GT8A 3THBA 2QLUA 5FM2A 4QQJA 1ZMUA 4ANSA 2YDKA 3ZO3A 2VGOA 4BYJA 3E3BX 3R01A 4LGHA 3PG3A 5J9ZA 4D2RA 4TWPA 4H3QA 4MTAA 3QLFA 5J5TA 2VTOA 2PVLA 1YHVA 2VWXA 1YWVA 3DK7A 4CFMA 3OWKA 1H07A 2JLDA 3SVVA 4FSQA 3SLSA 3EQFA 4M7IA 5AR5A 4FEXA 1XHAA 3I5ZA 5CS6A 5I3OA 3OY3A 4W4YA 4Y46A 3ZEWA 3MFRA 5FTQA 2YAKA 3Q4UA 1JOWB 3RKBA 2UW8A 4MNEB 1NVQA 1U5QA 1UA2A 4C61A 2OH4A 5KMLA 4TW9A 5EI6A 5HO8A 3KIOC 4YZBA 2AC3A 1WVYA 4X3FC 3AT3A 3FHRA 2XEYA 2OFVA 4OBOA 3LFCA 2HWPA 2F57A 4M13A 5IQIA 3RZBA 3FHIA 1ZXEA 2BAJA 2VO7A 3Q32A 4DTBA 2QO9A 3NVKI 3LOKA 5KHWA 4IAZA 1AQ1A 4KIKA 5FQDC 4TNBA 2GSFA 1XH5A 2ITUA 3VUMA 3UMWA 3NSZA 3FI4A 2PWLA 3P9JA 4IFGA 4JDIA 3POOA 4I3ZA 3KY2A 5M56A 1R0PA 5AUWA 4LOQA 5A6NA 3P78A 2OBJA 4FR4A 2Q0NA 3BGQA 4DEIA 1NY3A 1PXKA 1WCCA 4MBJA 3ERKA 4S34A 4B8MA 2B54A 3GQLA 3PJ8A 5LMKC 2R3NA 4AQCA 4V05A 4ACCA 3JXWA 3MESA 2ZVAA 3V8WA 4DLJA 4YNEA 4DF3A 4QMUA 3C4XA 3R7OA 2W5HA 3IPHA 3DKFA 3DZOA 4UXQA 5AV2A 3TUDA 3FMNA 4IFCA 4I6QA 5DRBA 4ZLZA 3AMBA 4ARKA 4YSJA 4FMQA 2PULA 3AQVA 2C3JA 4MHAA 4D58A 4GK4A 4O7TA 2W1ZA 3GBZA 1VR2A 4IIRA 3BELA 4QPMA 3KRRA 3G9LX 1WBSA 5H2UA 1PXMA 1YI6A 4F6WA 3HV6A 5BVKA 4F9YA 5A54A 2V7AA 4HJOA 3LXKA 3C1XA 3W2CA 3Q53A 4FV6A 2EXEA 4F64A 3ZRLA 1JKTA 2QOKA 4GU6A 3WZKA 4LG4A 2W4JA 3DK6A 3HZTA 3L1SA 3O5AA 5IUGA 4U40A 4JXFA 2XP2A 2ZB0A 3CBLA 3NAXA 4KSQA 4OLIA 4RLKA 4YJNA 4AZTA 3MVHA 4J98A 4QTEA 2C0TA 5D1JA 4B9DA 5C4KA 4R78A 3S1HA 1OKWA 4EK8A 5I9VA 5IU2A 4CGAA 4P7EA 2HZIA 2BVAA 3KCKA 2JKOA 3DNDA 4FGBA 4XLVA 3DAJA 4O0WA 4FTCA 3UVRA 4H36A 3TDWA 3LXLA 5FLFA 3OW4A 3VWAA 2C1AA 5BPYA 4XHKB 1OIRA 1P4OA 4BR3A 2XIZA 2QOFA 1IA8A 3D2IA 5CXHA 3R9OA 4FKQA 3D4QA 5JFSA 4O7ZA 2IVUA 4X2KA 4TT7A 5ANDA 5AFVA 1M7NA 3PY3A 3EQPA 5GZ8A 3P7BA 2CKEA 4PP7A 3MIAA 5M06A 3WF5A 4JAIA 4M69B 4OW8A 4V0GB 4BGHA 4LMUA 3QQGA 3F88A 1PY5A 4XV2A 1PXLA 3PPKA 3O51A 4QP1A 5FEQA 4FG9A 4DA5A 4KS7A 3UGCA 4MXXA 3I6UA 3Q96A 4NW6A 5L3AA 3VNTA 3WE4A 4BDBA 4IACA 5CXZA 2XNPA 3PYYA 3UOKA 5CAPA 3QQJA 4ORKA 5GINE 4C2WA 1KE5A 2R3MA 3MW1A 4ENXA 3OZ6A 3BX5A 3TUBA 5TE0A 2GMXA 1MRUA 2YM3A 3MVMA 4EH6A 5HVKA 3IG7A 3LIJA 2V5QA 3A61A 4PTEA 5IDPA 3VBYA 3C4ZA 1G8SA 2J90A 2R3OA 3W1FA 4EKLA 2XBAA 4MXAA 4FZ7A 2JDVA 3HGKA 3JVRA 4IH8A 5FEDA 3ANRA 2W4KA 3LMGA 3DBEA 3NDMA 3KFAA 4IVAA 3C0GA 3R8MA 4DBNA 4UMUA 3MH1A 3BGPA 2UW0A 5B2LA 2NNWB 3DFAA 3A4OX 4NM7A 2OZAA 3OWJA 2BFYA 1BYGA 4XP3A 2QLQA 3O8TA 3PA3A 5IF1A 4H3BA 5KE0A 2OJFE 3D14A 4LUEA 2ZFYA 1SNXA 2F9GA 2YM4A 2XAOA 3GP0A 4BHNA 3VJOA 1GZOA 3TYKA 2R3RA 3CQWA 4OR5A 2X9FA 3RNYA 3VC4A 4O82A 1M52A 2AEGA 3JVSA 3OS3A 2BIKB 4XMOA 2OO8X 4QD6A 4RZWA 1FVRA 4M3QA 2CN5A 4BCJA 2E9UA 3OXTA 4BCKA 4C57A 5FG8A 2NYAA 5HU9A 2ETKA 3BU5A 4E4XA 4K18A 5LOHA 4BCHA 4E4NA 2Z7SA 2V62A 4NYEA 4J95A 3IDBA 5DNRA 3IW8A 3HRBA 3D15A 4AA0A 1KV2A 3EFWA 2YM5A 2A19B 1P2AA 3CR0A 4LQMA 4CV9A 2C6OA 2VWWA 3ACJA 3IQ7A 3VBTA 4AXDA 4FSRA 4YLJA 1TKIA 4C38A 4RVKA 3KVWA 1XH8A 2HELA 3EH9A 3P79A 3V8TA 4ZLYA 4EJ7A 5HE0A 2RGPA 3BHTA 1SM2A 2PMNX 4M14A 5HHWA 3H10A 2XYNA 5FWKK 4C3FA 3UIMA 4TL0A 5FDPA 5EG3A 1XBAA 2EXMA 3LE6A 1IAHA 4FVPA 3QTSA 4IB1A 2PZYA 2WPAA 4PY1A 4D1ZA 5KBQA 2I6LA 3KF7A 3TNPC 4Z16A 2WTIA 5D7VA 5K0KA 1LUFA 3NW7A 4NKSA 4MX9A 2GTMA 3Q4TA 2XNBA 2XM9A 2OSCA 4A4OA 2OIQA 4FIJA 3Q60A 3V5QA 2VTTA 2W17A 3ZLXA 5HORA 2HIWA 5A4EA 1NA7A 2FB8A 4IX5A 2W1DA 3HV3A 4L53A 4FZFB 4Y72A 4RIWA 3QCQA 1Z57A 4GG5A 3NIZA 5CAVA 5K5XA 2HY81 4JOAA 4DGGA 4M0ZA 5HVJA 4XG6A 3I7BA 4NEUA 3FKNA 5HCYA 1GIIA 1SVEA 2GHGA 4GL9A 3UO6A 3RPYA 5CTPA 3QGYA 3AOXA 2GTNA 2Z60A 2XK3A 4YMJA 3QXOA