2IWIA

Crystal structure of the human pim2 in complex with a ruthenium organometallic ligand ru1
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
257
structure length
244
Chain Sequence
YRLGPLLGKGGFGTVFAGHRLTDRLQVAIKVIPRNRVLVTCPLEVALLWKVGAGGGHPGVIRLLDWFFMLVLERPLPAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFERDQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE PIM-2
publication title Crystal structure of the PIM2 kinase in complex with an organoruthenium inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 59
structure length 244
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2006-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2iwiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2iwiA01
2E2BA 2CKQA 3RPRA 5GJGA 4H1MA 3QWJA 2IVVA 4JR3A 4PDPA 3A7HA 4G17A 4QMWA 1OL5A 3V04A 4EHEA 2GHLA 4R8QA 3ID6C 2R3KA 2RSVA 1OI9A 4FIGA 4EUUA 5A4TA 5AR5A 3P86A 2PZYA 4RLLA 2G2HA 2J6MA 4DEGA 3QLFA 1SZMA 3EQPA 4P5QA 4BCKA 1WVXA 4Z7HA 1RW8A 5FEQA 5L8LA 2OZAA 5J7HA 5J5SA 4RIYB 4E6AA 4OLIA 3ULZA 4F7LA 3H4JA 2ZM3A 1Q4LA 3DKGA 1J7UA 4O38A 1OKZA 5AV1A 2P2HA 2Z7LA 3HL7A 4LQMA 2ZV7A 2PVMA 1W8CA 3Q9YA 1PXMA 3FZPA 3ZO3A 4GRBA 3TM0A 2OFVA 4AOJA 1MQBA 4KS8A 4YJSA 4HZRA 3ACKA 4F1TA 3K54A 4ASDA 4JDJA 4D0WA 3GC8A 3ODZX 3C4FA 2YA9A 3TKHA 4XG4A 1K3AA 1J7IA 4BY9E 2XMYA 3RKBA 3BCEA 3BYUA 5AUTA 4RFMA 5ETIA 3K5UA 2GNIA 2XCHA 1JLUE 4F0IA 5ANOA 3OW3A 5HVJA 3OVVA 3ALNA 4W8EA 2E9OA 2QONA 3FAAA 3LQ5A 3HMNA 3O50A 4WRSA 3DDQA 3ORIA 4FV6A 3ZSGA 4IADA 4C37A 5HVKA 5G1XA 3H0ZA 4CCUA 4A4XA 2X7GA 4XNEA 4NWMA 5DEYA 3TIYA 3CSVA 3NDMA 4HGLA 4MX9A 4QPMA 2W1ZA 3QYWA 4AGDA 5IH6A 4RGJA 3IONA 2W1FA 4IB3A 2B55A 2OIBA 4BTKA 3SKCA 3O8TA 3I0OA 3PLAE 4F9CA 3CGFA 5CNNA 1J1CA 4IDTA 3KREA 3LXNA 4RVTA 4E4NA 2OU7A 3Q9WA 4QPSA 4YSMA 2O65A 4HGTA 4IWOA 4CVAA 1P14A 3F3VA 5KMJA 2NNWB 2XCKA 4QMUA 2GFCA 1Z9XA 2PMOX 3R7GA 5C4LA 4FKWA 2OIDA 2E9VA 1PXJA 5CQWA 5HG7A 3VQUA 1OKYA 4O1PA 2FSMX 1JPAA 1B38A 3PUPA 3FL4A 4YJUA 4UWBA 5ETCA 5CF6A 3DKOA 3AC4A 4QMPA 4W4VA 3TXOA 2PL0A 2C6MA 4ZSAA 1NW1A 2JDVA 2V62A 4YC3A 1Q8ZA 2QO7A 4M13A 5KHWA 3DZOA 3NW5A 3GC7A 5H2UA 4B7TA 4GKHA 4YPSA 4G34A 3V5LA 5CEIA 3MTFA 4QMZA 3CQUA 3FLQA 2C6TA 3P7AA 3CY2A 5HZNA 1Y8GA 3R00A 3LFNA 4BBEA 4AOIA 5LVNA 4PPAA 3R8ZA 2WOUA 3LPBA 5FWKK 3W32A 5GJDA 2WMSA 1OUKA 3EFJA 4R7HA 4ACMA 4BF2A 3CJFA 3Q52A 3Q9ZA 4FIHA 3R7YA 4I93A 4AP7A 5HOAA 3Q5ZA 2WOTA 4HPUE 3R8LA 2I0YA 2JDRA 5AUYA 2HY81 5TT7A 4FKGA 5EYDA 3MIYA 4ZMFA 4GW8A 4LMNA 1KE9A 2VD5A 4IZ5A 3IOKA 4ACDA 3HGKA 2RL5A 3FQEA 4UALA 4UXQA 4Y5HA 5CQUA 4ZEGA 3KY2A 3SAYA 4LRMA 2JC6A 3GEQA 5KZ0A 1Q5KA 2ONLA 3MVJA 4HVSA 5C1QB 3KRXA 3RK9A 3TDVA 2WB8A 2EXCX 2PZIA 2UZLA 1ZYCA 4FT0A 2QKRA 4PTEA 2G01A 3ALOA 4NJ3A 1H28A 2BZJA 1Y57A 1JBPE 3ANRA 3PXYA 5T68A 2XA4A 4JBQA 1FQ1B 3LXLA 1M2QA 1M7NA 4GFGA 5HE1A 4EBWA 3C51A 2WELA 2JKKA 4L8MA 3RAKA 2YLEA 5IMEA 1PW2A 3IW5A 4TYHA 5FBNC 1H1SA 1GY3A 3RWPA 4L68A 1A48A 1VZOA 5AM7A 2YM7A 2W9ZB 4NKSA 4WNKA 3O23A 4KIQA 1UKHA 4RC3A 2VNWA 4M69B 4CMTA 4DEHA 5ITAA 4CLIA 4BCHA 1TQMA 1WBNA 4HNFA 4HZSA 4DN5A 3QC9A 4OTFA 4PV0A 2PMLX 4J99A 4CQEA 3H3CA 2A19B 4OBOA 4ZJVA 2CGXA 3ZRLA 3MY5A 5CU3A 3P78A 1IR3A 4ZSJA 4D5KA 2XNEA 5C4KA 2PVRA 4R3RA 4ALUA 5HLPA 4IJPA 2I7QA 2ITOA 2WTCA 3M42A 3PP1A 4DEBA 4E4LA 4BDHA 4NYEA 3R71A 3UTOA 3PA4A 2VTRA 5HG9A 3DDPA 1NVRA 4MD9E 3TZ8A 2I0HA 3CC6A 3IW8A 4CSVA 4FBXA 3ORZA 4IM2A 3UVQA 3V5TA 3ZSHA 5KMOA 2GHMA 3AD5A 2UW5A 2VX3A 4FMQA 2DUVA 4BGHA 4CLJA 3KF7A 5E8UA 3FHRA 4RMZA 3V5JA 4II5A 3R83A 5T6KA 1F5QA 4I6QA 5EHLA 3UO5A 3SD0A 5LVPA 3R9RA 4EKKA 3EN9A 1V0PA 4IX4A 4MK0A 2E9UA 4I23A 4K11A 3TWJA 3EKNA 5A4QA 3CY3A 2P0CA 1PJKA 2JIUA 2VO0A 3LAUA 5BMSA 1LUFA 4YGAA 3LMIA 3MA3A 3H9FA 1B6CB 2ZYBA 2C6EA 3GXLA 3QD4A 4U42A 3ATTA 2R3PA 3NUSA 3ZEWA 5LMBA 3VHKA 5TKDA 4IFGA 4JAIA 2JIVA 3AC2A 1FPUA 3C50A 3PRIA 3UZPA 1BL7A 4NT4A 3ZZEA 4DG0E 2ETRA 3E88A 3Q2MA 2YJSA 3FLNC 5CVFA 4FC0A 4DLIA 5CZIA 1DAYA 3P1AA 3FXWA 3R8UA 4ANNA 4DT9A 2FSTX 2OK1A 1ZLTA 3OP5A 2IZTA 4AGCA 5EDRA 2XNBA 4PRJA 4NU1A 1YWVA 3PG3A 2X39A 4MBIA 5E8YA 5JEBA 3BV2A 2QG5A 3A60A 2JBPA 1M7QA 2Y4PA 3I1AA 4PMMA 4S34A 4M84A 5FRIA 5GHVA 5C27A 4C4EA 5IQAA 3CBLA 5HCXA 5DT0A 4G1WA 2YEXA 1M17A 2JIIA 1GZKA 3W2RA 2IW9A 2CN5A 3W8LA 3BPRA 4DGGA 3EFKA 5LVMA 5IQHA 3I5ZA 4R1VA 5JRQA 4F6UA 2W9FB 5I9UA 3UODA 3OS3A 5FXRA 1YOJA 4RA4A 3VN9A 4O7LA 2YDKA 2WGJA 4ANOA 3F2AA 4AFEA 5IA0A 4DEAA 1I44A 3FUPA 3OXTA 3TG1A 3UIMA 3PSDA 4E26A 2C5YA 4FNZA 1R3CA 5TR6A 4NCTA 4FG7A 4F9WA 5AA8A 4F1MA 3FMDA 5CT7A 1Z57A 4YO6A 2XEYA 4B6LA 5F9EA 3BEGA 3F9NA 4CZYB 4RC4A 4O0YA 3ZYAA 3HVCA 3VS6A 5K4IA 3KXXA 1CKPA 5IQEA 2CCHA 2VO7A 1H8FA 5ANDA 3MV5A 4MXOA 2XM9A 4RSSA 1OKVA 4RFZA 3PY3A 1U54A 2RFDA 3VBXA 1JOWB 1GZ8A 4Q9ZA 3QQUA 2X8EA 4DEDA 4MAOA 2X2KA 3ZCLA 2QOFA 5HO7A 3O8PA 3QXOA 4L00A 5M57A 4EWQA 5JQ5A 2O3PA 2O5KA 3DQXA 3NS9A 1GIJA 2HENA 2R3LA 3OY3A 1V0BA 2FGIA 2CN8A 4QQCA 4B8MA 2DWBA 4EJNA 5CEOA 2E9NA 5HORA 5L2IA 4ACHA 4N70A 4AT4A 4EHZA 5CALA 4WOVA 3FHIA 3D7TB 2GDOA 5CEMA 4RWKA 4ENXA 4L46A 5HD7A 3FKOA 4YSJA 4ACGA 1G8AA 3SA0A 2GNFA 4ZSEA 4EZ7A 3RAIA 3NYNA 3DCVA 4IB1A 1J7LA 3NVKI 2J0LA 4NSTA 4BCJA 5CX9A 1PMUA 2VGPA 3HEGA 5M4IA 4JI9A 4J8NA 2IG7A 4RJ8A 4GFOA 1CSNA 2BAJA 2WKMA 3RALA 3IGGA 3MS9A 4E7WA 1O6YA 2HZIA 3THBA 2LGCA 3QTXA 3DJ5A 4FIIA 4RWJA 1H1QA 2XJ0A 3LCDA 4G5JA 4IDVA 3RP9A 3GT8A 2C5XA 3R01A 3O2MA 3HNGA 4I0SA 4QQJA 4DINA 2HAKA 1W0XC 4GG5A 4OT6A 4F70A 5C8KA 4CRSA 1DI9A 5FDXA 3ORPA 4G3DA 3OWLA 4L3JA 3WE8A 4DFBA 2WZJA 4QTEA 3ZO1A 2R0IA 3DXNA 1P2AA 4P7EA 2X2MA 3SV0A 4DYMA 5CU4A 3GOPA 3LCSA 5L4QA 3BBTB 3LQ3A 2GTMA 2RIOA 3UQCA 2H96A 5B2MA 2VTTA 3QHRA 5CU6A 5HE3A 3R9OA 3I4BA 4GKIA 2WHBA 3L9PA 4ZTSA 3ZXZA 1YI4A 4FOBA 3FZRA 2XJ1A 4WSQA 4QTAA 2ZJWA 4YO4A 3DQWA 3AGLA 4TWPA 3TI1A 2C69A 1UVRA 4FKIA 3FY2A 4JX3A 1R1WA 3QXPA 4U5JA 2FH9A 3WYXA 2PUPA 3EOCA 3LLAA 5FTOA 4H36A 4J98A 1IA8A 4XBRA 1JAMA 1YXSA 4H3PA 3UC4A 3LM5A 4BCOA 1WAKA 4CKIA 1SYKA 1Y8YA 5LMKC 4IC7A 1U5RA 5C8NA 4U44A 4YNOA 5DIAA 3CTQA 5HTCA 3ENMA 4MXAA 3PY1A 3PXQA 1Q8WA 3KULA 4GK4A 4L44A 3RWQA 3MFSA 4EEVA 2BTSA 4K77A 3Q4UA 2B54A 4E5AX 5IDNA 3OWJA 3NW6A 2OJ9A 3P7CA 5B2LA 2REIA 4QP2A 4O0UA 1BI8A 5GJFA 4F4PA 5M08A 4OGRA 3UPXA 4KINA 5BVDA 3D15A 2H9VA 2QR7A 4LMUA 3FBVA 3AOXA 3TZ9A 4FOCA 4J1RA 2WTIA 2G2IA 4IX3A 1REKA 1UU3A 4JL9A 5GINE 5HIDA 1CM8A 4O7ZA 4FTUA 4ITJA 5D11A 3EQCA 2IZUA 3ZLXA 4ZIMA 1RJBA 3COIA 2FYSA 3EQDA 3UNJA 1P4FA 1FINA 2QOHA 4WSYA 3UC3A 3QKKA 4BGQA 3UZTA 3IW4A 1M2PA 5HU9A 4NZWB 3CKXA 3TUBA 3N4VA 2OBJA 4YLJA 5LJJA 5AIKA 4HYUA 5CU2A 2WNTA 5AV2A 4Y85A 3QTUA 2NRYA 2X8DA 2Z7RA 3P0MA 4BCMA 5IA3A 2JAVA 1FVTA 4AF3A 4DF3A 4Y83A 3F3WA 1AGWA 2JBOA 2Y0AA 2W1DA 4NTTA 1QPEA 3QLGA 4IAKA 4EYMA 4ZY4A 4EKLA 3GFEA 3PA5A 2ITZA 1XBBA 3P23A 3G9LX 4QMVA 4A9SA 3BU5A 3ORXA 5FQDC 1R0PA 4XG3A 3QA0A 4A9TA 3LFAA 3PXZA 4V04A 3RZFA 1YXVA 1W98A 3TKIA 2BDJA 3TV6A 5AP6A 3L8PA 4GVJA 2J2IB 3ZMMA 5EKNA 2Z8CA 3D5UA 2BDFA 3MJ2A 3T9IA 1UWHA 3GCQA 2ITQA 4DAWA 3QQKA 4J96A 4RIXB 3E62A 4JBVA 4PUZA 4BI0A 4D58A 4FVRA 3FMHA 1UNLA 4D9TA 2JKQA 2WQMA 4AN2A 3D9VA 5FGKA 2GNJA 2VTPA 3COHA 4IZAA 5M55A 3OOGA 2VWWA 3B2TA 1F0QA 3HX4A 5A14A 2IVUA 5CT0A 3OOMA 3DU8A 5EI2A 1TQIA 1QPCA 2SRCA 4DH7A 3R7IA 4FT7A 3FSKA 3EQHA 2HW6A 2R4BA 2C5VA 2IZSA 2YAKA 4FZ7A 2YM6A 5J8IA 2YITA 4YNEA 2XIKA 5E8VA 3A8WA 4TZRA 5LMAA 4A06A 3KU2A 3QZFA 3RTPA 4BCPA 4O7TA 4K8AA 3GQIA 5JGBA 4ANQA 4QPAA 4C8BA 3VHEA 3R7OA 3CE3A 5CSHA 3P7BA 3Q60A 4FGRA 2BVAA 2JDOA 1RDQE 2NO3A 3P79A 5DOSA 3RGFA 5L2SA 4JRNA 4ZS4A 4JG7A 4G6LA 4IIRA 4IZYA 5JZNA 1OITA 1XH7A 1ZOEA 3HV6A 5IQFA 1H26A 3EQIA 4G31A 2R3RA 2PZPA 5AAFA 4AN3A 2R7BA 2BRNA 2I40A 4FK3A 3QZHA 4QMOA 2ZVAA 2W4KA 2AYPA 5E8TA 2C6OA 2JAMA 5A3XA 3ZONA 3LJ0A 4DBNA 2BIKB 5EYMA 3PE2A 3QD2B 2VWVA 4AW0A 5IA5A 4AT3A 3R63A 4C4HA 4XV9A 4OR5A 3GP0A 2DS1A 3QCSA 4WNOA 5E4HA 4S33A 2Y9QA 4L7FA 2X7OA 4GT5A 4D2PA 4A9UA 3R02A 5AUZA 4DCEA 2YLFA 4XBUA 4FEWA 3LLTA 4WBOA 1SMHA 2EVAA 3GU4A 3K5VA 5AAGA 5IEXA 4NM3A 1OM1A 4WG4A 3V6SA 5DT4A 4RVKA 2B7AA 4O0VA 2PVKA 2GS2A 4DFLA 5A4LA 5HE2A 3AC3A 3O7LB 3ZTXA 4RJ6A 4CFXA 4QMTA 3GU6A 5BNJA 3PIZA 4M7IA 3FMEA 4RX5A 4P5ZA 1E9HA 4I6FA 4ANSA 1WZYA 3PIXA 4FYNA 3UIUA 3QWKA 5CEQA 1IAJA 1H01A 3JVSA 2C6DA 1VYWA 3BHVA 3ODYX 3QTSA 4LG4A 1H1RA 4C34A 4ORKA 3CPBA 4YZDA 4EH7A 5LCJA 1XQZA 2VTSA 4EC9A 1WFCA 5AP3A 4JQ7A 3R2BA 3NW7A 2XKDA 3QQLA 4AW5A 3LKMA 5GZAA 1NT2A 2YISA 5A9UA 4I21A 5HNBA 2B53A 2FVDA 1K2PA 4YJQA 4ASXA 2WMAA 3R9HA 2IVTA 5BPYA 4ZJJA 1ZWSA 3E7OA 4PMTA 4CKRA 3WZKA 3ZFXA 4DGNA 3QQGA 4XV1A 3P9JA 2Q83A 4Y46A 3OWPA 1DAWA 4PL3A 3MDYA 4RPVA 3OMVA 1E1VA 3KF4A 3C9WA 5CXZA 1ZXEA 1ZZ2A 3I6UA 4FT3A 4KIOA 3CD3A 3FY0A 4CNHA 2HCKA 5I4NA 2PZ5A 3CKWA 2VTQA 3E8CA 3C4ZA 3L8SA 1BX6A 2QI8A 4LGHA 1GZNA 4AZSA 4E6DA 3EIDA 2Z02A 5A54A 1G3NA 3EMGA 3GCUA 5E92A 4R7BA 4YP8A 4YLLA 4IZ7A 4O81A 5I9VA 3W2PA 3W18A 4EYJA 3H10A 3QCXA 1JWHA 3FI2A 1YDSE 2XBAA 3NIEA 2BILB 2I1MA 4MF0A 4MXCA 5B7VA 3PPKA 5J9YA 4FNWA 5K0KA 3NRMA 4D4SA 1QCFA 2WQBA 2BUJA 3DNEA 3KKVA 3NNXA 4EZ5A 2WFYA 4FT9A 5CXHA 5A46A 4TRLA 3DJ6A 2GMXA 3VIDA 2CPKE 4IWDA 4O86A 1DM2A 2ZM4A 5E8WA 2C47A 3DGKA 3VWAA 4EH4A 4OTQA 3LFCA 3NR9A 4LL0A 4RC2A 4HVIA 3PZHA 3QA8A 4K6ZA 2F7ZE 4QTCA 4BRXA 1KSWA 1PXLA 5DG5A 1PF8A 3BLRA 4PP7A 3NUNA 4ITHA 3TV7A 2UZOA 4U43A 3JPVA 4X3FA 4FV7A 2CKPA 4X3FC 1I09A 4IAAA 4AT5A 3FL5A 2KTYA 3Q2JA 4MXYA 4FIJA 2ACXA 4V05A 3UOKA 3FDNA 2C5NA 4FSMA 5J1WA 4Q9SA 2V5QA 4HNIA 4MNFA 4PF4A 1M2RA 4IM3A 2QCSA 2XNGA 3BE9A 3E64A 3MH3A 3PA3A 3R21A 3FKNA 3F6XA 3G51A 3DLZA 4QP8A 5E91A 4HYIA 4XOZA 2W99B 2VNYA 1OMWA 2W17A 4IAIA 4GU6A 4V0GB 1NVSA 3ET7A 5CAPA 1ZRZA 4O0XA 3UVRA 3ZM4A 3CS9A 2R9SA 2RG5A 4C7TA 3Q6WA 4D1ZA 4JBOA 1LR4A 4NH1A 3HP2A 3TZ7A 5FTGA 4NIFB 5HNGA 2F2CB 3TNPC 2F7EE 4JQ8A 4Y72A 1UKIA 3NGAA 4KSQA 4DTBA 4J95A 2PVYA 2B0QA 2WU7A 3E87A 3R1YA 1WVWA 2C68A 5FXQA 4L9IA 3SRVA 4BCGA 2OF4A 1Q8TA 1OVEA 2XNNA 1Q61A 2C3JA 4FI1A 3Q96A 3MESA 3E3PA 3VULA 4U0IA 5EDQA 4EORA 5HO6A 3BELA 3IW7A 4QNYA 2VUWA 4RVLA 5M53A 4RX8A 3ROCA 3HV4A 3PXFA 2ITNA 5AADA 2PVHA 2C3KA 2YCRA 3R7EA 4I5CA 3KQ7A 4JJRA 3BHTA 4M0ZA 4IAZA 2YDIA 1KUTA 4O22A 4ARKA 3MN3A 4BIDA 2PUUA 3FLZA 1OL1A 5E9EA 2A27A 2XS0A 3QRIA 4FKRA 3ZBXA 5H8EA 3KN5A 3QTIA 1W7HA 2W5AA 5LQFA 3LW0A 5CANA 3OD6X 4FEVA 3DB8A 3C0IA 1L8TA 4G9RA 2V55A 1NVQA 2BIYA 2ZDUA 3Q6UA 2YWVA 4JIKA 2YERA 3L9NA 3V5QA 3ZLSA 3BRBA 2PULA 3A4OX 4X7QA 2XZSA 4MNEA 3UIXA 3DZQA 2WPAA 3GVUA 3RVGA 1XH5A 3FMMA 1YW2A 3VS2A 1HCLA 4O7YA 4C3RA 3A61A 5LOHA 4JNWA 1G5SA 4XG7A 4DEEA 3JUHA 4L45A 4BTMA 5JN2A 2RF9A 2WTKC 2A0CX 4X6QC 3V3VA 3SG8A 4U97A 1BMKA 4YJPA 4AUAA 3D5VA 5AEPA 5F95A 2OXXA 2QOCA 4BDEA 4EOQA 4IWPA 3PJ2A 2CGWA 5HCYA 1URCA 2VWBA 4BYIA 2GQRA 4GV1A 2OWBA 4A9YA 1CKJA 3BKBA 4O6LA 1YHVA 3E93A 4BKJA 4IBMA 5HI2A 3R2YA 4IH8A 4E93A 3LFSA 3LHJA 1OIUA 4PDSA 4XV3A 1VYZA 3FMLA 3C1XA 4J7BA 4JRVA 5CU0A 3K2LA 3BGZA 4JG6A 4L43A 4UEUA 4YJNA 2Z7SA 1T46A 4P4CA 5CTPA 4DGLC 4D28A 3VJOA 3ZUTA 5D10A 4D1SA 4BIBA 3BQRA 5FM2A 2I0EA 4DH8A 2EUFB 4H39A 3NIZA 3R7UA 4D4YA 4EZ3A 1IASA 4GK2A 3OTUA 4WRGA 1O9UA 5AMNA 2XRUA 4F08A 2W96B 1APME 3SVVA 1OL2A 4RIWB 3KCFA 1Y6AA 4IX6A 4RZWA 4XG8A 3UO6A 4HVGA 2QOLA 4L52A 2OLCA 3VS3A 4BI2A 4XX9A 5AP4A 4NL0A 3AMYA 3U54A 4DFUA 3OUNB 4BYJA 3QTZA 3PG1A 4AOTA 2GCDA 2VTOA 2X6EA 3AD6A 4CV9A 3H30A 3NUUA 4UMPA 3DA6A 5AA9A 5IDPA 4I3ZA 3I60A 1J3HA 4TW9A 3MSSA 5TO8A 2YZAA 3PJCA 4CD0A 4MBJA 4QRCA 4FL2A 2BRHA 3G9NA 4ZAUA 3MWUA 1V1KA 2JKOA 3DFAA 4EH6A 3OCTA 2OJFE 3NVMB 2EXEA 4RQKA 2Z60A 3FPMA 2CDZA 4RX9A 2ONLC 5C8MA 4IB0A 1XH4A 5K3YA 2JD5A 4BDKA 4YU2A 4C4IA 4NW5A 1PMEA 5JFWA 2J0MB 4DCAA 2WD1A 4OW8A 3NYXA 4I41A 3I6WA 5GIPE 4DT8A 4GG7A 3AD4A 3IPHA 2YCFA 1NY3A 4L01A 4PPCA 5ANEA 3IKAA 3VF8A 3WI6A 2PYWA 5KUPA 1QPDA 4PDYA 5D9HA 1UWJA 2W7XA 4OBQA 2WAJA 2VTJA 3FSFA 3VUTA 4OTDA 4ZS0A 3SW7A 2P2IA 2Y4IB 4GU9A 2IW6A 4NTSA 3EL8A 3KEXA 3NUAA 2F7XE 4FKVA 4RA5A 4RQVA 1R78A 5HBEA 4LOOA 2VTLA 3RZBA 2J9MA 3U9NA 3UIBA 4I4EA 4AGWA 4AZFA 2OKRA 3DJ7A 4TXCA 5B0XA 5HLWA 3OZ6A 5KZIA 3O96A 4UBAA 5DGZA 4E6QA 3R8MA 4AA5A 3QUPA 4JDKA 1OL6A 3KB7A 4I5HA 3WYYA 3WF5A 5HVYA 4FZAB 2NPQA 4ASEA 4XCUA 4LRKA 3G90X 2RKUA 2Z2WA 3IDBA 4QP9A 3UNZA 4CFUA 3EN6A 3KXGA 4GL9A 5EM8A 4B9DA 5KMMA 2VAGA 3MY1A 4FKTA 1JKTA 2QOQA 3CIKA 4LV8A 5L6WL 3H9OA 3VS0A 3BU3A 4FEUA 3VS1A 2PU8A 3BI6A 2ITPA 5LXMA 5M07A 2AC5A 4YTIA 3NYVA 4V01A 3FMJA 4I94A 3NMUF 3W2OA 4DFXE 5DNRA 3WZEA 1LEZA 3OHTA 4YJOA 2Y6MA 2IPXA 2R7IA 4DTAA 4G3GA 4F1OA 2UVZA 4FVQA 4I4FA 4GUEA 4IJ9A 1MRVA 5KBQA 3VBWA 2F57A 5D7VA 4C62A 3HV5A 3AT3A 3VVHA 4E5WA 4XLVA 4HCTA 2VTMA 5DFPA 2GS7A 4U3YA 4O7SA 3PJ1A 5EOBA 4N4SA 1OIQA 4LUEA 3SXRA 5BX0A 2JFLA 3LFDA 1QMZA 1X8BA 3RNIA 3ACJA 3WILA 2HZNA 3ZRMA 1YI6A 3CXWA 4AA4A 5HQ0A 5AJQA 2UZWE 4TYIA 3RI1A 3CD8A 2HW7A 5CAQA 5IUHA 4TL0A 4WT6A 3QC4A 3PY0A 4IE9A 2XVDA 1XBAA 1XR1A 2C5OA 3A8XA 4YC6A 2OW3A 4PMSA 3QD0A 4AG8A 5A6NA 3S2PA 3I7BA 3NAXA 3QALE 5FBOA 5AUUA 3AC1A 4FV4A 4XEYA 3TKUA 3BWJA 3VC4A 1H07A 2GPHA 3K3IA 4ANBA 4QYYA 4BCIA 4I92A 4AE6A 4BWXA 3R22A 4LV5A 2BDWA 3BHUA 4CFWA 4AN9A 2QU6A 3OUKA 3R9NA 4NFNA 3COKA 4QYGA 5IQDA 3BZ3A 2RFEA 4WHZA 4MCVA 2EU9A 3OF0A 4GJ2A 4IW0A 4NEUA 5E1EA 3P5KA 4F7JA 2OG8A 2YJRA 4ZZNA 4U79A 4BDGA 4FKPA 4BKZA 3FYJX 1A9UA 1H1PA 4I5PA 2XKFA 4OBPA 1ND4A 4APPA 3HMOA 2X8IA 4C58A 4E8AA 3FMNA 2J0JA 4R3CA 3PIYA 3OT8A 3A7FA 3ITZA 5D1JA 4DGOA 5EM7A 3EHAA 4D2RA 3WF9A 2QG7A 5DVRA 2XIYA 2VRXA 2O64A 4IMYA 5JZJA 3QRUA 1AQ1A 4CG8A 4NCTC 4RIYA 3DKCA 1YWNA 4Z3VA 2VX0A 4EK6A 2WXVA 3NUPA 2QODA 3I5NA 3MH0A 3HDMA 3PVWA 3F61A 3N51A 4TY1A 5CLPA 5DLSA 4O2ZA 2G1TA 3OXIA 1KE8A 2ETKA 3Q53A 4IVBA 5EDPA 2RFNA 1OBDA 4XMOA 3MFTA 1MRYA 4TWCA 4E3CA 2UW9A 4R7IA 4EONA 4HYSA 4FTTA 5EH0A 1DI8A 2WMXA 4X2KA 4EH2A 4KS7A 5CSPA 5LVOA 4BCNA 4C57A 4CG9A 2VWXA 3HRFA 1URWA 1YI3A 2YWPA 4AW2A 1BL6A 1OKWA 3G0FA 3T3VA 2Q0BA 3NYOA 2HZ4A 4ZLYA 1UA2A 4JT3A 1IA9A 2WTDA 3ORTA 2VX1A 3PSBA 5CF5A 4PWNA 5JFSA 2HY0A 3CLYA 2ERKA 3GENA 5DN3A 5KCVA 2C0IA 1S9JA 2OH0E 3PVBA 4PP9A 4AXAA 5HTBA 5AM6A 4XP3A 2X6DA 3ZDIA 3QQFA 2V0DA 4ZSGA 2F4JA 4S32A 2W5HA 4KBCA 2VZ6A 1TVOA 3NWWA 4RFYA 2W06A 5DEWA 4DA5A 5M56A 4QP7A 1M14A 3GU5A 1ZYDA 3LOKA 3QX2A 3NUXA 2C3IB 2YFXA 2XRWA 3BHHA 4H3BA 2JITA 3SOAA 2P4IA 3LCTA 4RRVA 3DLSA 2XJ2A 3EH9A 3MIAA 3HMMA 4DLJA 3QQJA 4EOLA 5LWNA 2JDTA 4RWLA 3QAME 4PY1A 4YJVA 4HVHA 3P08A 4FSTA 4IANA 3ENHA 4JBPA 4KIKB 4Y8DA 3GU8A 5CWZA 5M09A 2R3MA 4F9AA 2YABA 5DH3A 4USEA 3CCNA 4OTIA 2F9GA 4O83A 5EG3A 1JSUA 5IG1A 5IMXA 4FICA 2CKEA 2OXYA 3NZ0A 2ZOQA 1TKIA 2OO8X 3WZDA 2H8HA 4FTOA 5H8GA 3I81A 3CP9A 4KRCA 2ZM1A 5DBXA 4IXPA 2HELA 3QKMA 1LPUA 4YZBA 1SVGA 1JSTA 4FTAA 4FTNA 3VUMA 3LIJA 4PTCA 3QUEA 4MXXA 3VW6A 4D2SA 4JDIA 3R9DA 2C6LA 4DH3A 4IFCA 2CHLA 2WIPA 3V8SA 3GCVA 3ERKA 3LMGA 4W4WA 4A4LA 2YAAA 2YCSA 3O8UA 3W2CA 4G16A 4C61A 2B4SB 3DPKA 3AG9A 4PDOA 3ZEPA 5L6OA 4E73A 1WMKA 4Y73A 4M14A 4MQ2A 5GZ8A 5F4NA 4M3QA 4C38A 3GGFA 3FKLA 1KE7A 2R0UA 4MBLA 4ZTHA 4M12A 4BWKA 1EH4A 5HCZA 4BGGA 2PMNX 2W0JA 4W9XA 3QGWA 5J9LA 2WQNA 2VTAA 4RT7A 4O6EA 2W1CA 4FUXA 2BAKA 1SVEA 1PKDA 1ZY4A 3LFEA 5DR2A 3WBLA 3BEAA 2BKZA 1P5EA 4LL5A 4BDDA 3AT2A 2QVSE 4K0YA 5DPVA 5EHYA 4DG3E 5HLNA 1OIYA 4FKOA 5KMKA 2BFYA 3PYYA 4M97A 3VS7A 3KXNA 4F63A 5G6VA 1B39A 3QRTA 4EH8A 3CR0A 4FKLA 4EQCA 4RJ7A 5HEZA 2PTKA 1ERKA 4CMUA 2VTNA 5J79A 2GFSA 2C30A 4A9RA 3R73A 2ETMA 3F69A 3W16A 2ITUA 4ANMA 4IQ6A 4ZJIA 4JIAA 4M69A 5DRDA 1BUHA 3QTRA 3U8WA 3UBDA 5HKMA 4AACA 3UPZA 4FZ6A 2PHKA 3WOWA 5IQIA 1YKRA 4G2FA 3VUHA 4O0SA 4YTHA 2ZV2A 3DAEA 3I79A 3KRWA 5CENA 2YDJA 3DBFA 4FVPA 3C4XA 4R77A 4QNAA 2HWOA 4KBAA 3L8VA 4ID7A 3TV4A 3E8DA 1YQJA 5BYZA 2X4ZA 4UY9A 3TTIA 4AZWA 2VN9A 1Q99A 4ZLOA 4EBVA 2OF2A 1CTPE 4R5SA 2OZAB 5ACBC 3ZSIA 2BRMA 3FZOA 1ZYLA 4IEBA 3F66A 1Q3DA 3M1SA 3FQSA 3R28A 3QFVA 3D94A 3C5UA 3DBQA 3E8EA 4EK3A 2FB8A 4AAAA 4IC8A 4F65A 4F6SA 3EN5A 4Y95A 4OT5A 5DHJA 2B9HA 3U4UA 1U5QA 3EFLA 4C4FA 3FLSA 4LOPA 3AC5A 4KIPA 1P4OA 4FV0A 2OJGA 1PRYA 4AE9A 4FSRA 1U46A 3E92A 4TPTA 4CZTA 2OJJA 3Q9XA 3QU0A 4Q5EA 4YHTA 4W8DA 1XWSA 5K9IA 5EHOA 2IZRA 3R8VA 4AZTA 5I0BA 3MI9A 3R04A 5EM5A 3E63A 3NNVA 4U41A 5IUGA 3IDCA 2PVFA 4I5MA 3FE3A 3VS4A 4L3PA 1ZY5A 5ANIA 3PXRA 1UNGA 3OY1A 5FG8A 2UUEA 2J4ZA 4EOOA 1YRPA 5AV0A 3K3JA 2CNUA 1H4LA 3ZS5A 5CI6A 5ETAA 3NCGA 3MA6A 3N4TA 4M66A 4QMMA 4G6OA 2X9FA 4TNBA 4F9BA 2WQEA 2WTKB 5IQCA 1ZMVA 3EB0A 2BHEA 3C4EA 4EOJA 4LUDA 1MP8A 1ZMWA 3O51A 4EC8A 4K18A 4OTRA 4M0YA 3FI4A 3GBZA 5IISA 4RG0A 2XF0A 3QZGA 4EHVA 3IOPA 3EN7A 3EZVA 5JMSA 3PFQA 3KMUA 1OZ1A 4UYNA 3ZZWA 2X2LA 5I9ZA 3HP5A 5LCKA 4QMQA 3RJCA 5TE0A 2A2AA 1XKKA 5JSMA 2BCJA 3NSZA 4JS8A 5HIBA 5EFQA 5HBJA 3GCPA 4IWQA 2YM4A 1PXOA 4GUBA 1UU7A 3A2CA 4G3EA 1UV5A 5JGAA 2X9EA 2C1BA 3QGYA 3VO3A 2UW0A 4DH1A 2EB3A 5AP2A 3KMMA 4GYIA 2O8YA 3VBTA 4LGGA 5K5XA 5M06A 4KRDA 5K4JA 3KRRA 4TWOA 3S00A 3QF9A 3TDWA 3UO4A 2XK6A 2ZV9A 4FTMA 3BHYA 1PHKA 3HAMA 3F5UA 3VW8A 3DXPA 1Q97A 2HZ0A 3DAKA 2W4JA 3SOCA 3QQHA 4YUQA 5KNJA 4RJ3A 2FUMA 2UW4A 1FGKA 3F82A 4BTJA 3WF7A 4BBFA 4JG8A 4BZDA 4M15A 3QRJA 4MXZA 2WIHA 4MD8E 3R8PA 3NNUA 2J0KA 4BI1A 2WMVA 3NEWA 3VBVA 3GFWA 5FTQA 3ORKA 3OWKA 5TF9A 3W55A 5IU2A 4YZCA 3TACA 2XP2A 3BYSA 3EYHA 3RMFA 5JFXA 2VU3A 3D5WA 3HUCA 3ZO4A 5AR8A 4C59A 3EFWA 4O84A 4GIIA 3GOKA 5CAUA 1PMNA 3D7TA 1Q8UA 3MB7A 4YPDA 3MB6A 5ANJA 3LZBA 2UZVA 5EW8A 5AP5A 3DBCA 1SNUA 4TYHB 2EB2A 4RJ4A 2H6DA 2PSQA 3IDPA 2WQOA 3TEIA 3SHEA 4FT5A 4YLKA 4GVAA 3Q3BA 2VO3A 4CZUA 4KKEA 4D1XA 4FTCA 4BFMA 2J90A 5CSXA 5GIOE 2GNLA 4C4GA 4F0GA 3JY9A 3ZU7A 2CLQA 4N0SA 1J91A 3T8OA 4CQGA 5M51A 3RPVA 2R3OA 3FXXA 4R3PA 4WBBB 4R1YA 5CVGA 1QPJA 1OL7A 3G5DA 3OBGA 1U4DA 4D2VA 5TOZA 3QZIA 2EWAA 2VWIA 3EQFA 3G33A 2UW3A 5HHWA 4BZNA 4OAVB 2BMCA 2QQ7A 1IEPA 4MWIA 3UG1A 4X6RA 5HNIX 2ZMDA 2YIRA 1ZMUA 2QO9A 3M11A 4GMYA 1GJOA 2ZB1A 3KC3A 4XG2A 5AP0A 3BIZA 3KN6A 3VQHA 4EWHA 4XLIA 5HE0A 4UMRA 1YDTE 2UVYA 5BVWA 3D83A 3ZLWA 5KO1A 3IECA 2UW6A 2ITYA 4FF8A 1KV1A 4O91A 2PVNA 2R5TA 4LRJA 4O96A 3HECA 1WBVA 4S30A 2C4GA 3E5AA 5KKRC 2Q0NA 3NUYA 2XH5A 4CFNA 3R7VA 3W33A 2I0VA 3U55A 4DE4A 2VWUA 4O7VA 1Q8YA 2W05A 3EQBA 2QNJA 2X4FA 3Q5IA 3ULIA 1LP4A 4BR3A 5BUEA 1BLXA 1H27A 4YBKA 1SNXA 2XYUA 3UMXA 4F64A 1T45A 4X2GA 3RPYA 5FXSA 4ZSLA 4BC6A 4BTFA 1VR2A 2PZRA 4O82A 1IAHA 3DXQA 3JYAA 5CY3A 4XUFA 3RCDA 2GQSA 2OI4X 3MGYA 4ZZMA 2VTIA 4ASZA 5BVOA 5EOLA 5I3RA 2PVLA 2R64A 4L53A 4I22A 4AX8A 2QOKA 4KAOA 2HOGA 4UMQA 5J9ZA 4NFMA 4YC8A 1JNKA 3GQLA 3RAWA 2BZIB 4WA9A 5L6PA 4FKUA 2QLUA 4FV5A 4PMPA 5AR2A 1WBPA 3MYGA 4ACCA 3QCYA 3KVWA 4MF1A 3C7QA 5L8JA 5DYJA 1A06A 3WF8A 5EQYA 4TN6A 4NKAA 2XUUA 5F94A 3SC1A 3WZJA 2BROA 4O7WA 5KMLA 3DBDA 2WMBA 4Q5HA 1OUYA 3H9RA 1BKXA 2ITTA 4FSNA 2H34A 4DGMA 4CV8A 5HG8A 3QKLA 5AR3A 2B9FA 3HLLA 1YXTA 5KMIA 3MVHA 5DWRA 3L9LA 1WBOA 5A4CA 4UZHA 2X1NA 4GS6A 1RQQA 2HYYA 2QU5A 2WTVA 4TNDA 4E1ZA 3AMBA 2EXMA 3OCBA 3EJ1A 4HCVA 4QYHA 5BMMA 4BVUA 3KK9A 3GC9A 1SVHA 4J8MA 4QMNA 3HZTA 3TT0A 3C13A 3MTLA 5CZHA 1G8SA 5T3QA 4S31A 1WBTA 4YTFA 2UZEA 5CF4A 3BV3A 3DK6A 4LOQA 4CFMA 4FG8A 4UYAA 3GI3A 3EWHA 3TCPA 2XK4A 5FP6A 1FVVA 4OTHA 2GS6A 1WCCA 2J5FA 1GIIA 1CDKA 2R3IA 4XP0A 5LWMA 3U6JA 1V0OA 4BZOA 5D12A 5CASA 3MPMA 4X21A 2W1IA 5BVKA 5JFVA 3V6RA 4CKJA 1U54B 4RVMA 4FTKA 2YIQA 2G15A 2VGOA 1JQHA 2XK8A 5AV3A 3UGCA 4E4XA 4EL9A 5M4UA 2W4OA 3EN4A 2JEDA 3ZRKA 4XG6A 3TL8A 1ATPE 1ZZLA 3ZH8A 4ZTQA 3PLSA 3WF6A 5JT2A 3L9MA 4UXLA 3W8QA 1JVPP 2PVJA 3HV3A 4FZDB 4PX6A 4YHJA 1XH9A 5D41A 4RIXA 5AP1A 3WIKA 5CSWA 1FMOE 3QL8A 4M68A 4P2KA 4YZNA 5CEKA 3SGCA 4GK3A 3CQEA 4XRLA 2UW8A 4BWPA 3U6IA 4L6QA 5BVEA 2ERZE 4YZ9A 4KA3A 3W2SA 2JDSA 2WEIA 3LVPA 1KV2A 4IVCA 2GNHA 4UV0A 1MRUA 2GU8A 2W1EA 4ZP5A 3KVXA 4KKGA 4MWHA 3LCOA 3JXWA 3IGOA 4RX7A 1YXUA 4BDFA 4KBKA 2WMTA 1AD5A 2O0UA 4FSUA 3JS2A 3S1HA 3UQGA 3DNDA 3FC2A 4FR4A 5GNKA 2CMWA 2DYLA 4XV2A 1PXKA 5HTIA 3PTGA 2YM5A 3RAHA 3MH2A 3RHXA 4DBXA 4PPBA 4I1ZA 5KHXA 1PYXA 4JLCA 2NP8A 4HW7A 1ZOHA 3ZC6A 4EH3A 3GC0A 3BLHA 1K9AA 3G6GA 2CCIA 3ZHPC 4D4VA 2NRUA 4DITA 4HGEA 3SLSA 3UVPA 3KCKA 1H0VA 3DV3A 4CMOA 3O7LD 4M67A 4XS2A 3G0EA 3FZSA 4X0MA 4LI5A 5DE2A 4YHFA 4XG9A 3FLWA 5EW3A 5KE0A 4TKSA 4EQMA 5IUIA 1MUOA 1YVJA 5LARA 1OGUA 1XHAA 3B2WA 5CYIA 4Z16A 4MQ1A 2Y6OA 2P3GX 4HGSA 3ZC5A 3VNTA 3MBLA 1SM2A 3DK7A 3OT3A 3LFBA 1JSVA 3M2WA 4HCUA 4IVDA 3UE4A 4AWIA 5BYYA 3MVLA 3REPA 1XH8A 5FDPA 5F1ZA 3TIZA 3V8WA 5EYCA 3FYKX 4TT7A 5ETFA 2UV2A 4PL5A 5AWMA 3TTJA 3ZO2A 4EI4A 3SDJA 5AFVA 2XEZA 3ZM9A 4UB7A 2PUIA 4IB5A 4JQEA 3ELJA 3O71A 3VRYA 5JH6A 1OECA 3S3IA 1FBNA 4FEXA 3D2IA 1XBCA 4D2WA 4ZTNA 3E7VA 2C3LA 2W5BA 3NLBA 2OJIA 3PWDA 3KULB 4GT4A 4RIOA 2JKMA 4FGBA 3HA8A 2DQ7X 2J5EA 4X2FA 4HVDA 3RK7A 1LEWA 4UZDA 4XRJA 3CTHA 1H24A 3O17A 4BCQA 2WTWA 3ORLA 4IAFA 1FMKA 4KKHA 3RM7A 1YOLA 3PJ3A 3PZEA 5AAEA 2PMIA 4D55A 3HUBA 1PKGA 3PRFA 4U80A 5IQGA 3RCJA 1S9IA 1H0WA 2QR8A 3I0QA 5EYKA 3FEGA 3O0GA 3QD3A 5KMNA 4IAYA 4K9YA 4G3CA 4H1JA 4ITIA 4MYGA 4XP2A 3KRJA 4FK6A 4FKJA 3U51A 1W83A 2YM8A 4GSBA 4LGDA 5CAVA 4DG2E 4WNPA 3VS5A 3L1SA 5CAOA 2R3GA 4F0FA 4YJTA 5DR9A 3MW1A 4HYHA 2BAQA 3TJDA 2HK5A 5CNOA 4AU8A 5J1VA 2ESMA 4UX9A 1GZOA 3LE6A 4EHGA 3UG2A 5M4FA 4BCFA 1Q3WA 5HX8A 4JR7A 4GYGA 2J0IA 4BHZA 3A7IA 4LFIA 4CT2A 4JXFA 5AP7A 5BVNA 2CGUA 4AA0A 4IVAA 3VBYA 2C0OA 4GT3A 4D5HA 1OPLA 2GTNA 2G9XA 3B8RA 5EK7A 4DEIA 4DTKA 3VF9A 3V8TA 2IO6A 2IW8A 3HKOA 4BB4A 2PE2A 2XIXA 1YXXA 5AIRA 4EOMA 2IJMA 3Q4ZA 3BYMA 2HIWA 4R6VA 4YR8A 2CLXA 4FX3A 1WVYA 4QD6A 2UVXA 1REJA 5CSVA 2CGVA 2PK9A 3R1NA 4QMXA 1UNHA 1WBWA 3Q32A 4FNYA 3D5XA 3CJGA 2OSCA 4L67A 2C6IA 3SW4A 3R1SA 5H3QA 4L3LA 4B99A 4DFZE 3MPAA 5EKOA 2B1PA 4FTJA 1W84A 2ZMCA 1OIRA 1ZAOA 4JAJA 3N4UA 3PVUA 5L8KA 3JY0A 2VO6A 4IM0A 1E1XA 1OPKA 3ZXTA 3ZBFA 4IX5A 4YJRA 1O6KA 2V7AA 1TQPA 3JR1A 3IW6A 4U8ZA 5L2QA 1FOTA 4F09A 4V0GA 5HU3A 2YN8A 5AX3A 1UU8A 3PWYA 4AS0A 4R78A 3MH1A 3FXZA 3TNIA 4QTDA 4OUCA 3DTWA 1H08A 4NIFA 4QP3A 2XYNA 4U6RA 1JKKA 3UOLA 4FKSA 3D14A 2W1HA 3OCGA 3FJQE 4WIHA 4ZXTA 3WIGA 1PMVA 5LVLA 4YMJA 5L2TA 2ITVA 4C0TA 4B0GA 3COMA 4WUAA 4U9AA 3PPJA 4DC2A 3DBEA 4D9UA 4BL1A 4J52A 4GCJA 4QMYA 5J87A 2QHNA 3DKFA 4RZVA 3FMKA 3CEKA 3FQHA 1ZOGA 3NCZA 4MD7E 3KRLA 3RM6A 2IN6A 5FLFA 3NX8A 3DB6A 4FSZA 4WG5A 5CEPA 4C4JA 1PXNA 2GNGA 3UYSA 2UW7A 1OBGA 3UOHA 3F2NA 4ZY5A 2VTHA 3FWQA 4AW1A 4I20A 4JOAA 3UDBA 3BYOA 4UWCA 4QO9A 5E8ZA 3ZUUA 4C2WA 3OCSA 1Y6BA 4FV2A 4FNXA 4C3PA 3TUCA 3U4WA 3DK3A 3PVGA 4F6WA 3RNYA 5HX6A 3RK5A 3KL8A 3II5A 4XJ0A 2C0TA 3D0EA 4ERWA 3ORNA 4X2NA 3QTWA 3U9CA 4KUJA 5AV4A 2PY3A 3MFUA 5D7AA 4USFA 2YZLA 4CFFA 2W1GA 2OZOA 2WMRA 4QYEA 2VWYA 1CKIA 2QO2A 3BU6A 4O0WA 2R3NA 3T3UA 3FC1X 1Z5MA 3B8QA 3BWFA 5J7BA 4EJ7A 3QCQA 3GCSA 1IG1A 3D2KA 1YDRE 3WE4A 4EOSA 4I6BA 3CPCA 5IZFA 3FZ1A 4MTAA 3KK8A 4WO5A 5HBHA 4Z55A 5M44A 4OAUC 4JDHA 3OEZA 2VV9A 2QKWB 5ANGA 4Z9LA 5EI8A 1NA7A 2XK9A 4N57A 4BDJA 5EI6A 4ZY6A 4RBLA 3BBWA 5HO8A 3DOGA 4KNBA 5EQEA 4YTCA 3CQWA 4FTIA 5E7RA 3HMIA 2JFMA 4FUYA 4JX7A 3RPSA 1XJDA 4LYNA 3PSCA 4J97A 4NUSA 4W9WA 4N6ZA 4XYFA 3UP7A 4AFJA 5IH5A 2C1AA 2BRGA 4OTPA 3F3UA 2YIWA 2WEVA 3VRZA 3OBJA 2YIYA 4E6CA 4QQTA 2E9PA 4H05A 4I24A 4KWPA 4HPTE 4K2RA 4DFYA 2WMUA 1R39A 3UMWA 4AQCA 4C02A 4AZEA 2HXLA 4Y5QA 1GAGA 4EUTA 3MFRA 4TWNA 5IA4A 1ZYSA 3OTVA 4RIWA 4E4MA 5I9YA 5F20A 3MPTA 3E8NA 2YHVA 3R0TA 2KULA 3GUBA 4KD1A 4FV9A 1H00A 4PQNA 3OFMA 5HIEA 1MQ4A 5BVFA 5I9WA 4EOIA 3TNHA 1F3MC 4BICA 2GHGA 2RGPA 4FIFA 3EZRA 3EL7A 2OGVA 2V7OA 3PPZA 5K0XA 2WMQA 3V5WA 4O7RA 2UZBA 2BTRA 3F7ZA 1KOBA 3HYHA 5H8BA 2PWLA 4C3FA 3BQCA 4CYJA 2IVSA 5JRSA 4K1BA 4ALVA 3G2FA 3LMHA 4FKQA 3L8XA 4NJDA 2XM8A 1CMKE 5IA2A 3MVMA 3SXFA 4CCBA 2OICA 3UNKA 2FSLX 3IG7A 5KKRB 4X2JA 1YHWA 5HICA 5IPJA 3HAVA 3BYVA 3ORMA 2BRBA 4RJ5A 4C36A 3TNQB 3IK3A 3QRKA 2PE0A 4EK8A 2XNMA 2XNOA 5ANKA 4BBMA 1J1BA 5IA1A 5KBRA 5ACKA 3RPOA 3R30A 4WKQA 2Y7JA 2P33A 4QP1A 3A4PA 4X3FB 4AGUA 3A99A 5J95A 4EOKA 2XNPA 5LMKA 3NAYA 3RBWA 5BYLA 4ANLA 3KXHA 1GOLA 5C01A 5B2KA 4UN0C 4FTQA 3MY0A 4FODA 4YZMA 3CTJA 4NM7A 2RFSA 3UJGA 4CTCA 2CSNA 3IQ7A 2Y4IC 3QUDA 3U87A 4FEQA 2Y8OA 2ZAZA 3EQRA 5CVHA 4TTHB 2Z7QA 1JKSA 1Y91A 2R3FA 2XB7A 4O1OA 3D7ZA 1H1WA 3UYTA 4WD5A 4EK4A 3A7GA 1U59A 1R0EA 2P55A 3P4KA 5BUIA 4F9YA 2XKEA 3UQFA 3SX9A 4FZFB 4U3ZA 4A7CA 3F2RA 5J5TA 4ZOGA 3FLYA 4D4RA 4HJOA 2AUHA 4FYOA 4HOKA 5HGIA 4CXAA 5DT3A 1O6LA 4D2TA 3CGOA 4FV1A 4CFVA 3ATSA 2FA2A 3QX4A 3BE2A 2GQGA 3SRVB 1BI7A 5AUXA 5IF1A 5E8SA 5L2WA 2QOOA 3EKKA 3Q4TA 4WUNA 5AUVA 2CNQA 2VWZA 2X7FA 3FI3A 2ZV8A 5IQBA 5CS6A 3V51A 2ZB0A 3GU7A 4J53A 2WTJA 4IACA 3IS5A 4BDCA 1STCE 5EM6A 4QQ5A 4G5PA 1FGIA 4QYFA 3AC8A 2A1AB 4ZTLA 5KX8A 4UMTA 4CEGA 3JVRA 5IEVA 3NPCA 4TYGA 1W82A 2WU6A 4BHNA 3A62A 3VJNA 5A6OA 3GNIB 2LAVA 4D0XA 4GJ3A 2JGZA 5DMZA 5AX9A 3W1FA 3ANQA 3ZFYA 3HRBA 2PUNA 4BDIA 5K5NA 5AR4A 3F7WA 3TN8A 3EYGA 4ZMEA 4PNIA 1HOWA 1HCKA 2FO0A 4EH9A 4MNEB 4S2ZA 4IHPA 2XBJA 2YACA 4F7SA 4ZLZA 2PE1A 3MJ1A 4FV3A 2J50A 5I5ZA 3LCKA 3AGMA 3HDNA 4RLKA 3PE1A 1DS5A 2QD9A 3ZFMA 5IEYA 4GEOA 2B9IA 5DRBA 4I0RA 5HESA 3F3TA 5HG5A 3TJCA 4OTGA 4X3JA 5FD2A 2B9JA 2ITWA 4YURA 2CKOA 4O0RA 3DAJA 3ZDUA 3DT1A 1PY5A 2BZHB 2XIRA 4XHKB 3ROYA 4EQUA 4U7ZA 4W4YA 3ZOSA 3LXPA 1XO2B 2QLQA 5E8XA 1L3RE 4L7SA 3SG9A 4O21A 4KSPA 5E1SA 2BFXA 3DY7A 3KXMA 1H25A 4FTRA 4FE2A 4L42A 4ZTMA 4EH5A 3FV8A 3ETAA 2QHMA 4A07A 4O0TA 4E20A 3AQVA 3OC1A 4O2PA 4F99A 3G15A 2O2UA 2OH4A 4MHAA 4FIEA 1PXIA 2ITXA 2R3QA 3C4WA 4U40A 5C9CA 4B8LA 4BN1A 3OG7A 3LM0A 3HA6A 2WO6A 3C0HA 3QBNA 5IKWA 3ZUVA 4MEDA 4O7NA 3U6HA 3OW4A 3FZTA 1KOAA 4DH5A 3T9TA 5I9XA 5CI7A 1XH6A 5EW9A 1PXPA 5C03A 4FSYA 4QT1A 2BHHA 1JKLA 2O63A 4GIHA 1ZARA 3F5PA 3TZMA 4BDAA 3AMAA 3S4QA 2UZNA 3VUIA 3C4CA 4FV8A 3UP2A 4BIEA 4OTWA 5A4EA 4CT1A 3UOJA 4KB8A 5BQ0A 4I0TA 2UZUE 4APCA 1FVRA 4ZZOA 2X0GA 1YWRA 4M8TA 4PL4A 3TUDA 4E5BA 4ZK5A 5M4CA 1OPJA 3QHWA 1KE6A 3RHKA 2I6LA 3VUGA 3HRCA 1YOMA 3H0YA 2X81A 3NNWA 4PNKA 5CF8A 3LFFA 4MH7A 3AT4A 3V5PA 4Z7GA 3VUDA 4ONAA 3EQGA 4G3FA 2J7TA 3F5XA 2FSOX 3LXKA 4JVGA 5FM3A 3R1QA 2A4LA 3W10A 2XK7A 2R3HA 1GIHA 2G2FA 1ZYJA 2QURA 4WG3A 5I3OA 3VBQA 4QP6A 4UMUA 5JGDA 5H9BA 4MKCA 4QOXA 1GNGA 2UZTA 4GFMA 4Q2AA 5HD4A 4MVFA 5DA3A 3WARA 5JK3A 5FP5A 2GSFA 4CGAA 5L3AA 1NXKA 4QMLA 3IO7A 4FL1A 2BKKA 4EK5A 2QOIA 2RG6A 3F88A 3KMWA 5AR7A 4O27B 3I7CA 3QYZA 2YCQA 3KGAA 2HXQA 3R6XA 2BALA 4ALWA 4PTGA 4EOPA 1BYGA 1Q24A 3C0GA 3Q04A 4J71A 3F5GA 5BUJA 4KIKA 4USDA 3DFCB 4FA2A 3FPQA 1KWPA 4U81A 4FTLA 4A4OA 2F49A 3LJ2A 5FUTA 4G6NA 5JKGA 4NM0A 1Q62A 4ZTRA 3LQ8A 5GZ9A 3FI8A 4WNMA 3W2QA 2UZDA 3KFAA 3E3BX 3PP0A 4KABA 4BDBA 2QC6A 4U45A 4B4LA 4CRLA 5JQ8A 2OXDA 3HV7A 3F3ZA 2R3JA 3ZLYA 4P90A 4QMSA 4RWIA 2JLDA 1RE8A 3SXSA 4BKYA 3POOA 4G9CA 4N6YA 3V01A 3BLQA 4I6HA 1QL6A 3OEFX 2QOBA 2WMWA 4FL3A 3LJ1A 5C26A 5IH4A 3GB2A 4NK9A 3KXZA 2BR1A 4H58A 3TNWA 3BGPA 3VUKA 4C2VA 4NW6A 2J51A 4DHFA 5EQPA 4ENYA 2V22A 2YM3A 5DR6A 1IRKA 4UWYA 2OFUA 4YBJA 1VJYA 5FEDA 2XIZA 4C33A 5ICPA 3S0OA 4FSWA 4FSQA 2F2UA 4AZVA 5E90A 4CTBA 3DTCA 2BPMA 2BZKB 3LFQA 2CNVA 4GH2A 2CJMA 4XH6A 2R2PA 1KE5A 3UZRA 1Q41A 2XKCA 3D4QA 4R5YA 3SQQA 5DI1A 4C35A 2XK3A 3C5IA 3RINA 3Q4CA 4FG9A 2HWPA 3OXZA 3VAPA 4F7NA 2ZDTA 3DS6A 3PJ8A 2IWIA 3BGQA 1UU9A 2AC3A 3KA0A 4TYEA 3WZUA 4XOYA 3A7JA 3OROA 1YHSA 4K33A 4W4XA 3PDTA 3QTQA 3N9XA 3PXKA 3BX5A 4NM5A 4DFNA 3POZA 5AUWA 1PYEA 1WBSA 2YIXA 3G6HA 4H3QA 4LM5A 2PPQA 1VEBA 3S95A 4CYIA 2B52A 4QTBA 3AXWA 4TYJA 5FEEA 1OB3A 1M52A 2OIQA 2C6KA 3HMPA 4QP4A 4ERKA
chains in the Genus database with same CATH superfamily
2E2BA 2CKQA 3RPRA 5GJGA 4H1MA 3QWJA 2IVVA 4JR3A 4PDPA 3A7HA 4G17A 4QMWA 1OL5A 3V04A 4EHEA 2GHLA 4R8QA 3ID6C 2R3KA 2RSVA 4BJJB 1OI9A 4FIGA 4EUUA 5A4TA 5AR5A 3P86A 2PZYA 4RLLA 2G2HA 2J6MA 4DEGA 3QLFA 1SZMA 3EQPA 4P5QA 4BCKA 1WVXA 4Z7HA 1RW8A 5FEQA 5L8LA 2OZAA 5J7HA 5J5SA 4RIYB 4E6AA 3TYKA 4OLIA 3ULZA 4F7LA 3H4JA 2ZM3A 1Q4LA 3DKGA 1J7UA 4O38A 1OKZA 5AV1A 2P2HA 2Z7LA 3HL7A 4LQMA 2ZV7A 2PVMA 1W8CA 3Q9YA 1PXMA 3FZPA 3ZO3A 4GRBA 3TM0A 2OFVA 4AOJA 1MQBA 4KS8A 4YJSA 4HZRA 3ACKA 4F1TA 3K54A 4ASDA 4JDJA 4D0WA 3GC8A 3ODZX 3C4FA 2YA9A 3TKHA 4XG4A 1K3AA 1J7IA 4BY9E 2XMYA 3RKBA 3BCEA 3BYUA 5AUTA 4RFMA 5ETIA 3K5UA 2GNIA 2XCHA 3KIOC 1JLUE 4F0IA 5ANOA 3OW3A 5HVJA 3OVVA 3ALNA 4W8EA 2E9OA 2QONA 3FAAA 3LQ5A 3HMNA 3O50A 4WRSA 3DDQA 3ORIA 4FV6A 3ZSGA 4IADA 4C37A 5HVKA 5G1XA 3H0ZA 4CCUA 4A4XA 2X7GA 4XNEA 4NWMA 5DEYA 3TIYA 3CSVA 3NDMA 4HGLA 4MX9A 4QPMA 2W1ZA 3QYWA 4AGDA 5IH6A 4RGJA 3IONA 2W1FA 4IB3A 2B55A 2OIBA 4BTKA 3SKCA 3O8TA 3I0OA 3PLAE 4F9CA 3CGFA 5CNNA 1J1CA 4IDTA 3KREA 3LXNA 4RVTA 4E4NA 2OU7A 3Q9WA 4QPSA 4YSMA 2O65A 4HGTA 4IWOA 4CVAA 1P14A 3F3VA 5KMJA 2NNWB 2XCKA 4QMUA 2GFCA 1Z9XA 2PMOX 3R7GA 5C4LA 4FKWA 2OIDA 2E9VA 1PXJA 5CQWA 5HG7A 3VQUA 1OKYA 4O1PA 2FSMX 1JPAA 1B38A 3PUPA 3FL4A 4YJUA 4UWBA 5ETCA 5CF6A 3DKOA 3AC4A 4QMPA 4W4VA 3TXOA 2PL0A 2C6MA 4ZSAA 1NW1A 2JDVA 2V62A 4AXCA 4YC3A 1Q8ZA 2QO7A 4M13A 5KHWA 3DZOA 3NW5A 3GC7A 5H2UA 4B7TA 4GKHA 4YPSA 4G34A 3V5LA 5CEIA 3MTFA 4QMZA 3CQUA 3FLQA 2C6TA 3P7AA 3CY2A 5HZNA 1Y8GA 3R00A 3LFNA 4BBEA 4AOIA 5LVNA 4PPAA 3R8ZA 2WOUA 3LPBA 5FWKK 3W32A 5GJDA 2WMSA 1OUKA 3EFJA 4R7HA 4ACMA 4BF2A 3CJFA 3Q52A 3Q9ZA 4FIHA 3R7YA 4I93A 4AP7A 5HOAA 3Q5ZA 2WOTA 4HPUE 3R8LA 2I0YA 2JDRA 5AUYA 2HY81 5TT7A 4FKGA 5EYDA 3MIYA 4ZMFA 4GW8A 4LMNA 1KE9A 2VD5A 4IZ5A 3IOKA 4ACDA 3HGKA 2RL5A 3FQEA 4UALA 4UXQA 4Y5HA 5CQUA 4ZEGA 3KY2A 3SAYA 4LRMA 2JC6A 3GEQA 5KZ0A 1Q5KA 2ONLA 3MVJA 4HVSA 5C1QB 3KRXA 3RK9A 3TDVA 2WB8A 2EXCX 2PZIA 2UZLA 1ZYCA 4FT0A 2QKRA 4PTEA 2G01A 3ALOA 4NJ3A 1H28A 2BZJA 1Y57A 1JBPE 3ANRA 3PXYA 5T68A 1OGYA 2XA4A 4JBQA 1FQ1B 3LXLA 1M2QA 1M7NA 4GFGA 5HE1A 4EBWA 3C51A 2WELA 2JKKA 4L8MA 3RAKA 2YLEA 5IMEA 1PW2A 3IW5A 4TYHA 5FBNC 1H1SA 1GY3A 3RWPA 4L68A 1A48A 1VZOA 5AM7A 2YM7A 2W9ZB 4NKSA 4WNKA 3O23A 4KIQA 1UKHA 4RC3A 2VNWA 4M69B 4CMTA 4DEHA 5ITAA 4CLIA 4BCHA 1TQMA 1WBNA 4HNFA 4HZSA 4DN5A 3QC9A 4OTFA 4PV0A 2PMLX 4J99A 4CQEA 3H3CA 2A19B 4OBOA 4ZJVA 2CGXA 3ZRLA 3MY5A 5CU3A 3P78A 1IR3A 4ZSJA 4D5KA 2XNEA 5C4KA 2PVRA 4R3RA 4ALUA 5HLPA 4IJPA 2I7QA 2ITOA 2WTCA 3M42A 3PP1A 4DEBA 4E4LA 4BDHA 4NYEA 3R71A 3UTOA 3PA4A 2VTRA 5HG9A 3DDPA 1NVRA 4MD9E 3TZ8A 2I0HA 3CC6A 3IW8A 4CSVA 4FBXA 3ORZA 4IM2A 4O4DA 3UVQA 3V5TA 3ZSHA 5KMOA 2GHMA 3AD5A 2UW5A 2VX3A 4FMQA 2DUVA 4BGHA 4CLJA 3KF7A 5E8UA 3FHRA 4RMZA 3V5JA 4II5A 3R83A 5T6KA 1F5QA 4I6QA 5EHLA 3UO5A 3SD0A 5LVPA 3R9RA 4EKKA 3EN9A 1V0PA 4IX4A 4MK0A 2E9UA 4I23A 4K11A 3TWJA 3EKNA 5A4QA 3CY3A 2P0CA 1PJKA 2JIUA 2VO0A 3LAUA 5BMSA 1LUFA 4YGAA 3LMIA 3MA3A 3H9FA 1B6CB 2ZYBA 2C6EA 3GXLA 3QD4A 4U42A 3ATTA 2R3PA 3NUSA 3ZEWA 5LMBA 3VHKA 5TKDA 4IFGA 4JAIA 2JIVA 3AC2A 1FPUA 3C50A 3PRIA 3UZPA 1BL7A 4NT4A 3ZZEA 4DG0E 2ETRA 3E88A 3Q2MA 2YJSA 3FLNC 5CVFA 4FC0A 4DLIA 5CZIA 1DAYA 3P1AA 3FXWA 3R8UA 4ANNA 4DT9A 2FSTX 2OK1A 1ZLTA 3OP5A 2IZTA 4AGCA 5EDRA 2XNBA 4PRJA 4NU1A 1YWVA 3PG3A 2X39A 4MBIA 5E8YA 5JEBA 3BV2A 2QG5A 4AAYA 3A60A 2JBPA 1M7QA 2Y4PA 3I1AA 4PMMA 4S34A 4M84A 5FRIA 5GHVA 5C27A 4C4EA 5IQAA 3CBLA 5HCXA 5DT0A 4G1WA 2YEXA 1M17A 2JIIA 1GZKA 3W2RA 2IW9A 2CN5A 3W8LA 3BPRA 4DGGA 3EFKA 5LVMA 5IQHA 3I5ZA 4R1VA 5JRQA 4F6UA 2W9FB 5I9UA 3UODA 3OS3A 5FXRA 1YOJA 4RA4A 3VN9A 4O7LA 2YDKA 2WGJA 4ANOA 3F2AA 4AFEA 5IA0A 4DEAA 1I44A 3FUPA 3OXTA 3TG1A 3UIMA 3PSDA 4E26A 2C5YA 4FNZA 1R3CA 5TR6A 4NCTA 4FG7A 4F9WA 5AA8A 4F1MA 3FMDA 5CT7A 1Z57A 4YO6A 2XEYA 4B6LA 5F9EA 3BEGA 3F9NA 4CZYB 4RC4A 4O0YA 3ZYAA 3HVCA 3VS6A 5K4IA 3KXXA 1CKPA 5IQEA 2CCHA 2VO7A 1H8FA 5ANDA 3MV5A 4MXOA 2XM9A 4RSSA 2XAOA 1OKVA 4RFZA 3PY3A 1U54A 2RFDA 3VBXA 1JOWB 1GZ8A 4Q9ZA 3QQUA 2X8EA 4DEDA 4MAOA 2X2KA 3ZCLA 2QOFA 5HO7A 3O8PA 3QXOA 4L00A 5M57A 4EWQA 5JQ5A 2O3PA 2O5KA 3DQXA 4AXEA 3NS9A 1GIJA 2HENA 2R3LA 3OY3A 1V0BA 2FGIA 2CN8A 4QQCA 1W2FA 4B8MA 2DWBA 1W2CA 4EJNA 5CEOA 2E9NA 5HORA 5L2IA 4ACHA 4N70A 4AT4A 4EHZA 5CALA 4WOVA 3FHIA 3D7TB 2GDOA 5CEMA 4RWKA 4ENXA 4L46A 5HD7A 3FKOA 4YSJA 4ACGA 1G8AA 3SA0A 2GNFA 4ZSEA 4EZ7A 3RAIA 3NYNA 3DCVA 4IB1A 1J7LA 3NVKI 2J0LA 4NSTA 4BCJA 5CX9A 1PMUA 2VGPA 3HEGA 5M4IA 4JI9A 4J8NA 2IG7A 4RJ8A 4GFOA 1CSNA 2BAJA 2WKMA 3RALA 3IGGA 3MS9A 4E7WA 1O6YA 2HZIA 3THBA 2LGCA 3QTXA 3DJ5A 4FIIA 4RWJA 1H1QA 2XJ0A 3LCDA 4G5JA 4IDVA 3RP9A 3GT8A 2C5XA 3R01A 3O2MA 3HNGA 4I0SA 4QQJA 4DINA 2HAKA 1W0XC 4GG5A 4OT6A 4F70A 5C8KA 4CRSA 1DI9A 5FDXA 3ORPA 4G3DA 3OWLA 4L3JA 3WE8A 4DFBA 2WZJA 4QTEA 3ZO1A 2R0IA 3DXNA 1P2AA 4P7EA 2X2MA 3SV0A 4DYMA 5CU4A 3GOPA 3LCSA 5L4QA 3BBTB 3LQ3A 2GTMA 2RIOA 3UQCA 2H96A 5B2MA 2VTTA 3QHRA 5CU6A 5HE3A 3R9OA 3I4BA 4GKIA 2WHBA 3L9PA 4ZTSA 3ZXZA 1YI4A 4FOBA 3FZRA 2XJ1A 4WSQA 4QTAA 2ZJWA 4YO4A 3DQWA 3AGLA 4TWPA 3TI1A 2C69A 1UVRA 4FKIA 3FY2A 4JX3A 1R1WA 3QXPA 4U5JA 2FH9A 3WYXA 2PUPA 3EOCA 3LLAA 5FTOA 4H36A 4J98A 1IA8A 4XBRA 1JAMA 1YXSA 4H3PA 3UC4A 3LM5A 4BCOA 1WAKA 4CKIA 1SYKA 1Y8YA 5LMKC 4IC7A 1U5RA 5C8NA 4U44A 4YNOA 5DIAA 3CTQA 5HTCA 3ENMA 4MXAA 3PY1A 3PXQA 1Q8WA 3KULA 4GK4A 4L44A 3RWQA 3MFSA 4EEVA 2BTSA 4K77A 3Q4UA 2B54A 4E5AX 3AKKA 5IDNA 3OWJA 3NW6A 2OJ9A 3P7CA 5B2LA 2REIA 4QP2A 4O0UA 1BI8A 5GJFA 4F4PA 5M08A 4OGRA 3UPXA 4KINA 5BVDA 3D15A 2H9VA 2QR7A 4LMUA 3FBVA 3AOXA 3TZ9A 4FOCA 4J1RA 2WTIA 2G2IA 4IX3A 1REKA 1UU3A 4JL9A 5GINE 5HIDA 1CM8A 4O7ZA 4FTUA 4ITJA 5D11A 2XAMA 3EQCA 2IZUA 3ZLXA 4ZIMA 1RJBA 3COIA 2FYSA 3EQDA 3UNJA 1P4FA 1FINA 2QOHA 4WSYA 3UC3A 3QKKA 4BGQA 3UZTA 3IW4A 1M2PA 5HU9A 4NZWB 3W0QA 3CKXA 3TUBA 3N4VA 2OBJA 4YLJA 5LJJA 5AIKA 4HYUA 5CU2A 2WNTA 5AV2A 4Y85A 3QTUA 2NRYA 2X8DA 2Z7RA 3P0MA 4BCMA 5IA3A 2JAVA 4I6LA 1FVTA 4AF3A 4DF3A 4Y83A 3F3WA 1AGWA 2JBOA 2Y0AA 2W1DA 4NTTA 1QPEA 3QLGA 4IAKA 4EYMA 4ZY4A 4EKLA 3GFEA 3PA5A 2ITZA 1XBBA 3P23A 3G9LX 4QMVA 4A9SA 3BU5A 3ORXA 5FQDC 1R0PA 4XG3A 3QA0A 4A9TA 3LFAA 3PXZA 4V04A 3RZFA 1YXVA 1W98A 3TKIA 2BDJA 3TV6A 5AP6A 3L8PA 4GVJA 2J2IB 3ZMMA 5EKNA 2Z8CA 3D5UA 2BDFA 3MJ2A 3T9IA 1UWHA 3GCQA 3W0MA 2ITQA 4DAWA 3QQKA 2AEGA 4J96A 4RIXB 3E62A 4JBVA 4PUZA 4BI0A 4D58A 3BL9A 4FVRA 3FMHA 1UNLA 4D9TA 2JKQA 2WQMA 4AN2A 3D9VA 5FGKA 2GNJA 2VTPA 3COHA 4IZAA 5M55A 3OOGA 2VWWA 3B2TA 1F0QA 3HX4A 5A14A 2IVUA 5CT0A 3OOMA 3DU8A 5EI2A 1TQIA 1QPCA 2SRCA 4DH7A 3R7IA 4FT7A 3FSKA 3EQHA 2HW6A 2R4BA 2C5VA 2IZSA 2YAKA 4FZ7A 2YM6A 5J8IA 2YITA 4YNEA 2XIKA 5E8VA 3A8WA 4TZRA 5LMAA 4A06A 3KU2A 3QZFA 3RTPA 4BCPA 4O7TA 4K8AA 3GQIA 5JGBA 4ANQA 4QPAA 4C8BA 3VHEA 3R7OA 3CE3A 5CSHA 3P7BA 3Q60A 4FGRA 2BVAA 2JDOA 1RDQE 2NO3A 3P79A 5DOSA 3RGFA 5L2SA 4JRNA 4DHIB 4ZS4A 4JG7A 4G6LA 4IIRA 4IZYA 5JZNA 1OITA 1XH7A 1ZOEA 3HV6A 5IQFA 1H26A 3EQIA 4G31A 2R3RA 2PZPA 5AAFA 4AN3A 3AKLA 2R7BA 2BRNA 2I40A 4FK3A 3QZHA 4QMOA 2ZVAA 2W4KA 2AYPA 5E8TA 2C6OA 2JAMA 5A3XA 3ZONA 3LJ0A 4DBNA 2BIKB 5EYMA 3PE2A 3QD2B 2VWVA 4AW0A 5IA5A 4AT3A 3R63A 4C4HA 4XV9A 4OR5A 3GP0A 2DS1A 3QCSA 4WNOA 5E4HA 4S33A 2Y9QA 4L7FA 2X7OA 4GT5A 4D2PA 4A9UA 3R02A 3W0OA 5AUZA 4DCEA 2YLFA 4XBUA 4FEWA 3LLTA 4WBOA 1SMHA 2EVAA 3GU4A 3K5VA 5AAGA 5IEXA 4NM3A 1OM1A 1VLRA 4WG4A 3V6SA 5DT4A 4RVKA 2B7AA 4O0VA 2PVKA 2GS2A 4DFLA 5A4LA 5HE2A 3AC3A 3O7LB 3ZTXA 4RJ6A 4CFXA 3PFYA 4QMTA 3GU6A 5BNJA 3PIZA 4M7IA 3FMEA 4RX5A 4P5ZA 1E9HA 4I6FA 4ANSA 1WZYA 3PIXA 4FYNA 3UIUA 3QWKA 5CEQA 1IAJA 1H01A 3JVSA 3W0NA 2C6DA 1VYWA 3BHVA 3ODYX 3QTSA 4LG4A 1H1RA 4C34A 4ORKA 3CPBA 4YZDA 4EH7A 5LCJA 1XQZA 2VTSA 4EC9A 1WFCA 5AP3A 4JQ7A 3R2BA 3NW7A 2XKDA 3QQLA 4AW5A 3LKMA 5GZAA 1NT2A 2YISA 5A9UA 4I21A 5HNBA 2B53A 2FVDA 1K2PA 4YJQA 4ASXA 2WMAA 3R9HA 2IVTA 5BPYA 4ZJJA 1ZWSA 3E7OA 4PMTA 4CKRA 3WZKA 3ZFXA 3W0RA 4DGNA 3QQGA 4XV1A 3P9JA 2Q83A 4Y46A 3OWPA 1DAWA 4PL3A 3MDYA 4O4BB 4RPVA 3OMVA 1E1VA 3KF4A 3C9WA 5CXZA 1ZXEA 1ZZ2A 3I6UA 4FT3A 4KIOA 3CD3A 3FY0A 4CNHA 2HCKA 5I4NA 2PZ5A 3CKWA 2VTQA 3E8CA 3C4ZA 3L8SA 1BX6A 2QI8A 4LGHA 1GZNA 4AZSA 4E6DA 3EIDA 2Z02A 5A54A 1G3NA 3EMGA 3GCUA 5E92A 4R7BA 4YP8A 4YLLA 4IZ7A 4O81A 5I9VA 3W2PA 3W18A 4EYJA 3H10A 3QCXA 1JWHA 3FI2A 1YDSE 2XBAA 3NIEA 2BILB 2I1MA 4MF0A 4MXCA 5B7VA 3PPKA 5J9YA 4FNWA 5K0KA 3NRMA 4D4SA 1QCFA 2WQBA 2BUJA 3DNEA 3KKVA 3NNXA 4EZ5A 2WFYA 4FT9A 5CXHA 5A46A 4TRLA 3DJ6A 2GMXA 3VIDA 2CPKE 4IWDA 2XANA 4O86A 1DM2A 2ZM4A 5E8WA 2C47A 3DGKA 3VWAA 4EH4A 4OTQA 3LFCA 3NR9A 4LL0A 4RC2A 4HVIA 3PZHA 3QA8A 4K6ZA 2F7ZE 4QTCA 4BRXA 1KSWA 1PXLA 5DG5A 1PF8A 3BLRA 4PP7A 3NUNA 4ITHA 3TV7A 2UZOA 4U43A 3JPVA 4X3FA 4FV7A 2CKPA 4X3FC 1I09A 4IAAA 4AT5A 3FL5A 2KTYA 3Q2JA 4MXYA 4FIJA 2ACXA 4V05A 3UOKA 3FDNA 2C5NA 4FSMA 5J1WA 4Q9SA 2V5QA 4HNIA 4MNFA 4PF4A 1M2RA 4IM3A 2QCSA 2XNGA 3BE9A 3E64A 3MH3A 3PA3A 3R21A 3FKNA 3F6XA 3G51A 3DLZA 4QP8A 5E91A 4HYIA 4XOZA 2W99B 2VNYA 1OMWA 2W17A 4IAIA 4GU6A 4V0GB 1NVSA 3ET7A 5CAPA 1ZRZA 4O0XA 3UVRA 3ZM4A 3CS9A 2R9SA 2RG5A 4C7TA 3Q6WA 4D1ZA 4JBOA 1LR4A 4NH1A 3HP2A 3TZ7A 5FTGA 4NIFB 5HNGA 2F2CB 3TNPC 2F7EE 4JQ8A 4Y72A 1UKIA 3NGAA 4KSQA 4DTBA 4J95A 2PVYA 2B0QA 2WU7A 3E87A 3R1YA 1WVWA 2C68A 5FXQA 4L9IA 3SRVA 4BCGA 2OF4A 1Q8TA 1OVEA 2XNNA 1Q61A 2C3JA 4FI1A 3Q96A 3MESA 3E3PA 3VULA 4U0IA 5EDQA 4EORA 5HO6A 3BELA 3IW7A 4QNYA 2VUWA 4RVLA 5M53A 4RX8A 3ROCA 3HV4A 3PXFA 2ITNA 5AADA 2PVHA 2C3KA 2YCRA 3R7EA 4I5CA 3KQ7A 4JJRA 3BHTA 4M0ZA 4IAZA 2YDIA 1KUTA 4O22A 4ARKA 3MN3A 4BIDA 2PUUA 3FLZA 1OL1A 5E9EA 2A27A 2XS0A 3QRIA 4FKRA 3ZBXA 5H8EA 3KN5A 3QTIA 1W7HA 2W5AA 5LQFA 3LW0A 5CANA 3OD6X 4FEVA 3DB8A 3C0IA 1L8TA 4G9RA 2V55A 1NVQA 2BIYA 2ZDUA 3Q6UA 2YWVA 4JIKA 2YERA 3L9NA 3V5QA 3ZLSA 3BRBA 2PULA 3A4OX 4X7QA 2XZSA 4MNEA 3UIXA 3DZQA 2WPAA 3GVUA 3RVGA 1XH5A 3FMMA 1YW2A 3VS2A 1HCLA 4O7YA 4C3RA 3A61A 5LOHA 4JNWA 1G5SA 4XG7A 4DEEA 3JUHA 4L45A 4BTMA 5JN2A 2RF9A 2WTKC 2A0CX 4X6QC 3V3VA 3SG8A 4U97A 1BMKA 4YJPA 4AUAA 3D5VA 5AEPA 5F95A 2OXXA 2QOCA 4BDEA 4EOQA 4IWPA 3PJ2A 2CGWA 5HCYA 1URCA 2VWBA 4BYIA 2GQRA 4GV1A 2OWBA 3W0PA 4A9YA 1CKJA 3BKBA 4O6LA 1YHVA 3E93A 4BKJA 4IBMA 5HI2A 3R2YA 4IH8A 4E93A 3LFSA 3LHJA 1OIUA 4PDSA 4XV3A 1VYZA 3FMLA 3C1XA 4J7BA 4JRVA 5CU0A 3K2LA 3BGZA 4JG6A 4L43A 4UEUA 4YJNA 2Z7SA 1T46A 4P4CA 5CTPA 4DGLC 4D28A 3VJOA 3ZUTA 5D10A 4D1SA 4BIBA 3BQRA 5FM2A 2I0EA 4DH8A 2EUFB 4H39A 3NIZA 3R7UA 4D4YA 4EZ3A 1IASA 4GK2A 3OTUA 4WRGA 1O9UA 5AMNA 2XRUA 4F08A 2W96B 1APME 3SVVA 1OL2A 4RIWB 3KCFA 1Y6AA 4IX6A 4RZWA 4XG8A 3UO6A 4HVGA 2QOLA 4L52A 2OLCA 3VS3A 4BI2A 2AQXA 4XX9A 5AP4A 4NL0A 3AMYA 3U54A 4DFUA 3OUNB 4BYJA 3QTZA 3PG1A 4AOTA 2GCDA 2VTOA 2X6EA 3AD6A 4CV9A 3H30A 3NUUA 4UMPA 3DA6A 5AA9A 5IDPA 4I3ZA 3I60A 1J3HA 4TW9A 3MSSA 5TO8A 2YZAA 3PJCA 4CD0A 4MBJA 4QRCA 4FL2A 2BRHA 3G9NA 4ZAUA 3MWUA 1V1KA 2JKOA 3DFAA 4EH6A 3OCTA 2OJFE 3NVMB 2EXEA 4RQKA 2Z60A 3FPMA 2CDZA 4RX9A 2ONLC 5C8MA 4IB0A 1XH4A 5K3YA 2JD5A 4BDKA 4YU2A 4C4IA 4NW5A 1PMEA 5JFWA 2J0MB 4DCAA 2WD1A 4OW8A 3NYXA 4I41A 3I6WA 5GIPE 4DT8A 4GG7A 3AD4A 3IPHA 2YCFA 1NY3A 4L01A 4PPCA 5ANEA 3IKAA 3VF8A 3WI6A 2PYWA 5KUPA 1QPDA 4PDYA 5D9HA 1UWJA 2W7XA 4OBQA 2WAJA 2VTJA 3FSFA 3VUTA 4OTDA 4ZS0A 3SW7A 2P2IA 2Y4IB 4GU9A 2IW6A 4NTSA 3EL8A 3KEXA 3NUAA 2F7XE 4FKVA 4RA5A 4RQVA 1R78A 5HBEA 4LOOA 2VTLA 3RZBA 2J9MA 3U9NA 3UIBA 4I4EA 4AGWA 4AZFA 2OKRA 3DJ7A 4TXCA 5B0XA 5HLWA 4JMQA 3OZ6A 5KZIA 3O96A 4UBAA 5DGZA 4E6QA 3O5AA 3R8MA 4AA5A 1XMLA 3QUPA 4JDKA 1OL6A 3KB7A 4I5HA 3WYYA 3WF5A 5HVYA 4FZAB 2NPQA 4ASEA 4XCUA 4LRKA 3G90X 2RKUA 2Z2WA 3IDBA 4QP9A 3UNZA 4CFUA 3EN6A 3KXGA 4GL9A 5EM8A 4B9DA 5KMMA 2VAGA 3MY1A 4FKTA 1JKTA 2QOQA 3CIKA 4LV8A 5L6WL 3H9OA 3VS0A 3BU3A 4FEUA 3VS1A 2PU8A 3BI6A 2ITPA 5LXMA 5M07A 2AC5A 4YTIA 3NYVA 4V01A 3FMJA 4I94A 3NMUF 3W2OA 4DFXE 5DNRA 3WZEA 1LEZA 3OHTA 4YJOA 2Y6MA 2IPXA 2R7IA 4DTAA 4G3GA 4F1OA 2UVZA 4FVQA 4I4FA 4GUEA 4IJ9A 1MRVA 5KBQA 3VBWA 2F57A 5D7VA 4C62A 3HV5A 3AT3A 3VVHA 4E5WA 4XLVA 4HCTA 2VTMA 5DFPA 2GS7A 4U3YA 4O7SA 3PJ1A 5EOBA 4N4SA 1OIQA 4LUEA 3SXRA 5BX0A 2JFLA 3LFDA 1QMZA 1X8BA 3RNIA 3ACJA 3WILA 2HZNA 3ZRMA 1YI6A 3CXWA 4AA4A 5HQ0A 5AJQA 2UZWE 4TYIA 3RI1A 3CD8A 2HW7A 5CAQA 5IUHA 4TL0A 4WT6A 3QC4A 3PY0A 4IE9A 2XVDA 1XBAA 1XR1A 2C5OA 3A8XA 4YC6A 2OW3A 4PMSA 3QD0A 4AG8A 5A6NA 3S2PA 3I7BA 3NAXA 3QALE 5FBOA 5AUUA 3AC1A 4FV4A 4XEYA 3TKUA 3BWJA 3VC4A 1H07A 2GPHA 3K3IA 4ANBA 4QYYA 4QDVA 4BCIA 4I92A 4AE6A 4BWXA 3R22A 4LV5A 2BDWA 3BHUA 4CFWA 4AN9A 2QU6A 3OUKA 3R9NA 4NFNA 3COKA 4QYGA 5IQDA 3BZ3A 2RFEA 4WHZA 4MCVA 2EU9A 3OF0A 4GJ2A 4IW0A 4NEUA 5E1EA 3P5KA 4F7JA 2OG8A 2YJRA 4ZZNA 4U79A 4BDGA 4FKPA 4BKZA 3FYJX 1A9UA 1H1PA 4I5PA 2XKFA 4OBPA 1ND4A 4APPA 3HMOA 2X8IA 4C58A 4E8AA 3FMNA 2J0JA 4BJJA 4R3CA 3PIYA 3OT8A 3A7FA 3ITZA 5D1JA 4DGOA 5EM7A 3EHAA 4D2RA 3WF9A 2QG7A 5DVRA 2XIYA 2VRXA 2O64A 4IMYA 5JZJA 3QRUA 1AQ1A 4CG8A 4NCTC 4RIYA 3DKCA 1YWNA 4Z3VA 2VX0A 4EK6A 2WXVA 3NUPA 2QODA 3I5NA 3MH0A 3HDMA 3PVWA 3F61A 3N51A 4TY1A 5CLPA 5DLSA 4O2ZA 2G1TA 3OXIA 1KE8A 2ETKA 3Q53A 4IVBA 5EDPA 2RFNA 1OBDA 4XMOA 3MFTA 1MRYA 4TWCA 4E3CA 2UW9A 4R7IA 4EONA 4HYSA 4FTTA 5EH0A 1DI8A 2WMXA 4X2KA 4EH2A 4KS7A 5CSPA 5LVOA 4BCNA 4C57A 4CG9A 2VWXA 3HRFA 1URWA 1YI3A 2YWPA 4AW2A 1BL6A 1OKWA 3G0FA 3T3VA 2Q0BA 3NYOA 2HZ4A 4ZLYA 1UA2A 4JT3A 1IA9A 2WTDA 3ORTA 3VONA 2VX1A 3PSBA 5CF5A 4PWNA 5JFSA 2HY0A 3CLYA 2ERKA 3GENA 5DN3A 5KCVA 2C0IA 1S9JA 2OH0E 3PVBA 4PP9A 4AXAA 5HTBA 5AM6A 4XP3A 2X6DA 3ZDIA 3QQFA 2V0DA 4ZSGA 2F4JA 4S32A 2W5HA 4KBCA 2VZ6A 1TVOA 3NWWA 4RFYA 2W06A 5DEWA 4DA5A 4O4EA 5M56A 4QP7A 1M14A 3GU5A 1ZYDA 3LOKA 3QX2A 3NUXA 2C3IB 2YFXA 2XRWA 3BHHA 4H3BA 2JITA 3SOAA 2P4IA 4AQKA 3LCTA 4RRVA 3DLSA 2XJ2A 3EH9A 3MIAA 3HMMA 4DLJA 3QQJA 4EOLA 5LWNA 2JDTA