4ZTHA

Structure of human p38amapk-arylpyridazinylpyridine fragment complex used in inhibitor discovery
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
350
structure length
339
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Structure of human p38aMAPK-arylpyridazinylpyridine scaffold complex used in inhibitor discovery
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 115
structure length 339
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zthA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zthA01
4UWBA 3ORTA 4EH6A 5DRBA 5HG5A 4TY1A 4O0RA 4RVLA 3RNYA 2HW7A 3ZSHA 2Q0BA 1Y6BA 2Z7LA 5ANKA 4XOZA 5DWRA 4J96A 2GNHA 2WQMA 4K1BA 5EDPA 4NJ3A 3DJ6A 3TZ9A 3CTJA 5AMNA 3MB7A 3QRKA 5IH6A 2BFYA 3EQBA 2W1EA 3ZLYA 3P86A 2XUUA 4QOXA 2JD5A 1TVOA 2YFXA 3EFLA 4XYFA 3G90X 4R7HA 4ONAA 4D28A 5KUPA 3RK7A 3WF5A 1YHWA 3PJ1A 2C1BA 4RA5A 4MBJA 3VS2A 3W2CA 4F1TA 4O7ZA 1DAYA 3R9RA 4DFUA 3FLSA 4TWNA 4E26A 4FE2A 2YIQA 2ZM4A 5L2IA 4RZWA 3LCTA 5I5ZA 4ASEA 3E7VA 3LJ1A 4DEGA 4HNIA 5I3RA 3UO4A 3FKOA 4XLIA 2ERKA 5AJQA 4C34A 4F0IA 3O51A 2YAKA 4L52A 2P2HA 3TDWA 1IR3A 1U59A 4P90A 5GINE 5AAGA 3TNIA 4F0FA 4WO5A 4U79A 2JGZA 4CFMA 5H3QA 4YJSA 3UOKA 3MFSA 3Q53A 3QTRA 1MQ4A 4AXAA 4IX5A 4ZAUA 5FDXA 4EH4A 2WIHA 4BKYA 4FV7A 2J0JA 4FYNA 2FH9A 1ND4A 5CU2A 2GNFA 5M57A 2UZNA 2IW9A 4Z55A 2VTIA 4IADA 4QPMA 2GPHA 4CYJA 1KV2A 5IA4A 2OXXA 1OECA 3DY7A 3FUPA 3KL8A 1BI8A 4E6AA 3DNDA 3UOHA 2CNVA 2OIBA 3Q2MA 5CSPA 3ZC5A 3QQLA 4GKHA 3BEAA 4DG2E 4IFGA 4UMQA 2OZOA 5FBOA 1FBNA 4EOIA 1OL7A 3G9LX 2PVKA 3F3UA 5HD7A 4L3PA 5IISA 5L2TA 2WO6A 5FXSA 4MK0A 2ONLA 3MWUA 2W1GA 3MJ1A 1ZMVA 3NS9A 2DS1A 3OWPA 4QP7A 5A4CA 1ZRZA 2WMRA 2Z7QA 1CKJA 3C4CA 4O7YA 3VS7A 2O63A 1MP8A 4H3QA 3MESA 3QX4A 4OT5A 5AP3A 2QOHA 3UVQA 1RJBA 2WXVA 2CMWA 2J5FA 2EVAA 3DAJA 3GCQA 4YO6A 3OCGA 3BU5A 2C6KA 2OU7A 2XNEA 3D2KA 5AV2A 4F09A 2WTKC 3PY3A 4B0GA 3E93A 4PDOA 3NUAA 4LOOA 3ORIA 3UIXA 4PL3A 2OLCA 4FEUA 4QQCA 4BCGA 3HMOA 2OF2A 3WYXA 4DC2A 2YCFA 2UW5A 2QU5A 5A4TA 3H4JA 4DH3A 1ZZ2A 4YZDA 4ZTSA 5CF4A 4L46A 3L8VA 3D14A 3M42A 4KBKA 2IZSA 3VUTA 4MD9E 3SAYA 5M4FA 2XP2A 5K5NA 2X1NA 5I9XA 2R5TA 4UMTA 2VTAA 2X7GA 1GZOA 2PZ5A 4RQVA 4RX7A 1Q3DA 4DITA 3LXKA 3U51A 3WIKA 5KZIA 3GB2A 4Y83A 4Z7GA 2FSLX 2H34A 4XP3A 1Q8YA 4A9RA 4FVRA 3ZSGA 3PSDA 3QAME 4FICA 4P5ZA 5FD2A 3R00A 4G6NA 3WYYA 4P7EA 3I79A 3OCBA 4C8BA 3CXWA 3EQPA 4W4VA 1PJKA 2E9NA 3TV6A 2YM3A 5BVNA 5CU4A 2XM8A 5LXMA 3KRLA 3L8PA 5A4LA 4U97A 3M11A 2BALA 3R7OA 4USFA 3FLQA 3LVPA 2IVUA 2ZB0A 3HLLA 5BUIA 3TZMA 4E6CA 4UV0A 2XF0A 3I7BA 4I21A 1PKDA 1DAWA 3FMHA 3QRTA 4XV9A 2BRGA 5K4JA 4ITJA 2DYLA 3A61A 3CBLA 2QR8A 3ZRLA 5A54A 3LFSA 1YOJA 2OBJA 3FWQA 4OGRA 2JDSA 4EORA 2XYUA 3KREA 4IWPA 3CTHA 4I20A 2BDWA 1UU3A 3H9OA 4EK5A 4XBRA 3F3ZA 4RIOA 4AWIA 4R5SA 5F20A 4D2VA 2OSCA 2BAQA 4QMMA 4QMZA 2HZ4A 3TEIA 2XZSA 3MY5A 5CSHA 4KRCA 1OBGA 3SHEA 1ERKA 4CZYB 4PDSA 2IZRA 2JAMA 3R8VA 1YDTE 3UQGA 3MA6A 4J98A 4EOMA 3MYGA 1UNLA 1PXMA 2NRYA 4JJRA 3IECA 4ANOA 4QQTA 3QX2A 3EQRA 4KIOA 4RJ4A 3U9NA 2C5NA 3WOWA 3VBVA 4I3ZA 4MH7A 3OFMA 4U44A 4CSVA 5EYCA 3OTUA 3CLYA 4LUDA 1VYWA 1K9AA 3DBQA 4M69A 3HA6A 4NM3A 2Y9QA 4FA2A 2YIWA 3FI2A 4ACDA 3RAWA 4M69B 2XA4A 3ZU7A 5E8WA 3R7GA 5D41A 4UY9A 4APPA 4Q5EA 2ZDTA 1T45A 5LVLA 5CEIA 5LVOA 2RF9A 1P5EA 3UZPA 1H1QA 2VWIA 5AA9A 2JDVA 4BVUA 2ZV2A 3R63A 3CJGA 4FZDB 2OIQA 4XS2A 4LYNA 5BMMA 4E5WA 5CF6A 4TW9A 4CRLA 2VTNA 4U9AA 4D1ZA 4BZNA 4IWOA 1OL5A 2ITTA 4BCNA 3E8CA 1UU7A 3V6SA 4C36A 4ZMEA 2QOIA 4FKQA 1FVRA 3AT2A 1H4LA 2IO6A 4P5QA 5LMBA 2YM5A 2PVHA 4EOSA 4PWNA 5AP5A 3W33A 4BZOA 5IEXA 1L3RE 5IQIA 2PTKA 2B9JA 3EH9A 4BL1A 2CKOA 3VS6A 1YHSA 3NPCA 3L9NA 3AXWA 2BIYA 3EOCA 5TO8A 2BAJA 2RFNA 3AC5A 2PU8A 3Q9XA 2QO2A 1SYKA 4LGDA 3SRVB 4EQUA 2QO9A 4TNDA 4FSNA 4QP2A 2PYWA 3GGFA 3HP2A 3VF8A 2WHBA 1WZYA 3JY0A 2QLQA 3DAKA 4GYIA 4IVBA 4OTIA 3RCDA 4M67A 3PA3A 2UZEA 3ACKA 2F2CB 2JEDA 4UN0C 4CG8A 2G2IA 5B2LA 1Q62A 4CG9A 5AP7A 3WZUA 2C6DA 4RWIA 3BE9A 4DYMA 1W8CA 4DLJA 4QQJA 4DTKA 2EXMA 2XKFA 4QMLA 1PMUA 4FL1A 3BV2A 5IA1A 3FXWA 3QCXA 5CI7A 4OAVB 4QT1A 4RX5A 4KABA 5GZ9A 4A9UA 3C4FA 5FGKA 4ZJJA 4QYYA 1H1SA 4KKGA 4HNFA 2PVYA 3PWDA 3SA0A 3W2PA 4D4SA 3NZ0A 5EFQA 3HA8A 5EW3A 4AZSA 3MVJA 4JLCA 3KVXA 4FT0A 4BICA 3UNKA 3ATSA 4FGRA 4J1RA 3GC7A 4G9RA 3DT1A 5M4UA 3A8XA 4IM3A 3R7YA 3AD4A 4KBAA 2QHMA 5DRDA 4F9YA 3ACJA 3D5UA 3GI3A 3S3IA 3PE2A 4D9TA 3FJQE 3QD3A 4FNYA 4GG7A 1YWNA 4W4WA 2Y8OA 1KE6A 3QYZA 4CLIA 5IMEA 4C7TA 4O86A 1JKTA 4BDJA 4CFFA 1KV1A 4IDTA 4BI1A 2PZIA 3ZFYA 5AP1A 4KUJA 5CI6A 3LJ2A 2B4SB 4EH9A 4IC7A 1IAHA 3ORLA 4APCA 4PX6A 5K0XA 1YXXA 2W1DA 2VGOA 2X8EA 2YM7A 4Y8DA 5LMKC 3ANRA 1OVEA 2C0OA 4KWPA 1I09A 4PL4A 3QLFA 5BVOA 5IA3A 2I6LA 3GC8A 3QZFA 4DF3A 4PMMA 3UVPA 4A4LA 4XG4A 1TKIA 4XHKB 3MIYA 4C4HA 1Q8TA 2P3GX 2YLEA 3IW7A 4DEHA 4BDDA 2J5EA 3QQKA 5I9YA 5JRQA 4NCTA 4DBNA 3AOXA 3CGOA 1B38A 3B2WA 2W9ZB 3TNPC 5IG1A 2RFEA 4QYHA 3UP2A 2YEXA 5BNJA 3E92A 4R7IA 4AW0A 4QYGA 3GU6A 3KXXA 3NUSA 5AV4A 4NTTA 3UC4A 5M55A 4YPSA 3QFVA 4ZTNA 4G3CA 5JRSA 5T68A 3A8WA 5CWZA 4D4YA 3RALA 2O64A 5FG8A 5IA2A 2WMAA 3V8WA 2O2UA 3B8RA 5CANA 5ANJA 4FEVA 2VWZA 3LE6A 4HGSA 2WIPA 4XG6A 2FA2A 3HUBA 4QMUA 4ZJIA 3VAPA 3ALNA 4HPTE 4HYHA 4NM7A 2YA9A 5DBXA 4FT7A 2QOLA 4TTHB 2LAVA 1ZMUA 3BX5A 4L42A 4BCPA 1PXNA 2GQGA 4BFMA 5GZ8A 4GUEA 4CTCA 1YQJA 5KO1A 4BDFA 3DDQA 4DBXA 2C0TA 4FEWA 3CPCA 3LPBA 1GAGA 2F2UA 3QXPA 4FTAA 4JNWA 4XRJA 4ZZNA 4YC6A 3Q4UA 2HIWA 1MQBA 3ZYAA 2ERZE 2WMUA 5FTGA 3FZRA 3W1FA 5HE3A 1PMEA 3SOCA 4PDPA 3UG1A 5KMMA 2YJRA 4BBMA 5BVKA 4C62A 1HCKA 4P4CA 2Z02A 4C33A 3B2TA 1QL6A 2BKKA 3OCSA 4JAIA 3ZO4A 1CKIA 5DGZA 4X2JA 3RCJA 2B1PA 4DFLA 3F6XA 1BL7A 1GJOA 3VBQA 4BWXA 1EH4A 3NNXA 2PMLX 2XYNA 4ID7A 1KUTA 3C4XA 2ACXA 2YIXA 2RGPA 3OEFX 5EI8A 1ZYLA 4GU9A 4JDKA 3KRXA 2GTMA 3U54A 1YW2A 2XIRA 2YZLA 4HJOA 3P7AA 2C5YA 4QNYA 3V5PA 3WIGA 4ASDA 1JBPE 3R71A 5HZNA 5M4CA 5FEEA 2PMNX 4CCBA 3NNWA 4MXAA 5IZFA 4ACCA 4EONA 2YABA 3L9PA 4I6QA 2PMIA 4CFUA 3KN5A 5EM7A 2UW8A 2Z8CA 4XG2A 4ZLYA 3KY2A 2Z2WA 1VJYA 3RAHA 4F70A 4PP9A 2I7QA 4AZEA 2BPMA 3BHHA 3GBZA 3PRIA 4FL2A 3TTJA 3ZBXA 2WFYA 4WG3A 4DN5A 3DCVA 4X3JA 1DI8A 5KMKA 3CD8A 2PK9A 3R6XA 3RI1A 1MRYA 4PTGA 4IVCA 4S30A 3R83A 5DVRA 2W1CA 3TZ7A 4EH3A 4PP7A 1ZZLA 1R78A 5HKMA 4L6QA 3TNHA 4F9BA 4NM0A 5IUHA 3MBLA 3TG1A 3QCYA 4D4RA 5EHOA 5JQ5A 1JVPP 3RINA 5IQAA 4FKWA 4MHAA 4C2WA 4FVQA 3BLHA 1JLUE 2IW6A 4NT4A 4W8EA 4CT2A 3ORNA 3KB7A 4YUQA 2W05A 3JVRA 4JBQA 3F2RA 3V5LA 2BZIB 4QMTA 4RT7A 3LM0A 2FVDA 3V5WA 4ANQA 2OZAB 5GJGA 4C59A 2BCJA 5DHJA 3ZDUA 4C02A 5J95A 3BYSA 4ALUA 2I1MA 1NT2A 5IUIA 1QPDA 5TT7A 2YN8A 3BBWA 2BRNA 2BHEA 5FM2A 4AOIA 1CM8A 2VO7A 2C6EA 3AMYA 4ZP5A 4ANSA 5I0BA 3P0MA 4KBCA 2Y4PA 1FINA 1R0PA 2WMBA 4FKGA 1VYZA 4LGGA 4CFXA 3HX4A 5TF9A 4NKSA 3LCOA 5C1QB 3WE4A 3UDBA 5HLWA 4FV1A 2W5AA 3C4WA 2Z60A 5CVFA 4IZ5A 4BKZA 3NVMB 2J2IB 3DXPA 4FZ7A 3WF8A 3F61A 2PHKA 5J7HA 1U54A 3L9MA 2CPKE 2BMCA 4RQKA 3NYVA 4FIEA 5KHWA 3UVRA 2YISA 3NAYA 3QTUA 2QOFA 3PJ2A 4KA3A 1WBSA 4AP7A 4B4LA 1AD5A 3LMIA 5HVJA 4RX9A 3EFKA 5D7VA 4IB1A 3GU7A 3ZRKA 4UMPA 5I4NA 5C26A 2OFVA 1UWHA 4YTFA 2C3JA 4IB5A 3ZO1A 4ZIMA 4E5BA 4G2FA 1WBWA 4A9SA 3E7OA 5CVGA 3VN9A 4DFBA 4GT5A 3HRFA 4AA0A 5EK7A 3HMIA 5HTCA 1SVEA 1XKKA 2VWUA 3BYMA 1XH5A 4FYOA 2B7AA 5DT3A 5IF1A 3TJCA 5M4IA 1ZY5A 1GZ8A 4BB4A 4D5KA 2B9IA 3N51A 3NW6A 4E93A 4I5MA 4Z16A 2QKWB 4X0MA 4JBPA 4M3QA 2OJFE 5B2KA 2QU6A 4YJOA 5ANGA 4G16A 3MY1A 5D9HA 4Y95A 4KIQA 4HZSA 4E73A 4RLKA 4BKJA 4O82A 4K8AA 3Q4CA 4U5JA 5H8GA 2C5OA 4H36A 4D5HA 4YO4A 5J7BA 4FV2A 5J79A 4AF3A 4HW7A 4YHFA 5KKRC 2VN9A 2G2HA 3HL7A 5EHYA 4BIBA 2X39A 3V04A 3U6HA 3UO6A 3IW4A 4FI1A 4ARKA 3PJ3A 3BZ3A 4G3DA 4OTHA 5ANOA 5HTBA 3A4OX 3MDYA 3L8SA 4UZHA 5E8VA 4GKIA 1UKHA 4RC3A 2JBOA 4BR3A 4D9UA 2WGJA 2VNWA 4AX8A 1M7QA 4O7LA 5BVDA 3UOJA 4S33A 5EYMA 3W55A 4DFXE 3MVMA 1G8SA 4CGAA 2B0QA 4AT4A 4RJ7A 4KSQA 3LKMA 3ZLXA 4ALVA 3SGCA 3EYHA 2VTSA 4H58A 3T3VA 1XHAA 1OL1A 4F99A 3CGFA 5HU3A 1IAJA 2UZBA 2VNYA 4O0TA 4X2KA 4TNBA 4MD7E 2QC6A 2C6LA 2VWBA 2QOBA 4KSPA 3FDNA 3LZBA 2JLDA 3E64A 1OIRA 1XO2B 3KCKA 3ORKA 4C35A 4IWDA 2GS2A 3E3PA 2GHMA 5FP5A 4WHZA 3R8ZA 3LXPA 4KKEA 4L44A 3KULA 3R8UA 4BTFA 3FL5A 5CAVA 3FY0A 3JVSA 4U80A 4D2RA 4F63A 4ZSAA 3P4KA 3KK9A 3UZRA 1UU9A 3BU6A 3NLBA 5AR8A 4BIDA 3EQIA 3KULB 2QLUA 3V8TA 1U5RA 4BHNA 3FYKX 4DT8A 4IZYA 4NTSA 5LVMA 4FIGA 1OKZA 1FMOE 3SC1A 4N6YA 1JSVA 4G9CA 5AR3A 4EZ3A 5B2MA 3VQUA 4QP3A 1IA8A 4CT1A 4FOBA 4BCHA 4FKTA 4FK3A 3C7QA 3Q2JA 4UALA 3FAAA 1FGKA 2JITA 2W4JA 4FUYA 4E4MA 5J9LA 4OAUC 2PVLA 3ENHA 4YC8A 4BCFA 4NWMA 1J7UA 4R78A 3SOAA 3MH1A 4JX3A 2E9PA 4HVDA 2CSNA 3OWLA 5AX9A 4FTQA 3RAKA 1WBPA 1S9JA 3MIAA 3SXRA 3KK8A 3PA5A 5D1JA 3ANQA 3QD4A 4JIKA 2R3NA 3DBDA 3NUYA 1KE7A 4EC9A 4OUCA 4ZMFA 1KE5A 4MBIA 2C6MA 4H3BA 5J8IA 4DEAA 1NVRA 4AT5A 5CAQA 2HAKA 5LCKA 1LUFA 4YHJA 1PXLA 1PKGA 3SQQA 2PVJA 2WOTA 4I4EA 4KIKA 3WF9A 4CMOA 5TE0A 4TYHA 4EOQA 2VTHA 4IH8A 5DLSA 4KIKB 2C47A 4FSYA 4QPSA 5E8SA 4U41A 2QG7A 1M2QA 3NW7A 2OICA 4QMYA 4NFNA 5DNRA 3WF6A 3ZZWA 4GCJA 5IQDA 4FTMA 2B53A 3CQEA 1P4OA 3QZGA 2WQBA 4U0IA 2F9GA 2WMVA 2WZJA 4MF1A 2X6DA 4L8MA 3R2BA 3LLTA 1ATPE 1Y8GA 2DWBA 2YCRA 3PG1A 3PXRA 4FTJA 4EUTA 3FMJA 4ZSGA 3NUNA 2ETRA 4D4VA 4X7QA 3TN8A 4PMTA 4YC3A 3D9VA 4U7ZA 2YDIA 1HCLA 3C9WA 4D1SA 3HDMA 3CCNA 3DK3A 4XP2A 2C69A 5I9ZA 2W5HA 5IA0A 4YTHA 2R0IA 4DT9A 4B99A 3BHVA 4CQGA 3KFAA 2J50A 3AG9A 2QCSA 4F65A 1WVXA 4GVAA 5JEBA 3I0QA 4JL9A 4NH1A 1P2AA 4IVDA 4FKLA 1O6LA 4WRSA 5DEYA 1VZOA 4IB0A 2RFSA 3ZXZA 2XH5A 5EQPA 1Y57A 2W4KA 3MVLA 3FPQA 3P9JA 4Z9LA 4EC8A 3FHRA 1XBCA 1W83A 4GUBA 4JBVA 4LUEA 1BX6A 3MTLA 1FGIA 3PJ8A 4EOOA 2QOKA 2R64A 3UNJA 4YBKA 4FKSA 2JDTA 3VHKA 5IEVA 1AGWA 5HD4A 3DTCA 4N70A 1H28A 1JKKA 3VWAA 4C0TA 5IA5A 4EH5A 5A6NA 1XH6A 2VTLA 1BYGA 2RL5A 2ITVA 4FZ6A 1GOLA 4ACHA 3PJCA 5AIRA 3O8TA 3TTIA 2GU8A 1Y6AA 3G5DA 3COMA 5JFWA 5E8YA 3D4QA 4YHTA 1YOMA 1ZXEA 2VTOA 3Q04A 5HNIX 2JIIA 2PE0A 5BUJA 1FPUA 1OKYA 3MFTA 4HCTA 4J8MA 4QMNA 5IQCA 3R9DA 4KKHA 3T9TA 2I0HA 3MH2A 5E91A 3GU4A 2V62A 2J6MA 4OLIA 4RC4A 5FBNC 4ITHA 3ATTA 3VVHA 3LJ0A 3F7ZA 3MFUA 2BRBA 2R3MA 3GOPA 3RAIA 3OUNB 3ROYA 2PULA 1CTPE 4G3EA 4BC6A 1GIJA 4BCIA 4J99A 3GCPA 3TUDA 3S0OA 3A7FA 3W16A 2ITZA 4NK9A 1H07A 3G0EA 5JH6A 4UX9A 3QLGA 1H0WA 4FG7A 5BVFA 4FSQA 5AFVA 2HY81 4Z3VA 2EWAA 2HXQA 3VUIA 2WMWA 1IA9A 1H24A 4D58A 3PZEA 4DH7A 2VUWA 2CJMA 3RM7A 2PUIA 2PUPA 4N57A 4I4FA 2DQ7X 4QP6A 3CPBA 2OJIA 4IAFA 5D11A 2YAAA 4DINA 2QKRA 5KMLA 3QD0A 4TT7A 3FQHA 2GNLA 4BDIA 2W1IA 2AC3A 4JXFA 2BZJA 4FV8A 3R7VA 4Z7HA 3PXFA 4KAOA 4BDEA 3IOPA 3ORXA 2JKKA 2NP8A 3FXZA 3OG7A 3P7BA 5HQ0A 4XG8A 4W4YA 4L53A 3SXFA 3UNZA 3NDMA 4RWLA 2CGVA 1A48A 5GZAA 3OTVA 5CS6A 4BN1A 3NNUA 4BDCA 1JPAA 5CEOA 2OH0E 4ORKA 4J71A 3ZZEA 3IOKA 4L00A 2Q0NA 4X2GA 3VS4A 1J7IA 3TXOA 2C6IA 3O17A 1M2PA 4BYIA 3OXTA 4X6QC 2CHLA 3EN4A 4R3PA 4I0SA 5DT4A 3QQHA 4YZ9A 4WD5A 1MRUA 3OOMA 2WMQA 3IW6A 3PPZA 4M7IA 4R3RA 4FTRA 5DR9A 2YDKA 4I94A 5IPJA 4EWQA 4E4NA 2BHHA 2OGVA 2CNUA 3VHEA 2IVTA 2WMTA 5FTOA 2XCHA 2ESMA 4GK2A 5F1ZA 3IDPA 1R1WA 3R02A 4RMZA 4FSMA 4EZ7A 4CEGA 2J7TA 3VUHA 3HUCA 4MXCA 2XBAA 3E63A 4NU1A 3FV8A 2VX0A 3HGKA 5EM5A 3KXNA 2X9EA 2YIYA 3OY1A 3A2CA 4D0XA 4E4LA 3MW1A 3K3IA 3LFAA 4G6LA 5J9ZA 1OUYA 4QYEA 5JFXA 3KC3A 4XG9A 4BTKA 2GQRA 3KF7A 3O7LB 3RWPA 5JGAA 4OTDA 5AP4A 4H3PA 5AV3A 3V5JA 4RFYA 2JDRA 4D0WA 5ANIA 2VZ6A 4QYFA 2ITOA 2XRWA 5CT0A 3ZSIA 3NNVA 2CLXA 5DIAA 4EOKA 3EKKA 4JI9A 3L8XA 3DJ5A 2CCHA 1GY3A 1UA2A 1DS5A 2FGIA 3OW4A 4L3JA 5CQUA 2PMOX 3R1YA 3ZHPC 4EWHA 4Y5QA 1YRPA 3UMXA 4MYGA 3VBXA 4AW1A 4AU8A 2F49A 2X4ZA 4TKSA 3PWYA 3ERKA 5HX8A 5ITAA 1UNGA 2OXDA 3LQ5A 2DUVA 4IMYA 1LP4A 4L43A 4L67A 3IONA 3BHYA 1PXPA 1QPEA 4UWYA 4W9WA 3GXLA 5HTIA 3UYTA 2Y6MA 5E1EA 2CN8A 2B54A 4O0WA 4DH5A 3NAXA 4O6EA 4PTEA 4MXOA 3P08A 2CDZA 2NRUA 2P4IA 4PL5A 3DXQA 5HCXA 2HW6A 2J0MB 2XJ1A 1YVJA 4I1ZA 4AZVA 1RDQE 3NEWA 4DTBA 3CR0A 4XCUA 2EB3A 3OT8A 3U87A 5EM6A 3THBA 4O0UA 3I60A 3HEGA 4ZTRA 2C3KA 1WCCA 3DKGA 4ZXTA 1F3MC 3OWJA 1VR2A 3CQWA 4FT5A 5ICPA 4JR7A 2BAKA 4TYJA 1Q41A 3FBVA 5E1SA 1KE8A 2UVYA 5E8TA 4QMSA 2HWPA 2WELA 4FSRA 1ZOEA 4IAKA 3R21A 3G9NA 4CXAA 5LJJA 5J5SA 4FK6A 5JSMA 2BTRA 2X7OA 4JQ7A 2W9FB 5HBHA 4KD1A 1FQ1B 2C4GA 2X9FA 3RKBA 1Q8UA 3U55A 3NUPA 3PP1A 4U81A 1WAKA 4A4OA 4AAAA 2BILB 3R0TA 5EDRA 4GG5A 3LW0A 3PIXA 3SRVA 2I0YA 1FVVA 4K18A 4OTFA 5CNNA 4LV5A 4B6LA 2VWVA 2J0LA 3DJ7A 3PXQA 2ZB1A 4EOPA 2YLFA 5AM6A 4L01A 2HYYA 2PUNA 2J0KA 3BV3A 1V0BA 2QURA 4FV3A 5EOBA 5HBJA 3A7JA 5JGDA 2IG7A 4DG3E 3OMVA 3G6HA 2BROA 4GEOA 5L6WL 4F6WA 3AC2A 4YNOA 3QTIA 3AC1A 4LQMA 4TYIA 2CGXA 3R73A 1RE8A 3LFCA 5C4KA 4FGBA 2A27A 3TUBA 2NO3A 4MTAA 5LOHA 4TZRA 5TR6A 4X21A 3R1SA 2G2FA 4AOTA 4FTTA 3OUKA 2G9XA 4E6DA 3R7UA 4CQEA 3SW4A 4TWOA 1LR4A 3OP5A 4FEQA 5AR2A 5EW8A 4GT4A 3C5IA 4OTPA 4Q2AA 5M44A 5HE0A 1YI3A 2A4LA 3TUCA 3MI9A 2HZNA 4F9AA 4HVGA 1OIQA 4LOQA 2WEVA 3GU8A 4IJ9A 4PDYA 3KXGA 1G8AA 1ZAOA 2GNIA 4NCTC 4BIEA 4O7VA 4O0YA 2GFSA 1B39A 5CF5A 5DYJA 2OFUA 3HV5A 4O0XA 3W2OA 2XIKA 1BKXA 1K3AA 4XH6A 3PG3A 3TI1A 4JBOA 5LMAA 3GFEA 4HZRA 5M51A 5CU3A 4ZS4A 1WBNA 2WTVA 4O7NA 4G31A 1ZYCA 3BELA 5JGBA 4JT3A 3GT8A 4YLLA 3N4VA 3PDTA 5BX0A 4L3LA 5DE2A 3F2AA 3QWJA 3EN7A 2V7OA 1W98A 3MH0A 4P2KA 3H10A 5E8ZA 5K5XA 4GT3A 3KCFA 4O2PA 3QL8A 4LM5A 1YXSA 2V55A 2VTMA 5L8KA 4IANA 3CD3A 5HE2A 3ZOSA 4YPDA 1GIHA 1R39A 3GEQA 3GCVA 1B6CB 4G5JA 4LRMA 3KEXA 3S2PA 4MQ1A 4RJ5A 4WRGA 4IZ7A 1J3HA 2CCIA 4D2SA 4V04A 3UMWA 4FNWA 2UZLA 2OWBA 3FI8A 2C6OA 4PUZA 1PYEA 5B7VA 3BIZA 4AS0A 1XH4A 4DE4A 2AC5A 3G6GA 2R7IA 1YDRE 1U5QA 3BU3A 3GENA 4USDA 4DEDA 1SZMA 4ZTMA 3K2LA 2P55A 5HHWA 5FWKK 2Y4IB 4DFYA 3ENMA 3VBTA 3MPTA 3C0HA 3MN3A 4GYGA 4I23A 5J5TA 3N4TA 4GW8A 2FYSA 1BLXA 4LV8A 3R28A 4KB8A 3EWHA 2XJ2A 2QR7A 4J7BA 4KS7A 4HGLA 2RFDA 4S2ZA 3V6RA 1OKVA 4RWJA 3R8PA 4F08A 5HO6A 4LRKA 3I5NA 5T3QA 4BYJA 4CKJA 5FEDA 3F88A 5A14A 4A7CA 1NVSA 3W8LA 2XM9A 1BI7A 3DV3A 3IW5A 2X2LA 5BVWA 3QU0A 4ALWA 4BTJA 4O7RA 3D5XA 3HKOA 4MWIA 3ITZA 5CNOA 3OBJA 4NW5A 2UZOA 4XV1A 2ZMDA 4JRNA 4U42A 5A6OA 1YI4A 4FUXA 5CEQA 2OXYA 3TCPA 4CFWA 3QQJA 5CEPA 4Q9SA 2XKCA 4TN6A 5AM7A 3ZM9A 2GNGA 3QKMA 2WTDA 2QOCA 4BDKA 5AEPA 5IQFA 4XEYA 2KTYA 3ZXTA 3DZQA 2AUHA 2I40A 3WZKA 4AN9A 3LMGA 5HO7A 5GIOE 3C5UA 2PZYA 4KIPA 3S95A 4WKQA 3EFJA 4WUNA 4JVGA 3RP9A 2HENA 1KE9A 2F7EE 3COKA 3F82A 4BTMA 2HK5A 3P5KA 5CZHA 3KVWA 4L7SA 1QPCA 2REIA 5A4EA 5IDNA 5JN2A 3FLYA 4KNBA 5HICA 5AUVA 4CCUA 5IQHA 3DOGA 4X2FA 2R3FA 2C68A 2IW8A 5CY3A 3EB0A 5EOLA 2A2AA 2ZV9A 1PF8A 3O2MA 4FG8A 3NIZA 4UXLA 2O0UA 2W06A 1J1CA 2Z7SA 3AT3A 4RC2A 4IE9A 4FL3A 3DB6A 1SNXA 4LL5A 4H05A 3ZS5A 4E8AA 5KE0A 3OS3A 4HGEA 4HOKA 3MV5A 4RJ3A 2I0VA 2XEZA 3FZSA 3QF9A 2HXLA 4EJNA 4I6HA 2XNGA 2LGCA 2P33A 1GNGA 4O2ZA 4YZBA 4YMJA 4BDGA 4MNFA 3WI6A 4BGGA 4F1OA 2GS7A 5FRIA 4LMNA 4V0GB 2GCDA 3FZPA 4ZK5A 1IEPA 2XKDA 4FV4A 3HZTA 4XLVA 4LFIA 1OMWA 3FLNC 3KRWA 2ZOQA 3O50A 1Z5MA 3UIUA 2J90A 2XIYA 3EFWA 3LXLA 4QD6A 3SKCA 5IU2A 3NMUF 1H08A 3FSKA 4CFVA 3MH3A 3FSFA 3ELJA 1Q24A 4W9XA 4E3CA 3P78A 5EM8A 3R8LA 3PZHA 3PIZA 3WE8A 5J1WA 4FNZA 2OZAA 2VTRA 3HP5A 2ZVAA 2X8DA 4O6LA 3ZFXA 3QQGA 3IGOA 4FIJA 4TPTA 3ROCA 3I81A 5AA8A 5EQYA 3UE4A 3LQ8A 2J0IA 2C5VA 1HOWA 4RPVA 3FPMA 4AGDA 5M06A 2CNQA 2OO8X 2FSOX 3EL8A 2WEIA 2E9VA 4EHZA 2W0JA 4EHGA 4M0ZA 4EH7A 3FI3A 3Q9YA 4WSYA 4B8LA 3UQCA 4FIIA 1W84A 3G33A 3QTWA 3VS3A 2IVSA 1I44A 5HESA 1OBDA 1GIIA 2PVFA 2R3JA 3QKLA 4UB7A 2XBJA 3PSCA 3A7HA 3QXOA 2PSQA 4XMOA 1JNKA 3FQEA 3NUUA 4PQNA 4ACGA 4CMTA 3A7IA 5K4IA 2BIKB 2W96B 3FMLA 3JXWA 3QYWA 2PL0A 3SXSA 3W18A 4ZLZA 4EKKA 3SG8A 3LFEA 3UOLA 2XK3A 2WKMA 5HEZA 1QPJA 3TKHA 3FMKA 3MB6A 4RIYB 4Y73A 4FSUA 1H26A 4ACMA 2VGPA 4FTUA 5HVKA 3JUHA 2UW6A 4NM5A 4YSMA 4ZLOA 4IHPA 3D7ZA 5LWNA 4DAWA 1NW1A 5M08A 4I0TA 4E4XA 4K2RA 5DH3A 3ZFMA 3E8NA 3NW5A 3Q4ZA 5C01A 4BCQA 2XNPA 3KXZA 4NIFA 4RVMA 3V5QA 4CFNA 1DI9A 2FSMX 3AC3A 4AFJA 2WU7A 3FKLA 3LAUA 2VO3A 3IO7A 3N9XA 1JKLA 4JX7A 4YJPA 2WAJA 3DTWA 3LCKA 4NIFB 4S34A 3BKBA 4F0GA 4OTGA 3PSBA 1M14A 4IM0A 4S32A 4PMPA 1ZYDA 3HMPA 3ZO2A 1VEBA 5L2QA 2X6EA 4XRLA 4ZY6A 3CSVA 5L2WA 5J1VA 1KOAA 3QC4A 4NKAA 4PY1A 3K54A 3DGKA 4UMUA 2BKZA 4QP4A 4YJTA 4UEUA 3DBEA 3LFDA 4NSTA 1XQZA 1JWHA 4G5PA 4JAJA 2R4BA 1J7LA 3VO3A 2JIUA 2R9SA 4U6RA 2JBPA 5KZ0A 4AUAA 2QO7A 4RGJA 4F9CA 5CAOA 3MGYA 4JDIA 4RRVA 3K5UA 3HRCA 3U8WA 2UZWE 1Q99A 2YHVA 2YWVA 2X2KA 3OHTA 3T8OA 2VWYA 3OROA 3TNQB 2Y7JA 3DAEA 1WMKA 4FT9A 4RFMA 2OK1A 3W10A 4ZJVA 4MVFA 2W5BA 4C38A 4ZSJA 2YERA 4CKIA 4OBPA 4R8QA 4U3ZA 4IIRA 4CVAA 5GNKA 4F7NA 1GZNA 3D5WA 5M56A 3WF7A 2BVAA 3PIYA 4K9YA 5H8EA 3CQUA 3V8SA 5FP6A 4JOAA 5DEWA 3I6WA 3KXHA 4FX3A 5GHVA 3NUXA 4DLIA 4NJDA 3ZLSA 4EQMA 3T9IA 3H30A 2GHGA 5AP6A 5KCVA 3DK6A 4BDHA 3A62A 4HCVA 5BUEA 5C27A 4C4JA 3F3TA 4RLLA 3Q5ZA 3EL7A 1LEWA 2UW0A 5AR4A 3IK3A 3PTGA 5TKDA 3QKKA 4FBXA 1V0PA 2VWWA 4PPBA 3W32A 1ZMWA 5AP0A 2FO0A 5E90A 3BHTA 2R3HA 2WNTA 3Q9ZA 2CGWA 5CAUA 3EKNA 4MXYA 3ZDIA 2ITQA 1NA7A 3RPRA 3H3CA 4CNHA 1ZY4A 2BRMA 5HBEA 4DFZE 2R3PA 3A4PA 3RVGA 4YR8A 1OIUA 3PE1A 2P0CA 2JFMA 2H96A 2R3GA 1LPUA 4BBEA 3ETAA 3H0ZA 1Q8ZA 3VIDA 3MY0A 4JS8A 1URWA 5M09A 5CVHA 4C3FA 5FLFA 1IASA 3LLAA 3S1HA 3U9CA 2HY0A 1ZLTA 5AP2A 4QTCA 3SVVA 4EK3A 2BDFA 4BI0A 3VNTA 4J53A 3MFRA 4WOVA 4UMRA 2XK8A 5DI1A 4YURA 4WSQA 1WBTA 3IKAA 4RG0A 3HV4A 1FOTA 3WZJA 4IAIA 1PHKA 4M68A 2YCSA 4MEDA 4V01A 4X3FA 5FM3A 2J51A 3KRJA 1T46A 2VTPA 4O38A 1GZKA 4ASXA 4WNOA 4EEVA 5KKRB 3FQSA 4ANLA 4X3FB 4Y5HA 4AZTA 2PVMA 4BGQA 4YJNA 4DHFA 1UV5A 2XK9A 3RBWA 2JDOA 2VX1A 3EQCA 3NX8A 4CV9A 3IQ7A 3W2RA 5I9WA 3PVGA 5DA3A 2R3RA 4MNEB 3RK5A 2EU9A 4GJ2A 4HYSA 5K0KA 1CKPA 3ALOA 4C2VA 3FY2A 3EJ1A 4IFCA 3E3BX 3WBLA 5EI6A 4CD0A 2JAVA 3DKOA 5IDPA 3OXZA 3TKUA 2IPXA 3G0FA 5D12A 4DFNA 2YCQA 3MS9A 4AZWA 2PUUA 4ANBA 3OT3A 3FMNA 4IAAA 4XV2A 1CDKA 1Q4LA 4CZUA 5IH5A 3AQVA 5KMIA 3AC8A 3FMDA 2VU3A 3E62A 3FXXA 3OVVA 4FZAB 3MA3A 4FTCA 5JQ8A 3PFQA 5GIPE 1U46A 1Q97A 1XR1A 2BRHA 2QODA 3ORMA 5DG5A 2C30A 4RVTA 4AW5A 4EH2A 2CGUA 4R1VA 5KBQA 1SVHA 4JQEA 4C57A 3MTFA 2CKQA 4ZOGA 4YGAA 1XJDA 1OPLA 3E88A 3SG9A 2XJ0A 3A99A 5K3YA 2FSTX 4FIHA 4DH1A 3BEGA 3OW3A 3PPJA 2WQEA 3UQFA 4XOYA 5HO8A 4O0SA 2ITYA 5KMJA 4R77A 2VTJA 3FEGA 3BYOA 3JY9A 3COIA 4F7JA 4F64A 1PW2A 1YKRA 5J9YA 3QD2B 2BFXA 2YACA 4ZZMA 4FIFA 5CENA 3MJ2A 3G51A 5J87A 1W82A 3BQCA 3EHAA 4GRBA 4UXQA 4W8DA 1M52A 3LFQA 3UYSA 4WNKA 4G3GA 5JZNA 3ZEPA 3AGLA 4IX3A 2VWXA 3E87A 4CYIA 3KU2A 5JFSA 3FL4A 3KQ7A 2ONLC 2A19B 2ETKA 2YM4A 4IVAA 4FSTA 5IQBA 4AQCA 3COHA 3AC4A 5EKNA 2QHNA 4FKOA 4FF8A 2YIRA 1G5SA 3OZ6A 3NSZA 3AMAA 3DA6A 3NYXA 2XB7A 4G1WA 5HG8A 3PY1A 2UZTA 2YWPA 1E1XA 5BVEA 3HDNA 4QMQA 3NYNA 1SM2A 1O6KA 1UKIA 3CEKA 3HMMA 4MD8E 2PY3A 3NIEA 4IW0A 4N0SA 1W0XC 4OW8A 4RA4A 4FG9A 4TXCA 4WUAA 2C1AA 2G1TA 3I4BA 5AADA 2EUFB 2UVZA 3Q96A 4YZCA 4ZEGA 5KMNA 1PXIA 5CSWA 5TOZA 2WTWA 1XH8A 3VBYA 1V0OA 5KHXA 5CQWA 2RG5A 3HAMA 4ASZA 4GIIA 3WARA 5LWMA 3ID6C 1BUHA 4D2PA 4M84A 4UWCA 4UYNA 2ITWA 4HYIA 3VUGA 4BGHA 1JKSA 2UUEA 4GFOA 4BCKA 4NFMA 3G15A 1A06A 4EHEA 4V05A 4TL0A 3QRJA 4YSJA 1WFCA 3IGGA 3MPAA 4WIHA 3RK9A 3VJOA 1PMNA 2XRUA 3BWJA 4TYGA 5A3XA 5CLPA 4AOJA 1M2RA 2XNNA 2B55A 4ZS0A 5M53A 2G01A 3DLSA 3QTQA 2PZPA 4TRLA 4XX9A 2QD9A 4IZAA 2Y6OA 3NWWA 5I3OA 5BMSA 3OC1A 4F4PA 2WQOA 2C6TA 2W1FA 3FYJX 2VX3A 5CSXA 4D1XA 4J8NA 5C9CA 3VJNA 3A60A 3TT0A 2FB8A 3EZVA 4HVHA 4E5AX 3DQWA 4GJ3A 4U45A 2V7AA 3BI6A 3BLQA 3C1XA 3HMNA 3MPMA 4FKIA 3NCGA 4WA9A 3C0GA 4X6RA 3KN6A 5CSVA 3UPXA 3LM5A 3PY0A 5D7AA 5DN3A 4YTIA 3BE2A 3WZDA 3NVKI 4O21A 3FC1X 4N6ZA 2ZYBA 4GSBA 3IG7A 3DB8A 3F9NA 5F94A 3RMFA 2R7BA 4EHVA 1H0VA 3FKNA 3POOA 4BHZA 4YTCA 4L68A 2VO6A 2UVXA 3CKXA 4IM2A 5ACBC 2XCKA 4AZFA 2QOQA 3IW8A 5F4NA 3DQXA 1KWPA 3D94A 4JG8A 3ZONA 4EI4A 4QMOA 3VUKA 2IN6A 4IJPA 3ODZX 4MX9A 4OTRA 3ORZA 3W2QA 1YXVA 4PV0A 1XH9A 3VBWA 3PXZA 5CU0A 4F6UA 2JIVA 4M8TA 3C4EA 2F7XE 2PZRA 3DFCB 2B9FA 3ET7A 3GFWA 3M1SA 3D15A 2GHLA 4RIWA 3RGFA 2RKUA 4I6FA 3JPVA 5AR5A 5HCZA 5IKWA 2GMXA 4RIWB 4R3CA 4O7TA 2SRCA 4M13A 2HOGA 2UZVA 4O0VA 5HNGA 3NRMA 4PRJA 3SDJA 3AD5A 5C8KA 4I24A 4PPAA 1REKA 3QA8A 4XG3A 4XG7A 4YBJA 1L8TA 3EMGA 3VS1A 3F5UA 1RW8A 2GTNA 2IWIA 2OI4X 5H9BA 4D2TA 3I7CA 5KNJA 1ZWSA 2BTSA 3ULZA 4BDAA 4LG4A 3PVWA 4AE9A 3JS2A 4F6SA 3ZEWA 1JSTA 2UW3A 5FDPA 5AV0A 3FI4A 4BCMA 5LQFA 4BBFA 5ETFA 4QRCA 4KINA 3BBTB 4TWPA 2JFLA 5AV1A 4ITIA 4EQCA 5A46A 4ZY4A 4O1PA 4QTDA 3DBCA 5E9EA 2WMSA 2ITXA 2AYPA 3BHUA 4IEBA 5EYKA 3VQHA 1OPJA 2RIOA 2WTKB 3LCDA 4L45A 4O1OA 4A07A 4IAYA 3V01A 1W7HA 1WVYA 5D10A 5BYLA 3QRIA 1IG1A 2XK6A 3QUEA 5HIEA 4I41A 4S31A 4O22A 5KBRA 4MQ2A 3G2FA 5L8JA 4C61A 5LVPA 2B52A 3GOKA 4A06A 5A4QA 3EIDA 3DKCA 3I6UA 5HOAA 4CTBA 3Q60A 4I5HA 3PLAE 3RPVA 1TQIA 3F2NA 4DEIA 2VTQA 2WD1A 5C8NA 3TZ8A 2VD5A 4JG6A 5EHLA 2UW4A 3P23A 2HZIA 3QUDA 1SNUA 3QALE 2ITNA 3PLSA 5CYIA 5EI2A 5CXHA 1ZOGA 2BDJA 4HPUE 4Y85A 5AUWA 2E2BA 4LOPA 4HGTA 3RPYA 5IQGA 1FVTA 1ZYJA 3HVCA 3RWQA 3NGAA 5L4QA 5DPVA 4OBQA 2W17A 2O65A 2O8YA 2BZKB 4A9YA 2R3LA 3H9RA 4AFEA 3D2IA 4G6OA 3QRUA 4U8ZA 3UPZA 3OY3A 2QQ7A 3V3VA 5CEMA 1OM1A 1YXTA 2OJGA 5HG9A 4QTEA 5EDQA 5I9UA 4HCUA 5M07A 3CC6A 4AA5A 5A9UA 2CLQA 1ZARA 2GS6A 2XS0A 3KMUA 3NR9A 3REPA 4E7WA 1YWVA 4A4XA 4CMUA 2GDOA 4PNKA 3AT4A 4FV0A 2V0DA 4DA5A 4DEEA 5CT7A 4AW2A 4F7SA 1TQMA 3R9NA 3ZUVA 4EBWA 4TWCA 2W1ZA 5BPYA 5AAEA 5AR7A 5HNBA 3UZTA 5IQEA 1O9UA 3DPKA 3FLZA 3GUBA 3O0GA 4UBAA 5F95A 4G17A 3EQDA 2UW9A 2PWLA 3GP0A 4C3RA 2QOOA 3IDCA 2W7XA 4U3YA 1H1WA 2WTCA 3FLWA 1LEZA 3GCUA 2IJMA 3CE3A 4MBLA 3UIBA 2J4ZA 4B7TA 4I0RA 3F5XA 2Y4IC 2EXEA 3SW7A 4KS8A 3H0YA 3OXIA 3QHWA 3L9LA 4Y72A 4H39A 5CX9A 3KMWA 3PVUA 1S9IA 2WTJA 5KX8A 2ZM3A 1OITA 3CJFA 2IVVA 5H2UA 4HVIA 4YZMA 4EK4A 3F3WA 4WG4A 4CV8A 3KKVA 4R1YA 4U40A 4W4XA 1BMKA 3Q5IA 5FQDC 4IB3A 4G3FA 3BYVA 3QQUA 2GFCA 2GNJA 2XMYA 3QC9A 5HLPA 4DH8A 5CALA 3D83A 2R2PA 3O23A 4MKCA 4R7BA 3BPRA 1KOBA 2B9HA 4DTAA 3V5TA 4NYEA 4FTKA 4I22A 2XKEA 2X0GA 3TNWA 4O83A 5AUXA 2ITUA 5LVNA 2H8HA 3R7IA 3NCZA 3K3JA 2Z7RA 1YHVA 1PXOA 4M97A 4MAOA 3TV4A 3UO5A 2PVNA 5IUGA 4FEXA 2O5KA 4C58A 4LL0A 3KXMA 4IX4A 3F5PA 4LMUA 4XBUA 2R3QA 1OI9A 4ZTHA 5FTQA 3RPSA 4FODA 4BF2A 1OUKA 4C4IA 3FZOA 4PPCA 2BZHB 2O3PA 1MUOA 1A9UA 5CU6A 3QUPA 3LMHA 5E8XA 4GS6A 3P1AA 3HV6A 4U43A 4CKRA 5IEYA 4RFZA 4EK6A 5AUZA 1NXKA 3ULIA 3R04A 3U4UA 3QGYA 3VUDA 1NVQA 1Y8YA 3VUMA 1P14A 3HAVA 4ZY5A 3RTPA 1NY3A 5EG3A 4BCJA 3PXKA 3W2SA 4BWKA 3TV7A 1JSUA 3QCSA 2F57A 3Q4TA 1WBVA 5ETIA 2C5XA 3TIZA 4AT3A 5KMOA 3GCSA 3I0OA 3RM6A 1JQHA 2HWOA 3DKFA 4RBLA 3TIYA 5F9EA 1UU8A 4RVKA 1XBAA 4MF0A 2KULA 2ITPA 3DLZA 4FC0A 4LRJA 3R2YA 4H1MA 5ACKA 3UTOA 3QTSA 4XV3A 5EH0A 3ZMMA 4DGGA 4RZVA 4F7LA 4AGWA 2OW3A 3GQLA 4QMPA 4OTWA 3IS5A 4K77A 4GU6A 3WZEA 1REJA 1E1VA 3EQGA 4JRVA 2H9VA 3FZ1A 5G6VA 3ZLWA 4BRXA 1SMHA 4JDHA 4ANMA 3ZUTA 3DDPA 4RSSA 4QPAA 2PE1A 3ZO3A 4EUUA 4IAZA 4QTAA 3LQ3A 2YITA 4QMWA 2BUJA 3C13A 4O27B 3TDVA 3C50A 1OZ1A 2ZJWA 1P4FA 3BCEA 3QZHA 3W8QA 4C4EA 3OCTA 3UIMA 5LCJA 3DBFA 4XNEA 3C51A 4IC8A 4RJ6A 3RZBA 2R3IA 4H1JA 4EKLA 4WBOA 4Q5HA 4RX8A 2XIXA 3E5AA 2R0UA 3DU8A 3TL8A 1OL2A 4NW6A 2A1AB 3O7LD 5DR2A 2HELA 3RHKA 3RZFA 1IRKA 1PXKA 1WVWA 3PVBA 3BGQA 1APME 3HV7A 4O7SA 2W4OA 4FR4A 4QP1A 3BGPA 5CAPA 3GVUA 4KRDA 5HLNA 3P7CA 5L3AA 4I5CA 2CKEA 5LMKA 5HGIA 3U4WA 4DGMA 1G3NA 5DOSA 5HI2A 2R3OA 5JT2A 3VRYA 3RHXA 2H6DA 4QP8A 2X4FA 3LFNA 4IXPA 3LFFA 3PPKA 2X2MA 4ERKA 3B8QA 3DFAA 2RSVA 4E20A 3KF4A 5JKGA 5L6OA 1F0QA 2XVDA 1M17A 2HCKA 3KGAA 3EYGA 4IACA 1CMKE 3D7TA 3LIJA 5AUYA 3CS9A 3GU5A 4FV9A 5E7RA 2A0CX 3CKWA 3SD0A 3D7TB 1Q8WA 4ZSLA 4NL0A 5HU9A 4Y46A 2P2IA 3PUPA 4J95A 4WBBB 3MVHA 4AG8A 4BZDA 3CY3A 3EQFA 3PYYA 2V5QA 1QMZA 4FKVA 2OJ9A 4D55A 2VAGA 4V0GA 2QG5A 4BI2A 4HVSA 4LI5A 3R1QA 5JZJA 1F5QA 4FTNA 4DG0E 1XH7A 2X81A 3FMMA 4OTQA 4O7WA 4A9TA 5LARA 3F3VA 3O8PA 2UZDA 4MCVA 4WNPA 3FMEA 4C4FA 2WQNA 3D5VA 1YXUA 2ZMCA 3C4ZA 3BLRA 4CZTA 4GK4A 2VTTA 5JFVA 4O81A 4FNXA 4UYAA 1H27A 3O96A 3P79A 4FSZA 3F69A 5DR6A 1OGUA 1K2PA 1ZYSA 3CP9A 4PTCA 3DNEA 3L1SA 3VS0A 5EQEA 2WPAA 2OIDA 1DM2A 1Y91A 1XWSA 2C3IB 5FEQA 5CF8A 1H1RA 1M7NA 3R9OA 4FTOA 3VS5A 1UWJA 3ZUUA 4YJRA 2JKQA 4IDVA 1ZOHA 3JYAA 4GK3A 3FE3A 3POZA 5HCYA 4EK8A 2ZV8A 4E6QA 3QWKA 3SLSA 2HZ0A 3OBGA 4M0YA 1UNHA 1Q3WA 3GNIB 3BWFA 3BRBA 3AD6A 3HNGA 3PXYA 2CKPA 3FHIA 3QGWA 2WU6A 2J9MA 3F7WA 2OJJA 1J1BA 2YM8A 5HG7A 1PYXA 5HIDA 5CXZA 4QMXA 2WB8A 2XNBA 4BY9E 4J52A 4NUSA 1BL6A 4JDJA 3HYHA 3UBDA 3LFBA 4C4GA 3VRZA 5ETCA 1Z57A 4WG5A 1H00A 4RIYA 1STCE 4YJVA 3R22A 1QCFA 4BWPA 4JR3A 1O6YA 2F4JA 4OT6A 1AQ1A 3OEZA 4FMQA 4MWHA 4QO9A 1J91A 1X8BA 4AGUA 4FOCA 3ZCLA 3TJDA 1R0EA 4EBVA 4K0YA 4PF4A 1JOWB 4QTBA 4FVPA 5B0XA 3U6IA 4NZWB 4O91A 4YNEA 5HIBA 4K6ZA 1OL6A 2WMXA 3UODA 4HYUA 3T3UA 4BCOA 5G1XA 2VV9A 3MSSA 4M12A 4DEBA 3R30A 5BYZA 4EOLA 4GMYA 1OB3A 1YWRA 4ZZOA 2OF4A 4FTLA 3EN6A 5HVYA 3RJCA 3OD6X 5L8LA 4DCAA 4L7FA 1H25A 1H1PA 3LCSA 4GVJA 2C0IA 4I93A 4EYJA 2Q83A 3IDBA 4FKPA 4I5PA 4OR5A 3OOGA 5CTPA 4JIAA 5H8BA 4AA4A 1U54B 5ANEA 4GL9A 3QZIA 4L9IA 5ETAA 4JG7A 4EH8A 3ZTXA 4GFMA 4AGCA 3PRFA 5CZIA 3I1AA 4ZSEA 5DMZA 2ZV7A 3U6JA 5HORA 4FKRA 3TACA 5E4HA 1V1KA 3AGMA 2C3LA 3CTQA 2EXCX 3FC2A 5CEKA 1SVGA 4QQ5A 3OF0A 3QA0A 3QBNA 3S00A 3RPOA 2ZAZA 3I5ZA 2XIZA 1H01A 3SX9A 4CLJA 1WBOA 4DGOA 3ZBFA 1TQPA 4BDBA 1PRYA 2XK4A 3D0EA 3UGCA 3EZRA 3F66A 2OG8A 3LXNA 4WNMA 3GQIA 2PE2A 3E8EA 5T6KA 3Q32A 3ZH8A 1PXJA 4FV6A 4IBMA 2XNOA 3KA0A 2QNJA 4GV1A 4II5A 4IX6A 5AX3A 5IH4A 3DK7A 4OBOA 4XUFA 3E8DA 2I0EA 3QTXA 5K9IA 3VF9A 4J97A 4M15A 5IMXA 1OIYA 2G15A 3DXNA 5GJFA 3AMBA 4FKUA 2YDJA 3LOKA 1XBBA 3HRBA 3DZOA 4K11A 5L6PA 1Z9XA 4X3FC 4QMVA 3GC9A 3QHRA 4F1MA 2IZUA 2XK7A 4FZFB 4IWQA 2JKOA 3OWKA 5BYYA 5JMSA 1YI6A 5BQ0A 2XNMA 1MRVA 5GJDA 3HV3A 5EYDA 5AUUA 4PNIA 3KRRA 4DCEA 2OH4A 4FT3A 5FXQA 2E9OA 3EQHA 2UZUE 5AIKA 5CASA 4FKJA 2GSFA 4I6BA 3R9HA 3S4QA 1URCA 3VC4A 5JK3A 2EB2A 1OPKA 2IZTA 4QNAA 2VO0A 5C4LA 4C3PA 4IQ6A 3Q3BA 4EJ7A 3CIKA 3IPHA 4RWKA 4F9WA 4RIXA 5I9VA 2X7FA 4YLJA 4YLKA 1OKWA 4GIHA 5HX6A 1CSNA 4RIXB 4FSWA 2X8IA 1FMKA 4I92A 5E92A 1Q5KA 5AWMA 4EL9A 4M14A 4ANNA 3TWJA 4YZNA 3JR1A 4DGNA 2ZDUA 2XEYA 3F5GA 3ZRMA 4YU2A 2RG6A 4DGLC 3H9FA 3R8MA 1R3CA 3LHJA 2FUMA 1PY5A 2JKMA 2R3KA 2ETMA 4YP8A 1JAMA 4NEUA 3VW8A 5EKOA 4XP0A 4QP9A 2OKRA 4Q9ZA 3WILA 4MXZA 1E9HA 2BR1A 2W1HA 3UP7A 5L2SA 4B8MA 5AAFA 4MXXA 4EYMA 2CN5A 3NYOA 4XJ0A 4WT6A 3II5A 3M2WA 4R5YA 3EN9A 4MNEA 5AUTA 3ZM4A 2VRXA 4ZTQA 2WTIA 4AN3A 4C37A 4K33A 3ORPA 5FXRA 5C03A 4N4SA 3R7EA 2V22A 2F7ZE 4TYEA 2E9UA 3Q6WA 2YZAA 4ENXA 2WOUA 3VULA 4B9DA 3R1NA 4FV5A 4EZ5A 4ENYA 4CRSA 5DFPA 4YJUA 3PP0A 3SV0A 2PPQA 2UW7A 2YM6A 3Q52A 3VW6A 4ERWA 3HECA 4X2NA 4FTIA 3O8UA 3O71A 2QONA 3QCQA 5DT0A 3UC3A 3A7GA 5ANDA 4O96A 3K5VA 3DS6A 4AACA 5C8MA 3CY2A 3BGZA 1U4DA 4USEA 4YJQA 2JC6A 2QVSE 2QI8A 4RJ8A 2NPQA 3FZTA 1UVRA 4O84A 3N4UA 1YDSE 1PMVA 4GH2A 4M66A 4PMSA 4ZTLA 4UZDA 5EW9A 2YJSA 3R01A 4AN2A 2Y0AA 3V51A 3TM0A 3UG2A 4D2WA 3BQRA 1H8FA 2PVRA 3PA4A 3Q9WA 5E8UA 3Q6UA 4TYHB 3QTZA 1RQQA 3ZC6A 3ODYX 2W99B 2ZM1A 4JQ8A 3QQFA 3RNIA 4EOJA 2GQSA 1KSWA 1Q61A 3KMMA 4G34A 5FUTA 4E1ZA 3EN5A 4LGHA 4R6VA 5HE1A 2NNWB 3BYUA 3UJGA 4AE6A 3GC0A 3C0IA 3TKIA 2UV2A 4GFGA 1YOLA
chains in the Genus database with same CATH superfamily
4UWBA 3ORTA 4EH6A 5DRBA 5HG5A 4TY1A 4O0RA 4RVLA 3RNYA 2HW7A 3ZSHA 2Q0BA 1Y6BA 2Z7LA 5ANKA 4XOZA 5DWRA 4J96A 2GNHA 2WQMA 4K1BA 5EDPA 4NJ3A 3DJ6A 3TZ9A 3CTJA 5AMNA 3MB7A 3QRKA 5IH6A 2BFYA 3EQBA 2W1EA 3ZLYA 1ST0A 3P86A 2XUUA 4QOXA 2JD5A 1TVOA 2YFXA 3EFLA 4XYFA 3G90X 4R7HA 4ONAA 4D28A 5KUPA 3RK7A 3WF5A 1YHWA 3PJ1A 2C1BA 4RA5A 4MBJA 3VS2A 3W2CA 4F1TA 4O7ZA 1DAYA 3R9RA 4DFUA 3FLSA 4TWNA 4E26A 4FE2A 2YIQA 2ZM4A 5L2IA 4RZWA 3LCTA 5I5ZA 4ASEA 3E7VA 3LJ1A 4DEGA 4HNIA 5I3RA 3UO4A 3FKOA 4XLIA 2ERKA 5AJQA 4C34A 4F0IA 3O51A 2YAKA 4L52A 2P2HA 3TDWA 1IR3A 1U59A 4P90A 5GINE 5AAGA 3TNIA 4F0FA 4WO5A 4U79A 2JGZA 4CFMA 5H3QA 4YJSA 3UOKA 3MFSA 3Q53A 3QTRA 1MQ4A 4AXAA 4IX5A 4ZAUA 5FDXA 4EH4A 2WIHA 4BKYA 4FV7A 2J0JA 4FYNA 1W2FA 2FH9A 1ND4A 5CU2A 2GNFA 5M57A 2UZNA 2IW9A 4Z55A 2VTIA 4IADA 4QPMA 2GPHA 4CYJA 1KV2A 5IA4A 2OXXA 1OECA 3DY7A 3FUPA 3KL8A 1BI8A 4E6AA 3DNDA 3UOHA 4JMQA 2CNVA 2OIBA 3Q2MA 5CSPA 3ZC5A 3QQLA 4GKHA 3BEAA 4DG2E 4IFGA 4UMQA 2OZOA 5FBOA 4O4CA 1FBNA 4EOIA 1OL7A 3G9LX 2PVKA 3F3UA 5HD7A 4L3PA 5IISA 5L2TA 2WO6A 5FXSA 4MK0A 2ONLA 3MWUA 2W1GA 3MJ1A 1ZMVA 3NS9A 2DS1A 3OWPA 4QP7A 5A4CA 1ZRZA 2WMRA 2Z7QA 1CKJA 3C4CA 4O7YA 3VS7A 2O63A 1MP8A 4H3QA 3MESA 3QX4A 4OT5A 5AP3A 2QOHA 3UVQA 1RJBA 3KIOC 2WXVA 2CMWA 2J5FA 2EVAA 3DAJA 3GCQA 4YO6A 3OCGA 3BU5A 2C6KA 2OU7A 2XNEA 3D2KA 4DDGA 5AV2A 4F09A 2WTKC 3PY3A 4B0GA 3E93A 4PDOA 3NUAA 4LOOA 3ORIA 3UIXA 4PL3A 2OLCA 4FEUA 4QQCA 4BCGA 3HMOA 2OF2A 3WYXA 4DC2A 2YCFA 2UW5A 2QU5A 5A4TA 3H4JA 4DH3A 1ZZ2A 4YZDA 4ZTSA 5CF4A 4L46A 3L8VA 3D14A 3M42A 4KBKA 2IZSA 3VUTA 4MD9E 3SAYA 5M4FA 2XP2A 5K5NA 2X1NA 5I9XA 2R5TA 4UMTA 2VTAA 2X7GA 1GZOA 2PZ5A 4RQVA 4RX7A 1Q3DA 4DITA 3LXKA 3U51A 3WIKA 5KZIA 3GB2A 4Y83A 4Z7GA 2FSLX 2H34A 4XP3A 1Q8YA 4A9RA 4FVRA 3ZSGA 3PSDA 3QAME 4FICA 4P5ZA 5FD2A 4LDTA 3R00A 4G6NA 3WYYA 4P7EA 3I79A 3OCBA 4C8BA 3CXWA 3EQPA 4W4VA 1PJKA 2E9NA 3TV6A 2YM3A 5BVNA 5CU4A 2XM8A 5LXMA 3KRLA 3L8PA 5A4LA 4U97A 3M11A 2BALA 3R7OA 4USFA 3FLQA 3LVPA 2IVUA 2ZB0A 3HLLA 5BUIA 3TZMA 4E6CA 4UV0A 2XF0A 3I7BA 4I21A 1PKDA 1DAWA 3FMHA 3QRTA 4XV9A 2BRGA 5K4JA 4ITJA 2DYLA 3A61A 3CBLA 2QR8A 3ZRLA 5A54A 3LFSA 1YOJA 2OBJA 3FWQA 4OGRA 2JDSA 4EORA 2A98A 2XYUA 3KREA 4IWPA 3CTHA 4I20A 2BDWA 1UU3A 3H9OA 4EK5A 4XBRA 1ST4A 3F3ZA 4RIOA 4AWIA 4R5SA 5F20A 4D2VA 2OSCA 2BAQA 4QMMA 4QMZA 2HZ4A 3TEIA 2XZSA 3MY5A 5CSHA 4KRCA 1OBGA 3SHEA 1ERKA 4CZYB 4PDSA 2IZRA 2JAMA 3R8VA 1YDTE 3UQGA 3MA6A 4J98A 4EOMA 3MYGA 1UNLA 1PXMA 2NRYA 4JJRA 3IECA 4ANOA 4QQTA 3QX2A 3EQRA 4KIOA 4RJ4A 4O4DA 3U9NA 2C5NA 3WOWA 3VBVA 4I3ZA 4MH7A 3OFMA 4U44A 4CSVA 5EYCA 3OTUA 3CLYA 4LUDA 1VYWA 1K9AA 3DBQA 4M69A 3HA6A 4NM3A 2Y9QA 4FA2A 2YIWA 3FI2A 4ACDA 3RAWA 4M69B 2XA4A 3ZU7A 5E8WA 3R7GA 5D41A 4UY9A 4APPA 4Q5EA 2ZDTA 1T45A 5LVLA 5CEIA 5LVOA 2RF9A 1P5EA 3UZPA 1H1QA 2VWIA 5AA9A 2JDVA 4BVUA 2ZV2A 3R63A 3CJGA 4FZDB 2OIQA 4XS2A 4LYNA 5BMMA 4E5WA 5CF6A 4TW9A 4CRLA 2VTNA 4U9AA 4D1ZA 4BZNA 4IWOA 1OL5A 2ITTA 4BCNA 3E8CA 1UU7A 3V6SA 4C36A 4ZMEA 2QOIA 4FKQA 1FVRA 3AT2A 1H4LA 2IO6A 4P5QA 5LMBA 2YM5A 2PVHA 4EOSA 4PWNA 5AP5A 3W33A 4BZOA 5IEXA 1L3RE 5IQIA 2PTKA 2B9JA 3EH9A 4F78A 4BL1A 2CKOA 3VS6A 1YHSA 3P5JC 3NPCA 3L9NA 3AXWA 2BIYA 3EOCA 5TO8A 2BAJA 2RFNA 3AC5A 2PU8A 3Q9XA 2QO2A 1SYKA 4LGDA 3SRVB 4EQUA 2QO9A 4TNDA 4FSNA 4QP2A 2PYWA 3GGFA 3HP2A 3VF8A 2WHBA 1WZYA 3JY0A 2QLQA 3DAKA 4GYIA 4IVBA 4OTIA 3RCDA 4M67A 3PA3A 2UZEA 3ACKA 2F2CB 2JEDA 4UN0C 4CG8A 2G2IA 5B2LA 1Q62A 4CG9A 5AP7A 3WZUA 2C6DA 4RWIA 3BE9A 4DYMA 1W8CA 4DLJA 4QQJA 4DTKA 2EXMA 2XKFA 4QMLA 1PMUA 4FL1A 3BV2A 5IA1A 3FXWA 3QCXA 5CI7A 4OAVB 4QT1A 4RX5A 4KABA 5GZ9A 4A9UA 3C4FA 5FGKA 4ZJJA 4QYYA 1H1SA 4KKGA 4HNFA 2PVYA 3PWDA 3SA0A 3W2PA 3TYKA 4D4SA 3NZ0A 5EFQA 3HA8A 5EW3A 4AZSA 3MVJA 4JLCA 3KVXA 4FT0A 4BICA 3UNKA 3ATSA 4FGRA 4J1RA 3GC7A 4G9RA 3DT1A 5M4UA 3A8XA 4IM3A 3R7YA 3AD4A 4KBAA 2QHMA 5DRDA 4F9YA 3ACJA 3D5UA 3GI3A 3S3IA 3PE2A 4D9TA 3FJQE 3QD3A 4FNYA 4GG7A 1TZDA 1YWNA 4W4WA 2Y8OA 1KE6A 3QYZA 4CLIA 5IMEA 4C7TA 4O86A 1JKTA 4BDJA 4CFFA 1KV1A 4IDTA 4BI1A 2PZIA 3ZFYA 5AP1A 4KUJA 5CI6A 3LJ2A 2B4SB 4EH9A 4IC7A 1IAHA 3ORLA 4APCA 4PX6A 5K0XA 1YXXA 2W1DA 2VGOA 2X8EA 2YM7A 4Y8DA 5LMKC 3ANRA 1OVEA 2C0OA 4KWPA 1I09A 4PL4A 3QLFA 5BVOA 5IA3A 2I6LA 3GC8A 3QZFA 4DF3A 4PMMA 3UVPA 4A4LA 4XG4A 1TKIA 4XHKB 3MIYA 4C4HA 1Q8TA 2P3GX 2YLEA 3IW7A 4DEHA 4BDDA 2J5EA 3QQKA 5I9YA 5JRQA 4NCTA 4DBNA 3AOXA 3CGOA 1B38A 3B2WA 2W9ZB 3TNPC 5IG1A 2RFEA 4QYHA 3UP2A 2YEXA 5BNJA 3E92A 4R7IA 4AW0A 4QYGA 3GU6A 3KXXA 3NUSA 5AV4A 4NTTA 3UC4A 5M55A 4YPSA 3QFVA 4ZTNA 4G3CA 5JRSA 5T68A 3A8WA 5CWZA 4D4YA 3RALA 2O64A 5FG8A 5IA2A 2WMAA 3V8WA 2O2UA 3B8RA 5CANA 5ANJA 4FEVA 2VWZA 3LE6A 4HGSA 2WIPA 4XG6A 2FA2A 3HUBA 4QMUA 4ZJIA 3VAPA 3ALNA 4HPTE 4HYHA 4NM7A 2YA9A 5DBXA 4FT7A 2QOLA 4TTHB 2LAVA 1ZMUA 3BX5A 4L42A 4BCPA 1PXNA 2GQGA 4BFMA 5GZ8A 4GUEA 4CTCA 1YQJA 5KO1A 4BDFA 3DDQA 4DBXA 2C0TA 4FEWA 3CPCA 3LPBA 1GAGA 2F2UA 3QXPA 4FTAA 4JNWA 4XRJA 4ZZNA 4YC6A 3Q4UA 2HIWA 1MQBA 3ZYAA 2ERZE 2WMUA 5FTGA 3FZRA 2XAMA 3W1FA 5HE3A 1PMEA 3SOCA 4PDPA 3UG1A 5KMMA 2YJRA 4BBMA 5BVKA 4C62A 1HCKA 4P4CA 2Z02A 4C33A 3B2TA 1QL6A 2BKKA 3OCSA 4JAIA 3ZO4A 1CKIA 5DGZA 4X2JA 3RCJA 2B1PA 4DFLA 3F6XA 1BL7A 1GJOA 3VBQA 4BWXA 1EH4A 3NNXA 2PMLX 2XYNA 4ID7A 1KUTA 3C4XA 2ACXA 2YIXA 2RGPA 3OEFX 5EI8A 1ZYLA 4GU9A 4JDKA 3KRXA 2GTMA 3U54A 1YW2A 2XIRA 2YZLA 4HJOA 3P7AA 2C5YA 4QNYA 3V5PA 3WIGA 4ASDA 1JBPE 3R71A 5HZNA 5M4CA 5FEEA 2PMNX 4CCBA 3NNWA 4MXAA 5IZFA 4ACCA 4EONA 2YABA 3L9PA 4I6QA 2PMIA 4CFUA 3KN5A 5EM7A 2UW8A 2Z8CA 4XG2A 4ZLYA 3KY2A 2Z2WA 1VJYA 3RAHA 4F70A 4PP9A 2I7QA 4AZEA 2BPMA 3BHHA 3GBZA 3PRIA 4FL2A 3TTJA 3ZBXA 2WFYA 4WG3A 4DN5A 3DCVA 4X3JA 1DI8A 5KMKA 3W0MA 3CD8A 2PK9A 3R6XA 3RI1A 1MRYA 4PTGA 4IVCA 4S30A 3R83A 5DVRA 2W1CA 3TZ7A 4EH3A 4PP7A 1ZZLA 1R78A 5HKMA 4L6QA 3TNHA 4F9BA 4NM0A 5IUHA 3MBLA 3TG1A 3QCYA 4D4RA 5EHOA 5JQ5A 1JVPP 3RINA 5IQAA 4FKWA 4MHAA 4C2WA 4FVQA 3BLHA 1JLUE 2IW6A 4NT4A 4W8EA 4CT2A 3ORNA 4MUQA 3VONA 3KB7A 4YUQA 2W05A 3JVRA 4JBQA 3W0SA 3F2RA 3V5LA 2BZIB 4QMTA 4RT7A 3LM0A 2FVDA 3V5WA 4ANQA 2OZAB 5GJGA 4C59A 2BCJA 5DHJA 3ZDUA 4C02A 5J95A 3BYSA 4ALUA 2I1MA 1NT2A 5IUIA 1QPDA 5TT7A 2YN8A 3BBWA 2BRNA 2BHEA 5FM2A 4AOIA 1CM8A 2VO7A 2C6EA 3AMYA 4ZP5A 4ANSA 5I0BA 3P0MA 4KBCA 2Y4PA 1FINA 1R0PA 2WMBA 4FJVA 4FKGA 1VYZA 4LGGA 4CFXA 3HX4A 5TF9A 4NKSA 3LCOA 5C1QB 3WE4A 3UDBA 5HLWA 4FV1A 2W5AA 3C4WA 2Z60A 5CVFA 1G8JA 4IZ5A 4BKZA 3NVMB 2J2IB 3DXPA 2IF8A 4FZ7A 3WF8A 3F61A 2PHKA 5J7HA 1U54A 4I6LA 3L9MA 2CPKE 2BMCA 4RQKA 3NYVA 4FIEA 5KHWA 3UVRA 2YISA 3NAYA 3QTUA 2QOFA 3PJ2A 4KA3A 1WBSA 4AP7A 4B4LA 1AD5A 3LMIA 5HVJA 4RX9A 3EFKA 5D7VA 4IB1A 3GU7A 3ZRKA 4UMPA 5I4NA 5C26A 2OFVA 1UWHA 4YTFA 2C3JA 4IB5A 3ZO1A 4ZIMA 4E5BA 4G2FA 1WBWA 4A9SA 3E7OA 5CVGA 3VN9A 4DFBA 4GT5A 3HRFA 4AA0A 5EK7A 3HMIA 5HTCA 1SVEA 1XKKA 2VWUA 3BYMA 1XH5A 4FYOA 2B7AA 5DT3A 5IF1A 3TJCA 5M4IA 1ZY5A 1GZ8A 4BB4A 4D5KA 2B9IA 3N51A 3NW6A 4E93A 4I5MA 4Z16A 2QKWB 4X0MA 4JBPA 4M3QA 2OJFE 5B2KA 2QU6A 4YJOA 5ANGA 4G16A 3MY1A 5D9HA 4Y95A 4KIQA 4HZSA 4E73A 4RLKA 4BKJA 4O82A 4K8AA 3Q4CA 4U5JA 5H8GA 2C5OA 4H36A 4D5HA 4YO4A 5J7BA 4FV2A 5J79A 4AF3A 4HW7A 4YHFA 5KKRC 2VN9A 2G2HA 3HL7A 5EHYA 4BIBA 2X39A 3V04A 3U6HA 3UO6A 3IW4A 4FI1A 4ARKA 3PJ3A 3BZ3A 4G3DA 4OTHA 5ANOA 5HTBA 3A4OX 3MDYA 3L8SA 4UZHA 5E8VA 4GKIA 1UKHA 4RC3A 2JBOA 4BR3A 4D9UA 2WGJA 2VNWA 4AX8A 1M7QA 4O7LA 5BVDA 3UOJA 4S33A 5EYMA 3W55A 4DFXE 3MVMA 1G8SA 4CGAA 2B0QA 4AT4A 4RJ7A 4KSQA 3LKMA 3ZLXA 3W0RA 4ALVA 3SGCA 3EYHA 2VTSA 4H58A 3T3VA 1XHAA 1OL1A 4F99A 3CGFA 5HU3A 1IAJA 2UZBA 2VNYA 4O0TA 4X2KA 4TNBA 4MD7E 2QC6A 2C6LA 2VWBA 2QOBA 4KSPA 3FDNA 3LZBA 2JLDA 3E64A 1OIRA 1XO2B 3KCKA 3ORKA 4C35A 4IWDA 2GS2A 3E3PA 2GHMA 3NFFB 5FP5A 4WHZA 3R8ZA 3LXPA 4KKEA 4L44A 3KULA 3R8UA 4BTFA 3FL5A 5CAVA 3FY0A 3JVSA 4U80A 4D2RA 4F63A 4ZSAA 3P4KA 3KK9A 3UZRA 1UU9A 3BU6A 3NLBA 5AR8A 4BIDA 3EQIA 3KULB 2QLUA 3V8TA 1U5RA 4BHNA 3FYKX 4DT8A 4IZYA 4NTSA 5LVMA 4FIGA 1OKZA 1FMOE 3SC1A 4N6YA 3BL9A 1JSVA 4G9CA 5AR3A 4EZ3A 5B2MA 3VQUA 4QP3A 1IA8A 4CT1A 4FOBA 4BCHA 4FKTA 4FK3A 3C7QA 3Q2JA 4UALA 3FAAA 1FGKA 2JITA 2W4JA 4FUYA 4E4MA 5J9LA 4OAUC 2PVLA 3ENHA 4YC8A 4BCFA 4NWMA 1J7UA 4R78A 3SOAA 3MH1A 4JX3A 2E9PA 4HVDA 2CSNA 3OWLA 5AX9A 4FTQA 3RAKA 1WBPA 1S9JA 3MIAA 3SXRA 3KK8A 3PA5A 5D1JA 3ANQA 3QD4A 4JIKA 2R3NA 3DBDA 3NUYA 1KE7A 4EC9A 4OUCA 4ZMFA 1KE5A 4MBIA 2C6MA 4H3BA 5J8IA 4DEAA 1NVRA 4AT5A 5CAQA 2HAKA 5LCKA 1LUFA 4YHJA 1PXLA 1PKGA 3SQQA 2PVJA 2WOTA 4I4EA 4KIKA 3WF9A 4CMOA 5TE0A 1XMMA 4TYHA 4EOQA 2VTHA 4IH8A 5DLSA 4KIKB 2C47A 4FSYA 4QPSA 5E8SA 4U41A 2QG7A 4DDIA 1M2QA 3NW7A 2OICA 4QMYA 4NFNA 5DNRA 3WF6A 3ZZWA 4GCJA 5IQDA 4FTMA 2B53A 3CQEA 1P4OA 3QZGA 2WQBA 4U0IA 2F9GA 2WMVA 2WZJA 4MF1A 2X6DA 4L8MA 3R2BA 3LLTA 1ATPE 1Y8GA 2DWBA 2YCRA 3PG1A 3PXRA 4FTJA 4EUTA 3FMJA 4ZSGA 3NUNA 2ETRA 4D4VA 1G8KA 4X7QA 3TN8A 4PMTA 4YC3A 3D9VA 4U7ZA 2YDIA 1HCLA 3C9WA 4D1SA 3HDMA 3CCNA 3DK3A 4XP2A 2C69A 5I9ZA 2W5HA 5IA0A 4YTHA 2R0IA 4DT9A 4B99A 3BHVA 4CQGA 3KFAA 2J50A 3AG9A 2QCSA 4F65A 1WVXA 4GVAA 5JEBA 3I0QA 4JL9A 4NH1A 1P2AA 4IVDA 4FKLA 1O6LA 4WRSA 5DEYA 1VZOA 4IB0A 2RFSA 3ZXZA 2XH5A 1OGYA 5EQPA 1Y57A 2W4KA 3MVLA 3FPQA 3P9JA 4Z9LA 4EC8A 3FHRA 1XBCA 1W83A 4GUBA 4JBVA 4LUEA 1BX6A 3MTLA 1FGIA 3PJ8A 4EOOA 2QOKA 2R64A 3UNJA 4YBKA 4FKSA 2JDTA 3VHKA 5IEVA 1AGWA 5HD4A 3DTCA 4N70A 1H28A 1JKKA 3VWAA 4C0TA 5IA5A 4EH5A 5A6NA 1XH6A 2VTLA 1BYGA 2RL5A 2ITVA 4FZ6A 1GOLA 4ACHA 3PJCA 5AIRA 3O8TA 3TTIA 2GU8A 1Y6AA 3G5DA 3COMA 5JFWA 5E8YA 3D4QA 4YHTA 1YOMA 1ZXEA 2VTOA 3Q04A 5HNIX 2JIIA 2PE0A 5BUJA 1FPUA 1OKYA 3MFTA 4HCTA 4J8MA 4QMNA 4QEBA 3R9DA 4KKHA 3T9TA 2I0HA 3MH2A 5E91A 5IQCA 3GU4A 2V62A 2J6MA 4OLIA 4RC4A 5FBNC 4ITHA 3ATTA 3VVHA 3LJ0A 3F7ZA 3MFUA 2BRBA 2R3MA 3GOPA 3RAIA 3OUNB 3ROYA 2PULA 1CTPE 4G3EA 4BC6A 1GIJA 4BCIA 4J99A 3GCPA 3TUDA 3S0OA 3A7FA 3W16A 2ITZA 4NK9A 1H07A 3G0EA 5JH6A 4UX9A 3QLGA 1H0WA 4FG7A 5BVFA 4FSQA 5AFVA 2HY81 4Z3VA 2EWAA 2HXQA 3VUIA 2WMWA 1IA9A 1H24A 4D58A 3PZEA 4DH7A 2VUWA 2CJMA 3RM7A 2PUIA 2PUPA 4N57A 4I4FA 2DQ7X 4QP6A 3CPBA 2OJIA 4IAFA 5D11A 2YAAA 4DINA 2QKRA 5KMLA 3QD0A 4TT7A 3FQHA 2GNLA 4BDIA 2W1IA 2AC3A 4JXFA 2BZJA 4FV8A 3R7VA 4Z7HA 3PXFA 4KAOA 4BDEA 3IOPA 3ORXA 2JKKA 2NP8A 3FXZA 3OG7A 3P7BA 5HQ0A 4XG8A 4W4YA 4L53A 3SXFA 3UNZA 3NDMA 4RWLA 2CGVA 1A48A 5GZAA 3OTVA 5CS6A 4BN1A 3NNUA 4BDCA 1JPAA 5CEOA 2OH0E 4ORKA 4J71A 3ZZEA 3IOKA 4L00A 2Q0NA 4X2GA 3VS4A 1J7IA 3TXOA 2C6IA 3O17A 1M2PA 4BYIA 3OXTA 4X6QC 2CHLA 3EN4A 4R3PA 4I0SA 5DT4A 3QQHA 4YZ9A 4WD5A 1MRUA 3OOMA 2WMQA 3IW6A 3PPZA 4M7IA 4R3RA 4FTRA 5DR9A 2YDKA 4I94A 5IPJA 4EWQA 4E4NA 2BHHA 2OGVA 2CNUA 3VHEA 2IVTA 2IEWA 2WMTA 5FTOA 2XCHA 2ESMA 4GK2A 5F1ZA 2NYAA 3IDPA 1R1WA 3R02A 4RMZA 4FSMA 4EZ7A 4CEGA 2J7TA 3VUHA 3HUCA 4MXCA 2XBAA 3E63A 4NU1A 3FV8A 2VX0A 3HGKA 5EM5A 3KXNA 2X9EA 2XALA 4AAYA 2YIYA 3OY1A 3A2CA 4D0XA 4E4LA 3MW1A 3K3IA 3LFAA 4G6LA 5J9ZA 1OUYA 4QYEA 5JFXA 3KC3A 4XG9A 4BTKA 2GQRA 3KF7A 4DHIB 3O7LB 3RWPA 5JGAA 4OTDA 5AP4A 4H3PA 5AV3A 3V5JA 4RFYA 2JDRA 4D0WA 5ANIA 2VZ6A 4QYFA 2ITOA 2XRWA 5CT0A 3ZSIA 3NNVA 2CLXA 5DIAA 4EOKA 3EKKA 4JI9A 3L8XA 3DJ5A 2CCHA 1GY3A 1UA2A 1DS5A 2FGIA 3OW4A 4L3JA 5CQUA 2PMOX 3R1YA 3ZHPC 4EWHA 4Y5QA 1YRPA 3UMXA 4MYGA 3VBXA 4AW1A 4AU8A 2F49A 2X4ZA 4TKSA 3PWYA 3ERKA 5HX8A 5ITAA 1UNGA 2OXDA 3LQ5A 2DUVA 4IMYA 1LP4A 4L43A 4L67A 3IONA 3BHYA 1PXPA 1QPEA 4UWYA 4W9WA 3GXLA 5HTIA 3UYTA 2Y6MA 5E1EA 2CN8A 2B54A 4O0WA 4DH5A 3NAXA 4O6EA 4PTEA 4MXOA 3P08A 2CDZA 2NRUA 2P4IA 4PL5A 3DXQA 5HCXA 2HW6A 2J0MB 2XJ1A 1YVJA 4I1ZA 4AZVA 1RDQE 3NEWA 4DTBA 3CR0A 4XCUA 2EB3A 3OT8A 3U87A 5EM6A 3THBA 4O0UA 3I60A 3HEGA 4ZTRA 2C3KA 1WCCA 3DKGA 4ZXTA 1F3MC 3OWJA 1VR2A 3CQWA 4FT5A 5ICPA 4JR7A 2BAKA 4TYJA 1Q41A 3FBVA 5E1SA 1KE8A 2UVYA 5E8TA 4QMSA 2HWPA 2WELA 4FSRA 1ZOEA 3W0QA 4IAKA 3R21A 3G9NA 4CXAA 5LJJA 5J5SA 4FK6A 5JSMA 2BTRA 2X7OA 4JQ7A 2W9FB 5HBHA 4KD1A 1FQ1B 2C4GA 2X9FA 3RKBA 1Q8UA 3U55A 3NUPA 3PP1A 4U81A 1WAKA 4A4OA 4AAAA 2BILB 3R0TA 5EDRA 4GG5A 3LW0A 3PIXA 3SRVA 2I0YA 1FVVA 4K18A 4OTFA 5CNNA 4LV5A 4B6LA 2VWVA 2J0LA 3DJ7A 3PXQA 2ZB1A 4EOPA 2YLFA 5AM6A 4L01A 2HYYA 2PUNA 2J0KA 3BV3A 1V0BA 2QURA 4FV3A 5EOBA 5HBJA 3A7JA 5JGDA 1VLRA 2IG7A 4DG3E 4QDVA 3OMVA 3G6HA 2BROA 4GEOA 5L6WL 4F6WA 3AC2A 4YNOA 3QTIA 3AC1A 4LQMA 4TYIA 2CGXA 3R73A 1RE8A 3LFCA 5C4KA 4FGBA 2A27A 3TUBA 2NO3A 4MTAA 5LOHA 4TZRA 5TR6A 4X21A 3R1SA 2G2FA 4AOTA 4FTTA 3OUKA 2G9XA 4E6DA 3R7UA 4CQEA 3SW4A 4TWOA 1LR4A 3OP5A 4FEQA 5AR2A 5EW8A 4GT4A 3C5IA 4OTPA 4Q2AA 5M44A 5HE0A 5BV3A 1YI3A 2A4LA 3TUCA 3MI9A 2HZNA 4F9AA 4HVGA 1OIQA 4LOQA 2WEVA 3GU8A 4IJ9A 4PDYA 3KXGA 1G8AA 1ZAOA 2GNIA 4NCTC 4BIEA 4O7VA 4O0YA 2GFSA 1B39A 5CF5A 5DYJA 2OFUA 3HV5A 4O0XA 3W2OA 2XIKA 1BKXA 1K3AA 4XH6A 3PG3A 3TI1A 4JBOA 5LMAA 3GFEA 4HZRA 5M51A 5CU3A 4ZS4A 1WBNA 2WTVA 4O7NA 4G31A 1ZYCA 3BELA 5JGBA 4JT3A 3GT8A 4YLLA 3N4VA 3PDTA 5BX0A 4L3LA 5DE2A 3F2AA 3QWJA 3EN7A 2V7OA 1W98A 3MH0A 4P2KA 3H10A 5E8ZA 5K5XA 4GT3A 3KCFA 4O2PA 3QL8A 4LM5A 1YXSA 2V55A 2VTMA 5L8KA 4IANA 3CD3A 5HE2A 3ZOSA 4YPDA 1GIHA 1R39A 3GEQA 3GCVA 1B6CB 4G5JA 4LRMA 3KEXA 3S2PA 4MQ1A 4RJ5A 4WRGA 4IZ7A 1J3HA 2CCIA 4D2SA 4V04A 3UMWA 4FNWA 2UZLA 2OWBA 3FI8A 2C6OA 4PUZA 1PYEA 5B7VA 3BIZA 4AS0A 1XH4A 4DE4A 2AC5A 3G6GA 2R7IA 1YDRE 1U5QA 3BU3A 3GENA 4USDA 4DEDA 1SZMA 4ZTMA 3K2LA 2P55A 5HHWA 5FWKK 2Y4IB 4DFYA 3ENMA 3VBTA 3MPTA 3C0HA 3MN3A 4GYGA 4I23A 5J5TA 3N4TA 4GW8A 2FYSA 1BLXA 4LV8A 3R28A 4KB8A 3EWHA 2XJ2A 2QR7A 4J7BA 4KS7A 4HGLA 2RFDA 4S2ZA 3V6RA 1OKVA 4RWJA 3R8PA 4F08A 5HO6A 4LRKA 3I5NA 5T3QA 4BYJA 4CKJA 5FEDA 3F88A 5A14A 4A7CA 1NVSA 3W8LA 2XM9A 1BI7A 3DV3A 3IW5A 2X2LA 5BVWA 3QU0A 4ALWA 4BTJA 4O7RA 4DHJA 3D5XA 3HKOA 4MWIA 3ITZA 5CNOA 3OBJA 4NW5A 2UZOA 4XV1A 2ZMDA 4JRNA 4U42A 5A6OA 1YI4A 4FUXA 5CEQA 2OXYA 3TCPA 4CFWA 3QQJA 5CEPA 4Q9SA