4NFMA

Human tau tubulin kinase 1 (ttbk1)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
293
structure length
293
Chain Sequence
b'DILPANYVVKDRWKVLKKIGGGGFGEIYEAMDLLTRENVALKVESAQQPKQVLKMEVAVLKKLQGKDHVCRFIGCGRNEKFNYVVMQLQGRNLADLRRSQPRGTFTLSTTLRLGKQILESIEAIHSVGFLHRDIKPSNFAMGRLPSTYRKCYMLDFGLARQYTNTTGDVRPPRNVAGFRGTVRYASVNAHKNREMGRHDDLWSLFYMLVEFAVGQLPWRKIKDKEQVGMIKEKYEHRMLLKHMPSEFHLFLDHIASLDYFTKPDYQLIMSVFENSMKERGIAENEAFDWEKAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tau-tubulin kinase 1
publication title The structure of human tau-tubulin kinase 1 both in the apo form and in complex with an inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 293
sequence length 293
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4nfmA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4nfmA01
3EL8A 3HMNA 3L8PA 4JQ7A 2JFLA 5FUTA 3OCTA 3WYYA 1Q24A 3FHIA 4FTOA 2IG7A 3MIAA 4MXCA 5FBOA 3W2QA 2BZJA 3QKMA 4N70A 3DAKA 5HO6A 4EQUA 3OVVA 4F4PA 4KKEA 4FV7A 5BVEA 3ID6C 3FMKA 3PG3A 2QOOA 2G2HA 3O7LB 4UXQA 2UZTA 2HWOA 2GTMA 5IUIA 1CDKA 2EXCX 1JKSA 3OMVA 2WTDA 5DR2A 4FSMA 4FEXA 4FTRA 3R8VA 2B55A 4BHZA 1BMKA 4QMNA 5E8WA 5DVRA 3VW6A 4ACDA 4AGWA 4IH8A 2WTKC 3SAYA 3AGMA 3HECA 1HCKA 3F66A 4JS8A 3BHHA 3NGAA 4QMXA 4E3CA 4PDSA 2XNMA 4DTKA 5EH0A 4PMSA 2HELA 5B2KA 2C5XA 4XCUA 1H28A 4BGHA 5KZ0A 3OT8A 1VEBA 4DEEA 4BN1A 5IF1A 5IZFA 2UZOA 3QQJA 2OLCA 4BGGA 5I5ZA 4JBQA 5D41A 4FIIA 2BDWA 4FSRA 4MBJA 3HAVA 5DFPA 4AGCA 1NA7A 2EXMA 4FTMA 2RKUA 4OTFA 3P4KA 4BICA 1PYEA 5K9IA 5E8XA 4J99A 1FVVA 1UU8A 5AUUA 5ANIA 3THBA 2GQRA 4NFMA 1KSWA 4S31A 4DH5A 3RZBA 1UNGA 4O91A 5AWMA 3DS6A 3DT1A 5C4LA 2WEIA 5CF4A 4MBLA 2XJ0A 5EKOA 5KO1A 3VULA 4DN5A 4UV0A 4RZWA 3FZSA 4PDPA 3R1NA 5IQIA 3QD2B 4WNOA 2DUVA 4IFGA 2YZAA 3A7FA 4EH9A 3VN9A 2IWIA 2RL5A 3LQ3A 4RIWA 3BGQA 2J5EA 2FB8A 3LMHA 5CU3A 5FDXA 4L3LA 3R6XA 1KOAA 4Y46A 4YHTA 2WQMA 5FXQA 2IZRA 4LGDA 4L01A 5H3QA 3R1SA 4NIFA 5EHLA 1B38A 3MI9A 3HKOA 1Q4LA 4GK2A 4O0XA 3ACJA 2EB2A 3ZO1A 4PTEA 1UU7A 3K54A 4BWPA 1ZRZA 1YI4A 2UUEA 3KK8A 3UNJA 2CSNA 5EDQA 4ONAA 5LVLA 5CALA 4FV9A 2HZ0A 4EJ7A 3HMMA 5C8KA 2W5HA 1B39A 3VF9A 3HRFA 1IEPA 1DS5A 1JPAA 1OM1A 1Y91A 2BPMA 3Q96A 3DQXA 3SG9A 3TL8A 5H2UA 5CTPA 2HZNA 3QC9A 1M2QA 2C3IB 4EBWA 2CMWA 5FTQA 5EW8A 4FG9A 3QQLA 3DKCA 4RGJA 3CTHA 4TY1A 2ZDUA 3UO6A 1PXIA 2XNBA 4EUUA 1YKRA 4ZTHA 3NRMA 4FT3A 3NEWA 2C1BA 3P08A 3FC2A 4EL9A 1FVTA 4J8NA 3PRFA 4YJOA 2W1GA 5L8KA 5HLPA 2BZHB 2UVZA 2XYNA 5LWNA 4HCTA 1IAJA 2PVKA 1XBCA 2VWIA 4WKQA 3QRKA 4ALVA 2X6DA 3DDPA 3E93A 3RMFA 4D4RA 4YHFA 2CCHA 4AQCA 4CEGA 5L3AA 4GK4A 3GU8A 4QP6A 4F0IA 2I6LA 3C4CA 5CQWA 3UIXA 4C7TA 3RHKA 4IM2A 4OR5A 4BC6A 1GZ8A 4EOPA 1H1PA 3DV3A 4AGDA 5AM6A 2AC5A 2PVRA 5HG8A 2PUIA 4O7LA 4O38A 4X3FA 1KE5A 3QZHA 2RGPA 5CVFA 3DJ5A 3TNIA 2WQBA 3E88A 5JRQA 5DWRA 5I9YA 2OXYA 2WO6A 2A19B 3CD3A 3EJ1A 3R0TA 4I0TA 2Z02A 5CZIA 4I22A 3QD3A 2B7AA 1O6LA 5CSWA 2OG8A 2BZKB 1OIRA 5KCVA 4C4FA 2ITVA 2O2UA 4DEDA 4G3GA 3BI6A 4ZSLA 5KMLA 4F7JA 4ORKA 2CNQA 3QXOA 4O96A 5M4IA 5EG3A 2W96B 5EYKA 3CEKA 4EC9A 2VGOA 2BZIB 4U79A 4AE9A 4CV8A 2FSOX 1FGKA 1ZYCA 4MXAA 2BILB 3WF8A 1GIHA 3RNYA 2QO2A 4DT8A 3UC3A 4EZ3A 5GJGA 5C8NA 3TIYA 5LVMA 2Q0BA 1PXJA 3E63A 4MH7A 4R5SA 5CEOA 4MX9A 5H8GA 2C6LA 5FEEA 2JIUA 2ZMDA 4QYYA 2E2BA 3R1YA 4FZFB 3CQUA 2GS2A 3R9DA 2QOLA 2UW5A 3NUSA 1YXVA 4IM0A 4F9BA 2PULA 2PVNA 2QOFA 3BWJA 4G3DA 4M97A 4AOIA 3DXPA 4LG4A 4MAOA 3G9NA 4O6EA 3FLYA 4MK0A 2R3HA 4NL0A 2CLQA 3BKBA 3LW0A 2X8DA 4RX5A 5HORA 2X0GA 5IEXA 1HCLA 2W1FA 3Q6UA 3G0FA 4FTCA 3ETAA 4H3QA 3W2OA 5GZAA 1XH8A 1YWRA 3HV3A 1OL6A 3BZ3A 5DRDA 4U7ZA 4IZ7A 1FINA 4I5PA 4IAKA 4NJ3A 3PE2A 3BBTB 4AAAA 3RPYA 5CNNA 3R7YA 1WBOA 2C0IA 4JR7A 4M12A 4RQVA 1H07A 3PIXA 4UMUA 3ATSA 2R7BA 3F5XA 5A46A 3TZ7A 1WBTA 4S30A 5CAQA 5IEVA 3E7OA 4DCAA 2Z7QA 3I4BA 3W2PA 3R01A 3TUDA 3CJGA 3LCTA 3P9JA 2QKRA 3R7OA 3RHXA 3AT2A 2O8YA 3WZEA 1JOWB 2OIQA 5BQ0A 3DK7A 2HYYA 1B6CB 1OECA 2EWAA 3OOGA 4G31A 5CSVA 5F1ZA 4TNBA 4BHNA 3QD0A 4E20A 2QHMA 3HDMA 3WZDA 5HVJA 3SD0A 4BGQA 3VJOA 2JKOA 5TKDA 4C61A 5ACKA 1H1RA 5F20A 5A54A 3R8ZA 3RNIA 4CRSA 4YSJA 3HNGA 5B2MA 3ZXZA 4EOIA 5L8JA 5LMBA 5LMKA 4GYGA 2VTHA 2KULA 4FL1A 2VWVA 4V0GB 5J9ZA 4PF4A 2YM5A 4F64A 4QTBA 3LFAA 1DI9A 2RG6A 2ZB0A 4YJQA 4CVAA 3JS2A 3OOMA 4M69B 4AZSA 3LXKA 1KWPA 1KE6A 2PHKA 3ZUUA 2C5YA 2OJ9A 5FGKA 3U6JA 4C2VA 3L9MA 4EZ5A 3S00A 2JLDA 2PUUA 4KA3A 4QMWA 2NPQA 3O71A 3QTWA 3C13A 5KKRC 2XJ1A 4PNKA 3EIDA 4O0TA 2VNWA 2GFSA 4YC3A 1XH6A 2QVSE 3Q2MA 2XKDA 5CX9A 5FEDA 3UVRA 2CKPA 3PSDA 3G5DA 2Y6OA 4Q5EA 1OKVA 5ANGA 2YA9A 3EQRA 2OWBA 3LCSA 4ASXA 1KE8A 5HD7A 3WOWA 4ZSAA 5HNIX 1QCFA 5EM7A 4X0MA 1IASA 4EWHA 4B8LA 3LJ0A 1F3MC 4XEYA 1GIIA 3PA4A 2UW8A 4U41A 5J8IA 2XBJA 5AAFA 4R77A 3C1XA 3HA6A 3BHUA 4BI0A 4DH3A 4LOPA 4YJRA 3DQWA 3F3WA 2C4GA 3PZHA 4M15A 2XEYA 4FK6A 4AN2A 4KUJA 2P3GX 3QKLA 4X3FC 2FSLX 3W18A 1YHVA 4O7RA 4WNPA 3ZO3A 3GU5A 2XZSA 5AP3A 2YZLA 5J87A 4KABA 4CLJA 2WMVA 4FKPA 5BVWA 3BLHA 4NW5A 4EOMA 4L53A 4QMQA 1ZYJA 4I20A 4JDHA 5F4NA 4ID7A 4JAIA 1TQMA 4YZDA 4FKIA 3KRJA 2Y8OA 2RG5A 5AM7A 5JFWA 1ZOGA 4BDCA 1W7HA 2HZIA 3R8LA 3UIBA 5M07A 2QR7A 2ESMA 3TG1A 2JIVA 2I0YA 3KB7A 5HNBA 1R78A 3OEFX 5LVNA 4QT1A 4QNYA 3PVBA 2OXXA 4BTMA 3GGFA 4O27B 2G01A 2I0HA 4IQ6A 4RC2A 2J5FA 2JDTA 2O65A 3FSKA 4BDHA 4NYEA 4YC6A 2UW6A 3QC4A 4L7SA 1NXKA 1R0PA 4O83A 3UODA 3FC1X 1OB3A 1GIJA 4B99A 3OUNB 5DIAA 3G2FA 3MB6A 3ORKA 4HGEA 4XOYA 2I7QA 1TQIA 1ZARA 3I1AA 3T9TA 3O51A 3SXFA 4FIEA 5IA2A 2W05A 3RALA 2WU6A 4LQMA 4NH1A 3LCKA 1QPEA 4HYIA 1PXKA 4IZ5A 3I5ZA 3Q9XA 2J7TA 2VZ6A 4O0RA 4XLIA 3W10A 3OXIA 1H01A 1MQ4A 2E9NA 2GQGA 3DTWA 3IW4A 2F2CB 4AW2A 4BDFA 4QP1A 5HU9A 3IPHA 4U5JA 3BV3A 1I44A 4G6OA 2XCHA 3BIZA 5AP4A 4FV8A 2YCFA 2XNEA 4AW1A 3B2TA 3H0ZA 4BKJA 3TNPC 5AR2A 3PXYA 1VYWA 1YDRE 2WMRA 2Z7SA 4G9RA 5M51A 3DNEA 2E9UA 4JQEA 5C26A 2ETKA 3FZ1A 5K0XA 3ZZWA 4E8AA 2F9GA 4M0ZA 2ZMCA 3IW8A 3OY3A 4FKVA 4F7LA 2VD5A 2WMSA 4DH1A 4O7ZA 3H3CA 3F3UA 1PYXA 3DK3A 4GUBA 3R7UA 5HO7A 5IEYA 5BUIA 2B9HA 4OBOA 4BBEA 4FTJA 2IVVA 3HX4A 4AE6A 5EM6A 4E5WA 4JAJA 5T3QA 3NNUA 5EW9A 5I9VA 4YJPA 5HD4A 5GZ9A 2XKFA 4NKSA 3TN8A 3FYKX 3UBDA 4LL5A 2PVFA 4ZTSA 2VWBA 3OD6X 3WE8A 4UWBA 4FT5A 2VNYA 4L44A 3VUTA 3DBFA 3EFLA 2WU7A 3NUPA 3QU0A 3FDNA 3R71A 4X6RA 3KN6A 3T9IA 4IAZA 2WPAA 3S95A 4OTPA 3UO5A 3QCXA 3TKUA 4MD8E 4GW8A 3S1HA 2CN5A 3NS9A 4K18A 5ANJA 2QOBA 4EHGA 1XO2B 4WHZA 5A6OA 2C0TA 5DN3A 1OUYA 5AR7A 5CU6A 1Y8GA 4IANA 3QZIA 4OBQA 4R5YA 4ZJJA 1LEZA 4U40A 3BYSA 4D1ZA 3GBZA 5LMAA 5HIEA 5JMSA 4O82A 1YDSE 3OWLA 3QRTA 5C27A 3G0EA 3QLFA 4YLKA 4R7BA 3GB2A 4IBMA 2HAKA 1K2PA 3KQ7A 5AUZA 3ZSIA 2HW6A 5J5SA 3DKOA 3EN5A 3NVMB 1Q8TA 4IB1A 3RGFA 5HX6A 3FLWA 2J2IB 2YCQA 3EN7A 1OPKA 2H8HA 4J95A 2R9SA 1M14A 2CGVA 3KRXA 3GC0A 4FKRA 3O17A 2XUUA 4R3RA 4WUNA 3PLSA 1G8AA 3LXNA 1CMKE 5CSXA 2SRCA 4QPAA 4BTFA 4FSNA 5A4EA 2R3FA 3PG1A 4UWYA 3ZEWA 1DAWA 3V5QA 4YGAA 1APME 5LVPA 2CN8A 4MKCA 4V05A 4ZXTA 3C4XA 3M2WA 1PXPA 4FX3A 5AP1A 3GOKA 2XKEA 4A9YA 5J79A 4YTHA 1RDQE 2VTRA 2JKMA 4RT7A 4AS0A 3QTQA 1Y57A 4HPUE 2CDZA 3R9HA 2EVAA 5CXZA 3CE3A 4AZEA 3VS0A 2C5NA 4WG3A 3D4QA 4NTTA 2BRGA 2F57A 3FMHA 2VN9A 4U80A 4EHZA 1NY3A 1WMKA 5CU2A 3BE2A 5HEZA 3UVQA 3KRLA 4RX8A 5JRSA 4GFMA 3FZRA 2BFYA 5M44A 4RFZA 5A4CA 1OZ1A 5AP0A 4EOKA 4RIWB 3CQWA 3KREA 3GNIB 4KAOA 5TE0A 1T46A 1S9IA 2YN8A 4BI1A 4YZCA 5AR4A 5LVOA 3CKXA 3V5WA 2IN6A 5KMJA 4KKHA 3PRIA 1ZYLA 3DDQA 5AV2A 3G9LX 2BRBA 3P7CA 2P4IA 2WIPA 4EKLA 1YHWA 2KTYA 5TR6A 1VR2A 3O8TA 5E8UA 2YIQA 4BCJA 2H34A 3TWJA 3N4TA 3R8UA 3HYHA 4QQJA 4QTEA 4IX3A 3V8WA 3KMMA 3QZFA 3NAYA 4MF1A 3GC8A 2YM3A 3U51A 4CFUA 5AFVA 4GFGA 3VUIA 3TM0A 4I23A 5T68A 3LFFA 1WBPA 3N4VA 3QRIA 5JEBA 4G34A 3DPKA 2ERZE 2BRNA 3EKKA 4BDGA 4IWDA 5GJDA 3ORNA 4G16A 1XKKA 4YU2A 4FR4A 1ZOHA 3F5GA 3DB8A 4F9WA 3LXPA 3N4UA 3I0QA 4IEBA 5HTIA 4J52A 4FV3A 3QRUA 5HNGA 2IZTA 1LR4A 3QGYA 5AV3A 2R2PA 3RCDA 5KKRB 3V3VA 4RC3A 4BCQA 3OP5A 3A8WA 5E8TA 3UMWA 2QU5A 2WZJA 3UTOA 4ENYA 1REJA 3IW6A 5DBXA 3UQGA 3Q04A 3C0GA 4YJTA 5JQ5A 3G6GA 3D7ZA 4MNEA 3ZLSA 3MH1A 2W1HA 4CYJA 5FXSA 3FXXA 2X8EA 3CGOA 2DS1A 3PPJA 1F0QA 4J96A 2VRXA 4GK3A 5CEMA 4CLIA 3P0MA 4FEVA 5AIKA 3CSVA 1IA8A 2VO6A 3SXSA 2YDJA 3CD8A 4CNHA 2CJMA 3PJ8A 2PZRA 3K3IA 3WARA 4YR8A 4I93A 4GMYA 1Q5KA 3F7ZA 3FUPA 4OTDA 5KNJA 2C6EA 3UG2A 3NAXA 5IU2A 3JY9A 4JL9A 2HK5A 2XK6A 4LV5A 3EFJA 2JD5A 2RIOA 3EH9A 4JDIA 1FBNA 4ZJIA 5HTCA 4F70A 1OITA 1UNHA 3UQFA 3FMLA 3KA0A 3TZ8A 2ZYBA 3PPKA 3F6XA 4J7BA 4M84A 4QOXA 3RI1A 5CAUA 4OAUC 1YOLA 2REIA 3LJ1A 2BR1A 4JG7A 3DCVA 4BDDA 4BDJA 2JITA 4APCA 4D2RA 3LLAA 1JVPP 1YRPA 2GTNA 4RC4A 4ZOGA 3OFMA 1PJKA 4ARKA 2PMOX 3EMGA 2QODA 3MIYA 3R22A 4X2NA 3EZRA 2GCDA 4EH2A 1L8TA 5E8SA 4YPDA 1J1BA 4RQKA 3PXQA 5HBJA 2GHMA 4USFA 4EWQA 4BKZA 1YOJA 3F3VA 4C62A 1S9JA 3ZC6A 4EH3A 4AU8A 3C50A 4B0GA 4F09A 5HIDA 4M3QA 4R8QA 4FKOA 3V8TA 4QTDA 4BVUA 3FQHA 1AGWA 4CCBA 4LGGA 2B52A 5E90A 1OUKA 4FNZA 4RVKA 3L8VA 4WSYA 3H10A 4CZTA 4EH7A 4IVCA 4AF3A 1YI6A 4KNBA 4I6HA 5B2LA 3FMEA 2FSMX 1Y8YA 4FSUA 3DBEA 2VWZA 1PHKA 2QI8A 4AW5A 4MXYA 1WVXA 1W82A 3COHA 3AC5A 1H8FA 1WFCA 2YIRA 3LQ8A 4IVDA 2C5OA 4E4MA 4ERKA 5A6NA 2C68A 3ZO4A 4AT3A 4NT4A 1SVEA 5FLFA 5FP6A 2J6MA 3GCSA 3OS3A 5E8VA 4BZDA 5AA8A 5L2TA 4WNKA 4EK6A 3QX2A 4FTIA 5CI6A 3R8PA 2C6IA 4W8DA 3ZOSA 4PMTA 3FKOA 3BU6A 3PUPA 4PQNA 3BHYA 4KIKB 3MESA 2R4BA 4ZAUA 2BCJA 4LOOA 4PMPA 3ORZA 4P4CA 2UVXA 3EQPA 3OEZA 4XOZA 5TF9A 5CF8A 3HV5A 1IR3A 2J9MA 4RFYA 4ZY6A 3VUKA 2VTJA 3OTUA 4K33A 5EDPA 4JX3A 4KBAA 3UOLA 1SYKA 4FV5A 4E93A 5BUJA 4FG7A 3BBWA 4U43A 3R83A 2CNUA 3WBLA 4TPTA 3ROYA 4EOOA 2WIHA 3EN6A 2X2MA 2JFMA 3LLTA 4GH2A 1R1WA 5CNOA 3KY2A 3PY1A 3SVVA 2VGPA 4FZ7A 3ZLWA 4D0XA 1PXNA 1ZYDA 1V0BA 4RLKA 4BFMA 3FMDA 4XYFA 2J50A 5DE2A 2B9JA 4XBRA 3IKAA 3R21A 1ERKA 5JH6A 3LM0A 2XNPA 2FYSA 3R04A 3U8WA 3L8SA 3W1FA 2NO3A 4YBKA 4YTFA 1URCA 1IRKA 2PSQA 3QA8A 3U4WA 3NYOA 3KL8A 4EHVA 1Y6BA 3PJ2A 3PVWA 4C36A 3QYWA 3AC4A 4K1BA 4ACGA 4KD1A 5IISA 4TYGA 2JAVA 3V5JA 1OPJA 3I81A 3LCDA 1YHSA 3SA0A 5E92A 4CMTA 3ZLYA 3DKGA 5LWMA 2B0QA 4XV9A 4ALWA 4GYIA 4CFNA 1Z9XA 3LAUA 3NPCA 3QTIA 4IW0A 4S34A 4IAFA 5L8LA 2GHGA 2UV2A 4RJ8A 3FPMA 4MQ2A 4FT7A 4EOJA 4PPBA 4RX7A 2ZM1A 3TIZA 1WAKA 2DYLA 3MBLA 1PXMA 3D94A 2HOGA 3AQVA 3VS1A 2IVUA 2P0CA 4IAIA 4CQGA 3OCSA 4PRJA 2O63A 2A1AB 3EQIA 4RX9A 3UPXA 5CF6A 3PVUA 3FLSA 3ODZX 3FMNA 3G6HA 1DM2A 4JG8A 3T8OA 1OL2A 3UE4A 2HCKA 4JRVA 2BTSA 2IZUA 5CAOA 5KHXA 2VV9A 2IW6A 2VWYA 4QP8A 2I0EA 3L9LA 3ORPA 3TCPA 2OIBA 3HRCA 4KRDA 3F5PA 1TQPA 3A4OX 4AWIA 3EWHA 4A9SA 2F4JA 3BV2A 1VJYA 4FKTA 4EK4A 2WMQA 2QHNA 1OMWA 3MGYA 1U54B 5AUYA 2JGZA 3MTFA 4GU9A 3ZFMA 3BYUA 4FT0A 4C34A 3Q3BA 5C01A 3UPZA 4LRJA 5HCXA 3FAAA 4NEUA 3SC1A 5LQFA 1YXXA 2X1NA 3I6UA 3EQBA 3ORXA 4J98A 2RFNA 1LPUA 3D14A 5BPYA 1QPJA 5BYZA 3HLLA 4O2PA 3NLBA 3TI1A 1Q41A 3VF8A 1CSNA 2I1MA 3JVRA 2J0JA 1WBNA 3E7VA 2V5QA 3HDNA 3PY0A 3MN3A 4A9RA 2BHEA 4WSQA 3DOGA 5CWZA 3E92A 3QGWA 5JT2A 3QCYA 3E62A 4FVPA 3KULA 4MXXA 4X2KA 4Y72A 3QHRA 5H8EA 2I40A 2HENA 3LIJA 4E6CA 2XH5A 2CGXA 3OROA 4GVAA 4XLVA 3VUMA 4ZJVA 4C4JA 5J95A 5JQ8A 2IVSA 1M17A 3RINA 4LRKA 1OBGA 3H9OA 3MY5A 5HCYA 2XKCA 1SZMA 4FV6A 3VUHA 3LFDA 3C4EA 2VTLA 4FL2A 4YJVA 3MTLA 4RSSA 2HIWA 2OF2A 4IACA 2XIRA 3VWAA 2B9IA 4CFFA 5K5NA 3F82A 5D7AA 2ITNA 4OTQA 4E5BA 4E6DA 4UEUA 3TUCA 1H1WA 1CKPA 4I6FA 2C3LA 4XG6A 3W55A 4F1OA 3UZTA 2PK9A 2F7XE 4LGHA 3NW6A 4XRJA 3F7WA 3VBVA 5CENA 3VS6A 5M56A 4Z55A 3SRVB 1UKIA 1J7IA 4G5PA 4O2ZA 1AQ1A 3SX9A 2JBPA 1OKYA 1XH4A 3W8QA 5L2WA 3AC8A 2GNFA 5A4TA 3L9PA 3UNZA 3K2LA 4EH8A 1XH9A 3O7LD 3TUBA 3KF7A 2CGUA 3FE3A 5D12A 2YEXA 3BGZA 5G6VA 5K4JA 4XV3A 4CTBA 4DF3A 1BLXA 1YXUA 5J5TA 3B8QA 3M42A 4A4LA 1BX6A 2XMYA 4USEA 1T45A 3Q53A 3QL8A 3VQUA 4EEVA 4IM3A 2PMIA 4GEOA 2PE1A 4LL0A 5FM3A 3O50A 3V04A 2QOHA 4RZVA 1BKXA 5BYLA 1LEWA 4U97A 3BEAA 4I24A 4TXCA 4EJNA 4FSWA 2J90A 3VHEA 5KZIA 3QWKA 3DXQA 3KXZA 3QXPA 4FV2A 4DGOA 2R7IA 2WTCA 1IA9A 3UC4A 4FV1A 1YW2A 1E9HA 4DG0E 4GS6A 4UYNA 4O0UA 3MYGA 4TYHB 2OH4A 3D7TB 4GFOA 2JAMA 2Y4IB 5DH3A 4HVGA 3JR1A 3Q60A 5A14A 5CT7A 3IW5A 3A2CA 2YIYA 4EQCA 3AT3A 3DAJA 4BCPA 3U54A 3C9WA 1JBPE 4LMNA 3RJCA 3U6IA 1KE7A 2QR8A 4XV2A 2OZAA 4HNFA 4HYHA 2Y0AA 3QD4A 4KIQA 4CYIA 5A4QA 5M06A 3Q5ZA 5KMIA 4I5HA 3AG9A 4EK8A 2BKKA 4FKQA 3VS2A 2X2LA 4EBVA 2BFXA 2GNLA 4QMTA 3EN9A 5DT0A 5EW3A 5CVHA 4QYFA 3CXWA 5DT4A 4ZSEA 3IDCA 4EOLA 4L42A 3ZS5A 4ZTNA 5EI8A 4QP7A 5CEQA 2R3PA 5F9EA 5GZ8A 3EL7A 3G51A 3OZ6A 3F9NA 4UB7A 2ZV9A 2GPHA 3DU8A 3NUUA 4CGAA 3RCJA 5AV4A 5KBRA 3FQSA 5IQEA 4TN6A 3FLNC 4M8TA 4PPCA 1JSVA 4IB0A 2WMTA 3TTIA 4M68A 4CG9A 3CTQA 1GZOA 4C37A 4AA4A 3FMJA 3PY3A 4YJSA 4AZWA 4USDA 4C3PA 4DEIA 4TYEA 4AGUA 4BY9E 2PVLA 4I6QA 1JKTA 5FBNC 4E1ZA 2JDVA 4GV1A 3UIMA 4MWIA 4O21A 4U44A 2W17A 4S32A 4HGLA 2LAVA 3HZTA 5D9HA 4AA5A 4RA5A 3C5IA 4FKUA 3QRJA 5JZNA 4F9CA 2A27A 1M2RA 3M11A 3RPVA 2E9OA 3ERKA 2BROA 3DA6A 2AYPA 4RVLA 4BWXA 2XNGA 1OIQA 5B7VA 3LOKA 4ITJA 4TWOA 3SW7A 4UX9A 3PSCA 4H36A 4X21A 4RVMA 2GDOA 2YITA 4AX8A 4C0TA 2W4KA 4ZLZA 4O7SA 4YSMA 3CY2A 3ZRMA 2WAJA 4H1MA 4BDAA 3OWJA 2R3RA 3P7AA 4R3CA 4Z16A 1SMHA 5I0BA 5AP5A 2NP8A 3KXXA 1E1XA 3K3JA 4DEGA 3ITZA 3ODYX 4U0IA 4XH6A 4W4XA 5CSPA 2W9ZB 2XIKA 2C6OA 5AX3A 4P2KA 5IA0A 4M7IA 2BUJA 2BMCA 2OIDA 2UZBA 3LCOA 3QTZA 3B2WA 3D2IA 3DK6A 2XM8A 4D5KA 2VTIA 3BELA 4D58A 3HP5A 4MEDA 3KXNA 3A7JA 3KVXA 1WVYA 3Q6WA 1RW8A 3V01A 4U8ZA 3II5A 3S4QA 3I60A 3NVKI 4BTJA 3GP0A 4NSTA 2W0JA 5KMNA 3VS5A 3DJ6A 5IA4A 3Q4ZA 1YWNA 2CPKE 4MNEB 4IJPA 4QMOA 4ANSA 4BCNA 2ZV8A 4QYGA 5GHVA 4D2VA 4BIEA 3PDTA 5CF5A 3UOJA 2WTKB 1YWVA 1GZNA 3OCBA 3V5TA 4GT4A 4IAYA 4D4VA 5HLWA 4OTRA 4CRLA 4YURA 5K4IA 3E8CA 4YBJA 1KOBA 1AD5A 2X4FA 3A99A 4YPSA 2B4SB 3ZH8A 2X81A 2ZV7A 4LUDA 3RPOA 4AN9A 4CZYB 1YDTE 3AMAA 4L3JA 3NYNA 2YERA 4KIOA 1H1SA 4NM0A 3O8PA 3ZFXA 3NCGA 4MHAA 5JFVA 4GIIA 3VUDA 4BDEA 1JKKA 3I6WA 2UW9A 4UMPA 2PUNA 1KE9A 4BDBA 4IIRA 1SM2A 4YMJA 4K11A 4FZ6A 5HO8A 3M1SA 4R6VA 3VIDA 4F63A 1R3CA 4L45A 4JRNA 3NNWA 4QQ5A 2GNJA 3UVPA 4QQCA 4X6QC 3FKNA 4E4XA 2OSCA 3UOHA 3GU7A 4FICA 4XUFA 1RJBA 4XRLA 3FZOA 4GG5A 2PWLA 2Y9QA 3KEXA 3QCSA 5D11A 4EH5A 4MXOA 3H9RA 4OW8A 1Q61A 1REKA 2JDSA 1OL1A 2YDIA 3MPAA 4XX9A 5DT3A 4D55A 3BRBA 3K5VA 3WF9A 4F6UA 4G9CA 1NW1A 2PVHA 3JY0A 3Q32A 3TACA 4NW6A 4RWKA 2YACA 4D9TA 4FKWA 4NCTA 5HX8A 1QMZA 3BCEA 4YZNA 5GINE 5AUTA 5AP7A 3E87A 4M0YA 4I5CA 2F7ZE 2CCIA 2F7EE 4O0YA 5C8MA 3SW4A 4FE2A 4D5HA 2EU9A 4EYMA 4R7HA 5IA1A 4EH4A 5JGDA 1CTPE 1M2PA 3KU2A 4I0SA 3TTJA 4W4YA 4G3FA 4MWHA 2BIYA 5M55A 5L6OA 3OC1A 2ITTA 2C5VA 2VX1A 4BDIA 4OLIA 4MCVA 4OTHA 4K6ZA 2E9VA 4R7IA 3QUPA 4PTCA 3U9CA 5CSHA 2QG5A 1U59A 4ITHA 3ZO2A 3WYXA 4DFYA 5CU0A 2HY81 3F2RA 3JYAA 5EM8A 3Q4UA 4N57A 1PY5A 3RZFA 2IJMA 2QO7A 4CSVA 4LM5A 4DYMA 1NVQA 2XNNA 4ANOA 4DEHA 1TVOA 5M08A 4RIYB 4PP9A 4F08A 5E91A 4BCGA 4DC2A 4FVQA 3PVGA 3GOPA 4OAVB 5K3YA 2IW8A 2UZEA 3O8UA 5FDPA 3IG7A 4YLJA 4ERWA 2LGCA 2OO8X 4HVHA 3SV0A 4O7NA 4BB4A 3VS3A 4TRLA 3R7EA 4F7SA 5DPVA 3QQGA 4B8MA 3DLZA 5IDPA 4QPMA 1OPLA 2I0VA 5BVKA 4R1YA 4WOVA 2RSVA 4E6AA 2R0IA 4NM7A 5DOSA 2PVYA 4D4SA 4TTHB 3MVLA 3NUYA 4DHFA 3V6SA 4DEBA 2WTIA 4QYEA 5HE1A 3RM7A 3SOCA 1XBAA 2W1EA 4R3PA 4JQ8A 3NUXA 3OBGA 4AW0A 5HE3A 3TZ9A 3LVPA 2YLFA 2WOUA 3ZTXA 4DFZE 1ZOEA 4BZOA 4QMPA 5HGIA 5HBHA 1YXTA 2FH9A 4JVGA 4RWIA 5LMKC 4I92A 4HCUA 4CXAA 4TYJA 3R73A 4B7TA 3OUKA 4IX4A 2XIZA 2ZB1A 4RJ6A 4ALUA 4HVDA 5BYYA 5IQBA 3O0GA 3Q9WA 2W5BA 4U3ZA 4CD0A 2QLQA 4IX5A 4YC8A 3AC3A 2WNTA 4BIBA 1MUOA 1V1KA 2OJJA 4JI9A 4KB8A 5DRBA 3MA6A 4I0RA 2R3QA 3ULZA 3MFTA 5HOAA 2EB3A 4XG7A 5HQ0A 4C35A 1ZMUA 4KRCA 2R3JA 1XHAA 1U4DA 2J51A 4APPA 4BDKA 4BCIA 5BX0A 3DXNA 3HV7A 2YAKA 5DYJA 4FI1A 3LFEA 4MQ1A 5AUXA 3C7QA 3PFQA 2VTNA 5TO8A 3I7CA 4Q5HA 3ZFYA 2PMLX 3A7HA 3Q52A 3MV5A 2WQOA 3HGKA 4KBCA 4JNWA 2W9FB 1F5QA 2XK9A 3CIKA 4V04A 2GSFA 2BAJA 2XP2A 3OWPA 2WMWA 1J3HA 2WB8A 4PWNA 4QP9A 4NM5A 3RTPA 4J53A 3S0OA 2VTAA 4KINA 2OU7A 5CXHA 3DNDA 4GSBA 3HUBA 3FXZA 4IE9A 3QF9A 4QMVA 3MSSA 1WBSA 3KRRA 5DEYA 4O7VA 4MBIA 4RMZA 2ETRA 3KCFA 5J7BA 2NRUA 2Q83A 5EQEA 3S3IA 3SQQA 2C1AA 4F9AA 5HU3A 2PZIA 2W1ZA 4NIFB 2X7OA 2YIWA 4NCTC 3EFKA 3IONA 2PZ5A 1UWJA 1GZKA 3W2CA 2R3LA 2XA4A 5E1SA 2VTQA 1OL5A 4H3PA 4DCEA 5EYDA 4YO4A 2BDFA 4XMOA 2FGIA 4UYAA 5JSMA 5HE0A 1FGIA 1H27A 4JLCA 4FEWA 4ACMA 3QBNA 2YWPA 5E4HA 3OXZA 4U81A 1GAGA 4IB3A 3VC4A 5ANOA 4O22A 4QP2A 5D1JA 5I9XA 3KRWA 4QD6A 3CCNA 4P5QA 4R78A 3KGAA 3LE6A 2XBAA 1K3AA 3QQFA 4LV8A 3OW3A 1GJOA 2YIXA 3GI3A 4PDOA 4CCUA 4FL3A 3KXMA 2FO0A 4L8MA 4WRGA 4XV1A 4FV4A 3RVGA 4UMRA 4BI2A 5HVYA 4AOJA 2C6TA 3ALNA 3E8NA 1UU9A 4YJUA 4FMQA 3B8RA 2HY0A 3G33A 4UMQA 3POOA 3V51A 4DH7A 3L1SA 5AMNA 3IW7A 4N4SA 5KMKA 5CAVA 1JSUA 2XK8A 3LFQA 3LFSA 3HMOA 4EUTA 2RFSA 4W4WA 1BI8A 3TDVA 4IDTA 4FYOA 3AMYA 2VX3A 4IDVA 4PTGA 1MP8A 4UALA 3WILA 3LMGA 3AD4A 2PMNX 4XP2A 3GCQA 4FC0A 1WVWA 3SLSA 3W8LA 4V0GA 2VWWA 3QLGA 4AG8A 4P90A 4J97A 2OKRA 4QTAA 3KXHA 3FXWA 5ETCA 2R3IA 5E8YA 2OFVA 1YVJA 4FA2A 2CKEA 2CNVA 2HXLA 4WIHA 3CGFA 5M53A 2XF0A 2WQNA 2J0IA 4OTGA 3WF6A 5DMZA 3GXLA 2X9EA 4JOAA 1ZY4A 4H05A 5HG7A 3RM6A 2CKQA 1XWSA 4X3FB 4OT5A 4FIFA 2QU6A 4QQTA 2JDRA 2R3NA 4U9AA 4PL4A 5AA9A 4O1PA 3U9NA 4HZSA 4DT9A 4TW9A 2BALA 3TV7A 4AT4A 5IMEA 2H9VA 4E7WA 4WA9A 2W7XA 4W9WA 4ZMFA 4ZTQA 3AMBA 3L8XA 4D2WA 3SG8A 3BPRA 2C47A 4ACCA 3JVSA 3DBQA 1O6KA 1ZAOA 3QAME 4PV0A 3OTVA 3MVJA 2BHHA 1U5QA 3COKA 5BVDA 1P4FA 4RVTA 3ORTA 1ZY5A 3AC2A 3E5AA 3RPRA 2QOKA 1W0XC 3FLQA 5J7HA 5IQFA 3QYZA 1G3NA 2VWUA 4IWOA 4LYNA 4ANQA 5KUPA 4BWKA 5C4KA 3BQCA 4AA0A 4YZBA 4FUXA 1FVRA 4EZ7A 2JKQA 2QLUA 2XK7A 3NX8A 4C3FA 4ZK5A 4L46A 2VTMA 2V7AA 2ZJWA 3QZGA 3FPQA 4BBFA 4O86A 5ETIA 3IS5A 4FK3A 4TKSA 5EOBA 2YM4A 3HP2A 5I4NA 5BNJA 2JC6A 5JFSA 1PMUA 3W32A 2X9FA 4C33A 4IWQA 4OT6A 5ANDA 4CQEA 5BVNA 5DR9A 3WIGA 3ORIA 3RBWA 3AT4A 3CC6A 3QTUA 5JKGA 1FPUA 2ACXA 2OXDA 3QA0A 4ZZOA 5ICPA 1E1VA 2C0OA 4Q9SA 3MS9A 2ITUA 1V0PA 4YP8A 4DGMA 5A9UA 3ZM9A 4K77A 2PZYA 5JGBA 4IC8A 4DE4A 3R2BA 4FVRA 3V6RA 4BTKA 1LUFA 4FEQA 3TJCA 4L43A 5CEPA 4C3RA 5G1XA 3RAIA 3ZC5A 3GUBA 4LFIA 4XG4A 3ZDUA 4DG2E 3DGKA 2B53A 3FLZA 5I3OA 2OJGA 2WEVA 3OWKA 4Q9ZA 2B54A 5EQYA 4D1SA 3F2AA 1UKHA 2GS7A 3T3UA 2ITZA 4O6LA 4ZTLA 1XR1A 5ANEA 1V0OA 2X6EA 3NWWA 3D5VA 4UZDA 3TEIA 3W2SA 4QMSA 4L7FA 4A07A 4E4NA 1G5SA 3COMA 5GIPE 5A3XA 1Q8WA 3PYYA 4GT3A 4IVBA 2B9FA 4IWPA 4S2ZA 5CZHA 3POZA 4PP7A 4C59A 5AUWA 1PKGA 4H39A 4M13A 3CKWA 3G15A 3MVHA 4GUEA 4RIOA 3RK9A 4KKGA 1M7QA 5JZJA 3FY0A 1P5EA 5HCZA 4DFUA 1M7NA 3EQFA 4HZRA 1ZLTA 1ZZ2A 3PXRA 2V62A 4JXFA 4J1RA 4GG7A 2XB7A 1XH5A 1GOLA 2XS0A 3H4JA 3RPSA 5HZNA 2ETMA 3LJ2A 4WBBB 5BMMA 2UW0A 5IH5A 3FJQE 1H26A 4W4VA 4A4OA 2VO3A 3EHAA 2GS6A 4YTIA 3FHRA 4O7YA 1EH4A 4RJ3A 3MFUA 4ZS4A 4TZRA 1CKJA 4TT7A 2ITXA 3IK3A 3U55A 3KF4A 4A4XA 1ZXEA 3CR0A 2J4ZA 2WMUA 4CV9A 1JAMA 2AC3A 1DI8A 3A8XA 4EH6A 3FZPA 3NYVA 5HBEA 5E7RA 5C03A 3SDJA 4BCMA 3FZTA 4CFWA 2Z2WA 1YQJA 2V22A 4MNFA 4IFCA 4X7QA 4YNEA 3ORLA 3REPA 3MFRA 3ORMA 4D9UA 3FEGA 1QPCA 1BYGA 4FNXA 3ELJA 4HJOA 3OCGA 3UDBA 5DR6A 2VO7A 2OK1A 3EKNA 3LQ5A 4YZ9A 2OGVA 4IX6A 3CS9A 3ROCA 2ITWA 4WNMA 3VVHA 1J1CA 4HGTA 3IDPA 2WXVA 2JKKA 2EUFB 3KC3A 2VUWA 4FTAA 1OBDA 3R8MA 4NM3A 4P7EA 2XEZA 2IVTA 4IZYA 4RJ5A 5LXMA 1U46A 4N0SA 4JBOA 4XHKB 3EOCA 4F6WA 3EQCA 3AD5A 5DA3A 1PF8A 3RK7A 1ND4A 2YDKA 3Q4TA 4I94A 4BBMA 5GIOE 4FSQA 4CT2A 3N9XA 1XBBA 3MDYA 3P86A 2W99B 1ATPE 2X7FA 3BHVA 3KK9A 3PP1A 4CKRA 5FWKK 3PTGA 1O9UA 5E8ZA 1MRYA 5CS6A 5AIRA 3F3TA 4KIPA 4IVAA 3DBDA 4RJ4A 3WF7A 4DTAA 2FUMA 4MTAA 1O6YA 4DGGA 3I0OA 2YAAA 3C4ZA 4ANNA 1QPDA 3FI4A 3WI6A 2R64A 3KMUA 3NZ0A 4IMYA 4TNDA 4H58A 4BF2A 4MF0A 3V5PA 2YM6A 5FM2A 4EORA 4BZNA 1UV5A 1UVRA 2VTOA 3DKFA 3CY3A 4ZY5A 4QMZA 1GNGA 3LMIA 3IGOA 3ZRLA 2BDJA 3QTRA 3VW8A 2GNGA 4C58A 2XRUA 3VS4A 5T6KA 2ERKA 2BIKB 4WG4A 1YXSA 5C1QB 2ITOA 4ASZA 3NIEA 2WOTA 4UZHA 4EI4A 3GC9A 1A9UA 3FI2A 2QQ7A 4MVFA 5DHJA 5EM5A 2O64A 3LZBA 4I6BA 4RIXA 4E5AX 5BVOA 4IXPA 3GFEA 4J71A 4L67A 3DZQA 3DY7A 3R2YA 4UMTA 1MRUA 2ITPA 3UG1A 3A7IA 2AUHA 5CT0A 3QQUA 2QG7A 3RAHA 4O7WA 4FIHA 5GJFA 1SVHA 1R0EA 4WUAA 5IA5A 3LPBA 2IZSA 2XK4A 3MVMA 4XG2A 4F0GA 4FGRA 1RE8A 2JDOA 2UZVA 4IZAA 5I9ZA 5E9EA 4QP3A 2RFEA 4ANBA 3DFAA 1H4LA 3R00A 2UVYA 4RPVA 5CAPA 3SGCA 3ZYAA 3UIUA 3WZKA 3UZPA 4KS7A 4ENXA 4C2WA 3D5WA 4NZWB 4Y83A 1H1QA 3FYJX 4NFNA 4ZSJA 3TV6A 3TNWA 5HG9A 3PWDA 3R02A 3ZCLA 2OI4X 4XP0A 4UXLA 3R9NA 4MD7E 3P7BA 4ZZNA 4DA5A 3DAEA 4Y5HA 5IQAA 1U5RA 3MB7A 2WHBA 5IQHA 3EB0A 4ZTRA 1JNKA 3W2RA 5D10A 1RQQA 2GNHA 4F65A 4I41A 1GY3A 4BCFA 4V01A 3TJDA 4EQMA 1H0WA 3ULIA 2Y6MA 2Y4PA 4FSYA 2QOCA 4EONA 3F88A 3IDBA 4RBLA 2WTVA 4K0YA 5KHWA 2BAQA 3FSFA 3FI3A 5EI6A 3OXTA 4Y85A 4C4GA 3SOAA 2J0KA 2Q0NA 2H96A 4WBOA 1ZWSA 2JEDA 3KVWA 3PJ1A 4QNAA 4FKSA 4FNWA 4X2FA 3PJCA 3LXLA 3NW5A 3HRBA 3Q4CA 4QP4A 4ZP5A 5AEPA 1H08A 2QOIA 3MH3A 4EC8A 3NYXA 3EQGA 4HW7A 5A4LA 1VYZA 2C6MA 4HCVA 2IO6A 3QWJA 1W8CA 5IPJA 3UOKA 3BGPA 3QX4A 1BL6A 1J91A 5AADA 3BX5A 4LOQA 4C4IA 3OW4A 4XS2A 2VX0A 1Y6AA 3D2KA 3F61A 3ZSGA 3F3ZA 1Q3WA 2NRYA 4FTTA 4F9YA 3U6HA 3TNHA 2NNWB 4FBXA 3DLSA 2QD9A 3GCPA 3OG7A 4PNIA 2UZWE 4FIGA 4FKGA 5EKNA 3NNXA 5L2QA 4J8MA 5FG8A 3KMWA 4AOTA 1STCE 4EHEA 4ZLOA 3A62A 4F6SA 2XIYA 3MFSA 4QO9A 5I9WA 4R1VA 5F94A 2VO0A 2Y7JA 1BL7A 4GRBA 5EFQA 4Z7HA 3TXOA 5CI7A 5IG1A 2BAKA 1XQZA 2IW9A 2PVJA 2W4JA 5C9CA 3E8EA 1XJDA 3HVCA 5ETAA 2XM9A 2G1TA 3AGLA 3F69A 3FV8A 3IO7A 4GVJA 3ZMMA 2YISA 4FSZA 4P5ZA 1K9AA 3D5UA 3GVUA 3ANRA 5HKMA 3ZUTA 4YO6A 2QC6A 4RA4A 4Q2AA 1PRYA 3W16A 3ZONA 2PUPA 4O84A 2QNJA 4HOKA 4FZDB 4ZTMA 4EK3A 2YCSA 1I09A 1OIYA 4OBPA 4PL3A 3AC1A 5E1EA 3VUGA 2PE0A 2V55A 5ANKA 2OZOA 3R30A 4D4YA 3V5LA 3RKBA 3R7IA 4QMUA 4JG6A 4L68A 3GFWA 3N51A 2C3JA 5HICA 4CT1A 3HUCA 3P79A 4L3PA 4RWJA 4N6ZA 4CFVA 4FT9A 2V0DA 3D15A 4L00A 4PPAA 4U3YA 5FQDC 3QKKA 2O0UA 5CLPA 4KIKA 4RRVA 4D1XA 5ETFA 4CTCA 3VBTA 2C3KA 3K5UA 2CLXA 4JJRA 2FSTX 3DZOA 3R28A 4QMMA 4HVSA 4FTUA 3BYVA 5H9BA 3UO4A 5L2SA 3DTCA 3GENA 2GQSA 3GEQA 3KCKA 4I4FA 4U6RA 4GL9A 4PDYA 2W5AA 4A9UA 4TWPA 4QRCA 4YJNA 1JLUE 4D2SA 4XBUA 3UP2A 4FG8A 2VTPA 5IH6A 5EHOA 1Q8YA 3P1AA 4AN3A 2RF9A 4GU6A 4X2GA 3ZLXA 1BI7A 2HZ4A 5EHYA 5HE2A 4LI5A 4ITIA 2X8IA 4IB5A 3RWPA 3W33A 2G2IA 4Y95A 3CPBA 5DG5A 5FTOA 5DI1A 5IKWA 4BYIA 4DG3E 2Z7RA 2OW3A 5M57A 2PU8A 1UNLA 3U4UA 4NTSA 5AUVA 1G8SA 1Q3DA 2Z7LA 4DFNA 3EQDA 5JFXA 3ENMA 4Y73A 4PL5A 5HLNA 4M67A 2YABA 3NW7A 3VO3A 1OKZA 3BHTA 4G2FA 5JGAA 5IDNA 3ACKA 4Y8DA 2CGWA 3R63A 2C6DA 1JKLA 4Z7GA 3KXGA 1A48A 1WBWA 3LFNA 3BU3A 2BKZA 3EFWA 4BCHA 2X4ZA 3NR9A 3EZVA 2WMBA 3PPZA 3MA3A 3SXRA 5I3RA 4CG8A 2ZOQA 5KMMA 5LARA 2GMXA 4RFMA 5HHWA 4PUZA 4CMUA 5AAGA 3IGGA 3C5UA 3ZUVA 3ALOA 4G17A 3C0IA 3PWYA 2UZDA 4MD9E 3MH0A 3OT3A 2UW3A 4DINA 2OICA 3OHTA 4OTWA 4CFMA 3NUNA 2WKMA 3PSBA 4IHPA 4FTNA 4OTIA 5KE0A 4GIHA 3FI8A 4UN0C 4NWMA 3SHEA 4GKIA 4LUEA 3OF0A 4FEUA 4FTLA 2RFDA 3A4PA 3F2NA 1PMNA 4G3CA 1XH7A 3EN4A 2W1DA 2OF4A 2B1PA 3TV4A 3R9RA 4NK9A 1ZZLA 1Z5MA 4FIJA 5M4FA 2GFCA 2UW7A 2Z60A 4DFBA 2PE2A 4G6LA 5IA3A 2ZV2A 4D28A 5AV0A 2VU3A 3UGCA 4FGBA 3VBXA 4E4LA 3DBCA 3ET7A 2QKWB 3FBVA 4QMYA 5HIBA 3I5NA 3BLRA 4DBXA 1FOTA 3DJ7A 4JBPA 4OGRA 3HEGA 3MWUA 3IQ7A 1KV2A 4HNIA 4FZAB 5EDRA 2JBOA 3P5KA 3T3VA 4WO5A 5D7VA 4XG8A 1U54A 3MPTA 4ASEA 2ZM3A 4X3JA 2VAGA 3HV6A 1TKIA 4I1ZA 2GU8A 1Q8ZA 3UJGA 4TL0A 1WZYA 4XG9A 2ZVAA 3TNQB 4FKLA 1JWHA 3E3PA 4DFXE 1SNXA 3FL5A 2HXQA 3D0EA 3PZEA 2P2IA 4EK5A 4ANMA 5HVKA 4ZIMA 3VBWA 3ZSHA 4IC7A 4JBVA 4QPSA 3VAPA 2PZPA 3QUDA 1NVSA 4JDJA 5J9YA 2PY3A 2X39A 4JDKA 4DAWA 4KSPA 5BVFA 2W1CA 1URWA 2PTKA 5L2IA 2P33A 3BU5A 5J1WA 3PXKA 2OH0E 3A61A 3IECA 4A9TA 2C30A 2ONLA 3NNVA 1FMOE 2PPQA 2XCKA 2HWPA 3E64A 4KSQA 3QTSA 3GU4A 2J0LA 2G2FA 4M14A 2XIXA 2W1IA 1FQ1B 3HA8A 3R7VA 4EYJA 3VS7A 3QQHA 4XG3A 3VHKA 4C57A 5EK7A 3RWQA 3CPCA 3BLQA 4C4EA 4G3EA 3WE4A 4K2RA 4DGNA 2G9XA 2QURA 3D83A 3DB6A 3VQHA 4AP7A 4ZZMA 4NJDA 4DITA 5AAEA 2GHLA 4RWLA 1FMKA 3PA3A 1HOWA 1P4OA 3CJFA 4D0WA 4B9DA 1OVEA 5TOZA 3UQCA 3UMXA 1JQHA 3WZUA 4DLIA 2GNIA 4HVIA 3WF5A 5FTGA 1A06A 3SRVA 3AXWA 3IOPA 4BCKA 3D5XA 2C69A 5B0XA 4BKYA 5IMXA 1OKWA 5TT7A 3UP7A 3ZHPC 3QQKA 3HMPA 3UYTA 3QUEA 2VWXA 4JX7A 4QYHA 4O0SA 3JPVA 5K5XA 3ZRKA 3KN5A 2QOQA 3BYOA 3PA5A 5CYIA 4DGLC 4FYNA 5AP2A 4NKAA 1KV1A 1X8BA 3QFVA 3PIZA 5DEWA 3HV4A 4KBKA 5M4UA 4U42A 1J7UA 4C8BA 3H9FA 5CU4A 3ZU7A 5JN2A 4ZLYA 3BWFA 1H25A 1OIUA 2R3OA 1ZYSA 3GQLA 1OGUA 5M09A 5BUEA 4YUQA 5LCKA 3FY2A 3QHWA 3CBLA 3UZRA 4O0VA 2J0MB 3PXFA 4AUAA 4YNOA 4E73A 2YJSA 3VRZA 4D2TA 2A2AA 4G5JA 1KUTA 4TYHA 3D7TA 5LOHA 4D2PA 3H0YA 3R7GA 2R0UA 4F1MA 2FA2A 3GT8A 4MYGA 2WELA 3BE9A 3NMUF 5AR8A 1MQBA 3UYSA 4BCOA 4PMMA 3NIZA 4FODA 3NSZA 4IJ9A 4ZEGA 1UWHA 4U45A 3V8SA 1IG1A 2EXEA 4L9IA 3L9NA 4GJ2A 4TWCA 4FUYA 3E3BX 1UA2A 4I5MA 4DTBA 5M4CA 4GCJA 1YOMA 3AOXA 2WMAA 4IADA 4CKIA 3DFCB 3U87A 4K8AA 4FV0A 2PVMA 3GCUA 3P23A 2XJ2A 3KULB 1VZOA 4G1WA 4K9YA 1PXLA 2O5KA 3GCVA 3VJNA 5EOLA 4ZMEA 2F2UA 2ITQA 4HYSA 1R39A 3BYMA 5HG5A 3TT0A 5L6PA 1OI9A 3E8DA 4ANLA 4LMUA 4X2JA 2XVDA 4FNYA 2F49A 4PY1A 5IUGA 2UZLA 5KMOA 4RIXB 3O2MA 5HTBA 1WCCA 1ZMWA 4I21A 3LFCA 3PIYA 2R3KA 2OBJA 4JIAA 3I7BA 2ZDTA 4O7TA 1CKIA 3OBJA 4UBAA 4BL1A 1DAYA 2WMXA 3FQEA 4PX6A 5DGZA 5FEQA 2PL0A 5LCJA 4F0FA 4G6NA 3EYGA 1W83A 1W84A 4YZMA 2XYUA 3F5UA 4NU1A 3ZBXA 4I4EA 1H24A 4A7CA 3FMMA 4F99A 4O1OA 2YHVA 3PP0A 4KS8A 2XK3A 4UWCA 4AZFA 2QONA 2WTWA 2ITYA 3KFAA 3P78A 2ONLC 5H8BA 2R3MA 4FSTA 2VTTA 5I9UA 4KWPA 2A0CX 3RK5A 1H0VA 1SVGA 2BVAA 2VTSA 3GU6A 4Y5QA 2FVDA 4ZSGA 4AT5A 4E26A 1IAHA 2X2KA 4EOSA 4L52A 4NUSA 4RLLA 4AZVA 2W06A 2UZUE 2C6KA 1J7LA 3Q9YA 4C38A 4TWNA 1PMVA 3Q2JA 2OFUA 1Q62A 2CHLA 4DBNA 3AD6A 3PXZA 4M69A 2WD1A 2YJRA 3CLYA 2CKOA 2G15A 3D9VA 4WG5A 3R9OA 4ZY4A 4GKHA 4FOCA 5HESA 4TYIA 3LM5A 4II5A 2IPXA 3I79A 5FD2A 2Z8CA 3MPMA 1NVRA 5JK3A 4WRSA 3BQRA 3HAMA 2WFYA 4Z9LA 2YLEA 4ZS0A 4DLJA 4CFXA 2QO9A 3C51A 3G90X 4GJ3A 4JIKA 4O0WA 5IH4A 4YHJA 2R5TA 3ZM4A 4FTQA 5DNRA 4QTCA 2UZNA 2YWVA 2V7OA 4RG0A 3O23A 3UNKA 1PKDA 3COIA 4B6LA 1W98A 5FXRA 3QALE 4F7NA 3ZXTA 3C4WA 5IQDA 1PW2A 2WQEA 4EKKA 5EI2A 2UW4A 3OY1A 4OUCA 1OL7A 2JIIA 1WBVA 1QL6A 5KBQA 4HGSA 3VBYA 3FWQA 2WGJA 4BYJA 3HL7A 2XNOA 2OZAB 3FL4A 3SKCA 3MY0A 1MRVA 5AR5A 5AX9A 4C02A 4ACHA 2BRMA 2H6DA 3MY1A 3C4FA 4B4LA 3PLAE 3MW1A 4DEAA 1Q99A 5AJQA 3NDMA 3RAWA 4XP3A 5ITAA 4AFEA 5CY3A 4BIDA 5CEKA 4YLLA 2R3GA 5AP6A 3LFBA 3QTXA 3CP9A 2BRHA 3CTJA 1Q8UA 2Y4IC 2E9PA 4L6QA 5AR3A 5EYCA 5FRIA 2XRWA 2P2HA 2WTJA 2PYWA 3NCZA 4WD5A 4XNEA 1Z57A 4EOQA 4AFJA 3A60A 3PE1A 3A7GA 4H1JA 1P2AA 4M66A 3JUHA 3H30A 4HYUA 3TZMA 3Q9ZA 4HPTE 3QCQA 4A06A 5DLSA 1BUHA 3EYHA 4N6YA 1PXOA 3LKMA 3EQHA 5CQUA 3Q5IA 3JXWA 2YM8A 3GC7A 2BTRA 4FF8A 5K0KA 1L3RE 1UU3A 2QCSA 3MH2A 5IUHA 3BEGA 2DWBA 2YCRA 5CEIA 3S2PA 4YTCA 1Q97A 3KKVA 4W8EA 3ANQA 4I3ZA 4ASDA 3ZDIA 1YI3A 4LRMA 2OJFE 5F95A 3TDWA 4DFLA 1PMEA 1JSTA 5HI2A 4Z3VA 3ZZEA 5EQPA 5ACBC 3CQEA 3RAKA 4UY9A 5J1VA 3VBQA 1LP4A 4MXZA 4F1TA 3TKIA 5GNKA 5CASA 4CZUA 3ZEPA 5J9LA 4O81A 4FOBA 3WZJA 3C0HA 4AXAA 4GT5A 2W4OA 3ZBFA 1CM8A 3HMIA 3TKHA 4IAAA 2X7GA 2O3PA 4S33A 1NT2A 5IQGA 3LHJA 3ATTA 4AACA 4CMOA 2HW7A 2ZAZA 4XJ0A 4FTKA 3IOKA 4C4HA 3R1QA 5BMSA 2A4LA 2ZM4A 2DQ7X 4RIYA 5KX8A 5L4QA 3ENHA 5LJJA 4JR3A 2YFXA 5AV1A 5CANA 3WIKA 3NUAA 4CKJA 4JT3A 2OJIA 3FKLA 4RJ7A 4H3BA 4BRXA 1H00A 1M52A 1ZMVA 2YM7A 5EYMA 5CVGA 4BR3A 1P14A 1SNUA 2P55A 4FKJA 5FP5A 3O96A 4AZTA 3VRYA 4E6QA 3VNTA 4W9XA 4DH8A 3RP9A 5IQCA 3MJ1A 3MJ2A 5L6WL 4WT6A 3PJ3A 3GQIA 4QMLA
chains in the Genus database with same CATH superfamily
3EL8A 3HMNA 3L8PA 4JQ7A 2JFLA 5FUTA 3OCTA 3WYYA 1Q24A 3FHIA 4FTOA 2IG7A 3MIAA 4MXCA 5FBOA 3W2QA 2BZJA 3QKMA 4N70A 3DAKA 5HO6A 4EQUA 3OVVA 4F4PA 4KKEA 4FV7A 5BVEA 3ID6C 3FMKA 3PG3A 2QOOA 2G2HA 3O7LB 4UXQA 2UZTA 2HWOA 2GTMA 5IUIA 1CDKA 2EXCX 1JKSA 3OMVA 2WTDA 5DR2A 4FSMA 4FEXA 4FTRA 3R8VA 2B55A 4BHZA 1BMKA 4QMNA 5E8WA 5DVRA 3VW6A 4ACDA 4AGWA 4IH8A 2WTKC 3SAYA 3AGMA 3HECA 1HCKA 3F66A 4JS8A 3BHHA 3NGAA 4QMXA 4E3CA 4PDSA 2XNMA 4DTKA 5EH0A 4PMSA 2HELA 5B2KA 2C5XA 4XCUA 1H28A 4BGHA 5KZ0A 3OT8A 1VEBA 4DEEA 4BN1A 5IF1A 5IZFA 2ZFYA 2UZOA 3QQJA 2OLCA 4BGGA 5I5ZA 4JBQA 5D41A 4FIIA 2BDWA 4FSRA 4MBJA 3HAVA 5DFPA 4AGCA 1NA7A 2EXMA 4FTMA 2RKUA 4OTFA 3P4KA 2IF8A 4BICA 4AXCA 1PYEA 5K9IA 5E8XA 4J99A 1FVVA 1UU8A 5AUUA 5ANIA 3THBA 2GQRA 4NFMA 1KSWA 4S31A 4DH5A 3RZBA 1UNGA 4O91A 5AWMA 3DS6A 3DT1A 5C4LA 2WEIA 5CF4A 4MBLA 2XJ0A 5EKOA 5KO1A 3VULA 4DN5A 4UV0A 4RZWA 3FZSA 4PDPA 3R1NA 5IQIA 3QD2B 4WNOA 2DUVA 4IFGA 2YZAA 3A7FA 4EH9A 3VN9A 2IWIA 2RL5A 3LQ3A 4RIWA 3BGQA 2J5EA 2FB8A 3LMHA 5CU3A 5FDXA 4L3LA 3R6XA 1KOAA 4Y46A 4YHTA 2WQMA 5FXQA 2IZRA 4LGDA 4L01A 5H3QA 3R1SA 4NIFA 5EHLA 1B38A 3MI9A 3HKOA 1Q4LA 4GK2A 4O0XA 3ACJA 2EB2A 3ZO1A 4PTEA 1UU7A 3K54A 4BWPA 1ZRZA 1YI4A 2UUEA 3KK8A 3UNJA 2CSNA 5EDQA 4ONAA 5LVLA 5CALA 4FV9A 2HZ0A 4EJ7A 3HMMA 5C8KA 2W5HA 4DDGA 1B39A 3VF9A 3HRFA 1IEPA 1DS5A 1JPAA 1OM1A 1Y91A 2BPMA 3Q96A 3DQXA 3SG9A 3TL8A 5H2UA 5CTPA 2HZNA 3QC9A 1M2QA 2C3IB 4EBWA 2CMWA 5FTQA 5EW8A 4FG9A 3QQLA 3DKCA 4RGJA 3CTHA 4TY1A 2ZDUA 3UO6A 1PXIA 2XNBA 4EUUA 1YKRA 4ZTHA 3NRMA 4FT3A 3NEWA 2C1BA 3P08A 3FC2A 4EL9A 1FVTA 4J8NA 3PRFA 4YJOA 2W1GA 5L8KA 5HLPA 2BZHB 2UVZA 2XYNA 5LWNA 4HCTA 1IAJA 2PVKA 1XBCA 2VWIA 4WKQA 3QRKA 4ALVA 2X6DA 3DDPA 3E93A 3RMFA 4D4RA 4YHFA 2CCHA 4AQCA 4CEGA 5L3AA 4GK4A 3GU8A 4QP6A 4F0IA 2I6LA 3C4CA 5CQWA 3UIXA 4C7TA 3RHKA 4IM2A 4OR5A 4BC6A 1GZ8A 4EOPA 1H1PA 3DV3A 4AGDA 5AM6A 2AC5A 2PVRA 5HG8A 2PUIA 4O7LA 3P5JC 4O38A 4X3FA 1KE5A 3QZHA 2RGPA 5CVFA 3DJ5A 3TNIA 2WQBA 3E88A 5JRQA 5DWRA 5I9YA 2OXYA 2WO6A 2A19B 3CD3A 3EJ1A 3R0TA 4I0TA 2Z02A 5CZIA 4I22A 3QD3A 2B7AA 1O6LA 5CSWA 2OG8A 2BZKB 1OIRA 5KCVA 4C4FA 2ITVA 2O2UA 4DEDA 4G3GA 3UDZA 3BI6A 4ZSLA 5KMLA 4F7JA 4ORKA 2CNQA 3QXOA 4O96A 5M4IA 5EG3A 2W96B 5EYKA 3CEKA 4EC9A 2VGOA 2BZIB 4U79A 4AE9A 4CV8A 2FSOX 1FGKA 1ZYCA 4MXAA 2BILB 3WF8A 1GIHA 3RNYA 2QO2A 4DT8A 3UC3A 4EZ3A 5GJGA 5C8NA 3TIYA 5LVMA 2Q0BA 1PXJA 3E63A 4MH7A 4R5SA 5CEOA 4MX9A 5H8GA 2C6LA 5FEEA 2JIUA 2ZMDA 4QYYA 2E2BA 3R1YA 4FZFB 3CQUA 2GS2A 3R9DA 2QOLA 2UW5A 3NUSA 1YXVA 4IM0A 4F9BA 2PULA 2PVNA 2QOFA 3BWJA 4G3DA 4M97A 4AOIA 3DXPA 4LG4A 4MAOA 3G9NA 4O6EA 3FLYA 4MK0A 2R3HA 4NL0A 2CLQA 3BKBA 3LW0A 2X8DA 4RX5A 5HORA 2X0GA 5IEXA 1HCLA 2W1FA 1W2FA 3G0FA 3Q6UA 3ETAA 4FTCA 4H3QA 3W2OA 5GZAA 1XH8A 1YWRA 3HV3A 1OL6A 3BZ3A 5DRDA 4U7ZA 4IZ7A 1FINA 4I5PA 4IAKA 4NJ3A 3PE2A 3BBTB 4AAAA 3RPYA 5CNNA 3R7YA 1WBOA 2C0IA 4JR7A 4M12A 4RQVA 1H07A 3PIXA 4UMUA 3ATSA 2R7BA 3F5XA 5A46A 3TZ7A 1WBTA 4S30A 5CAQA 5IEVA 3E7OA 4DCAA 2Z7QA 3I4BA 3W2PA 3R01A 3TUDA 3CJGA 3LCTA 3P9JA 2QKRA 3R7OA 3RHXA 3AT2A 2O8YA 3WZEA 1JOWB 2OIQA 5BQ0A 3DK7A 2HYYA 1B6CB 1OECA 2EWAA 3OOGA 4G31A 5CSVA 5F1ZA 4TNBA 4BHNA 3QD0A 4E20A 2QHMA 3HDMA 3WZDA 5HVJA 3SD0A 4BGQA 3VJOA 2JKOA 5TKDA 4C61A 5ACKA 1H1RA 2IEWA 5F20A 5A54A 3R8ZA 3RNIA 4CRSA 4YSJA 3HNGA 5B2MA 3ZXZA 4EOIA 5L8JA 5LMBA 5LMKA 4GYGA 2VTHA 2KULA 4FL1A 2VWVA 4V0GB 5J9ZA 4PF4A 2YM5A 4F64A 4QTBA 3LFAA 1DI9A 2RG6A 2ZB0A 4YJQA 4CVAA 3JS2A 3OOMA 4M69B 4AZSA 3LXKA 1KWPA 1KE6A 2PHKA 3ZUUA 2C5YA 2OJ9A 5FGKA 3U6JA 4C2VA 3L9MA 4EZ5A 3S00A 2JLDA 2PUUA 4KA3A 4QMWA 2NPQA 3O71A 3QTWA 3C13A 5KKRC 2XJ1A 4PNKA 3EIDA 4O0TA 2VNWA 2GFSA 4YC3A 1XH6A 2QVSE 3Q2MA 2XKDA 5CX9A 5FEDA 3UVRA 2CKPA 3PSDA 3G5DA 2Y6OA 4Q5EA 2XANA 1OKVA 5ANGA 2YA9A 3EQRA 2OWBA 3LCSA 4ASXA 1KE8A 1ST0A 5HD7A 3WOWA 4ZSAA 5HNIX 1QCFA 5EM7A 4X0MA 1IASA 4EWHA 4B8LA 3LJ0A 1F3MC 4XEYA 1GIIA 3PA4A 2UW8A 4U41A 5J8IA 2XBJA 5AAFA 4R77A 3C1XA 3HA6A 3BHUA 4BI0A 4DH3A 4AXEA 4LOPA 4YJRA 3DQWA 3F3WA 2C4GA 3PZHA 4M15A 2XEYA 4FK6A 4AN2A 4KUJA 2P3GX 3QKLA 4X3FC 2FSLX 3W18A 1YHVA 4O7RA 4WNPA 3ZO3A 3GU5A 2XZSA 5AP3A 2YZLA 5J87A 4KABA 4CLJA 2WMVA 4FKPA 5BVWA 3BLHA 4NW5A 4EOMA 4L53A 4QMQA 1ZYJA 4I20A 4JDHA 5F4NA 4ID7A 4JAIA 1TQMA 4YZDA 4FKIA 3KRJA 2Y8OA 2RG5A 5AM7A 5JFWA 1ZOGA 4BDCA 1W7HA 2HZIA 3R8LA 3UIBA 5M07A 2QR7A 2ESMA 3TG1A 2JIVA 2I0YA 3KB7A 2X0OA 5HNBA 1R78A 3OEFX 5LVNA 4QT1A 4QNYA 3PVBA 2OXXA 4BTMA 3GGFA 4O27B 2G01A 2I0HA 4IQ6A 4RC2A 2J5FA 2JDTA 2O65A 3FSKA 4BDHA 4NYEA 4YC6A 2UW6A 3QC4A 4L7SA 1NXKA 1R0PA 4O83A 3UODA 3FC1X 1OB3A 1GIJA 4B99A 3OUNB 5DIAA 3G2FA 3MB6A 3ORKA 4HGEA 4XOYA 2I7QA 1TQIA 1ZARA 3I1AA 3T9TA 3O51A 3SXFA 4FIEA 5IA2A 2W05A 3RALA 2WU6A 4LQMA 4NH1A 3LCKA 1QPEA 4HYIA 1PXKA 4IZ5A 3I5ZA 3Q9XA 2J7TA 2VZ6A 4O0RA 4XLIA 3W10A 3OXIA 1H01A 1MQ4A 2E9NA 2GQGA 3DTWA 3IW4A 3W0OA 2F2CB 4AW2A 4BDFA 4QP1A 5HU9A 3IPHA 4U5JA 3BV3A 1I44A 4G6OA 2XCHA 3BIZA 5AP4A 4FV8A 2YCFA 2XNEA 4AW1A 3B2TA 3H0ZA 4BKJA 3TNPC 5AR2A 3PXYA 1VYWA 1YDRE 2WMRA 2Z7SA 4G9RA 5M51A 3DNEA 2E9UA 4JQEA 5C26A 2ETKA 3FZ1A 5K0XA 3ZZWA 4E8AA 2F9GA 4M0ZA 2ZMCA 3IW8A 3OY3A 4FKVA 4F7LA 2VD5A 2WMSA 4DH1A 4O7ZA 3H3CA 3F3UA 1PYXA 3DK3A 4GUBA 3R7UA 5HO7A 5IEYA 5BUIA 2B9HA 4OBOA 4BBEA 4FTJA 2IVVA 3HX4A 4AE6A 5EM6A 4E5WA 4JAJA 5T3QA 3NNUA 5EW9A 5I9VA 4YJPA 5HD4A 5GZ9A 2XKFA 4NKSA 3TN8A 3FYKX 3UBDA 4LL5A 2PVFA 4ZTSA 2VWBA 3OD6X 3WE8A 4UWBA 4FT5A 2VNYA 4L44A 3VUTA 3DBFA 3EFLA 2WU7A 3NUPA 3QU0A 3FDNA 3R71A 4X6RA 3KN6A 3T9IA 4IAZA 4AXDA 2WPAA 3S95A 4OTPA 3UO5A 3QCXA 3TKUA 4MD8E 4GW8A 3S1HA 2CN5A 3NS9A 4K18A 5ANJA 2QOBA 4EHGA 1XO2B 4WHZA 5A6OA 2C0TA 5DN3A 1OUYA 5AR7A 5CU6A 1Y8GA 4IANA 4O4EA 3QZIA 4OBQA 4R5YA 4ZJJA 1LEZA 4U40A 3BYSA 4D1ZA 3GBZA 5LMAA 2X0QA 5HIEA 5JMSA 4O82A 1YDSE 3OWLA 3QRTA 5C27A 3G0EA 3QLFA 4YLKA 4R7BA 3GB2A 4IBMA 2HAKA 1K2PA 3KQ7A 5AUZA 3ZSIA 2HW6A 5J5SA 3DKOA 3EN5A 3NVMB 1Q8TA 4IB1A 3RGFA 5HX6A 3FLWA 3BL9A 2J2IB 2YCQA 3EN7A 1OPKA 2H8HA 4J95A 2R9SA 1M14A 2CGVA 3KRXA 3GC0A 4FKRA 3O17A 2XUUA 4R3RA 4WUNA 3PLSA 1G8AA 3LXNA 1CMKE 5CSXA 2SRCA 4QPAA 4BTFA 4FSNA 5A4EA 2R3FA 3PG1A 4UWYA 3ZEWA 1DAWA 3V5QA 4YGAA 1APME 5LVPA 2CN8A 4MKCA 4V05A 4ZXTA 3C4XA 3M2WA 1PXPA 4FX3A 5AP1A 3GOKA 2XKEA 4A9YA 5J79A 4YTHA 1RDQE 2VTRA 2JKMA 4RT7A 4AS0A 3QTQA 1Y57A 4HPUE 2CDZA 3R9HA 2EVAA 5CXZA 3CE3A 4AZEA 3VS0A 2C5NA 4WG3A 3D4QA 4NTTA 2BRGA 2F57A 3FMHA 2VN9A 4U80A 4EHZA 1NY3A 1WMKA 5CU2A 3BE2A 5HEZA 3UVQA 3KRLA 4RX8A 5JRSA 4GFMA 3FZRA 2BFYA 5M44A 4RFZA 5A4CA 1OZ1A 5AP0A 4EOKA 4RIWB 3CQWA 3KREA 3GNIB 4KAOA 5TE0A 1T46A 1S9IA 2YN8A 4BI1A 4YZCA 5AR4A 5LVOA 3CKXA 3V5WA 2IN6A 5KMJA 4KKHA 3PRIA 1ZYLA 3DDQA 5AV2A 3G9LX 2BRBA 3P7CA 2P4IA 2WIPA 4EKLA 1YHWA 2KTYA 5TR6A 1VR2A 3O8TA 5E8UA 2YIQA 4BCJA 2H34A 3TWJA 3N4TA 3R8UA 3HYHA 4QQJA 4QTEA 4IX3A 3V8WA 3KMMA 3QZFA 3NAYA 4MF1A 3GC8A 2YM3A 3U51A 4CFUA 5AFVA 4GFGA 3VUIA 3TM0A 4I23A 5T68A 3LFFA 1WBPA 3N4VA 3QRIA 5JEBA 4G34A 3DPKA 2ERZE 2BRNA 3EKKA 4BDGA 4IWDA 5GJDA 3ORNA 4G16A 1XKKA 4YU2A 4FR4A 1ZOHA 3F5GA 3DB8A 4F9WA 3LXPA 3N4UA 3I0QA 4IEBA 5HTIA 4J52A 4FV3A 3QRUA 5HNGA 2IZTA 4BJJB 1LR4A 3QGYA 5AV3A 2R2PA 3RCDA 5KKRB 3V3VA 4RC3A 4BCQA 3OP5A 3A8WA 5E8TA 3UMWA 2QU5A 2WZJA 3UTOA 4ENYA 1REJA 3IW6A 5DBXA 3UQGA 3Q04A 3C0GA 4YJTA 5JQ5A 3G6GA 3D7ZA 4MNEA 3ZLSA 3MH1A 2W1HA 4CYJA 5FXSA 3FXXA 2X8EA 3CGOA 2DS1A 3PPJA 1F0QA 4J96A 2VRXA 4GK3A 5CEMA 1TFFA 4CLIA 3P0MA 4FEVA 5AIKA 3CSVA 1IA8A 2VO6A 3SXSA 4DDIA 2YDJA 3CD8A 4CNHA 2CJMA 3PJ8A 2PZRA 3K3IA 3WARA 4YR8A 4I93A 4GMYA 1Q5KA 3F7ZA 3FUPA 4OTDA 5KNJA 2C6EA 3UG2A 3NAXA 5IU2A 3JY9A 4JL9A 2HK5A 2XK6A 4LV5A 3EFJA 2JD5A 2RIOA 3EH9A 4JDIA 1FBNA 4ZJIA 5HTCA 4F70A 1OITA 1UNHA 3UQFA 3FMLA 3KA0A 3TZ8A 2ZYBA 3PPKA 3F6XA 4J7BA 4M84A 4QOXA 3RI1A 5CAUA 4OAUC 1YOLA 2REIA 3LJ1A 2BR1A 4JG7A 3DCVA 4BDDA 4BDJA 2JITA 4APCA 4D2RA 3LLAA 1JVPP 1YRPA 2GTNA 4RC4A 4ZOGA 3OFMA 1PJKA 4ARKA 2PMOX 3EMGA 2QODA 3MIYA 3R22A 4X2NA 3EZRA 2GCDA 4EH2A 1G8KA 5E8SA 4YPDA 1L8TA 1J1BA 4RQKA 3PXQA 5HBJA 2GHMA 4USFA 4EWQA 4BKZA 1YOJA 3F3VA 4C62A 1S9JA 3TYKA 3ZC6A 4EH3A 4AU8A 3C50A 4B0GA 4F09A 5HIDA 4M3QA 4R8QA 4FKOA 3V8TA 4QTDA 4BVUA 3FQHA 1AGWA 4CCBA 4LGGA 2B52A 5E90A 1OUKA 4FNZA 4RVKA 3L8VA 4WSYA 3H10A 4CZTA 4EH7A 4IVCA 4AF3A 1YI6A 4KNBA 4I6HA 5B2LA 3FMEA 2FSMX 1Y8YA 4FSUA 3DBEA 2VWZA 1PHKA 2QI8A 4AW5A 4MXYA 1WVXA 1W82A 3COHA 3AC5A 1H8FA 1WFCA 2YIRA 3LQ8A 4IVDA 2C5OA 4E4MA 4ERKA 5A6NA 2C68A 3ZO4A 4AT3A 4NT4A 1SVEA 5FLFA 5FP6A 2J6MA 3GCSA 3OS3A 3W0SA 5E8VA 4BZDA 5AA8A 5L2TA 4WNKA 4EK6A 3QX2A 4FTIA 5CI6A 3R8PA 2C6IA 4W8DA 3ZOSA 4PMTA 3FKOA 3BU6A 3PUPA 4PQNA 3BHYA 4KIKB 3MESA 2R4BA 4ZAUA 2BCJA 4LOOA 4PMPA 3ORZA 4P4CA 2UVXA 3EQPA 3OEZA 4XOZA 5TF9A 5CF8A 3HV5A 1IR3A 2J9MA 4RFYA 4ZY6A 3VUKA 2VTJA 3OTUA 4K33A 5EDPA 4JX3A 4KBAA 3UOLA 1SYKA 4FV5A 4E93A 5BUJA 4FG7A 3BBWA 4U43A 3AKJA 3R83A 2CNUA 3WBLA 4TPTA 3ROYA 4EOOA 2WIHA 3EN6A 2X2MA 3KIOC 2JFMA 3LLTA 4GH2A 1R1WA 5CNOA 3KY2A 3PY1A 3SVVA 2VGPA 4FZ7A 3ZLWA 4D0XA 1PXNA 1ZYDA 1V0BA 4RLKA 4BFMA 3FMDA 4XYFA 2J50A 5DE2A 2B9JA 4XBRA 3IKAA 3R21A 1ERKA 5JH6A 3LM0A 2XNPA 2FYSA 3R04A 3U8WA 3L8SA 3W1FA 2NO3A 4YBKA 4YTFA 1URCA 1IRKA 2PSQA 3QA8A 4LDTA 3U4WA 3NYOA 3KL8A 4EHVA 1Y6BA 3PJ2A 3PVWA 4C36A 3QYWA 3AC4A 4K1BA 4ACGA 4KD1A 5IISA 4TYGA 2JAVA 3V5JA 1OPJA 3I81A 3LCDA 1YHSA 3SA0A 5E92A 4CMTA 3ZLYA 3DKGA 5LWMA 2B0QA 4XV9A 4ALWA 4GYIA 4CFNA 3O5AA 1Z9XA 3LAUA 3NPCA 3QTIA 4IW0A 4S34A 4IAFA 5L8LA 2GHGA 2UV2A 4RJ8A 3FPMA 2NYAA 4MQ2A 4FT7A 4EOJA 4PPBA 4RX7A 2ZM1A 3TIZA 3W0MA 1WAKA 2DYLA 3MBLA 1PXMA 3D94A 2HOGA 3AQVA 3VS1A 2IVUA 2P0CA 4IAIA 4CQGA 3OCSA 4PRJA 2O63A 2A1AB 3EQIA 4RX9A 3UPXA 5CF6A 3PVUA 3FLSA 3ODZX 3FMNA 3G6HA 1DM2A 4JG8A 3T8OA 1OL2A 3UE4A 2HCKA 4JRVA 2BTSA 2IZUA 5CAOA 5KHXA 2VV9A 2IW6A 2VWYA 4QP8A 2I0EA 3L9LA 3ORPA 3TCPA 2OIBA 3HRCA 4KRDA 3F5PA 1TQPA 3A4OX 4AWIA 2XAMA 3EWHA 4A9SA 2F4JA 3BV2A 1VJYA 4FKTA 4EK4A 2WMQA 2QHNA 4O4DA 1OMWA 3MGYA 1U54B 5AUYA 2JGZA 3MTFA 4GU9A 3ZFMA 3BYUA 4FT0A 4C34A 3Q3BA 5C01A 3UPZA 4LRJA 5HCXA 3FAAA 4NEUA 3SC1A 5LQFA 1YXXA 2X1NA 3I6UA 3EQBA 3ORXA 4J98A 2RFNA 3W0QA 1LPUA 3D14A 5BPYA 1QPJA 5BYZA 3HLLA 4O2PA 3NLBA 3TI1A 1Q41A 3VF8A 1CSNA 2I1MA 3JVRA 2J0JA 1WBNA 3E7VA 2V5QA 3HDNA 3PY0A 3MN3A 4A9RA 2BHEA 4WSQA 3DOGA 5CWZA 3E92A 3QGWA 5JT2A 3QCYA 3E62A 4FVPA 3KULA 4MXXA 4X2KA 4Y72A 3QHRA 5H8EA 2I40A 2HENA 3LIJA 4E6CA 2XH5A 2CGXA 3OROA 4GVAA 4XLVA 3VUMA 4ZJVA 4C4JA 5J95A 5JQ8A 2IVSA 1M17A 3RINA 4LRKA 1OBGA 3H9OA 3MY5A 5HCYA 2XKCA 1SZMA 4FV6A 3VUHA 3LFDA 3C4EA 2VTLA 4FL2A 4YJVA 3MTLA 4RSSA 2HIWA 2OF2A 4IACA 2XIRA 3VWAA 2B9IA 4CFFA 5K5NA 3F82A 5D7AA 2ITNA 4OTQA 4E5BA 4E6DA 4UEUA 3TUCA 1H1WA 1CKPA 4I6FA 2C3LA 4XG6A 3W55A 4F1OA 3UZTA 2PK9A 2F7XE 4LGHA 3NW6A 4XRJA 3F7WA 3VBVA 5CENA 3VS6A 5M56A 4Z55A 3SRVB 1UKIA 1J7IA 4G5PA 4O2ZA 1AQ1A 3SX9A 2JBPA 1OKYA 1XH4A 3W8QA 5L2WA 3AC8A 2GNFA 5A4TA 3L9PA 3UNZA 3K2LA 4EH8A 1XH9A 3O7LD 2AEGA 3TUBA 3KF7A 2CGUA 3FE3A 5D12A 2YEXA 3BGZA 5G6VA 5K4JA 4XV3A 4CTBA 4DF3A 1BLXA 1YXUA 5J5TA 3B8QA 3M42A 1ST4A 4A4LA 1BX6A 2XMYA 4USEA 1T45A 3Q53A 3QL8A 3VQUA 4EEVA 4IM3A 2PMIA 4GEOA 2PE1A 4LL0A 5FM3A 3O50A 3V04A 2QOHA 4RZVA 1BKXA 5BYLA 1LEWA 4U97A 3BEAA 4I24A 4TXCA 4EJNA 4FSWA 2J90A 3VHEA 5KZIA 3QWKA 3DXQA 3KXZA 3QXPA 4FV2A 4DGOA 2R7IA 2WTCA 1IA9A 3UC4A 4FV1A 1YW2A 1E9HA 4DG0E 4GS6A 4UYNA 4O0UA 3MYGA 4TYHB 2OH4A 3D7TB 4GFOA 2JAMA 2Y4IB 5DH3A 4HVGA 3JR1A 3Q60A 5A14A 5CT7A 3IW5A 3A2CA 2YIYA 4EQCA 3AT3A 3DAJA 4BCPA 3U54A 3C9WA 1JBPE 4LMNA 3RJCA 3U6IA 1KE7A 2QR8A 4XV2A 2OZAA 4HNFA 4HYHA 2Y0AA 3QD4A 4KIQA 4CYIA 5A4QA 5M06A 3Q5ZA 5KMIA 4I5HA 3AG9A 4EK8A 2BKKA 4FKQA 3VS2A 2X2LA 4EBVA 2BFXA 2GNLA 4QMTA 3EN9A 5DT0A 5EW3A 5CVHA 4QYFA 3CXWA 5DT4A 4ZSEA 3IDCA 4EOLA 4L42A 3ZS5A 4ZTNA 5EI8A 4QP7A 5CEQA 2R3PA 5F9EA 5GZ8A 4AQKA 3EL7A 3G51A 3OZ6A 3F9NA 4UB7A 2ZV9A 2GPHA 3DU8A 3NUUA 4CGAA 3RCJA 5AV4A 5KBRA 3FQSA 5IQEA 4TN6A 3FLNC 4M8TA 4PPCA 1JSVA 4IB0A 2WMTA 3TTIA 4M68A 4CG9A 3CTQA 1GZOA 4C37A 4AA4A 3FMJA 3PY3A 4YJSA 4AZWA 4USDA 4C3PA 4DEIA 4TYEA 4AGUA 4BY9E 2PVLA 4I6QA 1JKTA 5FBNC 4E1ZA 2JDVA 4GV1A 3UIMA 4MWIA 4O21A 4U44A 2W17A 4S32A 4HGLA 2LAVA 3HZTA 5D9HA 4AA5A 4RA5A 3C5IA 4FKUA 3QRJA 5JZNA 4F9CA 2A27A 1M2RA 3M11A 3RPVA 2E9OA 3ERKA 2BROA 3DA6A 2AYPA 4RVLA 4BWXA 2XNGA 1OIQA 5B7VA 3LOKA 4ITJA 4TWOA 3SW7A 3VONA 4UX9A 3PSCA 4H36A 4X21A 4RVMA 2GDOA 2YITA 4AX8A 4C0TA 2W4KA 4ZLZA 4O7SA 4YSMA 3CY2A 3ZRMA 2WAJA 4H1MA 3W0NA 4BDAA 3OWJA 2R3RA 3P7AA 4R3CA 4Z16A 1SMHA 5I0BA 5AP5A 2NP8A 3KXXA 1E1XA 3K3JA 4DEGA 3ITZA 3ODYX 4U0IA 4XH6A 4W4XA 5CSPA 2W9ZB 2XIKA 2C6OA 5AX3A 4P2KA 5IA0A 4M7IA 2BUJA 2BMCA 2OIDA 2UZBA 3LCOA 3QTZA 3B2WA 3D2IA 3DK6A 2XM8A 4D5KA 3UDSA 2VTIA 3BELA 4D58A 3HP5A 4MEDA 3KXNA 3A7JA 3KVXA 1WVYA 3Q6WA 1RW8A 3V01A 4U8ZA 3II5A 3S4QA 3I60A 3NVKI 4BTJA 3GP0A 4NSTA 2W0JA 4O4CA 3VS5A 5KMNA 3DJ6A 5IA4A 3Q4ZA 1YWNA 2CPKE 4MNEB 4IJPA 4QMOA 4ANSA 4BCNA 2ZV8A 4QYGA 5GHVA 4D2VA 5BV3A 3PFYA 4BIEA 3PDTA 5CF5A 3UOJA 2WTKB 1YWVA 1GZNA 3OCBA 3V5TA 4GT4A 4IAYA 4D4VA 5HLWA 4OTRA 4CRLA 4YURA 5K4IA 3E8CA 4YBJA 1KOBA 1AD5A 2X4FA 3A99A 4YPSA 2B4SB 3ZH8A 2X81A 2ZV7A 4LUDA 3RPOA 4AN9A 4CZYB 1YDTE 3AMAA 4L3JA 3NYNA 2YERA 4KIOA 1H1SA 4NM0A 3O8PA 3ZFXA 3NCGA 4MHAA 5JFVA 4GIIA 3VUDA 4BDEA 1JKKA 3I6WA 2UW9A 4UMPA 2PUNA 1KE9A 4BDBA 4IIRA 2XARA 1SM2A 4YMJA 4K11A 4FZ6A 5HO8A 3M1SA 4R6VA 3VIDA 4F63A 1R3CA 4L45A 4JRNA 3NNWA 4QQ5A 2GNJA 3UVPA 4QQCA 4X6QC 3FKNA 4E4XA 2OSCA 3UOHA 3GU7A 4FICA 4XUFA 1RJBA 4XRLA 3FZOA 4GG5A 3TMOA 2PWLA 2Y9QA 3KEXA 3QCSA 5D11A 4EH5A 4MXOA 3H9RA 4OW8A 1Q61A 1REKA 2JDSA 1OL1A 2YDIA 3MPAA 4XX9A 5DT3A 4D55A 3BRBA 3K5VA 3WF9A 4F6UA 4G9CA 1NW1A 2PVHA 3JY0A 3Q32A 3TACA 4NW6A 4RWKA 2YACA 4D9TA 4FKWA 4NCTA 5HX8A 1QMZA 3BCEA 4YZNA 5GINE 5AUTA 5AP7A 3E87A 4M0YA 4I5CA 2F7ZE