4ZTHA

Structure of human p38amapk-arylpyridazinylpyridine fragment complex used in inhibitor discovery
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
350
structure length
339
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 14
publication title Structure of human p38aMAPK-arylpyridazinylpyridine scaffold complex used in inhibitor discovery
rcsb
source organism Homo sapiens
total genus 115
structure length 339
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zthA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zthA01
4S2ZA 2ETMA 4L6QA 3C13A 1H26A 1PXMA 1ZRZA 3KN5A 4TYHA 3SGCA 4FKGA 5CSWA 4YZBA 4FT7A 1M2PA 5IQFA 1RDQE 5IA5A 3LOKA 5GIOE 1Y8GA 2QG5A 4MH7A 4FSQA 2R3PA 2UZEA 4MXXA 3SDJA 4O82A 5JGDA 4JT3A 4I6HA 1R0EA 5E8ZA 1Q41A 4BBEA 4M97A 4FSYA 4H39A 4PPAA 4LOOA 5BUEA 4E6DA 3UGCA 2OFUA 4K1BA 1QPEA 2CGWA 4LL5A 4RJ8A 2NNWB 1H1PA 4M13A 4XP3A 3CJFA 5CYIA 5KKRC 3EZRA 2GCDA 4EH3A 1BI8A 4S34A 2C69A 4C7TA 1UU9A 3HUCA 3PYYA 4X0MA 4AZVA 4FKIA 3CY2A 5IA3A 3LFEA 2HCKA 2P33A 2QOFA 4G5JA 4FV7A 2RFDA 2HY0A 3FMJA 1YRPA 1RE8A 3DCVA 2IVSA 4DGOA 4QMSA 4RIXA 4I21A 4DFLA 5HIEA 3MB7A 1FMOE 2XUUA 4JAIA 4NTSA 3HV6A 2QONA 5LOHA 3EN5A 1XHAA 3F3VA 3I79A 4FV9A 1YHWA 5C4LA 1HCLA 4IZ5A 3BPRA 3KK8A 3TACA 4OR5A 2WPAA 4BZOA 3DXPA 2AYPA 2H6DA 3EFLA 2F7EE 4L52A 5HE0A 4XV1A 2G9XA 3KF7A 2QNJA 2BDWA 4L7FA 4XMOA 3QFVA 1YXXA 3P08A 4J1RA 4PP9A 4XRLA 4BICA 1W98A 4DGGA 4RGJA 5K0XA 5AUVA 3LQ8A 2ZDUA 3RMFA 4ZTQA 2XK7A 3FQHA 3U6IA 3PIYA 5CLPA 3UQGA 4X3FA 4AZSA 4F9YA 1KWPA 3SW7A 4O7TA 3K54A 2PVNA 3VBVA 4JBVA 3S2PA 3H3CA 4GVJA 5IQAA 2YM3A 1UU3A 4FV8A 3E92A 3NDMA 4X3FB 3NYXA 4ITJA 3E87A 3NSZA 3PXZA 2HZ0A 2ZMCA 1JNKA 4KINA 1PXLA 4GMYA 4I24A 4G2FA 1OL6A 4Z3VA 4FV6A 5BYLA 4V01A 3AC4A 5CEMA 2GNJA 5EOBA 1R39A 5DYJA 1Q3DA 3D14A 4NH1A 2J0LA 3MVLA 4USDA 4YLLA 3FWQA 3OY3A 4I0TA 3OT3A 4U0IA 3PVBA 4O84A 2WMVA 2RG6A 4AFJA 2GS6A 2ACXA 1R1WA 4FBXA 3GUBA 3L9PA 4M84A 4WNKA 4DBNA 1RQQA 3IOKA 1OL7A 5D7AA 4EH2A 5FBOA 3FMEA 2HIWA 3GENA 3GOPA 2QOIA 3RNYA 1ZZ2A 3ZU7A 5A4CA 3A4PA 5DN3A 5EI2A 3U6HA 3CTQA 3FLNC 3VVHA 3MB6A 2J9MA 4II5A 4E3CA 3RI1A 4RZWA 1QMZA 4HYIA 4YTFA 5A14A 3BKBA 4FV3A 5AR3A 2W17A 3O8UA 5J9YA 5A46A 5AUWA 4WO5A 3EB0A 3UBDA 4RJ4A 5HTBA 4IFGA 3P86A 1BMKA 5IISA 5TT7A 3BU6A 5KMIA 4O7WA 4XP0A 2PZIA 5EHYA 2WXVA 2WTIA 4DH7A 4LGDA 2AC5A 1ZYLA 4JIAA 3ZLXA 5E1EA 5H2UA 4N0SA 2YIRA 4GK3A 2YM4A 1ZWSA 4DLIA 4PQNA 5EDRA 4EONA 1Y6AA 3PP1A 3C50A 4IB3A 2OIBA 5TR6A 4FZFB 5DEYA 3TJDA 2GQSA 4I41A 5C9CA 4BY9E 4M0YA 1DI9A 3BYUA 4I5HA 3NRMA 4G3GA 1OBDA 2YJRA 3EQPA 1REKA 2IZTA 3ZRLA 4C4FA 4L7SA 3IW8A 3ORXA 3UIMA 5BMSA 4OAVB 1ZMWA 4BWPA 2ZV8A 4U5JA 4NM7A 2Y7JA 3KC3A 1H28A 4RC4A 3EJ1A 2G2IA 4QQTA 5A6OA 3QD2B 4O7LA 3UVPA 4B8MA 1XH8A 2CKEA 3CTJA 3R7OA 3SA0A 2R3LA 3OOGA 3GB2A 4TWNA 5J9LA 2WQMA 4HOKA 2ETKA 1WBSA 3AC8A 1P4FA 2XEZA 3KMWA 4TWCA 2QKWB 5IQGA 2HW6A 3EKKA 5HNIX 2JD5A 4IACA 4ZS4A 2DQ7X 4FTKA 3D5WA 4XCUA 3TL8A 4MF0A 4YPDA 4G31A 4LFIA 4ZSAA 4OTGA 5DPVA 4FE2A 4FIGA 3WILA 3E8NA 4UYNA 5AUZA 4DG0E 4IDTA 3LPBA 3V5PA 3UZTA 3BE2A 2UUEA 4U43A 3KB7A 3QRJA 3MV5A 3Q3BA 5AA8A 5HD7A 2XCHA 1SYKA 2IPXA 5CEKA 4Z16A 5EHLA 5HI2A 2V62A 3T8OA 4L01A 4EOIA 2XZSA 1KOBA 3POZA 5HVJA 3CGFA 4ZZMA 4M15A 1ZY5A 3DA6A 4W4VA 4CFFA 3BQCA 4CLIA 3TUDA 4GJ3A 4HGEA 2J5FA 3COIA 3R8LA 1JKKA 4E6AA 2ONLA 3HAVA 1MRUA 3CIKA 2JBPA 3EMGA 3ERKA 3HGKA 3DK3A 1FVRA 3I7CA 2GFCA 3ODYX 4IM3A 2BZIB 4IWQA 3JY0A 3MDYA 4L00A 1LPUA 3F3TA 4DFUA 1H08A 4AW5A 4DEGA 4YTIA 1NVQA 2JKKA 3F66A 1Y57A 4DE4A 4J53A 2W9FB 4PP7A 4QOXA 2WQNA 4C4IA 2O3PA 4L44A 4IB5A 2V55A 3ZM9A 4QP4A 1OKVA 1JOWB 2C6DA 4C58A 2W99B 5CF5A 4JR3A 4Q9SA 4FTOA 5FGKA 4CFNA 2R3OA 3M42A 2R0UA 4QTCA 3CR0A 4AACA 5CSHA 4EH5A 1OECA 4IEBA 4CZTA 3R8PA 3BEAA 5IMXA 4FKPA 2W1DA 5I9WA 5DHJA 3QU0A 4H58A 3ZO2A 3E8CA 4BTJA 2XM8A 4D1ZA 4CKRA 3OBGA 2BTSA 2OU7A 1V0OA 1OIUA 3FI2A 2IO6A 3Q4UA 5AP2A 5J8IA 4AOJA 4RX5A 1G5SA 3RGFA 4H1MA 3V5LA 2BMCA 3VS5A 4APCA 5AAFA 4DTKA 4KSPA 5A9UA 3ZUTA 3BYOA 3KF4A 3L9NA 4JRNA 2IW8A 2R64A 3C4CA 4C2VA 2C47A 2JKQA 2GDOA 2WTCA 3CEKA 3KCFA 2ZV7A 3KRRA 4FT5A 3CE3A 4HGSA 4IVAA 3DT1A 4L53A 3FE3A 4TRLA 5AUUA 1KE9A 4O91A 3QZIA 5F95A 4R1VA 5FD2A 2YM8A 1PKGA 3IKAA 3GEQA 4U8ZA 1DI8A 2LAVA 3SD0A 1QL6A 4PF4A 5F94A 3NNVA 5AP1A 3PRIA 5G1XA 5LQFA 4ZJIA 4P90A 1ZOGA 5HOAA 2VTLA 4UEUA 2C6LA 4GYIA 2XIZA 4LV8A 1Q8ZA 4W4WA 3A4OX 2ITTA 2BDFA 3IK3A 4FZAB 4ZJJA 2C6MA 5HLNA 3HDMA 2R0IA 4CZUA 2W4KA 5LWMA 4ASDA 4QNAA 3LVPA 4FZ7A 4ID7A 3QUEA 3AT3A 4D0WA 4XLVA 2QO7A 3QCSA 4YBJA 5CAOA 3PP0A 4ANMA 1URWA 2VUWA 3BZ3A 3MJ2A 4BDEA 3KXMA 2X39A 5HESA 4YP8A 4FTQA 3KK9A 3NZ0A 2QKRA 3TCPA 3DS6A 2VO6A 3F5UA 3GQLA 5K3YA 3QTUA 4D1XA 2IG7A 2VWWA 3GFEA 2WMSA 3VUKA 5KO1A 3BGZA 4NK9A 4QMOA 5GZ9A 1U5QA 3W32A 4FA2A 4A7CA 5HLWA 1NW1A 1FQ1B 2RF9A 1W0XC 1E1XA 4RT7A 3L9LA 4R1YA 2CSNA 4AGWA 1R0PA 3Q9YA 5BQ0A 5K4IA 4AE9A 4WD5A 4YLKA 4BDBA 5A6NA 4P5ZA 4E5BA 3QC9A 4GV1A 1V1KA 2VTMA 3MI9A 3OWJA 3A7FA 3NUPA 4ZSJA 5CAVA 4RIOA 3VS2A 2PK9A 3DOGA 1PXJA 3CS9A 3D94A 2JC6A 3QF9A 5AR8A 3G51A 4HCTA 2ZDTA 5FQDC 5HGIA 2UW8A 3ZBFA 3O23A 4E26A 5KKRB 2WMAA 3ZHPC 2B54A 4PDOA 4UMTA 4ZTRA 3TN8A 1U59A 3PIXA 5BVOA 3CQEA 3LCTA 3K2LA 4TT7A 1XJDA 5JN2A 4UALA 3FBVA 5LARA 3VNTA 3DBFA 2JKOA 5FLFA 1PJKA 2YISA 4AW1A 2GFSA 4IX5A 4AGCA 1K3AA 3DU8A 3DK6A 1H1RA 2VTRA 2EB2A 2UW0A 2PPQA 1CMKE 5AV2A 2QOBA 3KMUA 2WGJA 4WSYA 1YXTA 2OZOA 3PLSA 2OSCA 3ZSIA 5AIKA 3IOPA 3O7LD 3PY3A 5L2QA 4HJOA 1P5EA 2QC6A 3IDCA 2JBOA 4H3BA 4BYIA 4RA5A 3EN7A 4AZEA 4BIBA 4KIQA 2FH9A 4BZDA 2ZB1A 2R3IA 3DAJA 3NMUF 4AA5A 3H4JA 4FKWA 3F5XA 5E4HA 2V7OA 1BLXA 4H1JA 2OFVA 2ITOA 3GVUA 4EH7A 3TTJA 4AN2A 3W2CA 5A4LA 5C8NA 4CVAA 5LVPA 3JXWA 4W8DA 5IEXA 2GPHA 1M2RA 3C0IA 3ZS5A 4UXQA 5CI7A 1VJYA 3UE4A 2XK3A 3F7ZA 3D7TA 4L3LA 5ETCA 3Q5ZA 4XS2A 2VGPA 2YM5A 3EKNA 3QLGA 4CV9A 3HL7A 5K0KA 4D4RA 5EHOA 5GINE 3HMOA 4C4HA 3LXNA 3LM0A 4YJRA 3COKA 1JKSA 4WA9A 1LUFA 2R3HA 4E1ZA 4E5WA 4FKVA 5AP7A 2BROA 3C1XA 4BN1A 5DIAA 4EOKA 5L2SA 3DFCB 1OVEA 3GC0A 4AS0A 4MQ1A 4BBMA 4GU6A 2UW4A 1Q8TA 4OTRA 2HELA 5CT7A 5CXHA 5BVKA 2NRUA 4CRLA 5EG3A 5HD4A 5HG5A 4RX8A 3DTCA 5KZ0A 4YJPA 4F0IA 4BI2A 1LP4A 2Z7LA 3FL5A 3DJ6A 4P2KA 2XJ0A 1A06A 3LW0A 5FUTA 4D2PA 2HYYA 4EH9A 4QRCA 4CFWA 2QO9A 4IC7A 4IZAA 1GIHA 5JZJA 2X9EA 2XVDA 1E1VA 2O64A 5AA9A 3TT0A 4YTHA 5BVDA 2ZYBA 3RM6A 3LCKA 4FVPA 5EOLA 3UTOA 5HQ0A 5HE3A 4FNXA 2UW9A 1PY5A 4LYNA 3SXFA 4R8QA 2JIIA 3DBDA 2Y0AA 3SAYA 5F9EA 3AD5A 2VX3A 4XV3A 2QLUA 4QP6A 4F6UA 4MAOA 2LGCA 2CGVA 3MH2A 3I5ZA 4YJUA 3DNEA 5GIPE 3U4UA 3VHEA 3G9NA 3IGOA 4NT4A 1TVOA 2IVVA 1VZOA 3OTVA 1OI9A 4AP7A 4EYJA 3V51A 2PVFA 1JKLA 2GSFA 2EUFB 2QCSA 2X8IA 4HGLA 4KWPA 3JS2A 4BYJA 4DFZE 4F1OA 4IFCA 2R4BA 3IW7A 2WTDA 2BKKA 4JS8A 4O83A 4L67A 2Z7RA 3FSKA 3KXZA 3G0EA 4FT0A 4BCKA 3EWHA 1UWJA 2E9VA 4DINA 2A1AB 3T9TA 5C27A 4M69B 2VX0A 3LXLA 4FYOA 1PYEA 2XIRA 4CSVA 4DG2E 3R00A 5GNKA 2O2UA 2WOTA 2OH0E 4MBJA 4E5AX 3NS9A 5E8XA 1Z5MA 5H3QA 5CEQA 2XIYA 3A61A 3D4QA 4F9CA 2B55A 1XH4A 2Y4IC 4CNHA 3L1SA 3IW4A 2ITYA 4E93A 5AM6A 4DGLC 2C0TA 4E4MA 4FKJA 5CSXA 4C4EA 2J50A 2GU8A 3EFJA 3MH3A 5CVHA 4GKIA 3NUUA 4TTHB 3I81A 2FGIA 3V01A 3DBEA 4E4NA 3R73A 4BC6A 3VQUA 1QPJA 4YO4A 4R3RA 3Q9ZA 3DLSA 2YCSA 2V22A 2UZLA 2A4LA 4G9CA 3VS6A 4CQGA 4MNEA 4RFYA 3T3VA 3NR9A 5FM2A 3NUXA 3UNJA 3QRTA 2C3LA 4HPTE 4EJ7A 2X81A 3MA3A 4QT1A 5BYZA 4CT2A 3OUKA 4QMYA 4YZMA 2UW7A 4QTEA 4R78A 4IB0A 3E64A 1WZYA 4F9AA 4R6VA 2I1MA 2ZVAA 4HCUA 5D12A 3AD4A 1YDSE 1Q4LA 4OT5A 2EVAA 2B7AA 4FSMA 4JG6A 4RJ3A 2C5XA 3UVQA 3Q9XA 5L6WL 4D2WA 5I3RA 4XUFA 4AU8A 4E4LA 3I0OA 3HYHA 3A7JA 3CXWA 4OBOA 4FYNA 5KMMA 3VIDA 2R9SA 3CQWA 3MFUA 4QTAA 2OBJA 3IW6A 4ALUA 3S4QA 4QPMA 2XS0A 2CLXA 3MPAA 5E7RA 3WBLA 3PWYA 2VRXA 4K18A 4MBIA 5IA0A 3VAPA 3VBQA 3QZFA 4EH4A 2PUPA 3ZC5A 1MUOA 4KRCA 5IMEA 2IVTA 1GY3A 5EYDA 4B99A 3TUCA 1PRYA 4ASEA 3KVWA 5HO6A 3C5UA 4FEWA 2CNQA 3M2WA 3FMDA 3GU5A 3PG3A 4WHZA 4YJNA 4O7RA 3DJ5A 5E8TA 3V3VA 3LFCA 4FZDB 1H4LA 1O9UA 3JUHA 4BHNA 3BYVA 2G01A 3FKLA 2YJSA 4XG7A 4U3ZA 3HV5A 4R7IA 5LJJA 3BHHA 2C0IA 3FLYA 5H9BA 4F6SA 4HPUE 2PZ5A 4GH2A 2XKCA 4IX4A 3E8EA 3OCGA 4D2RA 3O51A 4G6LA 2OJ9A 4K8AA 2QHNA 3VWAA 3QKLA 4Y8DA 3HP5A 5DGZA 1OKYA 3PPJA 4WNPA 4HVIA 4LGHA 1EH4A 5EW9A 4USEA 4DEDA 1G8SA 4OTWA 3GC8A 2X8EA 2ITWA 4FTRA 3GNIB 3R63A 4DEIA 4Q5HA 4CKIA 2VNYA 5DNRA 4EK8A 3VJOA 5AIRA 3MFSA 1UV5A 2OZAB 2ZV2A 3C4WA 1OIRA 3DQXA 5E9EA 4FK3A 3EL8A 3QQKA 1GZ8A 4O0RA 3PY0A 3FAAA 4O21A 3THBA 1KV1A 2GQRA 3KFAA 4ZS0A 3TNWA 4MYGA 4CD0A 1J7UA 3OT8A 4RPVA 4TW9A 4GU9A 4K11A 3OW3A 4D9TA 3UNKA 3FY0A 3R1SA 4TYIA 4AT4A 2XJ2A 4YNEA 4JXFA 2IJMA 4ACCA 3TKHA 2R3RA 3C5IA 2WQEA 3FLWA 3CD8A 3GC7A 1H8FA 3QUDA 4BDIA 4UXLA 5ANDA 5FG8A 5IA1A 3R1QA 4CCUA 2O8YA 1OKWA 3B8QA 2JAVA 3A8XA 2BZJA 4XRJA 4A9RA 3WZEA 4GJ2A 1XO2B 1WVXA 4KS7A 2P2IA 5L2WA 5LCJA 4JG7A 4EOQA 1IAHA 2XNEA 4FL2A 4IWDA 4LL0A 4NTTA 3P7BA 5HICA 3W8QA 1R3CA 3TV6A 3UDBA 3VQHA 3BRBA 1E9HA 5HNBA 1YVJA 2P4IA 2R3MA 3HRBA 2GHLA 4NWMA 3ANRA 1JLUE 3ZEWA 2OLCA 4FSUA 4LMUA 2QQ7A 3G5DA 3G6GA 4FOBA 4QQCA 3WE8A 4FEQA 2XCKA 2YM7A 1SNXA 1FVTA 4YO6A 4WT6A 4ZSEA 4A9UA 5GJFA 2UV2A 3Q4TA 4JL9A 3QQGA 5TKDA 3R7EA 1O6LA 4DC2A 1I44A 4FEVA 5EM6A 3OCBA 2BFYA 5L8KA 2B1PA 4HW7A 3MY0A 4ERWA 4QYYA 3F3UA 3ORNA 2O63A 4TYHB 4FTAA 2QLQA 4O96A 4D2TA 2PUIA 1YXSA 4RX9A 2WMTA 3AC2A 3QQLA 4V0GA 5AR2A 4EK3A 4ASXA 5JEBA 3FMLA 2BTRA 4LI5A 3HX4A 5AM7A 4LRKA 3S95A 2WB8A 3R7UA 4BR3A 3R8MA 4D5HA 4GW8A 3TKIA 4HYUA 4PMSA 4V0GB 3R83A 3D5UA 4FTTA 4DITA 3VS3A 3UP7A 4LOQA 5ANEA 4U79A 5CNNA 5FXSA 1H24A 2JEDA 4W4XA 2R3KA 4EC9A 3EFKA 5KBQA 3SG9A 1BUHA 3BV2A 4UY9A 4ZK5A 5LWNA 3TKUA 2BHHA 3QCQA 3BU3A 5CU4A 1ZAOA 4CYIA 5HU9A 3ATTA 5CWZA 3R9DA 5ETIA 2JFLA 4FF8A 1UA2A 3VUIA 4HCVA 4CMTA 4RSSA 4EQUA 2UVYA 4O0SA 2X0GA 4EYMA 3ORKA 4GT5A 2J4ZA 4JBQA 3WYXA 5D1JA 1Z9XA 3AG9A 4FG7A 1BX6A 2GHMA 3BHVA 3GCQA 3I5NA 4RIXB 5E8SA 4O2PA 2XNNA 4CLJA 3F5PA 5K5XA 3VBXA 4ANNA 4G16A 2Z2WA 3FMNA 3O7LB 2UW3A 5CEPA 4XLIA 3E5AA 4MX9A 4A9TA 4ZZNA 5CF8A 4PMTA 3K5UA 1KV2A 3LJ0A 4S32A 4ZLYA 4WOVA 2C6IA 3FZRA 3LHJA 3TZ7A 3BBWA 4EBVA 3VF8A 4PRJA 5I9VA 3BHTA 4FSRA 2YN8A 4KBAA 4LV5A 2GS2A 4L43A 5CVFA 3QGYA 5E1SA 3RHKA 3RK7A 3ZSGA 4UN0C 3RAIA 5IEVA 4H36A 4BKYA 4CT1A 4TYEA 1U4DA 2H34A 5D41A 3B2WA 2F2CB 3C7QA 3MH1A 5EDQA 2EXCX 5AR7A 2UZTA 4C36A 3AT2A 2GTNA 4JJRA 3HP2A 2IZRA 3FDNA 4IZ7A 3R0TA 3FKOA 4IAIA 3OFMA 2XNGA 4HNIA 3HEGA 4W9XA 3CKXA 4FUYA 4MQ2A 2YWVA 1DS5A 3U9NA 4WUAA 1S9JA 3CC6A 4Y73A 4TWPA 4KIKA 5L8JA 4GK4A 4C33A 1BL6A 2I0VA 4M3QA 2YITA 4IH8A 3D2KA 4IAFA 5HG9A 2WIPA 2YLFA 4C37A 4AE6A 2C1AA 2J0JA 3ZEPA 3WZKA 1CDKA 1ZLTA 4KIKB 4YR8A 4JNWA 4PTGA 3EQDA 4MD7E 4G17A 3OS3A 3QTIA 5EI8A 4RVLA 4FIEA 4A4XA 3H9FA 1B6CB 2YDJA 3NUAA 4F7NA 3PA5A 3AMBA 2X6EA 2Y9QA 4O7NA 3DJ7A 4H05A 3A60A 2PUUA 3OWKA 5AMNA 1UU7A 4BCOA 5EH0A 3NNXA 3ORIA 3NCGA 4WRSA 1YWRA 4YPSA 5JK3A 1U54A 3RK9A 5HBJA 3FLSA 3PXFA 4HGTA 5CU6A 3ZO1A 2W1FA 1FPUA 3E62A 1OL1A 1JWHA 3DDPA 4PUZA 3JR1A 3RK5A 3VRZA 2BCJA 4G3CA 1ZYJA 3JVRA 5CT0A 5FDXA 4YMJA 4DG3E 4E8AA 2XNPA 5KBRA 2PVRA 2VTOA 1PMVA 2PE2A 5IU2A 3U51A 4X6QC 2W5BA 1OZ1A 2BPMA 1UNHA 5EQEA 5HX8A 1K9AA 2JDRA 4S31A 4JX3A 3VS1A 2B0QA 4EK4A 3QQHA 3GCVA 3F3ZA 4F1MA 3C0HA 3HAMA 3MVMA 4A9YA 3SHEA 1JQHA 3QA8A 4U3YA 2PVKA 5FTQA 5CALA 3LXKA 4F9WA 3EQGA 4PDSA 5DBXA 4RA4A 3KN6A 4AZWA 4ZZOA 4O0UA 1H27A 5BPYA 3G2FA 3DFAA 3A2CA 3PJCA 5CU0A 2YWPA 5ANJA 3BEGA 2VN9A 5ITAA 4YC6A 3L8SA 5H8BA 3SVVA 5F4NA 1FOTA 4JQ8A 3P7CA 5A54A 2CGXA 4FTIA 4YJOA 1OPKA 3F2RA 1B39A 4NCTC 4YC3A 3FI4A 4IX6A 5I9XA 3ODZX 5IUHA 5CVGA 4AQCA 3FSFA 2QHMA 2XK6A 3OWPA 3BGPA 2YACA 4IVCA 4G3DA 2Z7QA 4TYJA 1V0BA 2I0EA 1CM8A 5EQYA 3HV4A 2UZNA 3U6JA 4EJNA 4EWHA 1PW2A 3UO4A 3EN4A 1U46A 3CJGA 3W2RA 2PVYA 4BDAA 5ANOA 2YABA 1JVPP 2A19B 4FMQA 3Q4ZA 2ITQA 4GFMA 2VTAA 4ARKA 4IWPA 5HG8A 2CN8A 1A9UA 3FL4A 4Z55A 4MNFA 2X7OA 4EOSA 4BGQA 1ZARA 4OGRA 4Y46A 5JMSA 2HWPA 1Q5KA 1DM2A 5EKOA 4AT5A 4C3RA 5CASA 5EYMA 2CN5A 3KREA 4UWBA 1CKJA 1SVGA 2C6KA 1L3RE 4M66A 3OC1A 4BCQA 3Q04A 4FSNA 3QD4A 5ANIA 4QP9A 1SZMA 3G0FA 5BVWA 3OEFX 4KNBA 3TDVA 2WELA 3NIZA 4M8TA 2VWUA 2B9HA 3CTHA 2PU8A 5BUIA 4IADA 2WEVA 3GQIA 5I9YA 3RINA 5FTGA 4QMLA 3K3JA 3U9CA 4F65A 4ZTSA 5HORA 4O0WA 2W06A 3T9IA 1PMUA 2C6EA 3WYYA 4HZRA 3AOXA 1MRVA 1UWHA 4FODA 4CXAA 2AUHA 4E6QA 3ETAA 3V5QA 3WF6A 1ZMVA 2J7TA 5J5TA 1WVYA 3QKMA 5J7BA 4E6CA 4BGGA 4QMPA 3H9OA 3QAME 4OTHA 4J7BA 4FL3A 2JGZA 2X7FA 3BBTB 5HBEA 4YHTA 4XHKB 4PTCA 4XEYA 4L3JA 5FBNC 2O5KA 2XJ1A 4FKOA 2CKQA 3HMNA 4CKJA 1J1CA 5KZIA 1UNLA 4RRVA 4X2JA 4JDHA 4KKHA 4GFOA 3UOJA 2NP8A 2WTKB 2XK9A 2OXXA 4PY1A 4YSJA 1FGIA 1OGUA 5AV1A 3FZTA 3KRJA 4PL3A 3MVJA 1W7HA 3HA6A 3V5JA 4F4PA 4KABA 3VRYA 1Q97A 1JPAA 1SMHA 2G2HA 2XIXA 3EQCA 4O1OA 1R78A 5K5NA 5BVEA 4RMZA 3WZUA 4O81A 4XG6A 5CU2A 3RPSA 4ZY6A 2ITUA 2A0CX 4ZJVA 5CU3A 3TZ9A 5IUGA 2VWYA 4FICA 5CI6A 3ORZA 3UQCA 4I0RA 1W82A 2BHEA 2R3QA 4NSTA 4UB7A 3OXZA 3R01A 3VW6A 5E90A 3G6HA 3TV4A 3OY1A 3VBYA 2J5EA 3ROCA 3MTLA 4OBPA 3SLSA 3I7BA 4FKQA 5LVNA 4TNBA 4AZFA 1XBAA 2PWLA 4TZRA 3W1FA 2QOLA 5A4EA 4F63A 1Y6BA 3F88A 4F64A 4GFGA 2X2MA 5IQCA 4I4FA 3ZSHA 2FSTX 5CTPA 1IEPA 3GC9A 4XX9A 4C35A 4TL0A 5L8LA 4G1WA 3UPZA 4UMPA 5C8KA 4FTJA 5M08A 3H9RA 1KE7A 2HK5A 4Y72A 2XF0A 3WE4A 4EOMA 4QMXA 3LMGA 4CRSA 3TNPC 4CFMA 1SVHA 2Q0NA 4QMVA 4YBKA 3DB8A 4YC8A 3SQQA 2VO3A 3EHAA 3E93A 2B9IA 1ZYDA 5M55A 3OBJA 4C57A 3ZC6A 4L9IA 4DF3A 3VUTA 2P2HA 2PZRA 2RL5A 2W05A 4U97A 2BAQA 3UOHA 3KU2A 5CF4A 5JKGA 1DAWA 5M4FA 4I5CA 4M7IA 4S33A 3FKNA 3PG1A 3QRIA 4FTCA 4RVTA 2VNWA 2ZB0A 4C3FA 2YAKA 4JBOA 2Z02A 2VTNA 2JKMA 5LVLA 5ICPA 3V04A 3ZLYA 2G2FA 2DYLA 2WMXA 1KUTA 4UWYA 3A7HA 5JFSA 3E8DA 4AUAA 2GS7A 4GS6A 3DV3A 3MA6A 3FHIA 4UBAA 4XP2A 2BIYA 1J1BA 4MHAA 2BALA 4NM0A 2XIKA 3ZFMA 3DBCA 2W1EA 4A06A 1BYGA 3TZ8A 1IAJA 2XA4A 5HO8A 2PMNX 3F3WA 4PWNA 4C0TA 2C5OA 3FY2A 4BI0A 3MH0A 4I23A 4R5SA 4KKEA 5AJQA 4BGHA 5JRSA 3PY1A 4LOPA 4FC0A 3ZXZA 5DFPA 2YZAA 3R6XA 5C1QB 3E63A 3VS0A 2XP2A 5IQBA 4R7HA 3DK7A 1YDTE 4V05A 1F3MC 2J2IB 3FXXA 4JR7A 4ZY5A 4FKRA 1HOWA 5DEWA 3ZH8A 2C5VA 2EXMA 2OH4A 2C5YA 3ZZWA 2JAMA 4BTMA 4HVDA 4WG3A 2VWIA 3NX8A 3OWLA 4ENXA 3QA0A 4FNWA 3IGGA 3LFNA 5CZHA 4AA4A 2BUJA 5G6VA 4BL1A 3GU7A 3K5VA 3R9OA 3SV0A 3BU5A 4GUEA 2Z8CA 4YJVA 5JH6A 3FUPA 2BAKA 2W1ZA 4X21A 4B8LA 4FV5A 2VTPA 3RZBA 5HCZA 1NT2A 4GK2A 2QOHA 4BIDA 5C03A 2WQBA 4V04A 3UMWA 3UC4A 2HXQA 3I6WA 3AGLA 3POOA 4FV0A 4G9RA 4XG2A 3REPA 3WF9A 3MIYA 3D7TB 4PNKA 2CKPA 2WHBA 2YDKA 4LRJA 3R7VA 3DAEA 2H9VA 2B52A 5AP3A 2GNFA 2VTSA 3NCZA 2PZPA 3CY3A 3DAKA 5TO8A 3BHUA 1UVRA 3MFRA 4CYJA 2PVHA 2BRBA 4L8MA 4BCPA 4AF3A 4YUQA 3I6UA 2HZ4A 4RX7A 4I1ZA 3I60A 3RVGA 4M67A 4NJ3A 4RIYA 1S9IA 1YI3A 3S00A 1B38A 3UIUA 1Q8UA 3HRCA 3HNGA 3ACKA 3L8VA 3JPVA 3LFFA 4PPBA 5C01A 4ONAA 4BKJA 2IN6A 2C5NA 3VUDA 4CV8A 5AAGA 4DLJA 3DXNA 3ZLSA 4RIYB 2GNGA 3PIZA 3FLZA 4G3EA 2OJFE 2J90A 3COMA 3DZOA 4XOZA 4R3PA 4BTFA 3D0EA 2Q83A 4ZIMA 3R30A 3RM7A 4FSTA 4I5MA 3L8XA 1M2QA 3R9HA 3ALNA 4TY1A 4PMPA 4F7LA 4EZ3A 4I22A 3ZXTA 3PA4A 1WBVA 5HIBA 4XG4A 2ITXA 5J87A 5CSVA 4M14A 4X3FC 5KMOA 4BZNA 4BVUA 4EKKA 3P4KA 5KMNA 2PULA 1CTPE 3FXZA 4N57A 2C4GA 5IKWA 3RAKA 1M7NA 4DTAA 2FUMA 3SKCA 5M4IA 4HYSA 3ET7A 3C51A 4B7TA 3ZRKA 4ANSA 2B4SB 1MQBA 2XRUA 3PVUA 3EQBA 3BELA 2C0OA 3BV3A 3OOMA 1H1WA 2X2LA 5ACBC 4J8NA 4BB4A 2J0KA 3ACJA 3S0OA 4ASZA 5FM3A 3HKOA 3QZHA 2WKMA 3SG8A 3BX5A 3AD6A 3LFSA 3Q52A 1STCE 3VUMA 2QO2A 3M1SA 3M11A 3NIEA 3FJQE 4RJ6A 3V8TA 5IH6A 1XBCA 5K9IA 2IZUA 3RCDA 3RAHA 5AADA 3D9VA 2PVLA 2WMWA 4ANLA 1PXIA 4D2VA 3P1AA 3ZUVA 1YDRE 2VD5A 3Q53A 3QD3A 4E7WA 3GT8A 3FQSA 4KB8A 4EK6A 2VAGA 3UIXA 5J9ZA 3PE2A 4CFUA 3UVRA 4EH6A 2ZMDA 5KX8A 3LLAA 2CKOA 2XYNA 4BCMA 4FEUA 5ETFA 5GZAA 4QTBA 2X4ZA 1JSVA 2WTJA 3R8ZA 2RFNA 4DHFA 5IH4A 3FZOA 3U4WA 2W1CA 2YCFA 1MRYA 5IEYA 3MN3A 4FVRA 3FYJX 4NEUA 3AMAA 2XMYA 1NXKA 3IDBA 2CMWA 1FBNA 3PLAE 4F7JA 1W83A 3VHKA 4O7VA 2DWBA 3QCXA 4JI9A 4QP2A 4R77A 4WG5A 3PTGA 5C8MA 4MNEB 3OMVA 2H8HA 2I0HA 4FKUA 3LKMA 4LG4A 4YHJA 3ZM4A 2VTJA 4LGGA 2PMLX 1ATPE 1GJOA 2XNOA 3G90X 3PSCA 4J96A 4LUDA 3WF5A 3F9NA 3PPKA 5FXRA 4YNOA 1I09A 3BQRA 3R04A 4OLIA 3ZO3A 1WCCA 5CANA 3NYNA 4XJ0A 3TG1A 4DH3A 1W84A 5M07A 5EYCA 4BDJA 3GGFA 4J52A 3I1AA 4GIHA 4CGAA 3NNWA 4EZ7A 3O71A 3BYMA 3BYSA 4ANOA 1W8CA 3LCDA 2ZM3A 4X2KA 4DYMA 3CCNA 4W9WA 1GOLA 3G15A 5AR5A 2SRCA 3F61A 4ZTHA 4H3QA 5EQPA 3GCUA 5EI6A 4LM5A 4G6OA 1ZMUA 2VWBA 1M7QA 2PVMA 2R3GA 3CPCA 4CQEA 2FVDA 4E20A 2VTIA 1Y91A 3OXIA 4FKTA 4CG9A 3F7WA 2R5TA 1WFCA 5CF6A 4OW8A 5DT3A 2OKRA 5L4QA 2YAAA 3LXPA 1ERKA 5B2KA 5J7HA 5DI1A 1J7LA 2OO8X 3DB6A 4TN6A 3QL8A 5FXQA 1OMWA 1G8AA 2W96B 1MP8A 4J71A 3QZGA 4JOAA 1M14A 5AWMA 2WO6A 3QTQA 4MD9E 4Q2AA 2FSLX 3LMHA 4TKSA 4IMYA 4RZVA 5DOSA 3MW1A 4FG8A 4F99A 4GL9A 4ZAUA 4RWIA 1SVEA 3VBTA 2PUNA 5HZNA 2PHKA 4FV1A 2W5HA 4U6RA 1XH5A 1NY3A 2I0YA 2VWVA 3BLQA 3JVSA 4GT3A 4D2SA 4OTDA 1H25A 1HCKA 2REIA 5CNOA 3UO5A 3SOCA 3Q60A 3UG2A 3H10A 3NYOA 3KXNA 4AOIA 3NGAA 2FSOX 2VV9A 3PJ2A 5CAPA 2NRYA 3E7VA 1URCA 3HECA 3O50A 3FC1X 5M44A 1P14A 3CLYA 3LE6A 5CQUA 5A3XA 4APPA 3GU8A 2H96A 1V0PA 3W2PA 4O86A 4YZCA 1BL7A 3HVCA 2OF2A 3DPKA 4I94A 1WBPA 3P5KA 4QMWA 2G15A 4O38A 2V0DA 3D15A 4LUEA 5DH3A 4BIEA 4GSBA 2XNBA 2HXLA 5AV4A 2ZJWA 1YKRA 2UZDA 2DS1A 2XH5A 5J95A 2BVAA 4UMUA 3SXRA 3TNIA 4J98A 3CQUA 2JDOA 4JG8A 1FGKA 1PF8A 2VO0A 5IUIA 4BWXA 5KMKA 3CSVA 4K33A 4DEAA 4OTPA 4DEHA 5CY3A 4NKSA 3V8WA 4AOTA 3U54A 2X6DA 2JDVA 2QU6A 4HVSA 5HKMA 3Q6WA 2VZ6A 4GEOA 4QP3A 1T46A 5EW3A 5AV3A 3HMMA 3UYSA 5KCVA 1A48A 4MF1A 3MY5A 1TQPA 3TDWA 2PMOX 2E2BA 3DY7A 3NVKI 4Z7GA 3ZFYA 5IPJA 2ITNA 2OGVA 4FKLA 4MD8E 4BDKA 4MXYA 2J51A 4I6BA 4HNFA 5K4JA 5M57A 2I6LA 4X2NA 3W8LA 3DTWA 3DDQA 3QHRA 3SOAA 1GZOA 2PSQA 3Q96A 4F1TA 4YZNA 4WSQA 4ANBA 4FVQA 3ELJA 4PV0A 2QOCA 5JRQA 5HEZA 3PSDA 3VO3A 1KOAA 2VTTA 4O0VA 4BRXA 2YM6A 2ZV9A 4OBQA 3KGAA 4YU2A 4EBWA 3NW7A 2XBJA 4OT6A 2YHVA 4EUTA 4F09A 4UX9A 3EN6A 1H07A 4I20A 4JAJA 3Q6UA 4WNOA 1J91A 4O7SA 4O7YA 4GT4A 4TWOA 3D7ZA 3UMXA 3OW4A 1UU8A 2A27A 2UZUE 2VU3A 5TF9A 2PE1A 3H30A 4ZMFA 4HVHA 3IPHA 5AP5A 3EN9A 4RWKA 2P0CA 2F7ZE 4NFMA 3DXQA 4G34A 2VTQA 4Y5QA 3A99A 3QX2A 3R1NA 4Z9LA 3R22A 3KY2A 4MXCA 3RWQA 4KS8A 4MEDA 1JBPE 4BBFA 1APME 3UO6A 2VWZA 2E9OA 3QUPA 3Q32A 4JBPA 5AP6A 3MPTA 4U9AA 4EKLA 3W10A 4AA0A 4WRGA 4BCGA 5ANKA 2X8DA 2B9JA 4G6NA 2IZSA 3VN9A 3KXHA 5M4CA 3RALA 1OPLA 5DR9A 2BZHB 3U8WA 3VS4A 1UNGA 2XKDA 3RJCA 2ZOQA 4X3JA 3ZO4A 1YOMA 4R5YA 1FMKA 2BZKB 4QP8A 3RHXA 3QXOA 3ZONA 4K77A 1OUKA 5FDPA 2BILB 4JLCA 4GCJA 1PXOA 5CXZA 1Q99A 1H1SA 2OICA 4U45A 5CQWA 5I9UA 3WIGA 4DT9A 3QC4A 2R3NA 4WBOA 2OIQA 4Y95A 3W16A 4WBBB 3QTXA 2WOUA 4AWIA 1QPDA 4DEBA 4ZP5A 1XH7A 4HYHA 3ULZA 5HTCA 2GTMA 2ERZE 2Z60A 4X6RA 3N9XA 4AG8A 5HO7A 3TXOA 4BTKA 2UW6A 3TNQB 3LJ1A 4XG8A 4ACMA 5DR6A 1Q3WA 2J0MB 1ZYSA 4GG7A 5EM5A 5I5ZA 4JRVA 4F70A 4O1PA 3E3PA 2X7GA 4B4LA 1RW8A 4KBCA 3DBQA 1OM1A 4XBRA 3II5A 1Q8WA 2JIUA 2ZAZA 3FPQA 1M52A 2V5QA 3ID6C 3F5GA 3ORTA 1NA7A 2QOOA 5L2TA 4IM2A 2G1TA 2XRWA 1QPCA 2VWXA 3I4BA 3FQEA 3QKKA 4M12A 4YLJA 3HMPA 4EOLA 1XWSA 3TIYA 1Z57A 2VO7A 2ZM4A 2WFYA 4W8EA 3GBZA 3LQ3A 3OCTA 3PPZA 4PMMA 3KULA 3FV8A 5F1ZA 4CZYB 4OTIA 2QVSE 2UW5A 2C68A 4QQJA 3TV7A 4FSWA 3AMYA 4XOYA 2BRMA 3EL7A 2ETRA 5FEQA 3EQRA 4IB1A 3FHRA 5L2IA 3CD3A 2W4JA 3KULB 1U5RA 3LJ2A 2RKUA 3C4EA 3LM5A 3BGQA 3P79A 5FEDA 5T6KA 1WBWA 4F0GA 3PDTA 2C6TA 4MXOA 5IA2A 5GZ8A 4IE9A 4FTMA 2YA9A 2HENA 4ZTMA 3F2NA 5I0BA 4MTAA 3VF9A 2RIOA 3QALE 4FNYA 3KVXA 5BUJA 5C26A 5CEOA 3FI3A 4NIFA 4QMQA 4QTDA 5L6OA 2EB3A 3O8PA 2QD9A 3P78A 1XKKA 4Q5EA 3QLFA 5HBHA 3HMIA 1CKPA 5GHVA 5M4UA 4IHPA 4XV9A 3AXWA 3CP9A 3V6SA 1OPJA 2QG7A 3ENHA 5JSMA 2HZNA 4NIFB 5AUYA 2AC3A 3DKCA 4D4YA 3D2IA 5HCYA 5AX3A 3AT4A 4YJSA 1QCFA 3W2OA 3QBNA 4I3ZA 1U54B 3FMKA 2F7XE 3DKOA 3OG7A 2ITPA 1ZZLA 2XK8A 3V8SA 5AFVA 3R8UA 1TQMA 5A4TA 5B0XA 4EZ5A 3PXQA 3LFBA 4X7QA 3KRXA 4I4EA 4IM0A 3OF0A 5AP0A 3F6XA 2Y4IB 1J7IA 2YIXA 4FIJA 4FV2A 4YJQA 3T3UA 3ORPA 5KHWA 5KMLA 3PJ8A 5LMBA 4IQ6A 3QHWA 3MVHA 4KKGA 2BRHA 3NUYA 5I3OA 4FIIA 2C3KA 1OL5A 3GXLA 3HA8A 4U42A 4BDCA 4FIHA 4DH1A 5HCXA 3H0ZA 1YW2A 5DMZA 3GP0A 4P7EA 3LCOA 3W2SA 2JDTA 2IW6A 5DA3A 1H00A 5ANGA 3B2TA 4FK6A 3ULIA 4OUCA 4ACHA 2RFEA 4RIWA 1PXKA 1XH6A 2R3JA 3MTFA 4ORKA 4A4OA 4D5KA 1TQIA 2WIHA 4XYFA 3B8RA 3OUNB 3D5VA 4RJ7A 2OJIA 4D4VA 2BFXA 2C3JA 3EYHA 1X8BA 4EK5A 4H3PA 3Q2JA 3NW6A 4RIWB 4DFNA 2Q0BA 2GHGA 4EQCA 5KMJA 1OIQA 3Q2MA 3ZYAA 4RFMA 3W33A 5TE0A 5HLPA 2UZOA 5JGAA 3WZDA 2CJMA 2XNMA 3HV7A 3VBWA 5M09A 1Y8YA 3DQWA 5FWKK 4WG4A 3ZFXA 4HZSA 3TZMA 2X1NA 3DLZA 1AGWA 5FTOA 5AAEA 3G9LX 2IWIA 3P0MA 4O6EA 3VS7A 2W0JA 4TYGA 4BKZA 4YHFA 4EQMA 5D7VA 3QYWA 2W4OA 3TEIA 4RVKA 4X2FA 5DE2A 5CSPA 1WVWA 3BLHA 4JDJA 4D1SA 2C6OA 3BE9A 4TXCA 5H8EA 2I7QA 1GZNA 4KSQA 5CZIA 1PXNA 3RKBA 4AFEA 3LMIA 3ORLA 4Y5HA 4O27B 4FSZA 2GNLA 4F7SA 4MVFA 2RSVA 4PL5A 3DGKA 1JKTA 2OXDA 2VGOA 4IX3A 5TOZA 2C30A 5BMMA 3O8TA 3WF8A 3KEXA 2W7XA 5DT4A 2W5AA 2JLDA 3MY1A 4IDVA 1LEWA 4CG8A 4DTBA 3QQUA 5L3AA 4GG5A 4ZSLA 2PMIA 3DKGA 3ZOSA 3AQVA 4AT3A 4DGMA 4FEXA 1OB3A 5IG1A 4ACDA 3PJ3A 4RC2A 1VEBA 4N4SA 3R9NA 1IR3A 3Q9WA 4ZEGA 5DR2A 4LMNA 3WZJA 4MWIA 3E88A 3FZ1A 4EORA 5IDPA 3G33A 1NVSA 3QQJA 3GU6A 4BWKA 4IJ9A 5L6PA 3O17A 2FSMX 3HRFA 1Q62A 2HY81 3RPRA 4GKHA 4C8BA 4C02A 3W18A 4QMMA 5E91A 3ZMMA 3TWJA 1YOLA 1VYZA 4QO9A 4YZDA 5JZNA 5LMAA 4FOCA 2UVXA 5BVFA 2BRGA 5A4QA 1OKZA 3FC2A 3NAXA 4D58A 3MIAA 3LCSA 3QD0A 5T68A 4XBUA 5EKNA 5AV0A 3UOKA 4XV2A 2FO0A 4K0YA 5EW8A 3DKFA 2PY3A 5HTIA 4FGRA 3PXRA 2RG5A 3GI3A 3PWDA 3R21A 1SM2A 4ZTLA 3RP9A 3RTPA 3RZFA 3UOLA 4U7ZA 2WQOA 2WU6A 1P2AA 4R3CA 1WBTA 3UZRA 3VUGA 2I40A 3FXWA 2X4FA 2Z7SA 3OXTA 4EI4A 3NW5A 3QWKA 2W1HA 1XR1A 1OUYA 4PTEA 5EDPA 3FEGA 3PFQA 3AC5A 4NM3A 3RWPA 2WMUA 5E8UA 4EEVA 4IJPA 5E92A 4NJDA 3ATSA 3I0QA 1PKDA 3O96A 1SNUA 4E73A 4ENYA 1Q61A 1IASA 3R02A 2W1IA 4FTLA 4UV0A 2YEXA 4IXPA 3OTUA 4S30A 5FP5A 4UZHA 4F9BA 1T45A 4KIPA 4LQMA 5H8GA 5HU3A 3FMHA 1M17A 2GMXA 4GIIA 5C4KA 4FIFA 2GQGA 5DRDA 3A7IA 3EQIA 4YGAA 5B7VA 2ESMA 4WUNA 3EH9A 4O0XA 4NUSA 3WOWA 4ACGA 4EHEA 1H1QA 4XH6A 2ZM1A 3KMMA 1FVVA 3D5XA 3PXKA 2V7AA 3R28A 3HV3A 5EFQA 1PMNA 2JITA 2OI4X 4RFZA 3SW4A 3UYTA 3VUHA 4EOOA 4TNDA 3FZPA 3LFAA 5HIDA 1YWVA 2NO3A 3ROYA 4F0FA 4DA5A 3AC1A 2FA2A 4KRDA 2QI8A 4FTUA 3NWWA 3SXSA 4CCBA 4AW2A 2WAJA 3FZSA 3TUBA 4EL9A 4FX3A 5T3QA 4ITIA 5DLSA 5HVYA 5JT2A 3FMMA 1IG1A 3S1HA 5IQHA 3F2AA 4QPSA 4RWJA 4ANQA 4OTQA 3BI6A 5HG7A 5JQ5A 3PVWA 4BCHA 5IQEA 4OTFA 1JAMA 1WMKA 4ZOGA 5LMKC 2E9NA 3A62A 5M56A 4FV4A 4NL0A 2F4JA 2HAKA 4MBLA 3ZDUA 5E8VA 2PZYA 2X2KA 4K9YA 4UMQA 5BYYA 3RCJA 3ZZEA 4BCNA 4PDYA 2J6MA 1BKXA 2BRNA 3LAUA 4EHGA 4YSMA 4I6FA 4U41A 3PZEA 3FPMA 5AX9A 4U80A 2OJGA 4XG3A 1ZYCA 2R7IA 4USFA 2PL0A 4I93A 5DVRA 4D55A 2OXYA 4F6WA 4ZTNA 2UZWE 2C1BA 3HUBA 4J8MA 4FL1A 1GNGA 5JQ8A 4E4XA 4FNZA 3QRKA 2PE0A 1WBNA 4NU1A 4Y83A 5D10A 2B9FA 2WMQA 1OITA 3NYVA 3C4ZA 5CENA 2OIDA 4MCVA 3V6RA 2DUVA 2Y6OA 3EIDA 1WBOA 2F49A 5CAUA 2GNIA 3R7GA 3R71A 4NW5A 2C3IB 2WEIA 4Y85A 5HVKA 3R7YA 3KCKA 4QNYA 3UODA 3FI8A 4DAWA 1KSWA 2OK1A 3MJ1A 5DT0A 5CAQA 4QYHA 4GYGA 4JX7A 2OWBA 1PYXA 4RBLA 1OL2A 4NFNA 2VX1A 3V5WA 1YI6A 2VTHA 3DNDA 3UNZA 4HVGA 3PUPA 1OIYA 5AUTA 5JFVA 2UZVA 4IIRA 2UZBA 4FT9A 2YCQA 3C4XA 3KQ7A 3JY9A 5LVMA 4O6LA 2CDZA 3RPOA 4TPTA 4C3PA 5GJDA 3IW5A 4W4YA 4M0ZA 3ZRMA 4C4GA 5IH5A 3OP5A 4FZ6A 3ITZA 2OW3A 2QODA 2WNTA 3EQFA 1YOJA 4PDPA 4I0SA 4AXAA 5AEPA 2X9FA 3C4FA 2CCHA 3CBLA 3KRWA 4J97A 4NM5A 3BLRA 5HE1A 3L8PA 1CSNA 4ZSGA 4DFYA 2CGUA 3NEWA 3UPXA 3QTWA 3R2YA 3ORMA 4K6ZA 4L42A 4IW0A 4AGUA 4CEGA 4NYEA 4IAKA 2ITZA 4QMTA 4C61A 4R7BA 4YURA 4XNEA 1AD5A 3BHYA 5IQIA 4IANA 3MWUA 2XKFA 3JYAA 3N4TA 2QOKA 3QX4A 5LVOA 2IW9A 3ZCLA 1O6KA 3EQHA 3PE1A 4P5QA 1YHSA 2YFXA 2FYSA 2JIVA 2W9ZB 4BHZA 1WAKA 2B53A 5GJGA 5M51A 3MBLA 3ZUUA 3COHA 2KTYA 2O0UA 4FTNA 2QU5A 3NLBA 4FR4A 4EHVA 5KHXA 1UKHA 4ZXTA 5HE2A 3ENMA 3QTZA 3CPBA 4O0TA 4FGBA 3UZPA 1LR4A 3SC1A 4XG9A 3TTIA 4A4LA 3A7GA 2EU9A 4X2GA 3VULA 4ERKA 4ZLOA 1IA9A 4RJ5A 4KAOA 4IAZA 2JFMA 3BCEA 5E8WA 3O0GA 4J95A 1H0VA 1ZXEA 3OHTA 2CCIA 2QR7A 3PXYA 1NVRA 3MESA 2XM9A 2JDSA 3N51A 5CX9A 4ZY4A 4L68A 2WTVA 3UIBA 3F82A 5AR4A 3OEZA 5HHWA 2F9GA 3OCSA 4CTBA 5J5SA 1KE5A 2WTWA 4DT8A 1G3NA 2BR1A 3UJGA 2WZJA 4CTCA 2BDJA 4U81A 2CNVA 1KE8A 2WMRA 4BFMA 4CFVA 1XH9A 4A9SA 3GU4A 4J99A 2J0IA 2XB7A 4QMNA 2O65A 5IA4A 4IBMA 2BIKB 3GOKA 3OZ6A 1GAGA 3AGMA 4GRBA 3R1YA 2CNUA 3LIJA 4QYFA 4EWQA 1VR2A 4L3PA 3TIZA 4M68A 1F0QA 1P4OA 1YXUA 5AP4A 2CPKE 4AN3A 1BI7A 5ETAA 2BAJA 3AC3A 5EM8A 4DFXE 4NCTA 3QGWA 4U40A 4DH8A 1XQZA 3PJ1A 3KA0A 3QQFA 4ZMEA 2W1GA 3PRFA 3KRLA 3W55A 2F2UA 3L9MA 4M69A 1YXVA 2QOQA 3BWJA 4UZDA 2FB8A 3UG1A 3ZBXA 5HX6A 3N4VA 3RBWA 4BCIA 3E7OA 1XBBA 3OROA 4O22A 5F20A 4CFXA 3QWJA 1PHKA 4B9DA 3NVMB 3RPYA 4IVDA 4U44A 1LEZA 3CKWA 4RQKA 5EM7A 2F57A 2KULA 1Q8YA 5DRBA 4QMZA 2OJJA 2R7BA 2Y8OA 3OD6X 2PTKA 3ALOA 2HZIA 3LZBA 4RLLA 4MK0A 2ITVA 3TNHA 2HWOA 2QR8A 4O7ZA 3MYGA 3O2MA 4QMUA 2XYUA 3LLTA 5FRIA 3QYZA 3BWFA 4C62A 4PL4A 5E8YA 5BVNA 5KUPA 4NW6A 4IWOA 4WNMA 3WARA 2XEYA 3N4UA 3VW8A 1VYWA 4IC8A 4D28A 4JIKA 3GFWA 3MPMA 2WD1A 4CMUA 3DZQA 4C38A 2EWAA 3P7AA 3C9WA 4FT3A 3RPVA 3R8VA 3QCYA 4I92A 3S3IA 4D0XA 3HDNA 2E9PA 2WMBA 3GCSA 2ERKA 2RFSA 4N6YA 5J1WA 3A8WA 4KBKA 2RGPA 4DBXA 2HOGA 4JDIA 4RVMA 4MXAA 1DAYA 4F08A 2P3GX 5DWRA 3IS5A 4KIOA 4RC3A 4BF2A 4EOJA 2OG8A 2Y6MA 4IAAA 4QPAA 5D9HA 4GUBA 1YWNA 4FUXA 1ZOHA 1KE6A 4CMOA 3IG7A 3MGYA 4KUJA 2WU7A 3C0GA 2YERA 5HNGA 4P4CA 2YDIA 3H0YA 4WIHA 1JSUA 3PA3A 3PSBA 4QP7A 1IRKA 3KL8A 3MSSA 5EYKA 3VJNA 3Q5IA 3SX9A 2A2AA 5AUXA 3ANQA 4IAYA 4AN9A 2XBAA 4QYGA 4DFBA 4EOPA 4IVBA 4RWLA 3KKVA 4ITHA 3W2QA 2PYWA 4MWHA 4YJTA 5LCKA 3LFQA 4Q9ZA 3CGOA 3MFTA 3PVGA 4YTCA 1ND4A 3F69A 3KXXA 2R2PA 4O2ZA 4QD6A 4RLKA 5JFWA 3QTRA 2OF4A 3TM0A 4JDKA 4DCEA 5BX0A 4AZTA 4OAUC 4PX6A 4C4JA 3RNIA 1GIJA 3P9JA 3EZVA 2YIWA 1H01A 5M53A 4O0YA 4BCFA 4DGNA 4L45A 4A07A 3U55A 4MKCA 2ONLC 3TJCA 5B2MA 4AGDA 4AX8A 1J3HA 3LQ5A 3IECA 3ZTXA 3IO7A 4ZLZA 4C2WA 4YZ9A 1JSTA 3FYKX 2R3FA 3GCPA 3HZTA 4FG9A 3Q4CA 4DCAA 4BDGA 5IF1A 3NUNA 2QURA 4NZWB 2OZAA 2IVUA 3E3BX 4AAAA 3EOCA 4BI1A 1K2PA 4MXZA 3PZHA 5FP6A 4EH8A 2GNHA 4JQEA 1FINA 2EXEA 3IDPA 5IQDA 4I6QA 4Z7HA 5IDNA 4N6ZA 4RQVA 2HW7A 4C59A 5I9ZA 3HLLA 3K3IA 2YCRA 3U87A 5CEIA 3BIZA 3KXGA 3WIKA 4G3FA 4KD1A 4BCJA 5JFXA 4DN5A 4BDDA 1CKIA 5LXMA 1YI4A 3D83A 4B0GA 5EK7A 4I5PA 4QYEA 4UMRA 5BNJA 4LRMA 3EFWA 1PXPA 2WTKC 2YZLA 1F5QA 3V5TA 4PPCA 3UP2A 4C34A 1ZOEA 2BKZA 2YIQA 2UVZA 1UKIA 1REJA 4EHZA 1YHVA 3MS9A 4PNIA 3UC3A 4DEEA 5IZFA 4DH5A 2CLQA 4QQ5A 1OBGA 1TKIA 3NPCA 4L46A 5J1VA 3QXPA 3WF7A 5LMKA 5JGBA 4WKQA 4N70A 3TI1A 2NPQA 4D4SA 1PMEA 5M06A 4BDFA 3R2BA 3EYGA 4BDHA 2PVJA 3R9RA 1YQJA 3NUSA 3OVVA 4EUUA 4IZYA 4RG0A 4UYAA 4JVGA 1O6YA 4AW0A 1H0WA 3QRUA 4K2RA 3VC4A 2Y4PA 2XKEA 5KNJA 2YIYA 2CHLA 5J79A 5CS6A 3ZLWA 4FI1A 5DG5A 1ZY4A 4QP1A 1Q24A 4KA3A 5I4NA 4ALWA 3LFDA 2YLEA 3QTSA 4G5PA 5KE0A 3IQ7A 5FEEA 3FLQA 3SRVA 2XK4A 4FKSA 5ACKA 1GIIA 2P55A 3NNUA 3R7IA 5D11A 3P23A 1AQ1A 4JQ7A 3UQFA 1MQ4A 4B6LA 3IONA 4EC8A 2E9UA 4NKAA 3WI6A 5B2LA 3RAWA 4D9UA 3NAYA 4GVAA 3SRVB 1L8TA 1RJBA 4UWCA 4ALVA 1IA8A 3ZDIA 1GZKA
chains in the Genus database with same CATH superfamily
4S2ZA 2ETMA 4L6QA 3C13A 1H26A 1PXMA 1ZRZA 3KN5A 4TYHA 3SGCA 4FKGA 5CSWA 4YZBA 4FT7A 1M2PA 5IQFA 1RDQE 5IA5A 3LOKA 5GIOE 1Y8GA 2QG5A 4MH7A 4FSQA 2R3PA 2UZEA 4MXXA 3SDJA 4O82A 5JGDA 4JT3A 4I6HA 1R0EA 5E8ZA 1Q41A 4BBEA 4M97A 4FSYA 4H39A 4PPAA 4LOOA 5BUEA 4E6DA 3UGCA 2OFUA 4K1BA 1QPEA 2CGWA 4LL5A 4RJ8A 2NNWB 1H1PA 4M13A 4XP3A 3CJFA 5CYIA 5KKRC 3EZRA 2GCDA 4EH3A 1BI8A 4S34A 2C69A 4C7TA 1UU9A 3HUCA 3PYYA 4X0MA 4AZVA 4FKIA 3CY2A 5IA3A 3LFEA 2HCKA 2P33A 2QOFA 4G5JA 4FV7A 2RFDA 2HY0A 3FMJA 1YRPA 1RE8A 3DCVA 2IVSA 4DGOA 4QMSA 4RIXA 4I21A 4DFLA 5HIEA 3MB7A 1FMOE 2XUUA 4JAIA 4NTSA 3HV6A 2QONA 5LOHA 3EN5A 1XHAA 3F3VA 3I79A 4FV9A 3BL7A 1YHWA 5C4LA 1HCLA 4IZ5A 3BPRA 3KK8A 3TACA 4OR5A 2WPAA 4BZOA 3DXPA 2AYPA 2H6DA 3EFLA 2F7EE 4L52A 5HE0A 4XV1A 2G9XA 3KF7A 2QNJA 2BDWA 4L7FA 4XMOA 3QFVA 1YXXA 3P08A 4J1RA 4PP9A 4XRLA 4BICA 1W98A 4DGGA 4RGJA 5K0XA 5AUVA 3LQ8A 2ZDUA 3RMFA 4ZTQA 2XK7A 3FQHA 3U6IA 3PIYA 5CLPA 3UQGA 4X3FA 4AZSA 4F9YA 1KWPA 3SW7A 4O7TA 3K54A 2PVNA 3VBVA 1VLRA 4JBVA 3S2PA 3H3CA 4GVJA 5IQAA 2YM3A 3TMOA 1UU3A 4FV8A 3E92A 3NDMA 4X3FB 3NYXA 4DDGA 4ITJA 3E87A 3NSZA 3PXZA 2HZ0A 2ZMCA 1JNKA 4KINA 3UDTA 1PXLA 4GMYA 4I24A 4G2FA 1OL6A 4Z3VA 4FV6A 5BYLA 4V01A 3AC4A 5CEMA 2GNJA 5EOBA 1R39A 5DYJA 1Q3DA 3D14A 4NH1A 2J0LA 3MVLA 4USDA 4YLLA 3FWQA 3OY3A 4I0TA 3OT3A 4U0IA 3PVBA 4O84A 2WMVA 2RG6A 4AFJA 2GS6A 2ACXA 1R1WA 4FBXA 3GUBA 3L9PA 4M84A 4WNKA 4DBNA 1RQQA 3IOKA 1OL7A 5D7AA 4EH2A 5FBOA 3FMEA 2HIWA 3GENA 4AXEA 3GOPA 2QOIA 3RNYA 1ZZ2A 3ZU7A 5A4CA 3A4PA 5DN3A 5EI2A 3U6HA 3CTQA 3FLNC 3VVHA 3MB6A 2J9MA 4II5A 4E3CA 3RI1A 4RZWA 1QMZA 4HYIA 4YTFA 5A14A 3BKBA 4FV3A 5AR3A 2W17A 3O8UA 5J9YA 5A46A 5AUWA 4WO5A 3EB0A 3UBDA 4RJ4A 5HTBA 4IFGA 3P86A 1BMKA 5IISA 5TT7A 3BU6A 5KMIA 4O7WA 4XP0A 2PZIA 3TYKA 5EHYA 2XARA 2WXVA 2WTIA 4DH7A 4LGDA 2AC5A 1ZYLA 4JIAA 3ZLXA 5E1EA 5H2UA 4N0SA 2YIRA 4GK3A 2YM4A 1ZWSA 4DLIA 1ST0A 4PQNA 5EDRA 4EONA 1Y6AA 3PP1A 3C50A 4IB3A 2OIBA 5TR6A 4FZFB 5DEYA 3TJDA 2GQSA 4I41A 5C9CA 4LDTA 4BY9E 4M0YA 1DI9A 3BYUA 4I5HA 3W0OA 3NRMA 4G3GA 1OBDA 2YJRA 3EQPA 1REKA 2IZTA 3ZRLA 4C4FA 4L7SA 3IW8A 3ORXA 3UIMA 5BMSA 4OAVB 1ZMWA 4BWPA 2ZV8A 4U5JA 4NM7A 2Y7JA 3KC3A 1H28A 4RC4A 3EJ1A 2G2IA 4QQTA 5A6OA 3QD2B 4DHZA 4O7LA 3UVPA 4B8MA 1XH8A 2CKEA 3CTJA 3R7OA 3SA0A 2R3LA 3OOGA 3GB2A 4TWNA 5J9LA 2WQMA 4HOKA 2ETKA 1WBSA 3AC8A 1P4FA 2XEZA 3KMWA 4TWCA 2QKWB 5IQGA 2HW6A 3EKKA 5HNIX 2JD5A 4IACA 4ZS4A 2DQ7X 4FTKA 3D5WA 4XCUA 3TL8A 4MF0A 4YPDA 4G31A 4LFIA 4ZSAA 4OTGA 5DPVA 4FE2A 4FIGA 3WILA 3E8NA 4UYNA 5AUZA 4DG0E 4IDTA 3LPBA 3V5PA 3UZTA 1TFFA 3BE2A 2UUEA 4U43A 3KB7A 3QRJA 3MV5A 3Q3BA 5AA8A 5HD7A 2XCHA 1SYKA 2IPXA 5CEKA 4Z16A 5EHLA 5HI2A 2V62A 3T8OA 4L01A 4EOIA 2XZSA 1KOBA 3POZA 5HVJA 3CGFA 4ZZMA 4M15A 1ZY5A 3DA6A 4W4VA 4CFFA 3BQCA 4CLIA 3TUDA 4GJ3A 4HGEA 2J5FA 3COIA 3R8LA 1JKKA 4E6AA 2ONLA 3HAVA 1MRUA 3CIKA 2JBPA 3EMGA 3ERKA 3HGKA 3DK3A 1FVRA 3I7CA 2GFCA 3ODYX 4IM3A 2BZIB 4IWQA 3JY0A 3MDYA 4L00A 1LPUA 3F3TA 4DFUA 1H08A 4AW5A 4DEGA 4AXCA 4YTIA 1NVQA 2JKKA 3F66A 1Y57A 4DE4A 4J53A 1W2DA 2W9FB 4PP7A 4QOXA 2WQNA 4C4IA 2O3PA 4L44A 4IB5A 2V55A 3ZM9A 4QP4A 1OKVA 1JOWB 2C6DA 4C58A 4JMQA 2W99B 5CF5A 4JR3A 4Q9SA 4FTOA 5FGKA 4CFNA 2R3OA 3M42A 2R0UA 4QTCA 3CR0A 4AACA 5CSHA 4EH5A 1OECA 4IEBA 4CZTA 3R8PA 3BEAA 5IMXA 4FKPA 2W1DA 1G8JA 5I9WA 5DHJA 3QU0A 4H58A 3ZO2A 3E8CA 4BTJA 2XM8A 4D1ZA 4CKRA 3OBGA 2BTSA 2OU7A 1V0OA 1OIUA 3FI2A 2IO6A 3Q4UA 5AP2A 5J8IA 4AOJA 4RX5A 1G5SA 3RGFA 4DDIA 4H1MA 3V5LA 2BMCA 3VS5A 4APCA 5AAFA 4DTKA 4KSPA 5A9UA 3ZUTA 3BYOA 3KF4A 3L9NA 4JRNA 2IW8A 2R64A 3C4CA 4C2VA 2C47A 2JKQA 2GDOA 2WTCA 3CEKA 3KCFA 2ZV7A 3KRRA 4FT5A 3CE3A 4HGSA 4IVAA 3DT1A 4L53A 3FE3A 4TRLA 5AUUA 1KE9A 4O91A 3QZIA 5F95A 4R1VA 5FD2A 2YM8A 1PKGA 3IKAA 3GEQA 4U8ZA 1DI8A 2LAVA 3SD0A 1QL6A 4PF4A 5F94A 3NNVA 5AP1A 3PRIA 5G1XA 5LQFA 4ZJIA 3BLAA 4P90A 1ZOGA 5HOAA 2VTLA 4UEUA 2C6LA 4GYIA 2XIZA 4LV8A 1Q8ZA 4W4WA 3A4OX 2ITTA 2BDFA 3IK3A 4FZAB 4ZJJA 2C6MA 5HLNA 3HDMA 2R0IA 4CZUA 2W4KA 5LWMA 4ASDA 4QNAA 3LVPA 4FZ7A 4ID7A 3QUEA 4F78A 3AT3A 4D0WA 4XLVA 2QO7A 3QCSA 4YBJA 5CAOA 3PP0A 4ANMA 1URWA 2VUWA 3BZ3A 3MJ2A 4BDEA 3KXMA 2X39A 5HESA 4YP8A 4FTQA 3KK9A 3NZ0A 2QKRA 3TCPA 3DS6A 2VO6A 3F5UA 3GQLA 5K3YA 3QTUA 4D1XA 2IG7A 2VWWA 3GFEA 2WMSA 3VUKA 5KO1A 3BGZA 4NK9A 4QMOA 5GZ9A 1U5QA 3W32A 4FA2A 4A7CA 5HLWA 1NW1A 1FQ1B 2RF9A 1W0XC 1E1XA 4RT7A 3L9LA 4R1YA 2CSNA 3KIOC 4AGWA 1R0PA 3Q9YA 5BQ0A 5K4IA 4AE9A 4WD5A 4YLKA 4BDBA 5A6NA 4P5ZA 4E5BA 3QC9A 4GV1A 1V1KA 2VTMA 3MI9A 3OWJA 3A7FA 3NUPA 4ZSJA 5CAVA 4O4DA 4RIOA 3VS2A 2PK9A 3DOGA 1PXJA 3CS9A 3D94A 2JC6A 3QF9A 5AR8A 3G51A 4HCTA 2ZDTA 5FQDC 5HGIA 2UW8A 3ZBFA 3O23A 4E26A 5KKRB 2WMAA 3ZHPC 2B54A 4PDOA 4UMTA 4ZTRA 3TN8A 1U59A 3PIXA 5BVOA 3CQEA 3LCTA 3K2LA 4TT7A 1XJDA 5JN2A 4UALA 3FBVA 5LARA 3VNTA 3DBFA 2JKOA 5FLFA 1PJKA 2YISA 4AW1A 2GFSA 4IX5A 4AGCA 1K3AA 3DU8A 3DK6A 1H1RA 2VTRA 2EB2A 2UW0A 2PPQA 1CMKE 5AV2A 2QOBA 3KMUA 2WGJA 4WSYA 1YXTA 2OZOA 3PLSA 2OSCA 3ZSIA 5AIKA 3IOPA 3O7LD 3PY3A 5L2QA 4HJOA 1P5EA 2QC6A 3IDCA 2JBOA 4H3BA 4BYIA 4RA5A 3EN7A 4AZEA 4BIBA 4KIQA 2FH9A 4BZDA 2ZB1A 2R3IA 3DAJA 3NMUF 4AA5A 3H4JA 4FKWA 3F5XA 5E4HA 2V7OA 1BLXA 4H1JA 1TZDA 2OFVA 2ITOA 3GVUA 4EH7A 3TTJA 4AN2A 3W2CA 5A4LA 5C8NA 4CVAA 5LVPA 3JXWA 4W8DA 5IEXA 2GPHA 1M2RA 3PUFC 3C0IA 3ZS5A 4UXQA 5CI7A 1VJYA 3UE4A 2XK3A 3F7ZA 3D7TA 4L3LA 5ETCA 3Q5ZA 4XS2A 2VGPA 2YM5A 3EKNA 3QLGA 4CV9A 3HL7A 5K0KA 4D4RA 5EHOA 5GINE 3HMOA 4C4HA 3LXNA 3LM0A 4YJRA 3COKA 1JKSA 4WA9A 1LUFA 2R3HA 4E1ZA 4E5WA 4FKVA 5AP7A 2BROA 3C1XA 4BN1A 5DIAA 4EOKA 5L2SA 3DFCB 1OVEA 3GC0A 4AS0A 4MQ1A 4BBMA 4GU6A 2UW4A 1Q8TA 4OTRA 2HELA 5CT7A 5CXHA 5BVKA 2NRUA 4CRLA 5EG3A 5HD4A 5HG5A 4RX8A 3DTCA 5KZ0A 4YJPA 4F0IA 4BI2A 1LP4A 2Z7LA 3FL5A 3DJ6A 4P2KA 2XJ0A 1A06A 3LW0A 5FUTA 4D2PA 2HYYA 4EH9A 4QRCA 4CFWA 2QO9A 4IC7A 4IZAA 1GIHA 5JZJA 2X9EA 2XVDA 1E1VA 2O64A 5AA9A 3TT0A 2X0PA 4YTHA 5BVDA 2ZYBA 3RM6A 3LCKA 4FVPA 5EOLA 3UTOA 5HQ0A 5HE3A 4FNXA 2UW9A 1PY5A 4LYNA 3SXFA 4R8QA 2JIIA 3DBDA 2Y0AA 3SAYA 5F9EA 3AD5A 2VX3A 4XV3A 2QLUA 4QP6A 4F6UA 4MAOA 2LGCA 2CGVA 3MH2A 3I5ZA 4YJUA 3DNEA 5GIPE 3U4UA 3VHEA 3G9NA 3IGOA 4NT4A 1TVOA 2IVVA 1VZOA 3OTVA 1OI9A 4AP7A 4EYJA 3V51A 2PVFA 1JKLA 2GSFA 2EUFB 2QCSA 2X8IA 4HGLA 4KWPA 3JS2A 4BYJA 4DFZE 4F1OA 4IFCA 2R4BA 3IW7A 2WTDA 2BKKA 4JS8A 4O83A 4L67A 2Z7RA 3FSKA 3KXZA 3G0EA 4FT0A 4BCKA 3EWHA 1UWJA 2E9VA 4DINA 2A1AB 3T9TA 5C27A 4M69B 2VX0A 3LXLA 4FYOA 1PYEA 2XIRA 4CSVA 4DG2E 3R00A 5GNKA 2O2UA 2WOTA 2OH0E 4MBJA 4E5AX 3NS9A 5E8XA 1Z5MA 5H3QA 5CEQA 2XIYA 3A61A 3D4QA 4F9CA 2B55A 1XH4A 2Y4IC 4CNHA 1W2FA 3L1SA 3IW4A 1XMMA 2ITYA 4E93A 5AM6A 4DGLC 2C0TA 4E4MA 4FKJA 5CSXA 4C4EA 2J50A 2GU8A 3EFJA 3MH3A 5CVHA 4GKIA 3NUUA 4TTHB 3I81A 2FGIA 3V01A 3DBEA 4E4NA 3R73A 4BC6A 3VQUA 1QPJA 4YO4A 4R3RA 3Q9ZA 3DLSA 2YCSA 2V22A 2UZLA 2A4LA 4G9CA 3VS6A 4CQGA 4MNEA 4RFYA 3T3VA 3NR9A 5FM2A 3NUXA 3UNJA 3QRTA 2C3LA 4HPTE 4EJ7A 2X81A 3MA3A 4QT1A 5BYZA 4CT2A 3OUKA 4QMYA 4YZMA 2UW7A 4QTEA 4R78A 4IB0A 3E64A 1WZYA 4F9AA 4R6VA 2I1MA 2ZVAA 4HCUA 5D12A 3AD4A 1YDSE 1Q4LA 4OT5A 2EVAA 2B7AA 4FSMA 4JG6A 4RJ3A 2C5XA 3UVQA 3Q9XA 5L6WL 4D2WA 5I3RA 4XUFA 4AU8A 4E4LA 3I0OA 3HYHA 3A7JA 3CXWA 4OBOA 4FYNA 5KMMA 3VIDA 2R9SA 3CQWA 3MFUA 4QTAA 2OBJA 3IW6A 4ALUA 3S4QA 4QPMA 2XS0A 2CLXA 3MPAA 5E7RA 3WBLA 3PWYA 4AAYA 2VRXA 4K18A 4MBIA 5IA0A 3VAPA 3VBQA 3QZFA 4EH4A 2PUPA 3ZC5A 1MUOA 4KRCA 5IMEA 2IVTA 1GY3A 5EYDA 4B99A 3TUCA 1PRYA 4ASEA 3KVWA 5HO6A 3C5UA 4FEWA 2CNQA 3M2WA 3FMDA 3GU5A 3PG3A 4WHZA 4YJNA 4O7RA 3DJ5A 5E8TA 3V3VA 3LFCA 4FZDB 1H4LA 1O9UA 3JUHA 4BHNA 3BYVA 2G01A 3FKLA 2YJSA 4XG7A 4U3ZA 3HV5A 4R7IA 5LJJA 3BHHA 2C0IA 3FLYA 5H9BA 4F6SA 4HPUE 2PZ5A 4GH2A 2XKCA 4IX4A 3E8EA 3OCGA 4D2RA 3O51A 4G6LA 2OJ9A 4K8AA 2QHNA 3VWAA 3QKLA 4Y8DA 3HP5A 5DGZA 1OKYA 3PPJA 4WNPA 5BV3A 4HVIA 4LGHA 1EH4A 5EW9A 4USEA 4DEDA 1G8SA 4OTWA 3GC8A 2X8EA 2ITWA 4FTRA 3GNIB 3R63A 4DEIA 4Q5HA 4CKIA 2VNYA 5DNRA 4EK8A 3VJOA 5AIRA 3MFSA 1UV5A 2OZAB 2ZV2A 3C4WA 1OIRA 3DQXA 5E9EA 4FK3A 3EL8A 3QQKA 1GZ8A 4O0RA 3PY0A 3FAAA 4O21A 3THBA 1KV1A 2GQRA 3KFAA 4ZS0A 3TNWA 4MYGA 4CD0A 1J7UA 3OT8A 3AKKA 4RPVA 4TW9A 4GU9A 4K11A 3OW3A 4D9TA 3UNKA 3FY0A 3R1SA 4TYIA 4AT4A 2XJ2A 4YNEA 4JXFA 2IJMA 4ACCA 3TKHA 2R3RA 3C5IA 2WQEA 3FLWA 3CD8A 3GC7A 1H8FA 3QUDA 4BDIA 4UXLA 5ANDA 5FG8A 5IA1A 3R1QA 4CCUA 2O8YA 1OKWA 3B8QA 4FRFA 2JAVA 3A8XA 2BZJA 4XRJA 4A9RA 3WZEA 4GJ2A 4AQKA 1XO2B 1WVXA 4KS7A 2P2IA 5L2WA 5LCJA 4JG7A 4EOQA 1IAHA 2XNEA 4FL2A 4IWDA 4LL0A 4NTTA 3P7BA 5HICA 3W8QA 1R3CA 3TV6A 3UDBA 3VQHA 3BRBA 1E9HA 5HNBA 1YVJA 2P4IA 2R3MA 3HRBA 2GHLA 4NWMA 3ANRA 1JLUE 3ZEWA 2OLCA 4FSUA 4LMUA 2QQ7A 3G5DA 3G6GA 4FOBA 4QQCA 3WE8A 4FEQA 2XCKA 2YM7A 1SNXA 1FVTA 4YO6A 4WT6A 4ZSEA 4A9UA 5GJFA 2UV2A 3Q4TA 4JL9A 3QQGA 5TKDA 3R7EA 4BJJA 1O6LA 4DC2A 1I44A 4FEVA 5EM6A 3OCBA 2BFYA 5L8KA 2B1PA 4HW7A 3MY0A 4ERWA 4QYYA 3F3UA 3ORNA 2O63A 4TYHB 4FTAA 2QLQA 4O96A 4D2TA 2PUIA 4BJJB 1YXSA 4RX9A 2WMTA 3AC2A 3QQLA 4V0GA 5AR2A 4EK3A 4ASXA 5JEBA 3FMLA 2BTRA 4LI5A 3HX4A 5AM7A 4LRKA 3S95A 2WB8A 3R7UA 4BR3A 3R8MA 4D5HA 4GW8A 3TKIA 4HYUA 4PMSA 4V0GB 3R83A 3D5UA 4FTTA 4DITA 3VS3A 3UP7A 4LOQA 5ANEA 4U79A 5CNNA 5FXSA 1H24A 2JEDA 4W4XA 2R3KA 4EC9A 3EFKA 5KBQA 3SG9A 1BUHA 3BV2A 4UY9A 4ZK5A 5LWNA 3TKUA 2BHHA 3O5AA 3QCQA 3BU3A 5CU4A 1ZAOA 4CYIA 5HU9A 3ATTA 5CWZA 3R9DA 5ETIA 2JFLA 4FF8A 1UA2A 3VUIA 4HCVA 4CMTA 4RSSA 4EQUA 2UVYA 4O0SA 2X0GA 4EYMA 3ORKA 4GT5A 2J4ZA 4JBQA 3WYXA 5D1JA 1Z9XA 3AG9A 4FG7A 1BX6A 2GHMA 3BHVA 3GCQA 3I5NA 4RIXB 5E8SA 4O2PA 2XNNA 4CLJA 3F5PA 5K5XA 3VBXA 4ANNA 4G16A 2Z2WA 3FMNA 3O7LB 2UW3A 5CEPA 4XLIA 3E5AA 4MX9A 4A9TA 4ZZNA 5CF8A 4PMTA 3K5UA 1KV2A 3LJ0A 4S32A 4ZLYA 4WOVA 2C6IA 3FZRA 3LHJA 3TZ7A 3BBWA 4EBVA 3VF8A 4PRJA 5I9VA 3BHTA 4FSRA 2YN8A 4KBAA 4LV5A 2GS2A 4L43A 5CVFA 3QGYA 5E1SA 3RHKA 3W0PA 3RK7A 3ZSGA 4UN0C 3RAIA 5IEVA 4H36A 3W0RA 4BKYA 4CT1A 4TYEA 1U4DA 2H34A 5D41A 3B2WA 2F2CB 3C7QA 3MH1A 5EDQA 2EXCX 5AR7A 2UZTA 4C36A 3AT2A 2GTNA 4JJRA 2XANA 3HP2A 4O4EA 2IZRA 3FDNA 4IZ7A 3R0TA 3FKOA 4IAIA 3OFMA 2XNGA 4HNIA 3HEGA 4W9XA 3CKXA 4FUYA 4MQ2A 2YWVA 1DS5A 3U9NA 4WUAA 1S9JA 3CC6A 3W0MA 4Y73A 4TWPA 4KIKA 5L8JA 4GK4A 4C33A 1BL6A 2I0VA 4M3QA 2YITA 4IH8A 3D2KA 4IAFA 5HG9A 2WIPA 2YLFA 4C37A 4AE6A 2C1AA 2J0JA 3ZEPA 3WZKA 1CDKA 1ZLTA 4KIKB 4YR8A 4JNWA 4PTGA 3EQDA 4MD7E 3VONA 4G17A 3OS3A 3QTIA 5EI8A 4RVLA 4FIEA 4A4XA 3H9FA 1B6CB 2YDJA 3NUAA 4F7NA 3PA5A 3AMBA 2X6EA 2Y9QA 4O7NA 3DJ7A 4H05A 3A60A 2PUUA 3OWKA 5AMNA 1UU7A 4BCOA 5EH0A 3NNXA 3ORIA 3NCGA 4WRSA 1YWRA 4YPSA 5JK3A 1U54A 3RK9A 5HBJA 3FLSA 3PXFA 4HGTA 5CU6A 3ZO1A 2W1FA 1FPUA 3E62A 1OL1A 1JWHA 3DDPA 4PUZA 3JR1A 3RK5A 4AXFA 3VRZA 2BCJA 4G3CA 1ZYJA 3JVRA 5CT0A 5FDXA 4YMJA 4DG3E 4E8AA 2XNPA 5KBRA 2PVRA 2VTOA 1PMVA 2PE2A 5IU2A 3U51A 4X6QC 2W5BA 1OZ1A 2BPMA 1UNHA 5EQEA 5HX8A 1K9AA 2JDRA 4S31A 4JX3A 3VS1A 2B0QA 4EK4A 3QQHA 3GCVA 3F3ZA 4F1MA 3C0HA 3HAMA 3MVMA 4A9YA 3SHEA 1JQHA 3QA8A 4U3YA 2PVKA 5FTQA 5CALA 3LXKA 4F9WA 3EQGA 4PDSA 5DBXA 4RA4A 3KN6A 4AZWA 4ZZOA 4O0UA 1H27A 5BPYA 3G2FA 3DFAA 3A2CA 3PJCA 5CU0A 2YWPA 5ANJA 3BEGA 2VN9A 5ITAA 4YC6A 3L8SA 5H8BA 3SVVA 5F4NA 1FOTA 4JQ8A 3P7CA 5A54A 2CGXA 4FTIA 4YJOA 1OPKA 3F2RA 1B39A 4NCTC 4YC3A 3FI4A 4IX6A 5I9XA 3ODZX 5IUHA 2IF8A 5CVGA 4AQCA 3FSFA 2QHMA 2XK6A 3OWPA 3BGPA 2YACA 4IVCA 4G3DA 2Z7QA 4TYJA 1V0BA 2I0EA 1CM8A 5EQYA 3HV4A 2UZNA 3U6JA 4EJNA 4EWHA 1PW2A 3UO4A 3EN4A 1U46A 3CJGA 3W2RA 2PVYA 4BDAA 5ANOA 2YABA 1JVPP 2A19B 4FMQA 3Q4ZA 2ITQA 4GFMA 2VTAA 4ARKA 4IWPA 5HG8A 2CN8A 1A9UA 3FL4A 4Z55A 4MNFA 2X7OA 4EOSA 4BGQA 1ZARA 4OGRA 4Y46A 5JMSA 2HWPA 1Q5KA 1DM2A 5EKOA 4AT5A 4C3RA 5CASA 5EYMA 2CN5A 3KREA 4UWBA 1CKJA 1SVGA 2C6KA 1L3RE 4M66A 3OC1A 4BCQA 3Q04A 4FSNA 3QD4A 5ANIA 4QP9A 1SZMA 3G0FA 5BVWA 3OEFX 4KNBA 3TDVA 2WELA 3NIZA 4M8TA 2VWUA 2B9HA 3CTHA 2PU8A 5BUIA 4IADA 2WEVA 3GQIA 5I9YA 3RINA 5FTGA 4QMLA 3K3JA 3U9CA 4F65A 4ZTSA 5HORA 4O0WA 2W06A 3T9IA 1PMUA 2C6EA 3WYYA 4HZRA 3AOXA 1MRVA 1UWHA 4FODA 4CXAA 2AUHA 4E6QA 3ETAA 3V5QA 3WF6A 1ZMVA 2J7TA 5J5TA 1WVYA 3QKMA 5J7BA 4E6CA 4BGGA 4QMPA 3H9OA 3QAME 4OTHA 4J7BA 4FL3A 2JGZA 2X7FA 3BBTB 5HBEA 4YHTA 4XHKB 4PTCA 4XEYA 4L3JA 5FBNC 2O5KA 2XJ1A 4FKOA 2CKQA 3HMNA 4CKJA 1J1CA 5KZIA 1UNLA 4RRVA 4X2JA 4JDHA 4KKHA 4GFOA 3UOJA 2NP8A 2WTKB 2XK9A 2OXXA 4PY1A 4YSJA 1FGIA 1OGUA 5AV1A 3FZTA 3KRJA 4PL3A 3MVJA 1W7HA 3HA6A 3V5JA 4F4PA 4KABA 3VRYA 1Q97A 1JPAA 1SMHA 2G2HA 2XIXA 3EQCA 4O1OA 1R78A 5K5NA 5BVEA 4RMZA 3WZUA 4O81A 4XG6A 5CU2A 3RPSA 4ZY6A 2ITUA 2A0CX 4ZJVA 5CU3A 3TZ9A 5IUGA 2VWYA 4FICA 5CI6A 3ORZA 3UQCA 4I0RA 1W82A 2BHEA 2R3QA 4NSTA 4UB7A 3OXZA 3R01A 3VW6A 5E90A 3G6HA 3TV4A 3OY1A 3VBYA 2J5EA 3ROCA 3MTLA 4OBPA 3SLSA 3I7BA 4FKQA 5LVNA 4TNBA 4AZFA 1XBAA 2PWLA 4TZRA 3W1FA 2QOLA 5A4EA 4F63A 1Y6BA 3F88A 4F64A 4GFGA 2X2MA 5IQCA 4I4FA 3ZSHA 2FSTX 5CTPA 1IEPA 3GC9A 4XX9A 4C35A 4TL0A 5L8LA 4G1WA 3UPZA 4UMPA 5C8KA 4FTJA 5M08A 3H9RA 1KE7A 2HK5A 4Y72A 2XF0A 3WE4A 4EOMA 4QMXA 3LMGA 4CRSA 3TNPC 4CFMA 1SVHA 2Q0NA 4QMVA 4YBKA 3DB8A 4YC8A 3SQQA 2VO3A 3EHAA 3E93A 2B9IA 1ZYDA 5M55A 3OBJA 4C57A 3ZC6A 4L9IA 4DF3A 3VUTA 2P2HA 2PZRA 2RL5A 2W05A 4U97A 2BAQA 3UOHA 3KU2A 5CF4A 5JKGA 1DAWA 5M4FA 4I5CA 4M7IA 4S33A 3FKNA 3PG1A 3QRIA 4FTCA 4RVTA 2VNWA 2ZB0A 4C3FA 2YAKA 4JBOA 2Z02A 2VTNA 2JKMA 5LVLA 5ICPA 3V04A 3ZLYA 2G2FA 2DYLA 4FJVA 2WMXA 1KUTA 4UWYA 3A7HA 5JFSA 3E8DA 4AUAA 2GS7A 4GS6A 3DV3A 3MA6A 3FHIA 4O4CA 4UBAA 4XP2A 2BIYA 1J1BA 4MHAA 2BALA 4NM0A 2XIKA 3ZFMA 3DBCA 2W1EA 4A06A 1BYGA 3TZ8A 1IAJA 2XA4A 5HO8A 2PMNX 3F3WA 4QDVA 4PWNA 4C0TA 2C5OA 3FY2A 4BI0A 3MH0A 4I23A 4R5SA 4KKEA 5AJQA 4BGHA 5JRSA 3PY1A 4LOPA 4FC0A 3ZXZA 5DFPA 2YZAA 3R6XA 5C1QB 3E63A 3VS0A 2XP2A 5IQBA 4R7HA 3DK7A 1YDTE 4V05A 1F3MC 2J2IB 3FXXA 4JR7A 4ZY5A 4FKRA 1HOWA 5DEWA 3ZH8A 2C5VA 2EXMA 2OH4A 2C5YA 3ZZWA </