4ZTHA

Structure of human p38amapk-arylpyridazinylpyridine fragment complex used in inhibitor discovery
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
350
structure length
339
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Structure of human p38aMAPK-arylpyridazinylpyridine scaffold complex used in inhibitor discovery
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 115
structure length 339
sequence length 350
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2015-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zthA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zthA01
4UXQA 5CT7A 5B2LA 4PNIA 2X9EA 3A2CA 3TZMA 1OB3A 4FVRA 4PUZA 4B99A 3NUXA 2HZ0A 2UUEA 3I5ZA 2RKUA 5HZNA 4IVAA 3E62A 1G8SA 2HELA 3HV5A 4FEUA 3PTGA 4AZFA 4D0XA 2EXCX 4YBJA 4NIFA 4DEEA 4V05A 5A4LA 2YDIA 1CKJA 3QKLA 4HOKA 3UZPA 2HW7A 1ZYJA 3H9OA 4W4VA 3UJGA 3TDWA 4PDSA 4BZDA 3ZONA 4G5JA 4CTBA 3KK8A 4LOPA 4YZ9A 4WIHA 1M2RA 4D2SA 2BKZA 3BGQA 4O22A 5HEZA 4F9CA 3HDNA 2P33A 1R1WA 3R7UA 2A2AA 2RG5A 4MTAA 4YTHA 3R7VA 2F4JA 4QP6A 4BYJA 2X6DA 3SOAA 3DB6A 2YZAA 4UX9A 1LPUA 3JPVA 4EONA 4FA2A 4G6OA 3WE4A 1PKGA 3PXKA 3ZXTA 3NCGA 3NNVA 2CCIA 2J0IA 2YM3A 4WSQA 1H1RA 2R4BA 3PLSA 3R7EA 1K2PA 5IF1A 3QTZA 3UOJA 3BPRA 4BWXA 5BVNA 4CMUA 3IDBA 2UZTA 4QP8A 2XIYA 4DF3A 4J95A 3EB0A 4QTBA 3VIDA 2Q83A 3HECA 4DH5A 3MB7A 2YIQA 2GSFA 3DLSA 3F5UA 4ITJA 5AA9A 4BDEA 2VRXA 1WBWA 3C4CA 2FYSA 2VTRA 3KU2A 3CJFA 5HORA 3GBZA 2JKKA 4HVHA 3A7IA 5D10A 5KKRC 2YZLA 3R8MA 4ENYA 1A48A 3BHYA 3A4OX 5HNBA 3CY3A 1Q62A 3EQGA 4NEUA 1IAJA 4BZOA 3MVLA 4U40A 5AM6A 4IFCA 3PZHA 4HVDA 2GS2A 5FG8A 4XG7A 3MPTA 4C3PA 4BDKA 4BCJA 1O9UA 2R0UA 4IC8A 2UW8A 1W0XC 4H1MA 2PMIA 5HX8A 5I3OA 1Y6AA 5TT7A 2HY0A 1YI4A 3EKKA 1YWNA 4F63A 5E8VA 1XH9A 4FYNA 5M09A 3W2OA 4XLVA 4CEGA 5A4TA 3U54A 2XJ1A 2YCRA 4WNMA 3NWWA 4EQMA 4RX5A 1ZAOA 4QYYA 4TKSA 5EHLA 1M52A 5HLPA 2CJMA 3BWFA 4ZK5A 4ALWA 4UN0C 1XHAA 3GGFA 3OP5A 1UV5A 2PVRA 4NZWB 5IQIA 4ZJJA 4NTSA 3NW5A 4O2ZA 2WFYA 2E9OA 1KSWA 4ZS0A 2YERA 4FIGA 1ZMWA 1UU7A 3EQHA 4CZTA 2J0MB 3NUPA 3W2PA 1LEZA 2YA9A 4OTHA 2OIBA 4RRVA 4DT8A 5IMXA 1WZYA 3NX8A 3LCTA 4U80A 4YZNA 1YXTA 2UVYA 3BIZA 4JJRA 3NEWA 5LJJA 4KB8A 3BELA 2PUUA 3A7FA 2H6DA 2G2IA 3SGCA 3W16A 4NSTA 4CMTA 1UU3A 1EH4A 4OT5A 5K0KA 1Z57A 2Y4IC 4FKTA 5BQ0A 3ZBXA 5GJDA 3ORZA 3RPRA 3BQCA 3EQDA 2ETRA 1FMKA 2OF4A 4GS6A 4FSZA 4D2TA 3EL8A 4KBAA 4RLKA 4QMOA 5CZIA 3ZH8A 3TNPC 3VBTA 2X2LA 4QYFA 3MY0A 3GCUA 3WYYA 4B0GA 4TYEA 4JDHA 3NZ0A 2YAKA 3Q2JA 3WF9A 4GKIA 3QRTA 5HHWA 3N4UA 1WAKA 3F5GA 4CFVA 3FMEA 1KOBA 4G34A 5KMIA 1PXJA 3PG3A 2PE0A 3UIUA 5JT2A 2YM5A 2Q0BA 4CRLA 1Q5KA 2Z7RA 4D1SA 3CR0A 5HOAA 3FJQE 2GNFA 3T3UA 4FKRA 5JZNA 5AR3A 4EUUA 1XQZA 3TCPA 4GJ2A 1QPJA 3BU6A 2BRHA 4QMSA 4E20A 2QOQA 3LW0A 4HGLA 4Z7HA 5DVRA 4U3YA 3RZBA 1ZRZA 2WMXA 3DA6A 3OXZA 4CKRA 3TNIA 4O7SA 3R8LA 4NH1A 3FI4A 3E8CA 3PXQA 5DR2A 1URWA 4I20A 5FTOA 3DB8A 5IA5A 4AUAA 1FVVA 4B8MA 1PHKA 2WEVA 3G9NA 3TIZA 3KRLA 2PE2A 4EEVA 5CLPA 1KV1A 4RFZA 4E6QA 1M2PA 2W06A 3IG7A 2X7FA 1GZNA 4I3ZA 4YSMA 5E91A 2F2CB 2F49A 3TJCA 4ASDA 3CBLA 1OBDA 3NAXA 4W4YA 2PZIA 2VWBA 3I6UA 3MS9A 2QURA 3PVGA 4TT7A 5FEEA 3FZOA 5T6KA 3TT0A 4O1PA 3VBYA 1U5RA 4YJOA 3ETAA 2VWWA 4JIKA 2CN8A 5DR6A 4P5QA 2OXYA 4BHNA 4FG7A 3MYGA 3RBWA 4G6NA 4E6CA 4RJ3A 1Q8WA 1IASA 3V01A 3ZZWA 5FM2A 2BALA 3O7LD 4JR7A 1ZY5A 5EHOA 3LJ2A 4UMRA 3I5NA 3O50A 4FE2A 2E9NA 3KKVA 5KUPA 1FGIA 3M42A 3G2FA 2F57A 5AP1A 4P2KA 1Q8ZA 4XOYA 4YHJA 5LVLA 3Q4ZA 2FB8A 2IW9A 3SA0A 4W4WA 1OL5A 3IW6A 3QXOA 1B39A 4TWPA 4UALA 1SMHA 5CSPA 5IH4A 3I60A 2XKCA 2XYUA 4OTDA 2VD5A 2CLQA 3I1AA 2IVTA 4XMOA 1STCE 2VTJA 3Q6WA 5E4HA 2GHMA 4AX8A 3LM5A 2BFYA 4ZTRA 3ZRKA 4KIPA 4NW6A 4OTQA 4QMPA 4DTBA 2YITA 2FVDA 3C1XA 5CI6A 3KRJA 4ANBA 3CQEA 1NVQA 2LAVA 4ZTLA 2A0CX 4ZXTA 4PP9A 3FWQA 2Y6MA 4A06A 2UW7A 3GU8A 4MNEA 4ZJVA 4II5A 2XNNA 2C3JA 2JLDA 5KMOA 3DCVA 3OUNB 2GNHA 3E7VA 4IAZA 4PL3A 3VS2A 3ZO3A 2NRYA 3MW1A 5BVOA 3FI2A 2R7BA 5CXHA 3DQXA 4UB7A 5IQGA 3ODZX 5IQFA 5CSWA 3FQEA 2NPQA 4QT1A 3LFFA 3TKUA 5LXMA 3L9NA 2SRCA 3AC3A 3MH3A 4D1ZA 4GUBA 2ERZE 4G9CA 4EH2A 4FV6A 4PPBA 3RWQA 3T3VA 3UO4A 4HYUA 3R83A 3VW8A 2XKDA 4BKYA 1JVPP 3KXHA 5LOHA 1KE6A 5L2WA 5CAVA 4GW8A 3UPXA 3ZZEA 5IQDA 4C7TA 4CLJA 5LQFA 5AFVA 3W8QA 1JBPE 2VO7A 1YW2A 4GG7A 4GYGA 4IFGA 3WIKA 1UKHA 3CKXA 5IH6A 1DS5A 1H28A 2RF9A 4F6WA 1VR2A 1Y8YA 4J1RA 4E5BA 4ACHA 4Q9ZA 4QMZA 5AAFA 1GAGA 4IJPA 4EH5A 3UVRA 4ZTHA 2VWVA 4R3CA 1GZOA 4ZZOA 2YACA 4M68A 5HE3A 3G6GA 4K2RA 4F9WA 4HVGA 4Y5QA 3VHKA 3UOKA 3VUTA 4IZ7A 5LCKA 2GS7A 3DBFA 1U5QA 5E8TA 5HG5A 2W1ZA 2XMYA 1CSNA 3KRRA 2YCFA 4IZ5A 3TN8A 2O2UA 3W2RA 4D4RA 3ZRLA 1R3CA 4IDVA 5E92A 4AT4A 3EQBA 1Z5MA 3V5JA 4RLLA 5L8KA 4MWIA 2PK9A 3OUKA 4I23A 4L00A 2XS0A 4TL0A 2O5KA 2GHGA 4RQVA 2J0KA 4O6EA 3OWLA 5FXRA 3KA0A 3G90X 4F65A 4PTEA 4RFMA 4IVDA 4O83A 2C1AA 2EUFB 2XNGA 4AGWA 4E3CA 4L44A 4GFMA 3QGYA 4D2RA 3KEXA 5JEBA 3ZEWA 4BF2A 3HV7A 4YJRA 4RIWB 3RM6A 4ARKA 2JFLA 4RA5A 3UZRA 2PVNA 3GENA 4EH3A 5LVNA 3I4BA 5IA1A 5JGBA 3P7BA 3DBCA 2PMLX 5AUWA 3V5WA 2JKQA 1A9UA 1BYGA 3QGWA 1YKRA 3RALA 3IDPA 3QQUA 2PVFA 3PP1A 4PQNA 3SG9A 5FUTA 2HWPA 2YM6A 5L6OA 3H4JA 3MFTA 2GNJA 4QMLA 3MTFA 1JKTA 3QX2A 4F1MA 3QF9A 3QRKA 1H0VA 3MFRA 3CTHA 5E1EA 4BCOA 4FSQA 5DNRA 4B7TA 2IWIA 2VN9A 4MHAA 4J8NA 4EQCA 4XV1A 4C35A 3HUCA 5IQCA 5JGDA 3O8TA 3PJ1A 4YO6A 3NVKI 2QO2A 2FSOX 5IEVA 4QP9A 3R1NA 4DGLC 2NO3A 4E5AX 2W4JA 3AGMA 4ZSAA 4TRLA 3OXIA 4MF1A 3ACJA 4S2ZA 2QO7A 3ALNA 4FTOA 3MPAA 5E8SA 3QA8A 4O7WA 3PP0A 3Q9ZA 4KS7A 1BI8A 5DLSA 4E4XA 4J96A 3QQFA 2I0HA 5E8UA 2XNMA 3D9VA 1MQBA 5IKWA 4DA5A 4C38A 2OO8X 2I0YA 3WILA 3V5PA 2W1HA 1QMZA 1HCLA 2XM8A 3BYMA 2W99B 3CIKA 3F3UA 4FK6A 4XJ0A 5HNGA 1YOMA 3VQUA 1SVEA 4HGTA 4UMPA 5I9VA 4O7VA 3KN5A 5AM7A 2IJMA 4L43A 3LLAA 3EN5A 4I6BA 4NM7A 2OZOA 1XJDA 4I5CA 4KINA 4UXLA 4I41A 4M7IA 2XA4A 5EW9A 3PWYA 2ITZA 5JFVA 2WQMA 3FY2A 3LAUA 5CEPA 3MDYA 5GHVA 3MA6A 3VUGA 5ETAA 3BV3A 4DHFA 3TNHA 4EZ3A 5DYJA 2WTVA 5A6OA 4HZRA 1UU8A 4XYFA 3GFEA 4ASXA 5GIPE 2ZVAA 2BDJA 2OIDA 3DNEA 4FEXA 5HG7A 2BDFA 3WE8A 1Q8UA 1WVWA 1URCA 3FMLA 3H10A 1FINA 3NIEA 5EHYA 3D5XA 3NDMA 3FKOA 3F61A 4PDPA 3BEGA 2IW6A 4N6ZA 4BCMA 5AR5A 2QI8A 2C47A 4BGHA 2XB7A 2J90A 4Y72A 5FXSA 4DFNA 4FSMA 2AC3A 1AGWA 1TQIA 3IGGA 3RAIA 4RIXB 1QCFA 2R3MA 3H0YA 4MXAA 4UY9A 2P2IA 3P7AA 4HNFA 3UDBA 3UVPA 3SW4A 5H8EA 3MTLA 2AC5A 4OAVB 1XO2B 3ZS5A 4GUEA 4NK9A 4FTLA 5CZHA 3HMOA 3LVPA 3QLFA 4XOZA 5BUEA 3M2WA 2Z02A 1BLXA 4FTNA 3P1AA 4IX5A 5M51A 1FMOE 5AUUA 2QVSE 4TNDA 5AV2A 4FZ7A 5AUVA 1OIRA 3UGCA 2ITTA 2QHNA 2WU7A 1W83A 3QCXA 4R7IA 5M56A 4H1JA 3TACA 3AG9A 4QMQA 4IM2A 3VBWA 3IW7A 4G16A 4LG4A 2OFVA 2PU8A 4O0UA 5B2MA 4GRBA 1H01A 2JC6A 2JIVA 4HGSA 5ETFA 3ZO1A 3IPHA 1R39A 1ZYCA 3E88A 3KQ7A 4UWYA 5DFPA 5K5NA 2WTIA 4U8ZA 5A4CA 5ANEA 4FNYA 4FNWA 2C0IA 1DAWA 3WF6A 4ERKA 5I3RA 4RSSA 5CU2A 3NNXA 3BHTA 2C5VA 2QOKA 5KCVA 3ULIA 1OKZA 2GPHA 4Z3VA 1SM2A 2R2PA 4PDOA 4NFMA 4QMMA 5E7RA 4BL1A 4E6DA 5BVEA 5EQEA 2G2HA 1MUOA 4PNKA 2ZB1A 5F4NA 3ORKA 1GY3A 3VUHA 4ACDA 3C5IA 5AR7A 3C0IA 2YM4A 2XF0A 3R7GA 2FH9A 5E8XA 5BVDA 2QONA 4BB4A 4KKGA 5IUIA 5CU0A 4MD9E 4S30A 4OUCA 3UP7A 4CFFA 2PHKA 2W4KA 3U6IA 1P4OA 5M57A 2V22A 4JLCA 3A61A 2WHBA 3COHA 4YHTA 2Y6OA 5CXZA 1V0OA 1OIUA 4O0TA 2YLEA 4FV1A 3SX9A 5D9HA 4AP7A 2PUIA 3R28A 2UZNA 4LOQA 2I7QA 3ZM4A 3JR1A 4FTTA 1YOJA 3ZC6A 1IG1A 3CC6A 4GH2A 5BMSA 3FKLA 3LMGA 3K3IA 4BDHA 1QPCA 5GZ8A 5EI8A 4U42A 4DG3E 2X7OA 1LUFA 1JKKA 1OL6A 2GHLA 3F88A 3IW8A 4JQ8A 4KKEA 5FEDA 3VRZA 3UQGA 5AMNA 1BUHA 4ANOA 2OIQA 3OVVA 4FTCA 3ZC5A 4C34A 4YTIA 2B9JA 4H3QA 4OAUC 1T46A 4K0YA 5FP5A 4MKCA 2W9FB 2GCDA 4R3RA 2RFNA 5FTGA 4MBLA 1H4LA 3VS0A 1FPUA 3P08A 3R8UA 5L3AA 3Q4TA 3QRUA 5AA8A 3VHEA 5DN3A 3RZFA 4N57A 2G1TA 4IAAA 3LQ3A 3FZ1A 3LXLA 2ZM3A 2UZDA 3FKNA 3EZVA 5HBJA 1PY5A 4XV3A 4H58A 5HGIA 3RNYA 1PXNA 2I1MA 5KMKA 4YU2A 2QU6A 5JSMA 3TUCA 4OW8A 4LRJA 3ZTXA 2YDJA 2CGVA 4PRJA 3DK7A 1FVRA 5FXQA 4IAIA 1YHVA 1FVTA 5KO1A 3NSZA 2YM7A 4IC7A 1O6LA 5A46A 3ATTA 3HNGA 2VWZA 1H27A 3Q4UA 2YHVA 3ENMA 3MJ2A 3PIXA 4ANLA 5HG9A 3KN6A 2GNIA 1XWSA 5AV1A 2P4IA 4XV2A 4B8LA 4C4HA 4IQ6A 3RK5A 4E1ZA 3EJ1A 2OH0E 1Q3DA 4PL4A 2W1EA 3EN7A 4C33A 2PZYA 3RINA 3UNJA 4QMTA 5G6VA 4ZP5A 3GU7A 3POOA 1M7NA 4JAJA 4GL9A 1PXLA 4LUEA 3UPZA 2QLUA 1YXSA 5ANJA 2JKMA 3V8TA 3RAHA 1YHWA 3DKCA 2Z7LA 3VUKA 1OPJA 4F9BA 3Q5IA 3TTJA 3LQ8A 3ITZA 3AC1A 3PFQA 1SVHA 3CS9A 4M0ZA 1PMUA 4U5JA 4YJUA 5AP0A 3ZUTA 4APPA 3V5LA 3F69A 1RE8A 1XH8A 4IZYA 3R02A 4RZWA 2W1GA 4Y73A 3LM0A 4XCUA 4PL5A 5I4NA 4O81A 3EOCA 5EYDA 2C6IA 1OIQA 1OIYA 2UZUE 3KFAA 3IOKA 4JQ7A 2O8YA 2J0JA 2NNWB 4R77A 2XM9A 2G9XA 3HUBA 5JFSA 2FO0A 2R3FA 3ENHA 4IX4A 5K4JA 4C4GA 4CT2A 3LFEA 3QZHA 4IIRA 1TQPA 3W2CA 4ITHA 3G33A 4EHVA 3DZOA 1V0BA 4ZY6A 2PUPA 4FG9A 4KBCA 3K5UA 3Q9WA 3CSVA 3PVWA 1W84A 2HXLA 5EI6A 4AS0A 3I7CA 4I5MA 5CF6A 4O1OA 4JXFA 4YC6A 5AIKA 4M14A 1PXKA 4NJDA 2BVAA 2CMWA 4Q5EA 2JBPA 5CF4A 4GKHA 3QD4A 2Z7SA 3GCVA 3UG2A 4TWOA 5FWKK 5HLWA 1SVGA 5KMMA 2ACXA 4R7BA 4FF8A 2GFCA 3E93A 1W98A 3F6XA 2GTNA 4MYGA 4AT5A 2WU6A 5AP2A 4YUQA 3QQHA 4TYJA 3QUPA 1IR3A 3A4PA 3NNWA 4NFNA 3HP5A 5IA2A 1WBTA 4ANQA 2ZJWA 4M66A 3R1SA 3ORXA 2IVVA 2C69A 3DQWA 3R2BA 4UMTA 4IH8A 3ULZA 4BCQA 4IE9A 2XCKA 3Q6UA 3JVSA 4XG4A 3DFAA 4O0SA 4RIWA 4CTCA 1S9JA 3O8UA 4O91A 1REKA 1XBBA 2W96B 3BE9A 3D5WA 5BUIA 3NYOA 4L67A 2BMCA 4X7QA 4AZSA 4TYIA 3CD3A 2XK8A 2ERKA 2P0CA 4K9YA 3R2YA 4MVFA 4BZNA 4AZWA 1MRUA 2R9SA 4M12A 4ENXA 3AD5A 4L8MA 5C03A 4BKJA 2BR1A 4DFYA 4F9AA 3TUDA 3AC5A 4ORKA 4Y95A 3VS7A 4OTPA 5JZJA 5ANGA 3QZGA 3SOCA 4BBEA 3LJ1A 1IEPA 4ZZNA 4FV2A 3ELJA 2QOCA 5HIBA 3PUPA 2YCSA 4UZDA 5FQDC 1WVYA 3HMNA 3CTQA 3P78A 4FTQA 2XNOA 3QL8A 2YJSA 3OWKA 5CQUA 3E92A 4ZIMA 3O8PA 4AWIA 3RPSA 4USEA 4R7HA 3FLYA 2R3JA 1J7UA 5CVHA 3BKBA 3PY0A 1YDRE 3D2KA 4CGAA 3HP2A 4LRKA 4IXPA 3DTWA 3ID6C 1H1QA 3KULB 1YWVA 3EQCA 3QQLA 4AAAA 2X9FA 4D4SA 1QPEA 2QOHA 4FZDB 3H3CA 2C5YA 3FEGA 4AQCA 2WIPA 3NUYA 5CU3A 5KMNA 3Q53A 5FGKA 4ITIA 3U51A 3OBJA 4O38A 4D2WA 4EOLA 4DTAA 5DGZA 3KC3A 3LFAA 4ZZMA 5L6WL 5BYZA 4DLIA 2R64A 3DBEA 5GZ9A 4JBOA 4B4LA 1UWJA 2ETKA 3F3ZA 4FSWA 4X0MA 4CQEA 4YC8A 3PXFA 1WBPA 4C0TA 3ACKA 5J79A 3O23A 3TKIA 3AC8A 3GQIA 4FTUA 4QQCA 4BCHA 3JY0A 1VYZA 2ZDUA 4JX7A 4YZMA 4RVLA 3CKWA 3RNIA 3G15A 2XVDA 2JITA 4V0GA 4QTCA 3VJOA 3PXZA 5L2IA 2QODA 4S34A 2PTKA 3ATSA 2W1IA 3A7GA 3CTJA 3OROA 3IKAA 4FKGA 3VVHA 5CAOA 5BVWA 4I0TA 4UMQA 3KXGA 3DBDA 3E7OA 5C01A 4FTJA 4M69B 3SLSA 2C30A 4UBAA 4D5KA 3LMIA 3MIAA 1IAHA 4W9WA 3C4EA 4IWPA 2C6DA 4JDIA 2ITQA 4MWHA 5ICPA 2O3PA 2PZPA 4DAWA 4M0YA 4YP8A 4HW7A 4O86A 4EHEA 5M06A 2W0JA 1A06A 3QRJA 4O0WA 4FT5A 2J0LA 3O96A 2PVMA 3PIYA 5I5ZA 4FMQA 2W5BA 5DEWA 3AC2A 3IS5A 4YNEA 2UZEA 3LOKA 4X3FB 4F0IA 2WNTA 3NNUA 5B0XA 3H30A 1RJBA 3ZSHA 1ZYLA 3A60A 4RIXA 1YHSA 4WO5A 4A4XA 1Y6BA 2X4ZA 3KF7A 3KRWA 4O7YA 2WMSA 1XR1A 3TM0A 4FIEA 3VO3A 3OCGA 3QX4A 2VTLA 2VX0A 3FHIA 3JS2A 3AT2A 2JIUA 3DLZA 3CLYA 3NUSA 1J1CA 3ZMMA 2FSMX 3RP9A 2I6LA 5L8LA 2WXVA 3R71A 2GS6A 4RIYB 5GJFA 4CRSA 2PY3A 2X4FA 4KIKA 3DJ6A 3PJ2A 3FC1X 4OR5A 4CFMA 4PMMA 3BU5A 3L9LA 1ZYDA 3V3VA 3M11A 4ZY5A 4OLIA 2R3HA 3BLRA 3DGKA 1X8BA 3O2MA 3DAKA 4U44A 5J87A 1FQ1B 2CGXA 1KE8A 2BRBA 4OTRA 4XUFA 4ALVA 3W18A 2OKRA 4FSNA 1YOLA 3NRMA 3DKFA 3VBXA 5D7VA 3T9TA 5C8MA 3B2WA 3MB6A 5D1JA 4QMXA 3IDCA 3F3TA 4GJ3A 2BKKA 3QTWA 4IM3A 5DT3A 4N0SA 3P0MA 3HMIA 3GFWA 4YJNA 3FMMA 4D58A 2RFSA 3JY9A 3QC4A 2R3OA 3OTUA 4CLIA 4RT7A 3TXOA 4FKSA 1J1BA 4G3DA 4U97A 3LHJA 3FYJX 2C0TA 3FAAA 4JDKA 2NRUA 2PL0A 3FI3A 1Q61A 3P79A 5IA0A 5K5XA 2OICA 3FMJA 4V04A 3OFMA 3R9HA 3O71A 4JIAA 1NT2A 3IQ7A 4ZSJA 4EOKA 5C26A 3ERKA 5J5SA 3FMNA 3VF8A 5HI2A 4XRJA 1Q97A 4JS8A 4A9TA 4DYMA 4ZSLA 3GNIB 5C1QB 4IACA 4L01A 2W7XA 2WQOA 2VWYA 4KBKA 4DG0E 3NUNA 4GIHA 5AX9A 4DBNA 4E6AA 3HA8A 4P5ZA 3W10A 2PVLA 4U45A 1VJYA 2XZSA 2H34A 4JG8A 2WB8A 5AWMA 2CNQA 2W5AA 2UVZA 4U81A 4FYOA 4EOSA 5EYCA 4WNKA 4O2PA 4W8EA 4D28A 4PTGA 4QTEA 4CXAA 3RPVA 4HPUE 3R6XA 5IISA 4M97A 3QTXA 2HXQA 4FTMA 2VTIA 4JRVA 3HV4A 3ZDIA 4BRXA 4GT5A 2ZB0A 3QC9A 1JKLA 4JOAA 2QKRA 3PVBA 3HL7A 1BKXA 1VYWA 4MD8E 2HZ4A 2PMNX 5BYLA 2WD1A 4J98A 3RK7A 1H0WA 1AQ1A 1OKVA 3R22A 4X2JA 5HO7A 2YABA 4X3FC 3SXSA 4BDAA 5IA4A 1PXMA 3HA6A 3NIZA 5HCXA 3PY1A 5LMAA 2XKFA 4EBWA 3QKKA 3D94A 2BDWA 4TWCA 2W9ZB 3FI8A 3WI6A 2ETMA 3F2RA 2HIWA 2HZNA 4QP1A 4U79A 3PPZA 4FGRA 1IA8A 4J97A 2OW3A 1JPAA 5CI7A 2BRGA 4LI5A 2HZIA 2OBJA 2C3LA 4CCBA 3F2AA 3R9OA 3BBTB 2ITOA 1SNXA 2XRUA 3ZBFA 4C58A 4NM5A 5HU9A 3ZLYA 4L45A 5H9BA 3SDJA 4XG8A 4MXOA 3AXWA 3UYSA 4DINA 1KUTA 4BDFA 3DAEA 2PYWA 4L6QA 2C6EA 2HENA 2Z8CA 4JL9A 4DEDA 1SZMA 2BTSA 2O0UA 4OTWA 3UODA 3GOKA 2B9IA 1BX6A 3SKCA 3SG8A 2PVHA 4YHFA 4C02A 4ACGA 3IW4A 4IZAA 4FL3A 4ANMA 5FBNC 3COIA 4RWJA 4J99A 2W5HA 5HX6A 4UMUA 5IUGA 3DXPA 3CXWA 2YN8A 5EQYA 4RWIA 2QKWB 4KD1A 3BYOA 2CGUA 3EQRA 5CQWA 1OKWA 4Z7GA 4ACCA 2WMRA 3R1QA 3ZUVA 4AGUA 3L8VA 2WMQA 4AN2A 4G5PA 2J9MA 3BGPA 3RMFA 1Q41A 3O17A 1PMNA 3KGAA 1FGKA 4KKHA 2ZYBA 4YNOA 3P5KA 4QP2A 5CY3A 4D5HA 4BY9E 4O7TA 5AUZA 4O7LA 3QTRA 1ZOHA 3EWHA 4IVBA 3Q60A 4UYNA 2EVAA 3PXYA 4LQMA 3FUPA 3P7CA 4MXCA 5ANDA 5ANOA 3KMMA 4K8AA 4R6VA 4CVAA 5L6PA 1H08A 3TNWA 4DGNA 2P3GX 5CEMA 3PIZA 3EYGA 3KREA 1XH4A 4DE4A 3QUEA 5FLFA 3GVUA 4O0RA 1P5EA 2X8DA 1Q99A 4GYIA 5E1SA 3A7JA 3E63A 4H3BA 3LJ0A 4PV0A 4BIDA 4EH9A 2J4ZA 1DI8A 3LFNA 4EOOA 4FNZA 3ODYX 3LMHA 5L4QA 3TV6A 3DJ5A 2JDSA 3V6RA 3VUMA 3GB2A 3VF9A 5E9EA 3Q2MA 3GC7A 5AP7A 1ZYSA 3V51A 4USDA 3EQPA 5M55A 3I79A 3PG1A 4KAOA 3W2QA 3GC0A 3R9DA 3D4QA 4AW2A 3R1YA 4ZTMA 4YJSA 3RGFA 4XG2A 1YI3A 3VRYA 4TYHB 5AUTA 4R5SA 5CEOA 4O82A 2UZVA 3QTSA 3ALOA 4JQEA 3LFDA 1GIHA 2CKQA 5FBOA 3RHKA 4AT3A 1M2QA 2XNPA 4V01A 5CT0A 5AUYA 2QG7A 3AT3A 4IWDA 1B6CB 3EN6A 4F4PA 1H1SA 2BROA 2X81A 5B2KA 4QPAA 2YIWA 3TI1A 1P2AA 2OXDA 4IADA 3ORTA 4JDJA 4NU1A 4QQTA 2ZV2A 3MH0A 3Q4CA 3A99A 4X2NA 2C6MA 3UOLA 5M4FA 4NKAA 4JNWA 4AE6A 5A14A 3H0ZA 3SXRA 2W1CA 5DOSA 2GNGA 4UWCA 4RMZA 4F9YA 2XK4A 5M44A 4QQJA 5JRSA 3TL8A 2GQGA 3WF7A 2OLCA 5IQBA 2VNYA 3VC4A 4BKZA 4CKJA 2Y4PA 1WBVA 3K3JA 4LGHA 1WVXA 3CY2A 3OTVA 5FTQA 3QAME 3FE3A 4EUTA 4BYIA 5JGAA 4LL0A 2WAJA 4RJ4A 4FODA 3LXNA 5J7BA 3PA3A 2WTDA 1YXUA 2J6MA 4WG3A 1UNLA 3AMYA 3TEIA 4J7BA 3PYYA 4H05A 4W9XA 4MCVA 5M4CA 3IW5A 5D7AA 2Z60A 2VTOA 3CCNA 5EDPA 3H9FA 3EQIA 3L1SA 3KK9A 3ROYA 4YJVA 1Q4LA 3KULA 1Q8TA 1SYKA 3CQWA 3PJ3A 3QCSA 3QUDA 4YO4A 2WMTA 2IZSA 3G9LX 4LFIA 2ITXA 1Q8YA 2YJRA 2YDKA 1T45A 2BCJA 3NCZA 3QQJA 4L7SA 4F09A 1GZ8A 2HYYA 2CKEA 1H26A 3KMUA 4HCTA 2XKEA 2OH4A 4GVJA 4C36A 5CEKA 4E4LA 2QD9A 4MXYA 3D5VA 2J51A 4FKQA 2EU9A 3IK3A 2EWAA 4HZSA 2ONLA 4FGBA 4WSYA 4MAOA 1B38A 1YXVA 3BYSA 2WQNA 2HAKA 3S00A 1FOTA 4QNYA 3Q3BA 3R21A 1GOLA 2B4SB 4KS8A 3ROCA 3QXPA 2HY81 1PW2A 4NKSA 3RCJA 5IG1A 3OHTA 4M69A 3UZTA 4NCTC 2QQ7A 4BCPA 2G2FA 2XYNA 4ZTNA 3VN9A 3GU6A 4CYIA 2O63A 2XK7A 4FIIA 5HVYA 3U6JA 4AW0A 4DG2E 4GCJA 4GMYA 2W1DA 1H07A 4KIQA 3ZO4A 2V55A 3GU4A 3FQSA 3LFSA 3LPBA 2GMXA 1P4FA 5J9LA 1P14A 3FZSA 4A9SA 4R5YA 4X3FA 4O96A 2R3RA 5DHJA 5AP6A 1NVSA 3F3WA 5DWRA 4JBPA 3FLNC 2J5EA 3KY2A 4FT9A 2R3KA 4FR4A 2IVUA 4XHKB 4BHZA 4YSJA 3FLZA 2CNVA 4FKVA 1GNGA 1UU9A 4ZMFA 2B1PA 5DT0A 3QFVA 3JVRA 3REPA 1ND4A 4RIOA 5CAPA 2XRWA 4F1TA 3GP0A 4IHPA 4GEOA 3VS1A 3CEKA 4L7FA 3WZDA 3F9NA 2C6TA 3DKGA 1ZXEA 1KE9A 4K11A 3UO6A 4P90A 2UV2A 2CN5A 3GC9A 2C3IB 3LIJA 4FV4A 4KSQA 4RVTA 4ANNA 4YR8A 2ZMDA 3FMHA 2V5QA 5A54A 3PDTA 3FL4A 2OG8A 3IECA 3LCDA 4MBJA 5DG5A 3DTCA 5H3QA 3O51A 4DFZE 2PWLA 4QQ5A 4I22A 3V8SA 4HCVA 1WBSA 2JDTA 4YZBA 3UTOA 5HU3A 3TZ7A 3WZUA 2C5OA 3U9CA 4F0GA 4YC3A 3LLTA 4MQ1A 4ZSGA 1ERKA 3W2SA 4ONAA 3CE3A 4ANSA 5EM6A 1OI9A 4ZY4A 2V0DA 3A62A 5A4QA 2H96A 4IMYA 2VTMA 2OJGA 4FSYA 2VTAA 3OOGA 3WF8A 3EHAA 4IDTA 2BIYA 4H3PA 4G2FA 3BV2A 4JRNA 4S31A 3UQCA 3HEGA 3S3IA 3RAWA 1MRYA 3FZRA 1XH5A 5AJQA 5J95A 2ESMA 2OK1A 2WMUA 1KOAA 2YEXA 3PY3A 4EHGA 4L53A 2ITPA 2C68A 4APCA 4FSRA 3MVHA 4F99A 4MH7A 4YTFA 3W8LA 2V7AA 2BHHA 2GU8A 4GT3A 4O0VA 2WEIA 3ZUUA 4QO9A 3WZJA 4LV8A 3QHWA 3WF5A 4QMNA 4ZSEA 1I09A 3RCDA 4Q5HA 3ZU7A 4IB3A 4YJPA 1H25A 1VZOA 4DTKA 3NW6A 3PWDA 1TQMA 2B52A 4M67A 3WARA 1YXXA 2RSVA 5JQ5A 2XK9A 3WZKA 2PZRA 4ZJIA 5CS6A 4C4FA 1UNHA 1GIIA 1LEWA 3AD4A 5F94A 4A9UA 4DCAA 3ZCLA 5EYMA 4L46A 3OY3A 4OTFA 3R8PA 4TY1A 5C4LA 4YLLA 3ZSIA 3BGZA 3DFCB 3E3PA 4BDDA 4TPTA 5I9YA 3V5TA 4BN1A 3B2TA 3R7OA 2F7ZE 4CFNA 2OJ9A 4WNPA 3W32A 1J7IA 5IQHA 3OEFX 1KE7A 2REIA 4BBMA 4YZCA 3FQHA 3SV0A 1ZLTA 4EYMA 3OCTA 3UOHA 1J91A 5HO8A 4Z9LA 3AGLA 3L8PA 2WTKB 4G3FA 1M7QA 3KRXA 4MBIA 4WBOA 4RVMA 3T9IA 2F7EE 4EOIA 4J52A 4S33A 4A4LA 1XH7A 2A4LA 3R01A 1NY3A 3BBWA 3O0GA 5F95A 2GFSA 5L2SA 4AW5A 2VZ6A 2WTWA 1BMKA 4PMTA 2BILB 1OGUA 2BZIB 2C6OA 2VTSA 3NGAA 5CSHA 1F3MC 4PY1A 4PX6A 3LFCA 2CHLA 2QG5A 3A8WA 4MEDA 4D0WA 4JI9A 5AAEA 4OBPA 2OJIA 3QCYA 3S95A 1FBNA 4W8DA 3BU3A 4PDYA 2VO0A 4ALUA 3GU5A 5EW8A 3FV8A 5EM5A 1W7HA 3ZDUA 4BIBA 4NW5A 4IANA 5CAUA 4NL0A 1E1VA 4L9IA 5AEPA 2UZLA 3SRVB 4HJOA 1OZ1A 4BGQA 3E8DA 5L8JA 4C57A 2YISA 5BMMA 3NUAA 4GFGA 3KXZA 4UWBA 5HD4A 4AZVA 4CSVA 3V04A 1PJKA 1PYEA 4FX3A 4BDBA 4QRCA 4QNAA 4O7ZA 2C6LA 4EBVA 3S4QA 2C4GA 2IZUA 2FA2A 1JOWB 4CYJA 4FTIA 3QKMA 1JSUA 3EFKA 3QA0A 4CT1A 4A9YA 3NLBA 2QO9A 2R3PA 4A9RA 5CANA 5JKGA 3AD6A 5EK7A 5CTPA 4CFWA 1O6YA 1Q24A 2DS1A 1U54B 2B53A 2CGWA 2VWXA 3RWPA 4M15A 2PUNA 2E9UA 4YGAA 1M14A 4MQ2A 2DYLA 5LMKC 4F6SA 4ZLOA 1JAMA 4E7WA 2VTQA 5EH0A 2VX1A 2X39A 3FYKX 5DPVA 4RFYA 3TZ8A 4RZVA 1V1KA 2WTJA 5EKOA 3G6HA 5AV3A 2VTTA 2ZMCA 3FLQA 4KIOA 4RVKA 4TWNA 2IW8A 4E5WA 3R63A 2C0OA 4Z55A 4CD0A 3FHRA 3WOWA 3FDNA 2XIKA 2VGPA 1ZZ2A 4EL9A 2VO3A 4O0YA 4FVPA 3AMAA 1QL6A 5E90A 4XH6A 2EB2A 4NCTA 2X7GA 4O21A 4RX9A 1LP4A 5FRIA 3G51A 3VNTA 2ZV9A 4C2VA 4G9RA 3D15A 4AXAA 4BTKA 4XG6A 4TYHA 4K6ZA 4PF4A 2VWIA 5DR9A 3W1FA 4EORA 2A1AB 3H9RA 2QNJA 3MI9A 1OUKA 5DE2A 1OMWA 1F5QA 2WKMA 3DZQA 3VS4A 5HTCA 4D4VA 4TYGA 4XRLA 3PA4A 2XUUA 1UA2A 4DH8A 5EOLA 4E93A 5A4EA 4I0RA 3V8WA 3BHHA 3HMMA 5EDRA 5JMSA 1CKPA 2BZKB 4YZDA 2CKOA 5HD7A 5GINE 4AFEA 3PSBA 2QOBA 1ATPE 1YDTE 3MN3A 4FIJA 4CV8A 5JFXA 4FNXA 2LGCA 3W33A 5KE0A 4EOJA 2E2BA 4LMUA 1XH6A 3VS3A 3N4VA 4DBXA 3C4WA 2G01A 5BVFA 5EI2A 5M4IA 4O0XA 1JWHA 4LMNA 1E1XA 5HBHA 3GI3A 3RVGA 4BR3A 2E9PA 3FXXA 4X2GA 3KXXA 3TV4A 4C37A 4C4IA 4D4YA 1MQ4A 1OKYA 4LYNA 5TO8A 4IWQA 4E4MA 5KZIA 2HWOA 3DDQA 3FL5A 3QALE 2IN6A 3R9NA 2IZTA 3RM7A 4EZ7A 3WBLA 3GOPA 1G5SA 3BX5A 5HTBA 4GU6A 4KRCA 3KCFA 2WQBA 2OZAB 3EFJA 2YWVA 3ORIA 3B8RA 3MIYA 4ZLYA 5F9EA 4AZEA 1WBNA 1ZWSA 3F82A 5BYYA 3SXFA 4LGGA 4U3ZA 2DQ7X 3HRCA 2Y4IB 1BI7A 4S32A 4X3JA 5HG8A 5AP5A 2JAMA 1VEBA 3G0EA 5J5TA 2PVJA 3QRIA 4WKQA 4MD7E 4I21A 5C27A 2FSLX 5CSVA 4QP4A 2H9VA 2GQRA 4DEBA 4EWHA 2VNWA 4BTMA 5EYKA 3BWJA 2XP2A 3U4WA 4RJ5A 4BCFA 3MJ1A 1KE5A 5CEQA 3R7IA 1JSVA 3VAPA 4M13A 4GFOA 1RW8A 4M84A 2IZRA 4ZMEA 3HRFA 2ITUA 4AA5A 2CCHA 2WZJA 2BIKB 2AYPA 3PXRA 2X2MA 5HCYA 1IA9A 2VTNA 3RK9A 3I81A 3QHRA 4IJ9A 2ZV8A 5CALA 5ETCA 1K9AA 4LGDA 5IPJA 4NUSA 4I5HA 2B0QA 4EK6A 2GQSA 4A07A 3VULA 4ZTSA 3UE4A 4EK8A 4JBVA 4HGEA 3D7TB 3FMKA 4IM0A 4LM5A 4FEWA 2F2UA 3DS6A 1KV2A 4EH4A 2XJ0A 4FV9A 2O64A 5DA3A 3V6SA 3PA5A 3FY0A 4XV9A 3BHVA 3UIBA 1PKDA 4RA4A 2XBAA 4B6LA 3BZ3A 4TXCA 2ZDTA 3OCSA 4LV5A 4MF0A 5TE0A 3I0OA 3UMXA 3ZYAA 5IEXA 2XEYA 3HAMA 4EH8A 4J8MA 5E8YA 4C62A 4F1OA 2OXXA 3E5AA 4QMWA 2CPKE 3ET7A 5DBXA 3WIGA 4BC6A 2WQEA 4ZTQA 3VBQA 4BI1A 2OI4X 2UW0A 4R1YA 5DRDA 3OWPA 4J53A 3D7ZA 2QLQA 2DUVA 4ASEA 4BDCA 5JK3A 4CZYB 2RFEA 4FV0A 5I9ZA 4LOOA 2PULA 5M07A 3HLLA 4F64A 1APME 1H1WA 3K5VA 2B9FA 3C51A 4R3PA 5ANKA 3TWJA 1AD5A 4ID7A 5DT4A 2PVKA 3OOMA 1ZARA 5BVKA 5CSXA 5JQ8A 5JN2A 3POZA 2QOIA 3C7QA 3Q52A 5FM3A 3HVCA 5ANIA 4AE9A 3ORNA 3LCSA 5EFQA 3C5UA 5IMEA 2WPAA 1NVRA 5C4KA 4AZTA 5HESA 2V62A 4YLKA 5IQAA 2J50A 5HE2A 4G6LA 3HKOA 4MXZA 3QQGA 4CG9A 4FOBA 3ZSGA 4G17A 2JAVA 4QPSA 4CFXA 5LVPA 1J7LA 3NS9A 4RWKA 3UNZA 5M53A 3OBGA 3I0QA 3UQFA 4MNFA 2ZOQA 4I0SA 4CQGA 4BI0A 3CP9A 4FT7A 3ZHPC 3ANQA 4F7NA 3OW4A 3TIYA 4IB1A 1RQQA 2XEZA 3S2PA 3G5DA 4WNOA 4AW1A 2O65A 4DGOA 4FKJA 3KMWA 4A4OA 4NWMA 2CLXA 5ACKA 2P55A 4NJ3A 2RG6A 4QYHA 2BAJA 3OG7A 2QOFA 5HKMA 4P7EA 5KMJA 1OL2A 1CDKA 3P4KA 4WA9A 5LMBA 2ONLC 4G31A 4OBQA 4WHZA 3LXKA 2CNUA 1Z9XA 4EYJA 4F7JA 1U4DA 3QLGA 4HVSA 5IEYA 3EH9A 3PJ8A 4HYSA 5TF9A 2WO6A 4BCIA 5LMKA 4WG5A 4C2WA 4EQUA 4L52A 5I9WA 4IVCA 4DGGA 1V0PA 2F9GA 2R0IA 3BYUA 4NT4A 3TZ9A 3FXWA 2Z7QA 4FTKA 4FC0A 4QMUA 2R3NA 4FTAA 2ITYA 5A6NA 5DI1A 4E4NA 3OZ6A 3QD0A 5IA3A 1OL1A 5LWNA 5I9UA 3UO5A 2CKPA 4I94A 5BPYA 3BCEA 3WZEA 4R78A 4KUJA 3COKA 3R8ZA 3I7BA 4N70A 1JKSA 4YPDA 2GTMA 3F7ZA 4DEAA 4DN5A 3IO7A 4F7SA 2G15A 4JT3A 4QTAA 5CAQA 2IPXA 2GNLA 3NUUA 4R8QA 3NYXA 1MP8A 4BI2A 2XCHA 2J2IB 4K1BA 3BHUA 3Q5ZA 1XBAA 3FZPA 3KL8A 5ETIA 5CF5A 2JEDA 3VW6A 3VWAA 2DWBA 5C8KA 4XG3A 4XEYA 4F70A 4HYHA 2Z2WA 4K77A 4QMYA 1PRYA 5AV4A 3N9XA 3PPJA 4TNBA 5CENA 1E9HA 3MY1A 3HAVA 3BLHA 4PPAA 3SQQA 3D2IA 4IAKA 5HE0A 3QCQA 5H8BA 4DITA 2JD5A 2W05A 2YIRA 3L9PA 4K33A 4IAYA 3NYVA 1LR4A 2QOOA 2Y7JA 4BGGA 4RPVA 2YIXA 4BCKA 4I93A 4FBXA 4RX8A 3DY7A 2C1BA 2ITVA 3HMPA 2R3QA 2BAQA 3EKNA 1PMVA 2X1NA 1GIJA 1RDQE 3C4FA 1KWPA 4WD5A 1U59A 4JR3A 4EKLA 5KBRA 3NW7A 4OBOA 3QWKA 5TR6A 5M08A 4KNBA 1YI6A 2B7AA 2PE1A 2JKOA 3GT8A 5AR8A 4XNEA 1OVEA 4FV7A 2WMAA 3ZLWA 4DFUA 4BCNA 1J3HA 2YWPA 4QOXA 5I0BA 4JG6A 2KTYA 1WBOA 2OJFE 4XBUA 5H2UA 4DGMA 3CGOA 1UWHA 3DU8A 4Y85A 3ZXZA 4OTIA 2OSCA 2PPQA 3GCPA 4I6FA 5HCZA 5AUXA 3ZM9A 4IX6A 5GIOE 3QD3A 4FKIA 4EJNA 4FV3A 4X21A 4D55A 1ZMUA 2C6KA 3AMBA 4AOJA 3SRVA 3MVMA 1WFCA 5GNKA 3RHXA 5KNJA 4NM3A 3OT8A 4XP2A 4FG8A 3KXMA 4IW0A 1YWRA 5HVJA 4PP7A 3VS5A 5IUHA 4HNIA 4MX9A 4TZRA 2GDOA 2XIXA 3K54A 3MWUA 3TG1A 4EC8A 2XBJA 2QR8A 4FSUA 5CX9A 5D41A 4YJQA 3L9MA 2NP8A 5HQ0A 3VBVA 3AT4A 2OJJA 3EZRA 4Y46A 4Y83A 3RI1A 4EK5A 2VTHA 3MBLA 4KA3A 3KVWA 2BUJA 4DCEA 1Y57A 4F08A 3S1HA 2P2HA 4U41A 1U54A 5J9ZA 4AN9A 2OF2A 4LRMA 2QC6A 3OCBA 4I4EA 3U9NA 2X2KA 5IH5A 5M4UA 2R3GA 3UC3A 4DLJA 4HYIA 3V5QA 3FLWA 2R7IA 3PE1A 1OPKA 4FZAB 3UBDA 4P4CA 3NR9A 4K18A 3MSSA 4ZLZA 2ITNA 4D9UA 5CEIA 2BAKA 4RC4A 4EH7A 3FC2A 3AOXA 4XP3A 1XBCA 2PMOX 2JIIA 3HZTA 4M8TA 4YJTA 3B8QA 3C4XA 2OFUA 2PVYA 3F66A 3QQKA 4KRDA 4NM0A 5AADA 5J1VA 3DT1A 3MA3A 4AG8A 3OD6X 1UKIA 5FEQA 4AACA 1ZY4A 4L42A 4FI1A 5J9YA 5KHWA 3W55A 2HK5A 4XS2A 5F20A 4C3FA 5IDNA 4ERWA 4O6LA 1PXIA 3ZFXA 5KMLA 1SNUA 4RX7A 4UZHA 5AP4A 3OS3A 4EJ7A 2X8EA 4EKKA 5L2TA 3DK6A 2ZV7A 4XLIA 5IU2A 4QPMA 1R78A 5ITAA 2VGOA 3LFBA 2BHEA 4QMVA 5J8IA 5LWMA 4O7RA 3TJDA 1CMKE 1F0QA 2ITWA 3TUBA 1U46A 2VU3A 3FXZA 1JSTA 4L3PA 4IB5A 3F3VA 4FOCA 5AX3A 4E26A 2RFDA 1L3RE 3MFUA 5TOZA 3EFLA 3RPYA 3TNQB 3OMVA 3HYHA 3TV7A 2QHMA 2V7OA 4IB0A 4GK3A 5LVMA 2ZAZA 1W8CA 4FUXA 3U87A 3NMUF 4BCGA 5E8ZA 4H36A 4RBLA 2ZM4A 4AOTA 2JFMA 3PRFA 3HV6A 4TTHB 5CVFA 3U8WA 4BIEA 3RTPA 4F0FA 2AUHA 4F6UA 3LZBA 3RKBA 4EH6A 4I5PA 2R3IA 3AQVA 3MV5A 5EG3A 3VS6A 4L3JA 4BTJA 1PXOA 5F1ZA 3R00A 4DFXE 3PJCA 2OZAA 3DK3A 3CPCA 1WMKA 4I24A 4I6QA 3GEQA 1YRPA 3U4UA 3ANRA 5AP3A 4OGRA 1REJA 4F7LA 2WOTA 4WRSA 2PZ5A 3PVUA 3R73A 4DT9A 3K2LA 4DH1A 2WTCA 4AFJA 4FVQA 4BDJA 4FIFA 4NIFB 4EK3A 5JFWA 4I6HA 2HCKA 1PXPA 4L68A 1PMEA 3DXNA 2RGPA 4X6RA 3FLSA 4EOQA 4FEVA 4EHZA 4MXXA 5FDPA 1ZOEA 2HOGA 4D2PA 3Q96A 5B7VA 5KBQA 4YBKA 4FSTA 3RAKA 2C5NA 3QU0A 1ZOGA 5G1XA 3MPMA 3S0OA 4FL1A 3PSDA 4GU9A 5LARA 5I9XA 1HOWA 3KF4A 4EOMA 3OY1A 4IWOA 3QZFA 3D0EA 3THBA 4U9AA 1QPDA 2B9HA 3UVQA 3PRIA 2X6EA 3SHEA 4N4SA 4Q2AA 4D9TA 4NTTA 4O84A 4LUDA 5AIRA 4HPTE 1R0EA 4BICA 4EWQA 3D5UA 3JUHA 3PPKA 2BFXA 3C0GA 1R0PA 2VX3A 4I4FA 2B54A 5LCJA 1PF8A 3D7TA 1BL6A 3MGYA 2OWBA 3F5PA 4AA0A 4C8BA 5AR2A 3UC4A 4J71A 2BPMA 2XIRA 4BBFA 3ORPA 4OT6A 3IONA 4TW9A 4CKIA 3LXPA 3R9RA 3AC4A 3GUBA 4G1WA 2A19B 3MVJA 3CD8A 2RL5A 4BTFA 4V0GB 1JLUE 4BWPA 4C4JA 3ZLXA 5K4IA 5HE1A 3IOPA 3SW7A 3EIDA 2VUWA 2Y9QA 2VV9A 5E8WA 4OTGA 4BWKA 3HDMA 4CFUA 5HLNA 4KABA 4HCUA 3R30A 5A3XA 4ACMA 3CQUA 2J7TA 2Q0NA 2JDRA 5AAGA 3C4ZA 3FMDA 3QBNA 4Y8DA 2EXMA 3NYNA 4KSPA 4Y5HA 5D11A 3BYVA 5EDQA 4D1XA 1OM1A 2VO6A 4PPCA 5KX8A 5CASA 2YIYA 3OW3A 4FV5A 3RPOA 1OITA 2CSNA 4RIYA 3R0TA 3UYTA 4U43A 3T8OA 4RC2A 5HO6A 3VJNA 4CCUA 2JGZA 3QYZA 2BZJA 2HW6A 5EOBA 2I0EA 5T68A 4KWPA 3UIMA 4FICA 4BFMA 4QP7A 1Q3WA 2UZOA 3F5XA 1W82A 3PE2A 2XH5A 5FP6A 3VUDA 2VWUA 4CV9A 3NPCA 1H00A 1K3AA 3FPMA 4DEHA 3P9JA 5HVKA 1L8TA 3PLAE 4FT0A 5ACBC 4JG7A 4DEIA 3A8XA 5CNNA 3NAYA 4QTDA 2I40A 4BVUA 2UW9A 1YQJA 2FGIA 3D83A 4FUYA 4PTCA 4ZAUA 3E87A 2Y8OA 5EKNA 4DFBA 3ZEPA 3P86A 2W4OA 4I92A 2UW3A 4KIKB 4DEGA 2H8HA 4EZ5A 3JXWA 1H24A 5K3YA 4JX3A 4X2FA 4FL2A 3NVMB 5LVOA 3CJGA 4WT6A 4BDIA 5EM8A 3Q32A 4FIHA 2Y0AA 4FT3A 3FZTA 5HBEA 4ZS4A 2UVXA 3KB7A 4YLJA 3QTQA 3ORLA 3LE6A 2CDZA 5FD2A 2J5FA 3OXTA 2XNBA 3R8VA 4FV8A 4RQKA 2BRNA 2QCSA 3A7HA 3R04A 4WG4A 5A9UA 3ZLSA 4C4EA 3QTUA 2EXEA 4PWNA 3DV3A 2WMWA 3GCSA 3EMGA 3MY5A 2UW4A 2PSQA 4GSBA 4EC9A 4R1VA 2WOUA 2QU5A 4Z16A 2EB3A 1G3NA 3II5A 4C3RA 5CVGA 3DXQA 4FZ6A 5AV0A 3FSFA 4U0IA 2VAGA 3UG1A 2UW6A 4G3EA 4QYGA 3EYHA 3VQHA 4G3CA 2C5XA 1OPLA 3DDPA 4DH3A 3LQ5A 3CGFA 2QR7A 3VUIA 1YVJA 3M1SA 1UVRA 3L8XA 3LCOA 2FSTX 4G3GA 4RJ8A 5CU4A 3ZRMA 4WBBB 3JYAA 2JDVA 2WMBA 4X2KA 5T3QA 4A7CA 2XK3A 3QD2B 5D12A 3TKHA 2XJ2A 3R7YA 2RIOA 4CZUA 3F7WA 2WGJA 4AA4A 4RJ6A 4XBRA 4M3QA 1YDSE 3FBVA 4UV0A 1Y8GA 4FEQA 2W17A 3D14A 3DBQA 4JAIA 3ZOSA 2OU7A 4YPSA 1UNGA 2ZM1A 4U6RA 4DH7A 2XIZA 2YLFA 2A27A 1H1PA 3EN9A 5CWZA 3GCQA 3TDVA 4HVIA 4USFA 1JNKA 5IQEA 3GQLA 5H8GA 1OUYA 2X8IA 3QWJA 4RJ7A 5C9CA 3IGOA 1S9IA 5JH6A 3SC1A 5HIDA 2IG7A 3ZO2A 5KHXA 5JRQA 5DRBA 1M17A 5DEYA 4RWLA 4QD6A 5HIEA 2W1FA 3E8EA 4U7ZA 2IO6A 1WCCA 4AOIA 3OT3A 5HICA 1MRVA 4FTRA 4RG0A 4AU8A 5HTIA 5IDPA 3U6HA 5EQPA 4QP3A 4NYEA 5IZFA 5BNJA 1PYXA 2YAAA 3SAYA 3BLQA 1GZKA 4RC3A 4UYAA 5BX0A 4X6QC 1CM8A 5EW3A 5L2QA 3DNDA 3LKMA 2FUMA 3KVXA 3C0HA 4WOVA 4YTCA 4GT4A 4WUAA 4JBQA 5CYIA 3N4TA 2WMVA 2YFXA 2JDOA 2IVSA 4WUNA 1DAYA 1OECA 1GJOA 3DPKA 3P23A 3EN4A 4Q9SA 3LCKA 3ORMA 1BL7A 4CNHA 1DI9A 3QYWA 2BTRA 4D2VA 4O7NA 2BRMA 3UIXA 3EL7A 3LFQA 4EI4A 4ASZA 4MNEB 4PMPA 1TVOA 3C50A 1Y91A 3RJCA 4AGDA 5CF8A 3EQFA 5TKDA 5K9IA 1ZZLA 4FKPA 5AR4A 5KZ0A 3UNKA 3DJ7A 2XNEA 1IRKA 2R3LA 2OGVA 4RGJA 5GZAA 3GC8A 3KCKA 4LL5A 4GG5A 5DIAA 3OEZA 4C61A 1ZMVA 3ZFMA 3C13A 4BDGA 5C8NA 5K0XA 2C3KA 4JVGA 2UZBA 3E3BX 4GVAA 3OC1A 3DAJA 3O7LB 1NA7A 3E8NA 1TKIA 2YCQA 4FKUA 3UMWA 1H8FA 4FKOA 3Q9XA 5EM7A 2I0VA 3BQRA 3MH1A 4FZFB 3I6WA 3Q04A 4MK0A 2R5TA 3HRBA 3U55A 3UP2A 3F2NA 4XX9A 1OL7A 2F7XE 4N6YA 5KKRB 3COMA 3QZIA 5CNOA 4UEUA 4L3LA 3N51A 3HX4A 1O6KA 4EOPA 1OBGA 4CG8A 3SD0A 3ZFYA 3E64A 1HCKA 2KULA 5HNIX 2WTKC 4IX3A 3QTIA 4WRGA 4YURA 4IAFA 3BRBA 3DKOA 4CMOA 2X0GA 3MFSA 3BEAA 3HV3A 4XP0A 5FDXA 4PMSA 4ZEGA 3CPBA 4E8AA 1CKIA 2E9VA 2UW5A 4YMJA 1G8AA 3EFWA 2YM8A 4O27B 1I44A 4GV1A 4IEBA 5DH3A 4AN3A 5CU6A 2UZWE 2WIHA 3HGKA 3MH2A 4W4XA 3WYXA 1JQHA 1XKKA 2B55A 4GIIA 4GK2A 3SVVA 4ZOGA 2BZHB 3Q9YA 1DM2A 4FK3A 2XK6A 2QOLA 3GXLA 4H39A 4TN6A 3FPQA 4AGCA 4C59A 5DMZA 5BUJA 3OF0A 4GK4A 3PSCA 5J7HA 4IBMA 3KXNA 3L8SA 3BE2A 4FKWA 4I1ZA 4EK4A 4E73A 1NW1A 3BI6A 2JBOA 3DOGA 3OWJA 4AF3A 2VTPA 2WELA 3TTIA 4XG9A 1CTPE 3G0FA 4DC2A 4DFLA 3C9WA 1NXKA 3FSKA 3MESA 5J1WA 4QYEA 5GJGA 4FKLA 3PZEA 4B9DA
chains in the Genus database with same CATH superfamily
4UXQA 5CT7A 5B2LA 4PNIA 2X9EA 3A2CA 3TZMA 1OB3A 4FVRA 4PUZA 4B99A 3NUXA 2HZ0A 2UUEA 3I5ZA 2RKUA 5HZNA 4IVAA 3E62A 1G8SA 2HELA 3HV5A 4FEUA 3PTGA 4AZFA 4D0XA 2EXCX 4YBJA 4NIFA 4DEEA 4V05A 5A4LA 2YDIA 1CKJA 3QKLA 4HOKA 3UZPA 2HW7A 1ZYJA 3H9OA 4W4VA 3UJGA 3TDWA 4PDSA 4BZDA 3ZONA 4G5JA 4CTBA 3KK8A 4LOPA 4YZ9A 4WIHA 1M2RA 4D2SA 2BKZA 3BGQA 4O22A 5HEZA 4F9CA 3HDNA 2P33A 1R1WA 3R7UA 2A2AA 2RG5A 4MTAA 4YTHA 3R7VA 2F4JA 4QP6A 4BYJA 2X6DA 3SOAA 3DB6A 2YZAA 4UX9A 1LPUA 3JPVA 4EONA 4FA2A 4G6OA 3WE4A 3AKJA 1PKGA 3PXKA 3ZXTA 3NCGA 3NNVA 2CCIA 2J0IA 2YM3A 4WSQA 1H1RA 2R4BA 3PLSA 3R7EA 1K2PA 5IF1A 3QTZA 3UOJA 3BPRA 4BWXA 5BVNA 4CMUA 3IDBA 2UZTA 4QP8A 2XIYA 4DF3A 4J95A 3EB0A 4QTBA 3VIDA 2Q83A 3HECA 4DH5A 3MB7A 2YIQA 2GSFA 3DLSA 3F5UA 4ITJA 5AA9A 4BDEA 2VRXA 1WBWA 3C4CA 2FYSA 2VTRA 3KU2A 3CJFA 5HORA 3GBZA 2JKKA 4HVHA 3A7IA 5D10A 5KKRC 2YZLA 3R8MA 4ENYA 1A48A 3BHYA 3A4OX 5HNBA 3CY3A 1Q62A 3EQGA 4NEUA 1IAJA 4BZOA 3MVLA 4U40A 5AM6A 4IFCA 3PZHA 4HVDA 2GS2A 5FG8A 4XG7A 3MPTA 4C3PA 4BDKA 4BCJA 3PUFC 1O9UA 2R0UA 4IC8A 2UW8A 1W0XC 4H1MA 2PMIA 5HX8A 5I3OA 1Y6AA 5TT7A 2HY0A 1YI4A 3EKKA 1YWNA 4F63A 5E8VA 1XH9A 4FYNA 5M09A 3W2OA 1XMLA 4XLVA 4CEGA 5A4TA 3U54A 2XJ1A 2YCRA 4WNMA 4AAYA 3NWWA 4EQMA 4RX5A 1ZAOA 4QYYA 4TKSA 5EHLA 1M52A 5HLPA 2CJMA 3BWFA 4ZK5A 4ALWA 4UN0C 1XHAA 3GGFA 1G8KA 3OP5A 1UV5A 2PVRA 4NZWB 5IQIA 4ZJJA 4NTSA 3NW5A 4O2ZA 2WFYA 2E9OA 1KSWA 4ZS0A 2YERA 4FIGA 1ZMWA 1UU7A 3EQHA 4CZTA 2J0MB 3NUPA 3W2PA 1LEZA 2YA9A 4OTHA 2OIBA 4RRVA 4DT8A 5IMXA 1WZYA 3NX8A 3LCTA 4U80A 4YZNA 1YXTA 2UVYA 4DDGA 3BIZA 4JJRA 3NEWA 5LJJA 4KB8A 3BELA 2PUUA 3A7FA 2H6DA 2G2IA 3SGCA 3W16A 4NSTA 4CMTA 1UU3A 1EH4A 4OT5A 5K0KA 1Z57A 2Y4IC 4FKTA 5BQ0A 3ZBXA 5GJDA 3ORZA 3RPRA 3BQCA 3EQDA 2ETRA 1FMKA 2OF4A 4GS6A 4FSZA 4D2TA 3EL8A 4KBAA 4RLKA 4QMOA 5CZIA 3ZH8A 3TNPC 3VBTA 2X2LA 4BJJA 4QYFA 3MY0A 3GCUA 3WYYA 4B0GA 4TYEA 4JDHA 3NZ0A 2YAKA 3Q2JA 3WF9A 4GKIA 3QRTA 5HHWA 3N4UA 1WAKA 3F5GA 4CFVA 3FMEA 1KOBA 4G34A 5KMIA 1PXJA 3PG3A 2PE0A 3UIUA 5JT2A 2YM5A 2NYAA 2Q0BA 4CRLA 1Q5KA 2Z7RA 4D1SA 3CR0A 5HOAA 3FJQE 2GNFA 3T3UA 4FKRA 5JZNA 5AR3A 4EUUA 1XQZA 3TCPA 4GJ2A 1QPJA 3BU6A 2BRHA 4QMSA 4E20A 2QOQA 3LW0A 4HGLA 4Z7HA 5DVRA 4U3YA 3RZBA 1ZRZA 2WMXA 3DA6A 3OXZA 4CKRA 4MUQA 3TNIA 4O7SA 3R8LA 4NH1A 3FI4A 3E8CA 3PXQA 5DR2A 1URWA 4I20A 5FTOA 3DB8A 5IA5A 4AUAA 1FVVA 4B8MA 1PHKA 2WEVA 3G9NA 3TIZA 3KRLA 2PE2A 4EEVA 5CLPA 1KV1A 4RFZA 4E6QA 1M2PA 3W0NA 2W06A 3IG7A 2X7FA 1GZNA 4I3ZA 4YSMA 5E91A 2F2CB 2F49A 3TJCA 4ASDA 3CBLA 1OBDA 3NAXA 4W4YA 2PZIA 2VWBA 3I6UA 3MS9A 2QURA 3PVGA 4TT7A 5FEEA 3FZOA 5T6KA 3TT0A 4O1PA 3VBYA 1U5RA 4YJOA 3ETAA 2VWWA 4JIKA 2CN8A 5DR6A 4P5QA 2OXYA 4BHNA 4FG7A 3MYGA 3RBWA 4G6NA 4E6CA 4RJ3A 1Q8WA 1IASA 3V01A 3ZZWA 5FM2A 2BALA 3O7LD 4JR7A 1ZY5A 5EHOA 3LJ2A 4UMRA 3I5NA 3O50A 4FE2A 2E9NA 3KKVA 5KUPA 1FGIA 3M42A 3G2FA 2F57A 5AP1A 4P2KA 1Q8ZA 4XOYA 4YHJA 5LVLA 3Q4ZA 2FB8A 2IW9A 3SA0A 4W4WA 1OL5A 3IW6A 3QXOA 1B39A 4TWPA 4UALA 1SMHA 5CSPA 5IH4A 3I60A 2XKCA 2XYUA 4OTDA 2VD5A 2CLQA 3I1AA 2IVTA 4XMOA 1STCE 2VTJA 3Q6WA 5E4HA 2GHMA 4AX8A 3LM5A 2BFYA 4ZTRA 3ZRKA 4KIPA 4NW6A 4OTQA 4QMPA 4DTBA 2YITA 2FVDA 3C1XA 5CI6A 3KRJA 4ANBA 3CQEA 1NVQA 2LAVA 4ZTLA 2A0CX 4ZXTA 4PP9A 3FWQA 2Y6MA 4A06A 2UW7A 3GU8A 4MNEA 4ZJVA 4II5A 2XNNA 2C3JA 2JLDA 5KMOA 3DCVA 3OUNB 2GNHA 3E7VA 4IAZA 4PL3A 3VS2A 3ZO3A 2NRYA 3MW1A 5BVOA 3FI2A 2R7BA 5CXHA 3DQXA 4UB7A 5IQGA 3ODZX 5IQFA 5CSWA 3FQEA 2NPQA 4QT1A 3LFFA 3TKUA 5LXMA 3L9NA 2SRCA 3AC3A 3MH3A 4D1ZA 4GUBA 2ERZE 4G9CA 4EH2A 4FV6A 4PPBA 3RWQA 3T3VA 3UO4A 4DHIB 4HYUA 3R83A 3VW8A 2XKDA 4BKYA 1JVPP 3KXHA 5LOHA 1KE6A 5L2WA 5CAVA 4GW8A 3UPXA 3ZZEA 4DHJA 4C7TA 5IQDA 4CLJA 5LQFA 5AFVA 3W8QA 1JBPE 2VO7A 1YW2A 4GG7A 4GYGA 4IFGA 3WIKA 1UKHA 3CKXA 5IH6A 1DS5A 1H28A 2RF9A 4F6WA 1VR2A 1Y8YA 4J1RA 4E5BA 4ACHA 4Q9ZA 4QMZA 5AAFA 1GAGA 4IJPA 4EH5A 3UVRA 4ZTHA 2VWVA 4R3CA 1GZOA 4ZZOA 2YACA 4M68A 5HE3A 3G6GA 4K2RA 4F9WA 4HVGA 4Y5QA 3VHKA 3UOKA 3VUTA 4IZ7A 5LCKA 2GS7A 3DBFA 1U5QA 5E8TA 5HG5A 2W1ZA 2XMYA 1CSNA 3KRRA 2YCFA 4IZ5A 3TN8A 2O2UA 3W2RA 3P5JC 4D4RA 3ZRLA 1R3CA 4IDVA 5E92A 4AT4A 3EQBA 1Z5MA 3V5JA 4RLLA 5L8KA 4MWIA 2PK9A 3OUKA 4I23A 4L00A 2XS0A 4TL0A 2O5KA 2GHGA 4RQVA 2J0KA 4O6EA 3OWLA 5FXRA 3KA0A 3G90X 4F65A 4PTEA 4RFMA 4IVDA 4O83A 2C1AA 2EUFB 2XNGA 4AGWA 4E3CA 4L44A 4GFMA 3QGYA 4D2RA 3KEXA 5JEBA 3ZEWA 4BF2A 3HV7A 4YJRA 4RIWB 3RM6A 4ARKA 2JFLA 4RA5A 3UZRA 2PVNA 3GENA 4EH3A 5LVNA 3I4BA 5IA1A 5JGBA 3P7BA 3DBCA 2PMLX 5AUWA 3V5WA 2JKQA 1A9UA 1BYGA 3QGWA 1YKRA 3RALA 3IDPA 3QQUA 2PVFA 3PP1A 4PQNA 3SG9A 5FUTA 2HWPA 2YM6A 5L6OA 3H4JA 3MFTA 2GNJA 4QMLA 3MTFA 1JKTA 3QX2A 4F1MA 3QF9A 3QRKA 1H0VA 3MFRA 3CTHA 5E1EA 4BCOA 3BLAA 4FSQA 5DNRA 4B7TA 2IWIA 2VN9A 4MHAA 4J8NA 4EQCA 4XV1A 4C35A 3HUCA 5IQCA 5JGDA 3O8TA 3PJ1A 4YO6A 3NVKI 2QO2A 2FSOX 5IEVA 4QP9A 3R1NA 4DGLC 2NO3A 4E5AX 2W4JA 3AGMA 4ZSAA 4TRLA 3OXIA 4MF1A 3ACJA 4S2ZA 2QO7A 3ALNA 4I6LA 3AKKA 4FTOA 3MPAA 5E8SA 3QA8A 4O7WA 3PP0A 3Q9ZA 1TZDA 4KS7A 1BI8A 5DLSA 4E4XA 4J96A 5BV3A 3QQFA 2I0HA 5E8UA 2XNMA 3D9VA 1MQBA 5IKWA 4DA5A 4C38A 2OO8X 2I0YA 3WILA 3V5PA 2W1HA 1QMZA 1HCLA 2XM8A 3BYMA 2W99B 3CIKA 3F3UA 4FK6A 4XJ0A 5HNGA 1YOMA 3VQUA 1SVEA 4HGTA 4UMPA 5I9VA 4O7VA 3KN5A 5AM7A 2IJMA 4L43A 3LLAA 3EN5A 4I6BA 4NM7A 2OZOA 1XJDA 4I5CA 4KINA 4UXLA 4I41A 4M7IA 2XA4A 5EW9A 3PWYA 2ITZA 5JFVA 2WQMA 3FY2A 3LAUA 5CEPA 3MDYA 5GHVA 3MA6A 3VUGA 5ETAA 3BV3A 4DHFA 3TNHA 4EZ3A 5DYJA 2WTVA 5A6OA 4HZRA 1UU8A 4XYFA 3GFEA 4ASXA 5GIPE 2ZVAA 2BDJA 2OIDA 3DNEA 4FEXA 5HG7A 2BDFA 3WE8A 1Q8UA 1WVWA 1URCA 3FMLA 3H10A 1FINA 3NIEA 5EHYA 3D5XA 3NDMA 3FKOA 3F61A 4PDPA 3BEGA 2IW6A 4N6ZA 4BCMA 5AR5A 2QI8A 2C47A 4BGHA 2XB7A 2J90A 4Y72A 5FXSA 4DFNA 4FSMA 2AC3A 1AGWA 1TQIA 3IGGA 3RAIA 4RIXB 1QCFA 2R3MA 3H0YA 4MXAA 4UY9A 2P2IA 3P7AA 4HNFA 3UDBA 3UVPA 3SW4A 5H8EA 3MTLA 2AC5A 4OAVB 1XO2B 3ZS5A 4GUEA 4NK9A 4FTLA 5CZHA 3HMOA 3LVPA 3QLFA 4XOZA 5BUEA 3M2WA 2Z02A 1BLXA 4FTNA 4QDVA 3P1AA 4IX5A 5M51A 1FMOE 5AUUA 2QVSE 4TNDA 5AV2A 4FZ7A 5AUVA 1OIRA 3UGCA 2ITTA 2QHNA 2WU7A 1W83A 3QCXA 4R7IA 5M56A 4H1JA 3TACA 3AG9A 4QMQA 4IM2A 3VBWA 3IW7A 4G16A 4LG4A 2OFVA 2PU8A 4O0UA 5B2MA 4GRBA 1H01A 2JC6A 2JIVA 4HGSA 5ETFA 3ZO1A 3PFYA 3IPHA 1R39A 1ZYCA 3E88A 3KQ7A 4UWYA 5DFPA 5K5NA 2WTIA 4U8ZA 5A4CA 5ANEA 4FNYA 4FNWA 2C0IA 1DAWA 3WF6A 4ERKA 5I3RA 4RSSA 5CU2A 3NNXA 3BHTA 2C5VA 2QOKA 5KCVA 3ULIA 1OKZA 2GPHA 4Z3VA 1SM2A 2R2PA 4PDOA 4NFMA 4QMMA 5E7RA 4BL1A 4E6DA 5BVEA 5EQEA 2G2HA 1MUOA 4PNKA 2ZB1A 5F4NA 3ORKA 1GY3A 3VUHA 4ACDA 3C5IA 5AR7A 3C0IA 2YM4A 2XF0A 3R7GA 2FH9A 5E8XA 5BVDA 2QONA 4BB4A 4KKGA 5IUIA 5CU0A 4MD9E 4S30A 4OUCA 3UP7A 4CFFA 2PHKA 2W4KA 3U6IA 1P4OA 5M57A 2V22A 4JLCA 3A61A 2WHBA 3COHA 4YHTA 2Y6OA 5CXZA 1V0OA 1OIUA 4O0TA 2YLEA 4FV1A 3SX9A 5D9HA 4AP7A 2PUIA 3R28A 2UZNA 4LOQA 2I7QA 3ZM4A 3JR1A 4FTTA 1YOJA 3ZC6A 1IG1A 3CC6A 4GH2A 5BMSA 3FKLA 3LMGA 3K3IA 4BDHA 1QPCA 5GZ8A 5EI8A 4U42A 4DG3E 2X7OA 1LUFA 1JKKA 1OL6A 2GHLA 3F88A 3IW8A 4JQ8A 4KKEA 5FEDA 3VRZA 3UQGA 5AMNA 1BUHA 2X0PA 2OIQA 4ANOA 3OVVA 4FTCA 3ZC5A 4C34A 4YTIA 2B9JA 4H3QA 4OAUC 1T46A 4K0YA 5FP5A 4MKCA 2W9FB 2GCDA 4R3RA 2RFNA 3NFGB 5FTGA 4MBLA 1H4LA 3VS0A 1FPUA 3P08A 3R8UA 5L3AA 3Q4TA 3QRUA 5AA8A 3VHEA 5DN3A 3RZFA 4N57A 2G1TA 4IAAA 3LQ3A 3FZ1A 3LXLA 2ZM3A 2UZDA 3FKNA 3EZVA 5HBJA 1PY5A 4XV3A 4H58A 5HGIA 3RNYA 1PXNA 2I1MA 5KMKA 4YU2A 2QU6A 5JSMA 3TUCA 4OW8A 4LRJA 3ZTXA 2YDJA 2CGVA 4PRJA 3DK7A 1FVRA 5FXQA 4IAIA 1YHVA 1FVTA 5KO1A 3NSZA 2YM7A 4IC7A 1O6LA 5A46A 3ATTA 3HNGA 2VWZA 1H27A 3Q4UA 2YHVA 3ENMA 3MJ2A 3PIXA 4ANLA 5HG9A 2X0OA 3KN6A 2GNIA 1XWSA 5AV1A 2P4IA 4XV2A 4B8LA 4C4HA 4IQ6A 3RK5A 4E1ZA 3EJ1A 2OH0E 1Q3DA 4PL4A 2W1EA 3EN7A 4C33A 2PZYA 3RINA 3UNJA 4QMTA 5G6VA 4ZP5A 3GU7A 3POOA 1M7NA 4JAJA 4GL9A 1PXLA 4LUEA 3UPZA 2QLUA 1YXSA 5ANJA 2JKMA 3V8TA 3RAHA 1YHWA 3DKCA 2Z7LA 3VUKA 1OPJA 4F9BA 3Q5IA 3TTJA 3LQ8A 3ITZA 3AC1A 3PFQA 1SVHA 3CS9A 4M0ZA 1PMUA 4U5JA 4YJUA 5AP0A 3ZUTA 4APPA 3V5LA 3F69A 1RE8A 1XH8A 4IZYA 4DFUA 3R02A 4RZWA 2W1GA 4Y73A 3LM0A 4XCUA 4PL5A 5I4NA 4O81A 3EOCA 5EYDA 2C6IA 1OIQA 1OIYA 2UZUE 3KFAA 3IOKA 4JQ7A 2O8YA 2J0JA 2NNWB 4R77A 2XM9A 2G9XA 3HUBA 5JFSA 2FO0A 2R3FA 3ENHA 4IX4A 5K4JA 4C4GA 4CT2A 3LFEA 3QZHA 4IIRA 1TQPA 3W2CA 4ITHA 3G33A 4EHVA 3DZOA 1V0BA 4ZY6A 2PUPA 4FG9A 4KBCA 3K5UA 3Q9WA 3CSVA 3PVWA 1W84A 2HXLA 5EI6A 4AS0A 3I7CA 4I5MA 5CF6A 4O1OA 4JXFA 4YC6A 5AIKA 4M14A 1PXKA 4NJDA 2BVAA 2CMWA 4Q5EA 2JBPA 5CF4A 4GKHA 3QD4A 2Z7SA 3GCVA 3UG2A 4TWOA 5FWKK 5HLWA 1SVGA 5KMMA 2ACXA 4R7BA 4FF8A 2GFCA 3E93A 1W98A 3F6XA 2GTNA 4MYGA 4AT5A 2WU6A 5AP2A 4YUQA 3QQHA 4TYJA 3QUPA 1IR3A 3A4PA 3NNWA 4NFNA 3HP5A 5IA2A 1WBTA 4ANQA 2ZJWA 4M66A 3R1SA 3ORXA 2IVVA 2C69A 3DQWA 3R2BA 4UMTA 4IH8A 3ULZA 4QEBA 4BCQA 4IE9A 2XCKA 3Q6UA 3JVSA 4XG4A 1XMMA 3DFAA 4O0SA 4RIWA 4CTCA 1S9JA 3O8UA 4O91A 2AQXA 1REKA 1XBBA 2W96B 3BE9A 3D5WA 5BUIA 3NYOA 4L67A 2BMCA 4X7QA 4AZSA 3VONA 4TYIA 3CD3A 2XK8A 2ERKA 2P0CA 4K9YA 3R2YA 4MVFA 4BZNA 4AZWA 1MRUA 2R9SA 4M12A 4ENXA 3AD5A 4L8MA 5C03A 4BKJA 2BR1A 4DFYA 4F9AA 3TUDA 3AC5A 4ORKA 4Y95A 3VS7A 4OTPA 5JZJA 5ANGA 3QZGA 3SOCA 4BBEA 3LJ1A 1IEPA 4ZZNA 4FV2A 3ELJA 2QOCA 5HIBA 3PUPA 2YCSA 4UZDA 5FQDC 1WVYA 3HMNA 3CTQA 3P78A 4FTQA 2XNOA 3QL8A 2YJSA 3OWKA 5CQUA 3E92A 4ZIMA 3O8PA 4AWIA 3RPSA 4USEA 4R7HA 3FLYA 2R3JA 1J7UA 5CVHA 3BKBA 3PY0A 1YDRE 3D2KA 4CGAA 3HP2A 4LRKA 4IXPA 3DTWA 3ID6C 1H1QA 3KULB 1YWVA 3EQCA 3QQLA 4AAAA 2X9FA 4D4SA 1QPEA 2QOHA 4FZDB 3H3CA 2C5YA 1ST4A 4AQCA 3FEGA 2WIPA 3W0RA 3NUYA 5CU3A 5KMNA 3Q53A 5FGKA 4ITIA 3U51A 3OBJA 4O38A 4D2WA 4EOLA 4DTAA 5DGZA 3KC3A 3LFAA 4ZZMA 5L6WL 5BYZA 4DLIA 2R64A 3DBEA 5GZ9A 4JBOA 4B4LA 1UWJA 2ETKA 3F3ZA 4FSWA 4X0MA 4CQEA 4YC8A 3PXFA 1WBPA 4C0TA 3ACKA 5J79A 3O23A 3TKIA 3AC8A 3GQIA 4FTUA 4QQCA 4BCHA 3JY0A 1VYZA 2ZDUA 4JX7A 4YZMA 4RVLA 3CKWA 3RNIA 3G15A 2XVDA 2JITA 4V0GA 4QTCA 3VJOA 3PXZA 5L2IA 2QODA 4S34A 2PTKA 3ATSA 2W1IA 3A7GA 3CTJA 3OROA 3IKAA 4FKGA 3VVHA 5CAOA 5BVWA 4I0TA 4UMQA 3KXGA 3DBDA 3E7OA 5C01A 4FTJA 4M69B 3SLSA 2C30A 4UBAA 4D5KA 3LMIA 3MIAA 1IAHA 4W9WA 3C4EA 4IWPA 2C6DA 4JDIA 2ITQA 4MWHA 5ICPA 2O3PA 2PZPA 4DAWA 4M0YA 4YP8A 4HW7A 4O86A 4EHEA 5M06A 2W0JA 1A06A 3QRJA 4O0WA 4FT5A 2J0LA 3O96A 2PVMA 3PIYA 5I5ZA 4FMQA 2W5BA 5DEWA 3AC2A 3IS5A 4YNEA 2UZEA 3LOKA 4X3FB 4F0IA 2WNTA 3NNUA 5B0XA 3H30A 1RJBA 3ZSHA 1ZYLA 3A60A 4RIXA 1YHSA 4WO5A 4A4XA 1Y6BA 2X4ZA 3KF7A 3KRWA 4O7YA 2WMSA 1XR1A 3TM0A 4FIEA 3VO3A 3OCGA 3QX4A 2VTLA 2VX0A 3FHIA 3JS2A 3AT2A 2JIUA 3DLZA 3CLYA 3NUSA 1J1CA 3ZMMA 2XARA 2FSMX 3RP9A 2I6LA 5L8LA 2WXVA 3R71A 2GS6A 4RIYB 5GJFA 4CRSA 2PY3A 2X4FA 4KIKA 3DJ6A 3PJ2A 3FC1X 4OR5A 4CFMA 4PMMA 3BU5A 3L9LA 1ZYDA 3V3VA 3M11A 4ZY5A 4OLIA 2R3HA 3BLRA 3DGKA 1X8BA 3O2MA 3DAKA 4U44A 5J87A 1FQ1B 2CGXA 1KE8A 2BRBA 4OTRA 4XUFA 4ALVA 3W18A 2OKRA 4FSNA 1YOLA 3NRMA 3DKFA 3VBXA 5D7VA 3T9TA 5C8MA 3B2WA 3MB6A 5D1JA 4QMXA 3IDCA 3F3TA 4GJ3A 2BKKA 3QTWA 4IM3A 5DT3A 4N0SA 3P0MA 3HMIA 3GFWA 4YJNA 3FMMA 4D58A 2RFSA 3JY9A 3QC4A 2R3OA 3OTUA 4CLIA 4RT7A 3TXOA 4FKSA 1J1BA 4G3DA 4U97A 3LHJA 3FYJX 2C0TA 3FAAA 4JDKA 2NRUA 2PL0A 3FI3A 1Q61A 3P79A 5IA0A 5K5XA 2OICA 3FMJA 4V04A 3OFMA 3R9HA 3O71A 4JIAA 1NT2A 3IQ7A 4ZSJA 4EOKA 5C26A 3ERKA 5J5SA 3FMNA 3VF8A 5HI2A 4XRJA 1Q97A 4JS8A 4A9TA 4DYMA 4ZSLA 2AEGA 3GNIB 5C1QB 4IACA 4L01A 2W7XA 2WQOA 2VWYA 4KBKA 4DG0E 3NUNA 4GIHA 5AX9A 4DBNA 4E6AA 3HA8A 4P5ZA 3NFFB 3W10A 2PVLA 4U45A 1VJYA 2XZSA 2H34A 4JG8A 2WB8A 5AWMA 2CNQA 2W5AA 2UVZA 4U81A 4FYOA 4EOSA 5EYCA 4WNKA 4O2PA 4W8EA 4D28A 4PTGA 4QTEA 4CXAA 3RPVA 4HPUE 3R6XA 5IISA 4M97A 3QTXA 2HXQA 4FTMA 4O4BB 2VTIA 4JRVA 3HV4A 3ZDIA 4BRXA 4GT5A 2ZB0A 3QC9A 1JKLA 4JOAA 2QKRA 3PVBA 3HL7A 1BKXA 1VYWA 4MD8E 4JMQA 2HZ4A 2PMNX 5BYLA 2WD1A 4J98A 3RK7A 1H0WA 1AQ1A 1OKVA 3R22A 4X2JA 5HO7A 2YABA 4X3FC 3SXSA 4BDAA 5IA4A 1PXMA 4FJVA 3HA6A 3NIZA 5HCXA 3PY1A 5LMAA 2XKFA 4EBWA 3QKKA 3D94A 2BDWA 4TWCA 2W9ZB 3FI8A 3WI6A 2ETMA 3F2RA 2HIWA 2HZNA 4QP1A 4U79A 3PPZA 4FGRA 1IA8A 4J97A 2OW3A 1JPAA 5CI7A 2BRGA 4LI5A 2HZIA 2OBJA 2C3LA 4CCBA 3F2AA 3R9OA 3BBTB 2ITOA 1SNXA 2XRUA 3ZBFA 4C58A 3W0MA 4NM5A 5HU9A 3ZLYA 4L45A 5H9BA 3SDJA 4XG8A 4MXOA 3AXWA 3UYSA 4DINA 1KUTA 4BDFA 3DAEA 2PYWA 4L6QA 2C6EA 2HENA 2Z8CA 4JL9A 4DEDA 1SZMA 2BTSA 2O0UA 4OTWA 3UODA 3GOKA 2B9IA 1BX6A 3SKCA 3SG8A 2PVHA 4YHFA 4C02A 4ACGA 3IW4A 4IZAA 4FL3A 4ANMA 5FBNC 3COIA 4RWJA 4J99A 2W5HA 5HX6A 4UMUA 5IUGA 3DXPA 3CXWA 2YN8A 5EQYA 4RWIA 2QKWB 4KD1A 3BYOA 2CGUA 3EQRA 5CQWA 1OKWA 4Z7GA 4ACCA 2WMRA 3R1QA 3ZUVA 4AGUA 3L8VA 2WMQA 4AN2A 4G5PA 2J9MA 3BGPA 3RMFA 1Q41A 3O17A 1PMNA 3KGAA 1FGKA 4KKHA 2ZYBA 4YNOA 3P5KA 4QP2A 5CY3A 4D5HA 4BY9E 4O7TA 5AUZA 4O7LA 3QTRA 1ZOHA 3EWHA 4IVBA 3Q60A 4UYNA 2EVAA 3PXYA 4LQMA 3FUPA 3P7CA 4MXCA 5ANDA 5ANOA 3KMMA 4LDTA 4K8AA 4R6VA 4CVAA 5L6PA 1H08A 3TNWA 4DGNA 2P3GX 5CEMA 3PIZA 3EYGA 3KREA 1XH4A 4DE4A 3QUEA 5FLFA 3GVUA 4O0RA 1P5EA 2X8DA 1Q99A 4GYIA 5E1SA 3A7JA 3E63A 4H3BA 3LJ0A 4PV0A 4BIDA 4EH9A 2J4ZA 1DI8A 3LFNA 4EOOA 4FNZA 3ODYX 3LMHA 5L4QA 3TV6A 3DJ5A 2JDSA 3V6RA 3VUMA 3GB2A 3VF9A 5E9EA 3Q2MA 3GC7A 5AP7A 1ZYSA 3V51A 4USDA 3EQPA 5M55A 3I79A 3PG1A 4KAOA 3W2QA 3GC0A 3R9DA 3D4QA 4AW2A 3R1YA 4ZTMA 4YJSA 3RGFA 4XG2A 1YI3A 3VRYA 4TYHB 5AUTA 4R5SA 5CEOA 4O82A 2UZVA 3QTSA 3ALOA 4JQEA 3LFDA 1GIHA 2CKQA 4AXEA 5FBOA 3RHKA 4AT3A 1M2QA 2XNPA 4V01A 5CT0A 5AUYA 2QG7A 3AT3A 4IWDA 1B6CB 3EN6A 4F4PA 1H1SA 2BROA 2X81A 5B2KA 3AKLA 4QPAA 2YIWA 3TI1A 1P2AA 2OXDA 4IADA 3ORTA 4JDJA 4NU1A 4QQTA 2ZV2A 3MH0A 3Q4CA 3A99A 4X2NA 2C6MA 3UOLA 5M4FA 4NKAA 4JNWA 4AE6A 5A14A 3H0ZA 3SXRA 2W1CA 5DOSA 2GNGA 4UWCA 4RMZA 4F9YA 2XK4A 5M44A 4QQJA 5JRSA 3TL8A 2GQGA 3WF7A 2OLCA 5IQBA 2VNYA 3VC4A 4BKZA 4CKJA 2Y4PA 1WBVA 3K3JA 4LGHA 1WVXA 3CY2A 3OTVA 5FTQA 3QAME 3FE3A 4EUTA 4BYIA 5JGAA 4LL0A 2WAJA 4RJ4A 4FODA 3LXNA 5J7BA 3PA3A 2WTDA 1YXUA