5TOZA

Jak3 with covalent inhibitor pf-06651600
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
286
structure length
278
Chain Sequence
TIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMDVPALSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK3
publication title Discovery of a JAK3-Selective Inhibitor: Functional Differentiation of JAK3-Selective Inhibition over pan-JAK or JAK1-Selective Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 278
sequence length 286
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5tozA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5tozA01
4HGLA 4JDIA 4N57A 4A9SA 1Q8UA 3DDPA 3IG7A 4U3ZA 2UZBA 5EKOA 4CKRA 3LJ1A 2VTNA 4HGSA 4BIDA 1OL5A 3HYHA 3I0OA 3FLYA 4WG5A 5L2SA 4L53A 1M17A 3H9RA 4QMWA 3MFUA 4CTBA 3FXXA 4JQEA 4ZTNA 1R1WA 3VJOA 1Y8GA 2BRGA 2HELA 1ZWSA 1Z9XA 4MKCA 2XJ2A 1ND4A 4UEUA 3FV8A 4AOIA 3G0FA 4G17A 5EM7A 3DLZA 3MVHA 5JSMA 4TYHA 4IM2A 3ZC6A 4EUUA 5HVKA 2HZNA 3HA6A 3RPVA 3KL8A 5GJFA 2BZKB 2C5YA 1FPUA 3KMWA 4GVAA 4NM7A 4IAAA 4PNKA 5CASA 4USEA 4CGAA 3EQCA 2PVYA 4YJVA 3CD8A 4DEDA 2RSVA 5K0KA 3CBLA 1ATPE 4OAUC 3I5NA 5A14A 5HQ0A 4J53A 4ITJA 5CSXA 3ZBFA 1CKIA 3R8ZA 1O9UA 4KNBA 4UB7A 3OUNB 2A1AB 3LW0A 4QMSA 2VTMA 1Z5MA 4B9DA 5IA4A 4TYGA 3B2WA 3P7BA 2EWAA 2PMIA 2XKCA 1W84A 2WNTA 3R8UA 4JL9A 1H07A 4ZXTA 3AT2A 3POOA 4WNKA 2W06A 4JRVA 4RJ4A 2OW3A 3KULA 3NUSA 3BQRA 3FJQE 4TNDA 3HDMA 4I0RA 4E4XA 4LL5A 1DAYA 2HK5A 3BHVA 3DTWA 1WAKA 2W1CA 2JEDA 4UALA 4FIGA 4DE4A 2WU7A 2C6DA 4K33A 5CTPA 4NM5A 5AP7A 5GZ9A 1URWA 4PNIA 3ZLWA 3MH0A 1U54A 5BYYA 5AIKA 4NFNA 4R3PA 2GQSA 4DFBA 3DNDA 2WEIA 3QTSA 4Z55A 2Y6OA 3D7ZA 4IX6A 3TWJA 3BI6A 3RZBA 3VS2A 1I09A 1XH8A 3EMGA 4E6DA 4UXQA 4AOTA 2H34A 1PXJA 3B8QA 4TYHB 2NRUA 4UBAA 2VU3A 3ATTA 2X0GA 4PTGA 3NNVA 3D2KA 4XRJA 5BVNA 5CALA 2G1TA 3MIYA 3L8VA 4C38A 5KX8A 1YXSA 4ZAUA 4XNEA 4FEVA 1Y6BA 3QALE 4M67A 1WFCA 3NAXA 4H05A 3F3UA 4C62A 4U41A 2QU6A 5D7VA 5I9UA 2QC6A 2W1EA 2VO7A 3R01A 5EYDA 2EB2A 2YJSA 4CFXA 5AAGA 4ZY4A 3AD4A 3BE9A 1G3NA 3EZRA 2YIXA 4ASZA 4BGQA 4BBFA 5JGDA 2PVLA 2WQMA 1Y91A 4AA5A 4PDPA 4QD6A 3HNGA 5AV2A 2GS7A 4MEDA 2IO6A 4O38A 4IC7A 2W4OA 2BMCA 4C02A 2WMQA 3TNWA 1JKTA 4F1MA 4FV0A 2YITA 5JN2A 5LMKA 4AZFA 4G9CA 2PYWA 3KULB 2XIYA 5E8VA 3R73A 2WD1A 3R30A 5DE2A 4AZSA 4FKIA 4FL3A 4DT9A 1WBOA 5BUJA 4BF2A 5IA2A 5IA0A 3MS9A 4FV6A 4FSQA 3LJ0A 5K9IA 4Y73A 1U54B 5ACBC 2R0UA 2P2IA 2WQOA 4R5SA 4FIJA 3QC4A 4OTFA 4LG4A 5IH6A 4Z7HA 1B6CB 3QXPA 4CSVA 4D55A 4ORKA 2WQNA 3PLAE 3CY2A 3A60A 4MF1A 3DXQA 3QKKA 4XS2A 4OBQA 2PE0A 3QZFA 1Y8YA 1PXOA 3GU5A 4EOKA 1UWJA 4FTKA 3QXOA 5EHLA 2YDJA 4J8NA 2F2CB 5AIRA 3PJ8A 2PZRA 4FKVA 2JKOA 4M7IA 1W82A 3ROYA 3NIZA 2X4FA 2WMWA 4FSMA 4L45A 5AP1A 5EH0A 3QRUA 4D28A 4I6HA 5I5ZA 4TRLA 5CANA 5LVOA 5CF6A 3E5AA 3R7UA 2ITOA 3KEXA 3R9OA 3RJCA 1Q4LA 4FV7A 5KZ0A 4FV5A 5J9LA 2UZWE 3FKLA 4OTIA 2VWVA 2YA9A 3D0EA 4IBMA 5EM8A 2HAKA 4Y85A 4RVTA 5B2MA 1Z57A 3MYGA 4YMJA 5HBHA 3VUTA 2ERKA 5B2LA 5M53A 4M0ZA 3KRXA 5D10A 5DNRA 2PU8A 2EUFB 1L3RE 4DGLC 5KBQA 4PDOA 4AT5A 4HVIA 4FKSA 3T9IA 5ANDA 2WMVA 4X3FC 1J91A 2R4BA 3QUDA 1H27A 1PJKA 4FV8A 3HRCA 4B7TA 4W4WA 2BILB 3IGOA 4JG6A 5AAFA 4C58A 2KTYA 4AACA 3HAVA 4RX7A 5CSHA 1GZ8A 2GHMA 3A8WA 5BMMA 2EXMA 5J5TA 5HG8A 2JKKA 4FKGA 2YAKA 5IU2A 4AT3A 5E8XA 4IIRA 2FO0A 4EONA 1YXTA 2YM4A 5CQUA 4YZNA 3MVLA 3HAMA 2XK7A 4ZSJA 4D2PA 4ZTMA 3QRKA 4HVSA 3GXLA 4KIPA 5CQWA 1B39A 5TT7A 3NW5A 4BCFA 5CNNA 4DGMA 4ZZNA 4CCBA 2I0HA 2VRXA 2PTKA 3BQCA 3IW4A 3RTPA 3P9JA 3ZU7A 3DJ5A 4GS6A 4G3FA 4YHJA 2JITA 2QONA 5GZAA 4G3CA 4TT7A 5ANEA 2J51A 3V3VA 5HO7A 2XRWA 3DB6A 3GBZA 4H3BA 2JIVA 5TF9A 3VUIA 3ZEPA 4RWJA 4HOKA 4EJ7A 4AW1A 3LAUA 4YO6A 3HEGA 4G5PA 5CT7A 3FEGA 3FE3A 4RVMA 4CLIA 4ACGA 2ZDTA 3CSVA 5FQDC 4CRSA 4H58A 2BCJA 3QCSA 4FA2A 5IQHA 2P55A 4C4IA 4GSBA 3VS0A 3OCBA 5L2IA 3I6WA 5AM6A 5HICA 3TACA 1W98A 4L7SA 4BTMA 2B4SB 4FTRA 2AUHA 4XG2A 4F9CA 3D4QA 4GFMA 2YM7A 3QD4A 1A9UA 4ITIA 1B38A 3RK5A 4EK6A 2YM5A 5IDPA 3SA0A 2HWOA 3OY3A 4UXLA 4U43A 3ZUTA 1QL6A 3BYSA 3VBXA 2V7AA 4D4SA 4BYJA 5KNJA 3RAKA 3ORLA 3EQHA 5EI2A 3Q9ZA 5JGAA 4CFVA 3V51A 4H1MA 3C0GA 5A4QA 3DTCA 1BX6A 3PY3A 2C6IA 3PA3A 3NCZA 3DBDA 3MPAA 4MX9A 1SZMA 5HORA 2OGVA 3Q3BA 5HIDA 4KWPA 5CU6A 5J8IA 3UYSA 3V5PA 4V0GA 3ZXZA 1U4DA 4IH8A 5GJDA 2C6TA 4AP7A 2ZDUA 3QZHA 4EHVA 5IQBA 2CN5A 3LCKA 2VO0A 5BPYA 5EQPA 4NCTC 1PXNA 2XNBA 3AC3A 5IUHA 3QX4A 2HZ4A 4GMYA 2OIBA 4EH5A 4OTPA 1S9JA 1TVOA 2IZRA 2RIOA 1IR3A 3OW4A 4XCUA 3R7VA 2XK6A 2O64A 3FKNA 2VNWA 4H3PA 4UV0A 2VTIA 4ACCA 2X7OA 2BRBA 4CV9A 4LL0A 4FTQA 3HLLA 2RL5A 2VN9A 3IDBA 3C5UA 1NW1A 2PVRA 2W1DA 3I6UA 2FSOX 2OH0E 4RQVA 5JQ5A 3JS2A 2IZSA 2VX0A 4FIIA 4J99A 2IVVA 3KF4A 2J5EA 3D2IA 2PUUA 4U0IA 4K11A 4R3RA 4DG0E 3VS1A 4RFYA 4CV8A 3Q60A 5LMAA 4RBLA 2C0IA 3C1XA 3OD6X 2A4LA 4X6QC 4FUXA 4NUSA 1Q8YA 2UW4A 3MN3A 1VYWA 4S30A 2V5QA 3TEIA 2XP2A 4ANQA 4A06A 2Q0BA 5M07A 2X6EA 1GNGA 3SXFA 3G51A 1F5QA 2VTQA 3BLHA 3A61A 3GFEA 5FD2A 4B6LA 2ZMDA 3F2RA 2QOFA 3FMJA 4LI5A 4E8AA 2ERZE 4MD8E 4S33A 2QOOA 3CQUA 2VWZA 1UWHA 2RF9A 3ZO4A 1KUTA 2OIDA 4V0GB 3UOLA 1REJA 2KULA 3PJ2A 1IEPA 5C27A 2G2FA 3TNHA 4ZSGA 5IZFA 2GQRA 3MY1A 2W9FB 4AZWA 3W8QA 2B55A 4JT3A 5AR5A 4O7WA 3F61A 3RHXA 4A9UA 3LE6A 3EFJA 4PF4A 1H1SA 3DBFA 4OR5A 4F99A 2G9XA 1DAWA 3QX2A 3ET7A 4EWHA 2EXCX 5CAOA 3C4FA 2IW9A 4WD5A 3ZHPC 3WF6A 3BELA 1OI9A 1W7HA 2PZIA 2RFEA 2XVDA 3G15A 1ZOGA 4F7NA 4DCEA 4DCAA 2XNNA 3IQ7A 4MQ2A 3ODZX 3UPXA 5K5NA 1H00A 5KMOA 1NA7A 4PRJA 2RKUA 2OZAA 2R0IA 1R78A 1JPAA 1PHKA 3PA4A 3PPKA 4BIEA 3CCNA 3B8RA 2GNIA 2VTSA 4G3EA 3CXWA 1OM1A 3ZO1A 2WO6A 3KGAA 3A7HA 4C4FA 3HRFA 4ANMA 2VTAA 3JR1A 4I5MA 2Y0AA 2GDOA 4A7CA 3CGFA 1V0BA 5J9ZA 5L2TA 1ZARA 5EQYA 2PL0A 3IW5A 3PZEA 4GV1A 4RIOA 3RK7A 4ZK5A 4FIHA 4G2FA 3DKGA 3VUGA 5FBOA 3ACJA 4IVBA 1BL7A 5I4NA 2GNFA 2ETRA 3HUBA 4A9TA 1XH4A 5DOSA 3BGZA 2ITVA 2OXXA 4LGDA 3PRFA 3SAYA 5FM2A 3EL8A 2BROA 3MSSA 4EZ3A 5ANGA 5HX6A 4EQMA 4FVQA 3SKCA 2E2BA 3BEAA 3A7FA 2Z8CA 3BZ3A 3CTHA 3R1YA 4IAIA 4QOXA 4YC6A 5GIOE 3NIEA 2XF0A 2C1AA 3G9NA 4G6NA 1VZOA 4IVAA 1XKKA 3F3TA 2CKQA 1FQ1B 3FZSA 3KB7A 4BKZA 5D11A 2WIPA 3JVRA 1MUOA 2BZHB 2R3OA 4Q5EA 5EDRA 4AFEA 2OJGA 3KU2A 2J0MB 3BV3A 4HYSA 2YCSA 4NIFA 4EH2A 2B0QA 3R9RA 3SG9A 4O22A 2GHLA 4NKAA 3P0MA 3PTGA 4RSSA 3SQQA 5JMSA 5ETIA 5DA3A 3TZ8A 5EOBA 5LWNA 2OZAB 4IQ6A 5EHYA 4I5CA 2J90A 4C3RA 3HGKA 3NR9A 4C4JA 3MV5A 4FG8A 4XX9A 1GJOA 4BZDA 3AD6A 2F2UA 3R00A 4QQCA 3S95A 3PXFA 4QTDA 1XH6A 4L00A 4IJ9A 5GINE 3R2YA 1YXXA 2GQGA 3MIAA 4RIXA 5HO8A 3ZRKA 4E6AA 4RC4A 4NWMA 1NXKA 3D5XA 3QTXA 4JDKA 4QP9A 4ZP5A 4CMTA 4WHZA 2C69A 5HCZA 3BHUA 4FTAA 4O96A 5A46A 5AAEA 4RA4A 5AP0A 4MD7E 3EFKA 3G9LX 2PZ5A 2BFYA 3KK9A 5LWMA 4CRLA 4JAJA 4WNOA 2B9HA 1TKIA 2WMAA 3IS5A 4F64A 2PUIA 2OJIA 5IQAA 4F6SA 2BRMA 5I9WA 5LQFA 2CDZA 4PUZA 2HENA 2BR1A 2XBAA 4JX3A 4MBLA 3VBQA 2PVNA 1XJDA 4FL2A 3FMEA 3PXYA 3KKVA 4C2WA 2RFNA 4U3YA 2O63A 3LLAA 5EI6A 3CIKA 2J50A 2VTRA 3R8VA 4EOQA 3U87A 2XK3A 3T3VA 3VS3A 4KB8A 1H28A 2W1FA 5HVJA 4D9UA 1W0XC 1ZY4A 3BWFA 3OWJA 3OWKA 4O6EA 4BL1A 4QPSA 4E5WA 3TT0A 1FVTA 2XM8A 2OJJA 5FTOA 3WBLA 4FSNA 3ORTA 4W9XA 2J2IB 3HA8A 3UMXA 2CGXA 5GIPE 4XG8A 2W96B 4K77A 4BCOA 4K0YA 1UVRA 4XLIA 4F65A 4BKYA 3DQXA 3OXZA 4S32A 3BHHA 2FYSA 4BDKA 1VR2A 3OWPA 3NUUA 1NVRA 4RIXB 2XS0A 3QKMA 4MTAA 2WELA 3FPQA 2JD5A 4TYIA 1RQQA 1M2PA 3VBVA 4C3FA 3AC1A 2C30A 5T3QA 5I3OA 4NEUA 2YWPA 3HDNA 1Q97A 3D83A 4RX9A 4E3CA 4QQJA 4DH8A 4KBCA 2UZVA 4LQMA 3C5IA 3NNXA 5DWRA 3QU0A 2G15A 2W4KA 3LMGA 1ZLTA 4N6YA 2YAAA 4GYGA 1ZYDA 2H8HA 2ITUA 3OW3A 4QT1A 3E64A 4FTTA 4D1XA 2XNMA 4R7IA 3O7LD 3UJGA 3UVRA 3RP9A 2F7ZE 3L9MA 4X2FA 4CXAA 2PWLA 1DI9A 2R3FA 3BWJA 4FYOA 2OJ9A 5CEMA 4ZSAA 2BRHA 4GK4A 3V5LA 3KMMA 4MF0A 1KOBA 1HCKA 2P2HA 3K3IA 3FSKA 2WMXA 3T3UA 3FY0A 4I24A 4F0IA 4ENXA 5KHXA 2X2KA 3F3ZA 4MNFA 1QPCA 3CP9A 4NW5A 5F4NA 4E4MA 4HNIA 4KS7A 2YIYA 4Y46A 3MVJA 5TKDA 3UC4A 4EHZA 4ANSA 1KSWA 4XV9A 2YCRA 1BLXA 4C33A 4BCJA 1J3HA 3S1HA 3DBEA 4BDDA 2YEXA 3VS6A 1OUYA 4BBMA 2FSMX 2R3QA 3HL7A 3QBNA 2C3JA 4DBNA 4F1OA 2ZV2A 3MFTA 5LARA 4GT4A 1LP4A 2UW7A 4D9TA 4CLJA 3MFSA 1GIIA 3LXPA 3WF7A 1J1BA 5HE2A 3ZDUA 1UKHA 5HESA 4UMUA 3OMVA 5J7BA 3DS6A 3K5VA 3C4XA 1Q61A 2P33A 4NT4A 3RHKA 4JJRA 4ZLOA 4DT8A 5FBNC 3RCDA 4QQ5A 5I9XA 3IW7A 2ZYBA 1ZY5A 5A4TA 5LVMA 3OS3A 4GIIA 1T45A 2WQBA 4RJ7A 2XRUA 4F70A 4GK3A 3TIYA 4QMVA 3PA5A 5CF4A 1RE8A 4QMQA 3MY5A 3R7OA 3WYXA 4OTWA 4OTRA 2YLFA 3JVSA 2GFSA 3PWDA 4RVLA 3UOJA 4CEGA 2QLQA 5C01A 4D2VA 3BV2A 4G3DA 2HWPA 5E8UA 1H1QA 5LCJA 4E4LA 3BLQA 2P0CA 3E7OA 2NO3A 1FGKA 4B99A 2ESMA 4D0XA 1OL7A 3EL7A 4IWDA 2JDVA 3AGMA 3EFWA 2QOHA 4F6WA 3W55A 3QQHA 3GOKA 5IF1A 5K0XA 1S9IA 3VN9A 1UNLA 3O50A 3SG8A 2QO9A 2OLCA 3NSZA 2CGUA 5EM5A 3O17A 3QYWA 4USFA 4LMNA 3WF8A 4CNHA 4O82A 3PPJA 2ITPA 3PYYA 4F9AA 4WIHA 2VWUA 1Q62A 1FVVA 2ZAZA 3R0TA 4MAOA 5C8KA 4P4CA 1UNHA 4O0XA 4W9WA 1GZKA 1PY5A 4PDYA 2ZM4A 4FTMA 5BVFA 4M12A 4UX9A 1NY3A 3Q53A 1H01A 3FI2A 4D1ZA 4MXYA 4KIQA 2YDIA 4QP3A 3KXGA 4FEQA 4WG4A 3VRZA 2QOBA 4UMRA 4JS8A 1FOTA 4TW9A 4UYAA 2C6OA 3MPMA 3ORXA 1KE9A 4D2SA 4FKRA 4IM0A 2UW3A 4UWYA 4KD1A 4WT6A 3UDBA 1DI8A 5EW8A 3DJ6A 4YTIA 1J7LA 3QTRA 3MA6A 4I6FA 4IC8A 5JGBA 3NLBA 4Y83A 5AP4A 1SVGA 5CX9A 5TOZA 4RZWA 2ONLA 3BYMA 3DK3A 4FTCA 3SRVA 3F5GA 2CLXA 2VTPA 4LUEA 1ZYJA 3QTZA 3VC4A 1DS5A 4IVDA 2C6EA 4LM5A 5CYIA 2JC6A 3GU4A 4LOPA 2BAQA 2JKQA 3I81A 5J79A 4TL0A 1F3MC 2WOTA 5AUUA 2BKKA 3ZMMA 2GPHA 4BWKA 2WMRA 4USDA 1W83A 2FSTX 4EOJA 5FXRA 4HZRA 3ORZA 2BAKA 3ZRMA 4JXFA 4D2TA 4DLIA 3UYTA 4ZZOA 5CSWA 1G5SA 1OIYA 3ZSGA 3LCTA 3ZM4A 4DH5A 5JFVA 5KBRA 2QOCA 2X2MA 4KAOA 5CXZA 2B7AA 3KXNA 3U9NA 4XV2A 1YDRE 3QWJA 1ZOEA 1YDSE 4EQCA 2Z7QA 4NW6A 1BI7A 3UP2A 3EYGA 2HXQA 4BDEA 3LJ2A 4EC9A 5LOHA 2G2HA 3QTIA 4O2PA 3POZA 2WQEA 4KRCA 4WSYA 2QO7A 3PSCA 1P14A 4KKGA 4L68A 5AUTA 2PVMA 2BTSA 3R7YA 4CT1A 4IANA 3HP2A 2UZNA 3E62A 1OBGA 2PHKA 1URCA 5HOAA 3ZBXA 2C47A 2BKZA 3NUYA 3JXWA 4DFXE 4C3PA 3DFCB 4U79A 4ALUA 4ZS4A 2BAJA 4CQEA 4EK8A 3WZEA 4JIAA 2QOIA 2Y6MA 2X7GA 3LFAA 5KUPA 4D58A 4W8EA 3LFSA 4UY9A 5IQDA 2OF2A 3P78A 1UNGA 3VS7A 5IQEA 4ZLYA 4LOOA 5CF5A 5ETAA 4FKPA 4F4PA 4LGGA 3LM0A 3TDWA 4FKTA 5EI8A 3BEGA 3UMWA 4AA0A 4I1ZA 3QHWA 4MYGA 4BCGA 2O8YA 4BHNA 4GIHA 2BDJA 2R2PA 3ZUUA 2Z7RA 3LCOA 2I0YA 3BBWA 4XG7A 2BVAA 4PDSA 1E9HA 3PJ3A 3MB6A 3NGAA 2PVFA 4X2KA 3TIZA 3COHA 3RK9A 4FGRA 3LXNA 3OY1A 3LXLA 4MH7A 5C9CA 4OAVB 3U55A 5DR2A 5AV1A 2C0TA 1Q99A 4YPSA 3MBLA 2C5NA 1MQ4A 5EW9A 4U81A 5HO6A 3EN7A 2UZEA 4GT5A 3ZSIA 3DCVA 4CZTA 5BUEA 3HV5A 3A4OX 4TWPA 4BDCA 4FSZA 3ZO3A 2OFUA 5CU4A 4L8MA 4DHFA 2Y7JA 2YIWA 1YDTE 4Y5QA 4JQ7A 4EH8A 3V5WA 3Q9WA 5BX0A 1H24A 2QHNA 1JWHA 2WEVA 3PJCA 1WBVA 3PXKA 5AP3A 4U8ZA 1RJBA 1CSNA 4E5BA 4KUJA 4FVRA 2VAGA 4DFLA 1ZYLA 4OLIA 4O7VA 2W1ZA 3W2SA 3C7QA 3NRMA 3AQVA 3C50A 3KY2A 4FZAB 2WTCA 4KRDA 2J0IA 4AGCA 3BU6A 3R02A 5HLNA 2WIHA 2I6LA 1YKRA 4YNEA 3E88A 5AJQA 2QOKA 2BDFA 2R9SA 3PJ1A 3R9NA 5JQ8A 2YACA 4QMPA 3CD3A 4TYJA 4L42A 3SC1A 2CKEA 2CCIA 2JIUA 3C4WA 3GQIA 4YTHA 5I9VA 4G9RA 2HW6A 3WILA 4X6RA 2ZOQA 4FVPA 3AOXA 3DK6A 4F09A 5AA9A 3VWAA 2GFCA 2UZDA 3K2LA 2UVYA 4LGHA 3VAPA 1P5EA 4MWIA 3SW7A 2XUUA 1WCCA 3E92A 4MQ1A 2H96A 3VF8A 5HLWA 4XLVA 1CMKE 4EOSA 1VJYA 3QF9A 3F6XA 4EBVA 2FUMA 4FNWA 4YZ9A 4BFMA 3GU7A 5GJGA 1JAMA 3DAEA 3MW1A 2G2IA 4HPUE 5JZNA 2X39A 2V22A 5AR4A 2GCDA 3HKOA 3FHRA 3VUHA 3HV7A 3ITZA 4XV3A 1U5RA 3FMMA 1TQPA 1X8BA 3IK3A 4NTTA 2XJ0A 3GCQA 3HZTA 3P79A 3LXKA 2QKRA 4PPAA 4GU9A 4A4OA 3QZGA 4FG9A 2XJ1A 3V6SA 4C57A 4MD9E 4QYHA 4DFZE 5L6WL 1WBNA 3Q2JA 2OZOA 4M68A 3QRIA 4QMUA 4ZEGA 4BI2A 2VWYA 4J7BA 1PRYA 2BTRA 2ITQA 4A07A 1IA9A 3EFLA 4EL9A 3FC2A 5CF8A 2QODA 3EQFA 4BDAA 4BTFA 4EC8A 3PIZA 4E93A 4YR8A 3OEFX 5IQGA 4I3ZA 3EN5A 4TWCA 4G6LA 5M56A 2CMWA 5FRIA 4FOBA 2JLDA 2Y4IC 3UQGA 1WMKA 3FLQA 4CTCA 5ACKA 2C6LA 4E5AX 5DPVA 1W8CA 4FOCA 1J7IA 4ITHA 4L46A 4EK3A 3N4UA 3TN8A 4DLJA 3F5PA 5IA1A 3DA6A 3QAME 4D4RA 1JKLA 1LUFA 5DT0A 2GU8A 4EKKA 3FYKX 4GG5A 5GNKA 3IOKA 1H26A 5EDPA 1FBNA 5EQEA 1Y6AA 2DWBA 3EJ1A 1GZOA 2HXLA 4R6VA 2VZ6A 2PMOX 3PLSA 2ETKA 3L1SA 3Q6UA 4XHKB 4I20A 4BICA 2H6DA 5IISA 1ZZLA 3MA3A 3F82A 5D9HA 4HVHA 4DFUA 1KE5A 3CJFA 3EYHA 3TTIA 4YZDA 1QPJA 3NAYA 3ANRA 3OT3A 4FNYA 1M14A 1MP8A 3ELJA 3V5JA 3U6JA 4IX4A 1G8AA 5HG9A 2YCFA 4LYNA 3PG3A 3RWQA 1XQZA 3S3IA 3ZZEA 5FEEA 3G33A 4NTSA 3W10A 3S4QA 5EOLA 5KKRC 4U6RA 3HMOA 3DKFA 3R22A 5HCYA 3CQEA 3F3WA 4J8MA 4X7QA 4CFFA 5HU9A 3ENHA 2ZMCA 3I79A 3MI9A 4AN2A 4YU2A 1LPUA 4EZ5A 3C4EA 3FMNA 4EOIA 3UPZA 3O8TA 5G1XA 3N9XA 2C3IB 2A27A 3HP5A 5BVDA 5AV0A 3IECA 5CT0A 2UZLA 2Y9QA 2VD5A 3BLRA 2HYYA 2J5FA 2W99B 4FC0A 4I22A 4D4VA 3PDTA 3NMUF 5HD7A 2WMSA 4GU6A 3RBWA 1PXKA 3FLSA 4BHZA 3KCFA 4EOOA 4BR3A 4KINA 4YJUA 5KMKA 4RLLA 3HUCA 3D5WA 4ACMA 4EZ7A 1YI4A 5F1ZA 3UTOA 3WF9A 4OW8A 3TDVA 1H1RA 4NU1A 4TTHB 3IKAA 3ZXTA 5HG7A 1JKSA 3F3VA 4F7SA 5E4HA 1YOJA 4O84A 3N4TA 1MRYA 4DG3E 2CNQA 2IJMA 3LMHA 2I0VA 3KRRA 4CFMA 2YM8A 2EVAA 3RI1A 4K18A 5HX8A 4YZBA 3H4JA 1OPJA 1WBWA 4U45A 1YVJA 3RAHA 3SW4A 3BYUA 2HY81 2E9PA 3ZYAA 2NRYA 4XG9A 5IH5A 4FBXA 5K3YA 3UQFA 4U97A 2C6MA 2CJMA 3ENMA 2WAJA 4ZSLA 3THBA 4CVAA 4BRXA 3E63A 4DITA 2J0KA 2OFVA 4IW0A 4WBBB 5G6VA 4KIKA 5AWMA 5AV4A 3D5VA 4FV2A 1PXIA 3F69A 3AMBA 3TXOA 1YI3A 2XMYA 1Q5KA 4MXCA 1PKDA 2RG6A 3LCSA 4FTNA 4L67A 5HKMA 2XEZA 4FICA 4LFIA 4KBKA 2Y4PA 4PMSA 4MBIA 4PWNA 4EWQA 3OXIA 4LRJA 3EN4A 5K5XA 4WSQA 4NK9A 3DT1A 3CLYA 4FV1A 5HIEA 3FSFA 4L6QA 3KN5A 5AR3A 4RZVA 4AOJA 4CFUA 4RPVA 5A4CA 4F0FA 2J7TA 1SMHA 3JPVA 5HZNA 5DIAA 2QR8A 4IZ7A 4R78A 3V8SA 3HMNA 4RWLA 4U40A 3AC5A 4YJOA 5ETCA 4P90A 3LFFA 3LFEA 4L43A 2VNYA 3UOHA 3FHIA 4YNOA 2I1MA 1ERKA 3ZH8A 2B52A 4OGRA 3RVGA 2HIWA 4Q5HA 2V0DA 1PMUA 5HNBA 5FLFA 5HGIA 5J95A 1H08A 5H8GA 3WF5A 3ID6C 5KMMA 3BHTA 4N0SA 3GC7A 3VUMA 1LEWA 3DAKA 3RGFA 3ALOA 1DM2A 4KIOA 5KMJA 4CFNA 5IDNA 4G31A 5H8EA 5AUYA 2XNPA 2GNJA 4FKLA 2ZB1A 4FTJA 3GUBA 4XMOA 5A3XA 4KKEA 2JAMA 2WPAA 2UVZA 5HHWA 4YSMA 3P7AA 4UMTA 3NW6A 5IKWA 3R7EA 1NVSA 3QQFA 3W32A 5DEWA 5IEYA 3FBVA 4KIKB 4HYHA 3W8LA 3NCGA 3O0GA 2ZM3A 3JYAA 4DYMA 2J6MA 3RNYA 3E87A 4DH7A 2CKOA 4IAFA 3D15A 2QOLA 4JAIA 2IVSA 3R1QA 4YZMA 4RJ6A 3LIJA 5J9YA 3H30A 3AD5A 2CN8A 1Q24A 3CTJA 3I4BA 3OCTA 3W2RA 4ZSEA 4PQNA 1M7QA 4YO4A 2W17A 3DOGA 3ERKA 3G5DA 3KVWA 1OGUA 3QQJA 3VUKA 3L8SA 1G8SA 4LUDA 2CGVA 3VQHA 4PPBA 3F7WA 5DYJA 3BBTB 5TO8A 4ONAA 3VVHA 4ANNA 3MPTA 1R0PA 4KSPA 4DBXA 2BIYA 4DH1A 2W5BA 3ZRLA 3TG1A 2UZOA 4P5ZA 4C34A 4DN5A 3PSDA 4RQKA 3JY0A 3PP1A 4FKOA 5EK7A 2PSQA 1JNKA 2Q0NA 3TL8A 2VO6A 4ANBA 2Z02A 4RG0A 4YP8A 2JFLA 3EN9A 2XNGA 4AZEA 4DG2E 4UZHA 3M42A 3QGWA 3G90X 1GZNA 4K9YA 4KA3A 4O21A 3ORKA 4EK4A 5CU0A 2CNUA 4XG4A 3HV6A 4BGGA 1XH7A 1OL1A 3MH2A 5AUXA 4ZTHA 3UE4A 4FEUA 3NYXA 4ENYA 2X7FA 2CKPA 2ZV7A 3FL5A 4O2ZA 1RW8A 3OTVA 3UVPA 4RRVA 4FZFB 4HJOA 1XBAA 3DBCA 3NYVA 5CSVA 3DB8A 4XYFA 2W05A 2XKFA 4YLLA 3P86A 3O8PA 2O2UA 4F6UA 3P1AA 1XH5A 2OIQA 3I1AA 4GYIA 4E7WA 3R2BA 4UWCA 5LMKC 1ZMUA 5FWKK 4KS8A 4ZTSA 1UU9A 5E9EA 3KXHA 1H1WA 3Q96A 3DFAA 3ZEWA 4PV0A 3ZFYA 5A54A 3FXWA 5FEDA 3F7ZA 3SOAA 3C4CA 4LRKA 4B4LA 4E1ZA 5GZ8A 4FNZA 4I23A 1FMOE 3Q5IA 1K3AA 2BDWA 4NM3A 4L9IA 5EKNA 3Q04A 4YC3A 3OT8A 4TZRA 3DGKA 5J7HA 4IFCA 2GNGA 2E9NA 4WO5A 4QYYA 1OPLA 3OUKA 3QHRA 3GVUA 3UGCA 4FSWA 3RMFA 5E8SA 4TNBA 3A7IA 4AU8A 5AEPA 3C13A 5AADA 5ETFA 3RPYA 3G0EA 3OP5A 4GT3A 3GU6A 3W2PA 1O6LA 4V04A 4BWPA 3QFVA 4Q2AA 1MRUA 1R3CA 5EYKA 5TE0A 5FXSA 4CKJA 2GHGA 3E93A 3H9OA 3QTQA 4E4NA 3PXRA 4GKIA 2OU7A 3TZMA 4I94A 4JDHA 4QMZA 1E1XA 4BC6A 1ZOHA 3FI4A 2PY3A 5KMIA 4AUAA 3HRBA 2X8DA 4MXOA 4AFJA 4YHTA 1WVWA 3IO7A 1OECA 4W4YA 1WVYA 2WMBA 4W8DA 3A8XA 4QMMA 4WRGA 5IEVA 4FTIA 2W0JA 4ZTLA 4M69A 4S31A 3HMIA 4AW2A 2UW0A 3D7TA 1GY3A 2QNJA 4YTCA 4NIFB 4TYEA 5CAQA 3F9NA 4DTAA 5DHJA 3KC3A 3EQBA 4GRBA 2W9ZB 4CFWA 2ITXA 4XOZA 3D14A 4Z9LA 4R7HA 3UODA 1J7UA 5M57A 1JBPE 2XIKA 3CS9A 3OFMA 3BU5A 4JR3A 4RVKA 5H3QA 5A6NA 2VGOA 4BCHA 3WE4A 4L3LA 1JLUE 3ZDIA 2IVTA 4AGWA 4C4GA 1PF8A 1PXMA 1YRPA 4ARKA 4FE2A 4RFMA 2UUEA 1KV2A 1STCE 3DZQA 2I40A 3TJDA 1IA8A 4O0WA 5J1VA 3EHAA 4FK6A 4IZ5A 5ANIA 4GCJA 4D2WA 5DRBA 4I93A 3VJNA 5ANJA 3NUAA 3MTFA 4IX5A 4RMZA 4EOLA 4F9BA 4RWKA 4RGJA 3Q4ZA 3W2QA 3GENA 4C59A 3VF9A 1IAHA 1REKA 2WZJA 3KN6A 4PTEA 3UG1A 4JBPA 5FDXA 1BL6A 4W4XA 4N70A 1FMKA 4NL0A 4ID7A 4ANOA 3QA0A 3LFQA 1BI8A 5FG8A 4EH3A 1EH4A 3CR0A 1GAGA 1YQJA 4QYGA 3BU3A 2WTJA 4O7NA 4YZCA 5BUIA 4U42A 3R1NA 4CZUA 2PVJA 3QD2B 2QCSA 3DY7A 3GU8A 3REPA 4OT6A 3BE2A 1J1CA 4UN0C 4O0RA 4Z7GA 4ACHA 4ZMFA 4FIEA 4C2VA 1YHVA 3HV3A 1QPEA 5DT4A 5C4KA 4RIWA 4PL5A 3V8WA 4M13A 4DEIA 3WIKA 4IHPA 3CJGA 5H2UA 5J87A 5FDPA 4FYNA 4G5JA 4M69B 5JZJA 4TPTA 3NWWA 2E9VA 4PP7A 3GB2A 4S2ZA 4IJPA 5JT2A 4FNXA 3PZHA 3G6HA 5E92A 5HVYA 1YI6A 1KOAA 2PMNX 4DGOA 4X3FA 3AMYA 4L3PA 3WOWA 3GC0A 4QPAA 4QTAA 2J0LA 4ASEA 4BTKA 1KWPA 3VBWA 3S0OA 3EH9A 1JSUA 4OTHA 4HPTE 5CAUA 2A0CX 2CCHA 3ETAA 4IACA 2PVKA 4O6LA 1ZYCA 3W2CA 4C36A 1OKWA 3OOGA 2GS2A 4QMNA 1VYZA 3E3PA 4C4HA 2F7EE 4ANLA 3MVMA 4GKHA 2QG5A 1Q8ZA 3QYZA 4AGDA 2QOQA 5E1SA 1SVHA 4BDGA 4IDTA 4TXCA 3Q4UA 4GJ2A 3KQ7A 3E7VA 5C1QB 3WIGA 5IMEA 4FZ7A 1WVXA 4ZY6A 4RX8A 5M4FA 3P23A 1OL2A 1P4OA 4XEYA 3AC4A 4FKUA 2JBOA 4LV5A 4CG8A 4YSJA 1OVEA 3IW6A 4YBKA 3TUCA 3R1SA 2UW5A 3QD0A 4TY1A 1UU8A 3RAIA 2IWIA 4NYEA 4BDIA 3FXZA 4J95A 4XP3A 3ULIA 5E8TA 3AGLA 2DS1A 2XB7A 3A7JA 3BX5A 4YHFA 5F94A 4A9YA 4MHAA 5L8LA 3K54A 1F0QA 4IB5A 4HGEA 4FG7A 3Q9YA 3P5KA 4IAZA 1KE7A 4RIWB 2Z7LA 3R83A 3I7CA 3UIMA 4AG8A 5B7VA 2X9FA 5HI2A 3VW6A 4XG3A 2O3PA 4BDFA 4AWIA 1OUKA 5CXHA 2IW8A 3M1SA 2YFXA 4DFNA 5LMBA 2VUWA 5LXMA 3AT3A 4HCUA 5T68A 5KMLA 5CEQA 2WOUA 2BZIB 1TQMA 2QVSE 3R21A 2BPMA 4X3FB 4X2GA 4F9WA 3RCJA 1IAJA 2XK4A 4OT5A 5E7RA 3PE2A 4FSUA 5L4QA 3MFRA 3CPCA 4WNMA 5EG3A 3UOKA 5CNOA 1BYGA 3RM7A 5ICPA 5AP2A 5C03A 3TV4A 3UQCA 3L8PA 4U9AA 3QCQA 4XRLA 3QA8A 4AGUA 5FEQA 3QUEA 4IWOA 1XH9A 2PZYA 3SD0A 2XKDA 3EWHA 5ANKA 3ZLXA 4H1JA 5FP5A 2AYPA 4ERWA 5HTCA 3ZCLA 1PMNA 2YJRA 3C51A 3OOMA 4G16A 4IX3A 4A4LA 3SVVA 3TKHA 2UW6A 4C8BA 3LHJA 5CI7A 5AM7A 4FT3A 2XIZA 1XR1A 5I9ZA 3CEKA 1MRVA 4Y72A 3RAWA 1YXVA 3RKBA 1TQIA 4YJPA 4FSYA 4L7FA 1OL6A 4QP6A 4DEEA 4OBOA 3R9DA 1U59A 3AC8A 4GL9A 2YIRA 4AF3A 2DUVA 5M4IA 3FI8A 4F08A 4I4EA 3BPRA 3NUPA 1OPKA 5E91A 2J9MA 3IPHA 3N51A 4BCMA 5DEYA 2R5TA 4FZ6A 3H10A 2YERA 3Q9XA 4TWOA 3U6IA 2QHMA 2WKMA 4HNFA 5JRSA 5CVGA 3L8XA 3VS5A 4EH4A 5CAVA 4HYIA 5HTBA 2WMUA 4DINA 3PIXA 5KCVA 2YZLA 4PL3A 3UC3A 2VX3A 5AFVA 1H8FA 2W5AA 1Q3DA 2XYNA 4B8LA 4I21A 2VTHA 2X1NA 3IGGA 3PPZA 5JKGA 4QP8A 4A9RA 2VWWA 4I92A 2GNLA 2JDOA 2PMLX 1MQBA 2JKMA 4QNAA 3R9HA 4CZYB 3VUDA 5CI6A 4EUTA 5JK3A 5CEOA 2OICA 4O0TA 1JOWB 3DQWA 2VGPA 1V0OA 4IDVA 3ORMA 4IMYA 5CLPA 4PPCA 4BTJA 3ACKA 4U80A 4Z3VA 3PE1A 2BUJA 2O0UA 4GK2A 4H36A 2XEYA 4IZAA 5A4LA 2PZPA 3FZPA 2OXDA 4CD0A 5HLPA 2IG7A 3MWUA 5CZIA 2R3GA 3PG1A 3QQLA 2VTLA 5CEIA 3W18A 4O7LA 4G34A 3NNWA 4V05A 3NVMB 3LFBA 4QTCA 3Q52A 1XBCA 3QTUA 4ZTRA 4MXXA 3SRVB 3LQ3A 3BKBA 3PVUA 2DQ7X 4IM3A 4P7EA 3QLFA 2PK9A 1WBSA 4ZLZA 1NVQA 2B9FA 2OO8X 3WZUA 2HOGA 2NP8A 4E26A 2J4ZA 5L2WA 4EOMA 2Y8OA 3TKIA 5B2KA 5DH3A 3OTUA 4XBRA 4EBWA 1Q8WA 4P5QA 5FUTA 2XIRA 4GG7A 2EXEA 2SRCA 5M4UA 2X8IA 4O7RA 3NS9A 3JUHA 5DT3A 3TKUA 4IFGA 4ERKA 5DBXA 2VTOA 4M97A 4FKJA 4PMPA 4FEWA 4LRMA 4F0GA 5AMNA 4NKSA 1SM2A 3SV0A 3FLZA 4O1OA 4RC3A 3UIUA 5M08A 1V1KA 4R8QA 2YLEA 2LAVA 3RM6A 4QO9A 5E1EA 4O7TA 2B9IA 2YDKA 2P3GX 3O71A 4D2RA 1P2AA 4OTGA 4AN9A 4R77A 2C6KA 4ZZMA 2C68A 3LVPA 5CEPA 3I7BA 2OKRA 4X0MA 3AXWA 3W1FA 1OIQA 4AN3A 3VULA 5LJJA 2NPQA 2JGZA 3O7LB 3V5TA 3OF0A 3DJ7A 3OCGA 4GFOA 3QZIA 5CEKA 5AR2A 1YHSA 2WHBA 3RINA 1ZRZA 4L44A 3SXSA 1KV1A 3CC6A 3NDMA 4R1VA 2Z7SA 1YOMA 4WNPA 4A4XA 3FDNA 1LR4A 3E3BX 3UNKA 3SX9A 3MH3A 4O7YA 5KO1A 2ZV8A 4HCTA 2P4IA 3FMDA 4GFGA 4RJ5A 4FTLA 1ZMVA 5IG1A 5HTIA 5HU3A 1YWNA 3DKCA 2HZIA 5LVLA 3RPSA 4APCA 2VX1A 2CNVA 2WTIA 3Q6WA 4LV8A 4Y95A 3IOPA 3UNZA 3R63A 4EYJA 4M66A 2WMTA 5BVKA 1Q8TA 3PUPA 3FQEA 3L9LA 3U51A 3PFQA 4AS0A 3VS4A 2QQ7A 3GC8A 2R3MA 5BYZA 3PRIA 4JR7A 4CYJA 3SLSA 4E6QA 3OWLA 5DR9A 2ZB0A 3RPRA 4YTFA 5I0BA 3HV4A 2PUPA 2YHVA 3LQ8A 3UZPA 3DAJA 3EQGA 5L6PA 3DXNA 3RWPA 2V62A 2JDTA 3KFAA 4JG8A 2GSFA 2VO3A 4NZWB 3BYOA 4IWPA 4CT2A 4J52A 3GNIB 5JFWA 4O86A 2F4JA 4JBQA 5BYLA 3FUPA 4DEHA 5GHVA 3BGQA 1PYXA 4FX3A 5E8YA 4BKJA 4Z16A 5JFXA 4C7TA 3QD3A 2C5XA 3L9NA 4JNWA 1LEZA 4TKSA 4AE6A 3T9TA 5LVPA 5DN3A 3S00A 4XP0A 1U5QA 4GJ3A 2XNOA 3R6XA 4RC2A 4UWBA 3CKWA 1Y57A 4NM0A 4FTOA 4M8TA 5HBJA 1M2RA 3LQ5A 3ZOSA 3QKLA 4ALVA 4HW7A 4AE9A 3FY2A 1WBPA 5DGZA 1YW2A 2W1IA 2R3KA 5HCXA 3PXZA 4YJNA 3I60A 2ACXA 2X6DA 3FQSA 4R7BA 5HE0A 1U46A 4XP2A 3BHYA 3UVQA 2PVHA 1GIHA 1H0WA 4HVGA 4O83A 4EH7A 3R71A 4B0GA 2ITNA 5DG5A 4AA4A 4E6CA 4IAYA 3ZLSA 5HNIX 5IMXA 3UIXA 4YLJA 3OXTA 3WE8A 5HD4A 3ORPA 2FH9A 4QNYA 4QTBA 2PE2A 5E90A 2IZTA 4C61A 1PMVA 4JOAA 3LOKA 3QQGA 4OBPA 4FT9A 3Q4CA 3ALNA 4I6BA 4M14A 4ZJVA 4JI9A 2BHHA 4YPDA 4X2JA 2VWIA 5F20A 3GT8A 4FI1A 3VNTA 2A2AA 4C37A 2X4ZA 2OBJA 3ZONA 3FWQA 2UZTA 4E20A 5IH4A 2QI8A 2PPQA 3FKOA 2CSNA 3OHTA 3W33A 4QYFA 3BIZA 1IRKA 3NUNA 3LFCA 3Q2MA 1JSVA 2R3IA 4OTQA 2RFDA 3OEZA 4EHGA 5IUGA 4G1WA 3COKA 4BGHA 4YJQA 3AMAA 2O65A 2WTVA 3DZOA 4XJ0A 4FSRA 3O96A 3TNPC 2QURA 5D1JA 4FSTA 4JRNA 1YHWA 2ITYA 4U5JA 2O5KA 2XNEA 4O0UA 4QQTA 3A2CA 2HW7A 3WI6A 1FINA 2ZV9A 4D5KA 4BY9E 3O23A 2LGCA 4ZJIA 5CWZA 4I0SA 3MESA 5KHWA 2F9GA 5CU3A 2YN8A 3OZ6A 4BI0A 3G6GA 2UV2A 3VRYA 4QMXA 2C5OA 5BVWA 2R3NA 5M4CA 2WTWA 4IXPA 3GCPA 3UNJA 3ZFXA 5L3AA 4N4SA 4FKWA 4DF3A 3KMUA 3FZRA 4WOVA 2E9UA 1YOLA 5EM6A 2HCKA 5EHOA 3E8NA 2Q83A 5H8BA 5CVHA 3V8TA 4M84A 4UMQA 4KABA 4L52A 1PMEA 5IUIA 3TZ7A 5DFPA 3MY0A 2IW6A 3NZ0A 4CKIA 3NEWA 1QCFA 2VV9A 3GQLA 5HE3A 1NT2A 4O0YA 2XYUA 4XBUA 4QYEA 1OKYA 2OXYA 3NVKI 2WFYA 3SOCA 3M2WA 3ZFMA 1PYEA 1CDKA 5M51A 4WUAA 3HVCA 4HYUA 4WA9A 3A99A 4NJDA 3TNQB 4ZMEA 4D4YA 4QP1A 5F95A 5T6KA 1E1VA 1H0VA 4EK5A 2R7BA 4HGTA 1M7NA 2I0EA 1KE8A 3TTJA 3R04A 3G2FA 3ODYX 3KK8A 4O27B 3DBQA 1H4LA 1GOLA 4QRCA 3CQWA 2R3HA 5IEXA 2WTDA 3KXZA 2I7QA 4APPA 4YJSA 4YC8A 3ZTXA 2FGIA 1IASA 5AUVA 1YXUA 2DYLA 3VW8A 2OWBA 2XKEA 3DPKA 3FZ1A 3DXPA 2UZUE 3UO4A 5A4EA 3MDYA 3Q4TA 1YWVA 3QL8A 4JIKA 1O6KA 3ORIA 3Q32A 4F7LA 2QU5A 4QMOA 5TR6A 4DH3A 4BBEA 2BZJA 5DR6A 3EQPA 4FMQA 3NW7A 2CHLA 3MTLA 2XK9A 3KA0A 1BMKA 2UW9A 4IB0A 4WRSA 5AP5A 3QWKA 3QLGA 3S2PA 4HVDA 5KMNA 4F1TA 3QC9A 4QTEA 4I5HA 2ONLC 5JH6A 3SDJA 3TM0A 2F49A 4NSTA 3R8MA 3C0HA 5D41A 2X2LA 4KBAA 4DGNA 2YISA 4ZOGA 4WKQA 5AP6A 2YWVA 4O81A 4BDBA 2WU6A 4YJTA 2YABA 3E8EA 4JX7A 5AA8A 5FM3A 2OJFE 3KXXA 4AAAA 1H1PA 2R3LA 4QMLA 1OKZA 1GIJA 4EH9A 4WUNA 3OBJA 4KKHA 4DA5A 2XZSA 1FVRA 4D5HA 5J5SA 4GVJA 2IPXA 2HY0A 4ASXA 2YM6A 3F66A 4E73A 3FMLA 2XCKA 2FB8A 4P2KA 3V5QA 5DLSA 3MJ2A 1L8TA 3R7GA 2ITZA 2UW8A 1HCLA 4OUCA 3II5A 3KF7A 4F7JA 4H3QA 3ZS5A 5M44A 3GEQA 5FTGA 5C4LA 3PSBA 1XBBA 4IWQA 4I4FA 3WZJA 2QD9A 4BCQA 1ZZ2A 2XK8A 4L01A 3RPOA 2RG5A 3P4KA 5IPJA 2R3PA 4FV4A 2QLUA 2EU9A 3K5UA 1SNXA 3GC9A 1M52A 3EOCA 4GUEA 1CKPA 3A7GA 1AQ1A 3C0IA 4BCIA 1H25A 5IQFA 5KZIA 5CSPA 5EW3A 4HCVA 4RIYA 5EDQA 4FT0A 3IONA 5H9BA 2C3LA 5AUZA 3CTQA 4BB4A 1Q41A 3O8UA 2V55A 4RJ8A 4IB3A 3LMIA 3PVBA 5BVEA 4YJRA 3W2OA 4DTKA 3SGCA 4B8MA 1JSTA 1OZ1A 2F57A 4IVCA 1OIUA 4YURA 4MNEA 3V01A 2WTKB 3GCSA 4G3GA 3NYNA 4K8AA 3U9CA 5DMZA 4QMTA 4R1YA 3SXRA 5C8NA 4ALWA 3PY0A 4FUYA 3A62A 5AUWA 3EKKA 3PVWA 2QO2A 3LM5A 3EB0A 2FSLX 3EQRA 3EQDA 3UBDA 1OBDA 3E8DA 1PXPA 1R0EA 4J71A 4MXAA 2AC3A 3TI1A 4UMPA 2Z60A 4X21A 4BDJA 3FL4A 2C0OA 3QGYA 1QMZA 4I41A 1CM8A 4DEBA 3EKNA 4UYNA 4BZOA 1O6YA 2OG8A 2R3JA 2J0JA 4PL4A 2BRNA 4D0WA 4F9YA 5K4IA 3U6HA 5IA5A 5M09A 1WBTA 1JVPP 4BIBA 4FKQA 2W4JA 3GCUA 1V0PA 5D12A 4DGGA 3ZM9A 4BCPA 2B9JA 3BYVA 4FL1A 3GGFA 5FTQA 5F9EA 4FODA 4PY1A 1APME 3HX4A 2VWXA 3BRBA 2CPKE 5IA3A 2OH4A 2PE1A 4AQCA 1UKIA 2GTMA 3ZSHA 3O51A 4FF8A 2F7XE 3QCXA 4LMUA 4AW5A 3CKXA 3MGYA 4NH1A 4JBOA 4J98A 3KRJA 4FTUA 5LCKA 3U4UA 4C4EA 1YWRA 3R8LA 4RIYB 3UG2A 4O7ZA 2JBPA 3QTWA 4DFYA 3RZFA 1Q3WA 2Z2WA 3QRJA 4MK0A 4QP4A 2X9EA 5HIBA 2XCHA 4XH6A 4UZDA 4FK3A 3WARA 3HMPA 4EQUA 5M06A 3PXQA 1XO2B 2ETMA 5CAPA 5AR8A 3Q5ZA 4AX8A 4GEOA 4BCKA 5CU2A 4W4VA 2XH5A 2UVXA 4AZTA 3ZC5A 1XWSA 4MNEB 2G01A 2JDSA 4BWXA 5CENA 5IQIA 3W16A 1AD5A 2CLQA 3FC1X 3V6RA 4WG3A 3NUXA 4QP2A 4XG6A 3KREA 3MB7A 3U54A 3VBYA 1CKJA 1WZYA 3NYOA 4U44A 4Y8DA 4BVUA 4YUQA 2XM9A 5JRQA 5C8MA 4O91A 4BCNA 5AV3A 1AGWA 4MBJA 1FGIA 1QPDA 3OBGA 5AX9A 2R3RA 3IW8A 5E8WA 3LKMA 4RA5A 4Y5HA 3C9WA 3F2AA 5KE0A 4EORA 5K4JA 3FYJX 3PP0A 4BYIA 4BI1A 1OIRA 3QRTA 3P08A 4EOPA 1RDQE 5D7AA 1T46A 4O7SA 4FT5A 2ZJWA 2C5VA 3VBTA 4EHEA 3FZOA 3TUDA 2IZUA 4H39A 4XV1A 3OROA 3NX8A 4V01A 5HEZA 1A48A 3JY9A 5DI1A 4GW8A 4BDHA 1OMWA 3T8OA 3WYYA 4F63A 2JDRA 4JLCA 4MCVA 1SNUA 4CMUA 3AT4A 4FEXA 4IE9A 3TV6A 3EIDA 3KCKA 3DLSA 2REIA 4GUBA 4ZTQA 4X2NA 3OG7A 4C0TA 2JAVA 3KRWA 5L8JA 3UO6A 3TUBA 3PVGA 1PW2A 3TV7A 4YLKA 4II5A 4M0YA 4PP9A 5EFQA 4K6ZA 4PMMA 4ZS0A 3TCPA 5A9UA 2PULA 4DAWA 5B0XA 5CVFA 4N6ZA 3RNIA 3IDPA 3HECA 4HZSA 3AG9A 5EYCA 4R5YA 2BALA 3FLWA 1OKVA 2BHEA 2RFSA 2BFXA 5ITAA 2RGPA 4C35A 3GOPA 2C3KA 1KE6A 1HOWA 4JBVA 2ITTA 4RJ3A 3QCYA 3A4PA 2IN6A 3D5UA 3QQKA 1JQHA 5EYMA 2B54A 4S34A 4R3CA 5FP6A 2FVDA 3L9PA 3F2NA 1CTPE 2W7XA 4IAKA 4I0TA 3FZTA 3FAAA 2GNHA 4Q9SA 5AR7A 2WB8A 5HBEA 3U4WA 5BMSA 1SVEA 3E8CA 4L3JA 3FMKA 4QMYA 2NNWB 3GCVA 4DEAA 3HMMA 2X81A 5I3RA 3UO5A 1VEBA 3FLNC 4JG7A 4YGAA 5L6OA 4DC2A 2X8EA 4LOQA 3OC1A 3NNUA 3R28A 4Q9ZA 4FIFA 4M3QA 3QQUA 3D94A 5CZHA 4AXAA 4O0VA 1ZAOA 3K3JA 2VTTA 4QPMA 2QKWB 2FA2A 3BGPA 4XOYA 4CQGA 2YCQA 3CY3A 2OF4A 3D7TB 3C4ZA 3O2MA 4JVGA 3PIYA 3U8WA 3ULZA 3ANQA 5CY3A 1ZXEA 3F5XA 3FPMA 3WZKA 4CMOA 3CE3A 4EKLA 4TN6A 4FZDB 4J1RA 3EQIA 3SHEA 2JIIA 3KVXA 3ZLYA 5L8KA 2AC5A 1JKKA 3AC2A 3F88A 1UV5A 4ASDA 1PKGA 2B53A 3KRLA 2XIXA 2YM3A 2V7OA 1A06A 3P7CA 5M55A 2XBJA 3RALA 3ZO2A 4O0SA 4NFMA 5JEBA 2XA4A 2QR7A 5J1WA 3LFNA 3LZBA 3LFDA 4PMTA 5AX3A 4EH6A 1OITA 2C1BA 3ATSA 3MH1A 4J97A 2C4GA 2A19B 3R8PA 4K2RA 5DRDA 4DEGA 4KSQA 4FV9A 3ORNA 4RWIA 3TNIA 4G6OA 4MWHA 4XUFA 3H0YA 3WZDA 2VTJA 1UU3A 3FI3A 1OB3A 2OSCA 4OTDA 3TJCA 5BVOA 3VIDA 3KXMA 4X3JA 3GFWA 5DVRA 3B2TA 3H0ZA 3LCDA 3FQHA 3GI3A 4EJNA 3BCEA 4U7ZA 4I5PA 4WBOA 4AZVA 4IEBA 2W1HA 3LPBA 4J96A 2BIKB 2W5HA 4AW0A 5JFSA 4FT7A 5C26A 3GP0A 2YZAA 2E9OA 1XHAA 2WGJA 4MXZA 3PY1A 2PUNA 1R39A 5CS6A 3DDQA 4BZNA 3OCSA 4M15A 3UP7A 4AT4A 4I6QA 5BNJA 3COMA 4IADA 4RLKA 2ITWA 3COIA 4QP7A 2R7IA 4MVFA 5HE1A 2YIQA 1ZYSA 2W1GA 4ZY5A 5HG5A 1M2QA 2R64A 5I9YA 3H3CA 1K2PA 4GH2A 3I0QA 3OVVA 3R7IA 3VHEA 5HNGA 3PWYA 4RX5A 2CGWA 3UZTA 2Y4IB 2IVUA 1P4FA 2B1PA 2WTKC 3DU8A 2OI4X 2GS6A 4JQ8A 2EB3A 5L2QA 3ROCA 3EZVA 3VO3A 2OK1A 3V04A 1SYKA 2WXVA 3LLTA 4TWNA 3F5UA 4BN1A 3QUPA 2HZ0A 1BUHA 3DNEA 4PX6A 4O1PA 1IG1A 4YBJA 2GMXA 1BKXA 4PTCA 4RFZA 3TZ9A 1K9AA 4CCUA 3MJ1A 4EI4A 3N4VA 3ZUVA 1I44A 1UU7A 4JDJA 3IDCA 3I5ZA 2ZM1A 5E8ZA 4ZIMA 3DV3A 4IB1A 5ANOA 5A6OA 1PXLA 4ACDA 3DKOA 4K1BA 3UIBA 3ZZWA 3H9FA 4NCTA 4RT7A 4NJ3A 3EN6A 5FXQA 5KKRB 2ZVAA 2JFMA 3D9VA 4FR4A 4CYIA 5BQ0A 4CG9A 4EYMA 3DK7A 2H9VA 3FMHA 2GTNA 3NPCA 4D1SA 4EEVA 5FGKA 1UA2A 2VWBA 3CPBA 4DTBA 3VHKA 1ZMWA 4FGBA 3VQUA 4ZJJA 4FV3A 3M11A 4IZYA 5LVNA 5IQCA 2QG7A 3UZRA 3CGOA
chains in the Genus database with same CATH superfamily
4HGLA 4JDIA 4N57A 4A9SA 1Q8UA 3DDPA 3IG7A 4U3ZA 2UZBA 5EKOA 4CKRA 3LJ1A 2VTNA 4HGSA 4BIDA 1OL5A 3HYHA 3I0OA 3FLYA 4WG5A 5L2SA 4L53A 1M17A 3H9RA 4QMWA 3MFUA 4CTBA 3FXXA 4JQEA 4ZTNA 1R1WA 3VJOA 1Y8GA 2BRGA 2HELA 1ZWSA 1Z9XA 4MKCA 2XJ2A 1ND4A 4UEUA 3FV8A 4AOIA 3G0FA 4G17A 5EM7A 3DLZA 3MVHA 5JSMA 4TYHA 4IM2A 3ZC6A 4EUUA 5HVKA 2HZNA 3HA6A 3RPVA 3KL8A 5GJFA 2BZKB 2C5YA 1FPUA 3KMWA 4GVAA 4NM7A 4IAAA 4PNKA 5CASA 4USEA 4CGAA 3EQCA 2PVYA 4YJVA 3CD8A 4DEDA 2RSVA 5K0KA 3CBLA 1ATPE 4OAUC 3I5NA 5A14A 5HQ0A 4J53A 4ITJA 5CSXA 3ZBFA 1CKIA 3R8ZA 1O9UA 4KNBA 4UB7A 3OUNB 2A1AB 3LW0A 4QMSA 2VTMA 1Z5MA 4B9DA 5IA4A 4TYGA 3B2WA 3P7BA 2EWAA 2PMIA 2XKCA 1W84A 2WNTA 3R8UA 4JL9A 1H07A 4ZXTA 3AT2A 3POOA 4WNKA 2W06A 4JRVA 4RJ4A 2OW3A 3KULA 3NUSA 3BQRA 3FJQE 4TNDA 3HDMA 4I0RA 4E4XA 4LL5A 1DAYA 2HK5A 3BHVA 3DTWA 1WAKA 2W1CA 2JEDA 4UALA 4FIGA 4DE4A 2WU7A 2C6DA 4K33A 5CTPA 4NM5A 5AP7A 5GZ9A 1URWA 4PNIA 3ZLWA 3MH0A 1U54A 5BYYA 5AIKA 4NFNA 4R3PA 2GQSA 4DFBA 3DNDA 2WEIA 3QTSA 4Z55A 2Y6OA 3D7ZA 4IX6A 4O4DA 3TWJA 3BI6A 3RZBA 3VS2A 1I09A 1XH8A 3EMGA 4E6DA 4UXQA 4AOTA 2H34A 1PXJA 3B8QA 4TYHB 2NRUA 4UBAA 3W0QA 2VU3A 3ATTA 2X0GA 4PTGA 3NNVA 3D2KA 4XRJA 5BVNA 5CALA 2G1TA 3MIYA 3L8VA 4C38A 5KX8A 1YXSA 4ZAUA 4XNEA 4FEVA 1Y6BA 3QALE 4M67A 1WFCA 3NAXA 4H05A 3F3UA 4C62A 4U41A 2QU6A 5D7VA 5I9UA 2QC6A 2W1EA 2VO7A 3R01A 5EYDA 2EB2A 2YJSA 4CFXA 5AAGA 4ZY4A 3AD4A 3BE9A 1G3NA 3EZRA 2YIXA 4ASZA 4BGQA 4BBFA 5JGDA 2PVLA 2WQMA 1Y91A 4AA5A 4PDPA 4QD6A 3HNGA 5AV2A 2GS7A 4MEDA 4AXDA 2IO6A 4O38A 4IC7A 2W4OA 2BMCA 2X0QA 4C02A 2WMQA 3TNWA 1JKTA 4F1MA 4FV0A 2YITA 5JN2A 5LMKA 4AZFA 4G9CA 2PYWA 3KULB 2XIYA 5E8VA 3R73A 2WD1A 3R30A 5DE2A 4AZSA 4FKIA 4FL3A 4DT9A 1WBOA 5BUJA 4BF2A 5IA2A 5IA0A 3MS9A 4FV6A 4FSQA 3LJ0A 5K9IA 4Y73A 1U54B 5ACBC 2R0UA 2P2IA 2WQOA 4R5SA 4FIJA 3QC4A 4OTFA 4LG4A 5IH6A 4Z7HA 1B6CB 3QXPA 4CSVA 4D55A 4ORKA 2WQNA 3PLAE 3CY2A 3A60A 4MF1A 3DXQA 3QKKA 4XS2A 4OBQA 4DHZA 2PE0A 3QZFA 1Y8YA 1PXOA 3GU5A 4EOKA 1UWJA 4FTKA 3QXOA 5EHLA 2YDJA 4J8NA 2F2CB 5AIRA 3PJ8A 2PZRA 4FKVA 2JKOA 4M7IA 1W82A 3ROYA 3NIZA 2X4FA 2WMWA 4FSMA 4L45A 5AP1A 5EH0A 3QRUA 4D28A 4I6HA 5I5ZA 4TRLA 5CANA 5LVOA 5CF6A 3E5AA 3R7UA 2ITOA 3KEXA 3R9OA 3RJCA 1Q4LA 4FV7A 4QDEA 5KZ0A 4FV5A 5J9LA 2UZWE 3FKLA 4OTIA 2VWVA 2YA9A 3D0EA 4IBMA 5EM8A 2HAKA 4Y85A 4RVTA 5B2MA 1Z57A 3MYGA 4YMJA 5HBHA 3VUTA 2ERKA 5B2LA 5M53A 4M0ZA 3KRXA 5D10A 5DNRA 2PU8A 2EUFB 1L3RE 4DGLC 3P5JC 5KBQA 4PDOA 4AT5A 4HVIA 4FKSA 3T9IA 5ANDA 2WMVA 4X3FC 1J91A 2R4BA 3QUDA 1H27A 1PJKA 4FV8A 3HRCA 4B7TA 4W4WA 2BILB 3IGOA 4JG6A 5AAFA 4C58A 2KTYA 4AACA 3HAVA 4RX7A 5CSHA 2X0PA 1GZ8A 2GHMA 3A8WA 5BMMA 2EXMA 5J5TA 5HG8A 2JKKA 4FKGA 3W0SA 2YAKA 5IU2A 4AT3A 5E8XA 4IIRA 2FO0A 4EONA 1YXTA 2YM4A 5CQUA 4YZNA 3MVLA 3HAMA 2XK7A 4ZSJA 4D2PA 4ZTMA 3QRKA 4HVSA 3GXLA 4KIPA 5CQWA 1B39A 5TT7A 3NW5A 4BCFA 5CNNA 4DGMA 4ZZNA 4CCBA 2I0HA 2VRXA 2PTKA 3BQCA 3IW4A 3RTPA 3P9JA 3ZU7A 3DJ5A 4GS6A 4G3FA 4YHJA 2JITA 2QONA 5GZAA 4G3CA 4TT7A 5ANEA 2J51A 3V3VA 5HO7A 2XRWA 3DB6A 3GBZA 4H3BA 2JIVA 5TF9A 3VUIA 3ZEPA 4RWJA 4HOKA 3BL7A 4AW1A 4EJ7A 3LAUA 4YO6A 3HEGA 4G5PA 5CT7A 3FEGA 3FE3A 4RVMA 4CLIA 4ACGA 2ZDTA 3CSVA 5FQDC 4CRSA 4H58A 2BCJA 3QCSA 4FA2A 5IQHA 2P55A 4C4IA 4GSBA 3VS0A 3OCBA 5L2IA 3I6WA 5AM6A 5HICA 3TACA 1W98A 4L7SA 4BTMA 2B4SB 4FTRA 2AUHA 4XG2A 4F9CA 3D4QA 4GFMA 2YM7A 3QD4A 1A9UA 4ITIA 1B38A 3RK5A 4EK6A 2YM5A 5IDPA 3SA0A 2HWOA 3OY3A 4UXLA 4U43A 3ZUTA 1QL6A 3BYSA 3VBXA 2V7AA 4D4SA 4BYJA 5KNJA 3RAKA 3ORLA 4DHIB 3EQHA 4O4BB 3Q9ZA 5EI2A 5JGAA 4CFVA 3V51A 4H1MA 3C0GA 5A4QA 3DTCA 1BX6A 3PY3A 2C6IA 3PA3A 3NCZA 3DBDA 3MPAA 4MX9A 1SZMA 5HORA 2OGVA 3Q3BA 5HIDA 4KWPA 5CU6A 5J8IA 3UYSA 3V5PA 4V0GA 3ZXZA 1U4DA 4IH8A 5GJDA 2C6TA 4AP7A 2ZDUA 3QZHA 4EHVA 5IQBA 2CN5A 3LCKA 2VO0A 5BPYA 5EQPA 4NCTC 1PXNA 2XNBA 3AC3A 5IUHA 3QX4A 2HZ4A 4GMYA 2OIBA 4EH5A 4OTPA 1S9JA 1TVOA 2IZRA 2RIOA 1IR3A 3OW4A 4XCUA 3R7VA 2XK6A 2O64A 3FKNA 2VNWA 4H3PA 1TFFA 4UV0A 2VTIA 4ACCA 2X7OA 2BRBA 4CV9A 4LL0A 4FTQA 3HLLA 2RL5A 2VN9A 3IDBA 3C5UA 1NW1A 2PVRA 2W1DA 3I6UA 2FSOX 2OH0E 4RQVA 5JQ5A 3JS2A 2IZSA 2VX0A 4FIIA 4J99A 2IVVA 3KF4A 2J5EA 3D2IA 2PUUA 4U0IA 4K11A 4R3RA 4DG0E 3VS1A 4RFYA 4CV8A 3Q60A 5LMAA 4RBLA 2C0IA 3C1XA 3OD6X 2A4LA 4X6QC 4FUXA 4NUSA 1Q8YA 2UW4A 3MN3A 1VYWA 4S30A 2V5QA 3TEIA 2XP2A 4ANQA 4A06A 2Q0BA 5M07A 3AKLA 2X6EA 1GNGA 3SXFA 3G51A 1F5QA 2VTQA 3BLHA 3A61A 3GFEA 5FD2A 4B6LA 2ZMDA 3F2RA 2QOFA 3FMJA 4LI5A 4E8AA 2ERZE 4MD8E 4S33A 2QOOA 3CQUA 2VWZA 1UWHA 2RF9A 3ZO4A 1KUTA 2OIDA 4V0GB 3UOLA 1REJA 2KULA 3PJ2A 1IEPA 5C27A 2G2FA 3TNHA 4ZSGA 5IZFA 2GQRA 3MY1A 2W9FB 4AZWA 3W8QA 2B55A 4JT3A 5AR5A 4O7WA 3F61A 3RHXA 4A9UA 3LE6A 3EFJA 4PF4A 1H1SA 3DBFA 4OR5A 4F99A 2G9XA 1DAWA 3QX2A 3ET7A 4EWHA 2EXCX 5CAOA 3C4FA 2IW9A 4WD5A 3ZHPC 3WF6A 3BELA 1OI9A 1W7HA 2PZIA 2RFEA 2XVDA 3G15A 1ZOGA 4F7NA 4DCEA 4DCAA 2XNNA 3IQ7A 4MQ2A 3ODZX 3UPXA 5K5NA 1H00A 5KMOA 1NA7A 4PRJA 2RKUA 2OZAA 2R0IA 1R78A 1JPAA 1PHKA 3PA4A 3PPKA 4BIEA 3CCNA 3B8RA 2GNIA 2VTSA 4G3EA 3CXWA 1OM1A 3ZO1A 2WO6A 3KGAA 3A7HA 4C4FA 3HRFA 4ANMA 2VTAA 3JR1A 4I5MA 2Y0AA 2GDOA 4A7CA 3CGFA 1V0BA 5J9ZA 5L2TA 1ZARA 5EQYA 2PL0A 3IW5A 3PZEA 4GV1A 4RIOA 3RK7A 4ZK5A 4FIHA 4G2FA 3DKGA 3VUGA 5FBOA 3ACJA 4IVBA 1BL7A 5I4NA 2GNFA 2ETRA 3HUBA 4A9TA 1XH4A 5DOSA 3BGZA 2ITVA 2OXXA 4LGDA 3PRFA 3SAYA 1W2DA 5FM2A 3EL8A 2BROA 3MSSA 4EZ3A 5ANGA 5HX6A 4EQMA 4FVQA 3SKCA 2E2BA 3BEAA 4I6LA 3A7FA 2Z8CA 3BZ3A 3CTHA 3R1YA 4IAIA 4QOXA 4YC6A 5GIOE 3NIEA 2XF0A 2C1AA 2IF8A 3G9NA 1VZOA 4G6NA 4IVAA 1XKKA 3F3TA 2CKQA 1FQ1B 3FZSA 3KB7A 4BKZA 5D11A 2WIPA 3JVRA 1MUOA 2BZHB 2R3OA 4Q5EA 5EDRA 4AFEA 2OJGA 3KU2A 2J0MB 3BV3A 4HYSA 2YCSA 4NIFA 4EH2A 2B0QA 3R9RA 3SG9A 4O22A 2GHLA 4NKAA 3P0MA 3PTGA 4RSSA 3SQQA 5JMSA 5ETIA 5DA3A 3TZ8A 5EOBA 5LWNA 2OZAB 4IQ6A 5EHYA 4I5CA 2J90A 4C3RA 3HGKA 3NR9A 4C4JA 3MV5A 4FG8A 4XX9A 1GJOA 4BZDA 3AD6A 2F2UA 3R00A 4QQCA 3S95A 3PXFA 4QTDA 1G8JA 1XH6A 4L00A 4IJ9A 5GINE 3R2YA 1YXXA 2GQGA 3MIAA 4RIXA 5HO8A 3ZRKA 4E6AA 4RC4A 4NWMA 1NXKA 3D5XA 3QTXA 4JDKA 4QP9A 4ZP5A 4CMTA 4WHZA 2C69A 5HCZA 3BHUA 4FTAA 4O96A 5A46A 5AAEA 4RA4A 5AP0A 4MD7E 3EFKA 3G9LX 2PZ5A 2BFYA 3KK9A 5LWMA 4CRLA 4JAJA 4WNOA 2B9HA 1TKIA 2WMAA 3IS5A 4F64A 2PUIA 2OJIA 5IQAA 4F6SA 2BRMA 5I9WA 5LQFA 2CDZA 4PUZA 2HENA 2BR1A 2XBAA 4JX3A 4MBLA 3VBQA 2PVNA 1XJDA 4FL2A 3FMEA 3PXYA 3KKVA 4C2WA 2RFNA 4U3YA 2O63A 3LLAA 5EI6A 3CIKA 2J50A 2VTRA 3R8VA 4EOQA 3U87A 2XK3A 3T3VA 3VS3A 4KB8A 1H28A 2W1FA 5HVJA 4D9UA 1W0XC 1ZY4A 3BWFA 1OGYA 3OWJA 3OWKA 4O6EA 4BL1A 4QPSA 4E5WA 3TT0A 1FVTA 2XM8A 2OJJA 5FTOA 3WBLA 4FSNA 3ORTA 4W9XA 2J2IB 3HA8A 3UMXA 2CGXA 5GIPE 4XG8A 2W96B 4K77A 4BCOA 4K0YA 1UVRA 4XLIA 4F65A 4BKYA 3DQXA 3OXZA 4S32A 3BHHA 2FYSA 4BDKA 1VR2A 3OWPA 3NUUA 1NVRA 4RIXB 2XS0A 3QKMA 4MTAA 2WELA 3FPQA 2JD5A 3PUFC 3AKJA 4TYIA 1RQQA 1M2PA 3VBVA 4C3FA 3AC1A 2C30A 5T3QA 5I3OA 4NEUA 2YWPA 3HDNA 1Q97A 3D83A 4RX9A 4E3CA 4QQJA 4DH8A 4KBCA 2UZVA 4LQMA 3C5IA 3NNXA 5DWRA 3QU0A 2G15A 2W4KA 3LMGA 1ZLTA 4N6YA 2YAAA 4GYGA 1ZYDA 2H8HA 2ITUA 3OW3A 4QT1A 3E64A 4FTTA 4D1XA 2XNMA 4R7IA 3W0PA 3O7LD 3UJGA 3UVRA 3RP9A 2F7ZE 3L9MA 4X2FA 4CXAA 2PWLA 1DI9A 2R3FA 3BWJA 4FYOA 2OJ9A 5CEMA 4ZSAA 2BRHA 4GK4A 3V5LA 3KMMA 4MF0A 1KOBA 1HCKA 2P2HA 3K3IA 3FSKA 2WMXA 3T3UA 3FY0A 4I24A 4F0IA 4ENXA 5KHXA 2X2KA 3F3ZA 4MNFA 1QPCA 3CP9A 4NW5A 5F4NA 4E4MA 4HNIA 4KS7A 2YIYA 4Y46A 3MVJA 5TKDA 3UC4A 4EHZA 4ANSA 1KSWA 4XV9A 2YCRA 1BLXA 4C33A 4BCJA 1J3HA 3S1HA 3DBEA 4BDDA 2YEXA 3VS6A 1OUYA 4BBMA 2FSMX 2R3QA 3HL7A 3QBNA 2C3JA 4DBNA 4F1OA 2ZV2A 3MFTA 5LARA 4GT4A 1LP4A 2UW7A 4D9TA 4QDVA 4CLJA 3MFSA 1GIIA 3LXPA 3WF7A 1J1BA 5HE2A 3ZDUA 1UKHA 5HESA 4UMUA 3OMVA 5J7BA 3DS6A 3K5VA 3C4XA 1Q61A 2P33A 4NT4A 3RHKA 4JJRA 4ZLOA 4DT8A 5FBNC 3RCDA 4QQ5A 5I9XA 3IW7A 2ZYBA 1ZY5A 5A4TA 5LVMA 4LV7A 3W0OA 3OS3A 4GIIA 1T45A 2WQBA 4RJ7A 2XRUA 4F70A 4GK3A 3TIYA 4QMVA 3PA5A 5CF4A 1RE8A 4QMQA 3MY5A 3R7OA 3WYXA 4OTWA 4OTRA 2YLFA 3JVSA 2GFSA 3PWDA 4RVLA 3TMOA 3UOJA 4CEGA 2QLQA 5C01A 4D2VA 3BV2A 4G3DA 2HWPA 5E8UA 1H1QA 5LCJA 4E4LA 3BLQA 2P0CA 3E7OA 2NO3A 1FGKA 4B99A 2ESMA 4D0XA 1OL7A 3EL7A 4IWDA 2JDVA 3AGMA 3EFWA 2QOHA 4F6WA 3W55A 3QQHA 3GOKA 5IF1A 5K0XA 1S9IA 3VN9A 1UNLA 3O50A 3SG8A 2QO9A 2OLCA 3NSZA 2CGUA 5EM5A 3O17A 3QYWA 4USFA 4LMNA 3WF8A 4CNHA 4O82A 3PPJA 2ITPA 3PYYA 4F9AA 4WIHA 2VWUA 1Q62A 1FVVA 2ZAZA 3R0TA 4MAOA 5C8KA 4P4CA 1UNHA 4O0XA 4W9WA 1GZKA 1PY5A 4PDYA 2ZM4A 4FTMA 5BVFA 4M12A 4UX9A 2XALA 1NY3A 3Q53A 1H01A 3FI2A 4D1ZA 4MXYA 4KIQA 2YDIA 4QP3A 3KXGA 4FEQA 4WG4A 3VRZA 2QOBA 4UMRA 4JS8A 1FOTA 4TW9A 4UYAA 3NFGB 2C6OA 3MPMA 3ORXA 1KE9A 4D2SA 4FKRA 4IM0A 2UW3A 4UWYA 4KD1A 4WT6A 3UDBA 1DI8A 5EW8A 3DJ6A 4YTIA 1J7LA 3QTRA 3MA6A 4I6FA 4IC8A 5JGBA 3NLBA 4Y83A 5AP4A 1SVGA 5CX9A 5TOZA 4RZWA 2ONLA 3BYMA 3DK3A 4FTCA 3SRVA 3F5GA 2CLXA 2VTPA 4LUEA 1ZYJA 3QTZA 3VC4A 1DS5A 4IVDA 2C6EA 4DDIA 4LM5A 5CYIA 2JC6A 3GU4A 4LOPA 2BAQA 2JKQA 3I81A 5J79A 4TL0A 1F3MC 2WOTA 5AUUA 2BKKA 3ZMMA 2GPHA 4BWKA 2WMRA 4USDA 1W83A 2FSTX 4EOJA 5FXRA 4HZRA 3ORZA 2BAKA 3ZRMA 4JXFA 4D2TA 4DLIA 3UYTA 4ZZOA 5CSWA 1G5SA 1OIYA 3ZSGA 3LCTA 3ZM4A 4DH5A 5JFVA 5KBRA 2QOCA 2X2MA 4KAOA 5CXZA 2B7AA 3KXNA 3U9NA 4XV2A 1YDRE 3QWJA 1ZOEA 1YDSE 4EQCA 2Z7QA 4NW6A 1BI7A 3UP2A 3EYGA 2HXQA 4BDEA 3LJ2A 4EC9A 5LOHA 2G2HA 3QTIA 4O2PA 3POZA 2WQEA 4KRCA 4WSYA 2QO7A 3PSCA 1P14A 4KKGA 4L68A 5AUTA 2PVMA 2BTSA 3R7YA 4CT1A 4IANA 3HP2A 2UZNA 3E62A 1OBGA 2PHKA 1URCA 5HOAA 3ZBXA 2C47A 2BKZA 3NUYA 3JXWA 4DFXE 4C3PA 3DFCB 4U79A 4ALUA 4ZS4A 2BAJA 4CQEA 4EK8A 3WZEA 4JIAA 2QOIA 2Y6MA 2X7GA 3LFAA 5KUPA 4D58A 4W8EA 3LFSA 4UY9A 5IQDA 2OF2A 3P78A 1UNGA 3VS7A 5IQEA 4ZLYA 4LOOA 5CF5A 5ETAA 4FKPA 4F4PA 4LGGA 3LM0A 3TDWA 4FKTA 5EI8A 3BEGA 3UMWA 4AA0A 4I1ZA 3QHWA 4MYGA 4BCGA 2O8YA 4BHNA 4GIHA 2BDJA 2R2PA 3ZUUA 2Z7RA 3LCOA 2I0YA 3BBWA 4XG7A 2BVAA 4PDSA 1E9HA 3PJ3A 3MB6A 3NGAA 2PVFA 4X2KA 3TIZA 3COHA 3RK9A 4FGRA 3LXNA 3OY1A 3LXLA 4MH7A 5C9CA 4OAVB 3U55A 5DR2A 5AV1A 2C0TA 1Q99A 4YPSA 3MBLA 2C5NA 1MQ4A 5EW9A 4U81A 5HO6A 3EN7A 2UZEA 4GT5A 3ZSIA 3DCVA 4CZTA 5BUEA 3HV5A 3A4OX 4TWPA 4BDCA 4FSZA 3ZO3A 2OFUA 5CU4A 4L8MA 4DHFA 2Y7JA 2YIWA 1YDTE 4Y5QA 4JQ7A 4EH8A 3V5WA 3Q9WA 5BX0A 1H24A 2QHNA 1JWHA 2WEVA 3PJCA 1WBVA 3PXKA 5AP3A 4U8ZA 1RJBA 1CSNA 4E5BA 4KUJA 4FVRA 2VAGA 4DFLA 1ZYLA 4OLIA 4O7VA 2W1ZA 3W2SA 3C7QA 3NRMA 3AQVA 3C50A 3KY2A 4FZAB 2WTCA 4KRDA 2J0IA 4AGCA 3BU6A 3R02A 5HLNA 2WIHA 2I6LA 1YKRA 4YNEA 3E88A 5AJQA 2QOKA 2BDFA 2R9SA 3PJ1A 3R9NA 5JQ8A 2YACA 4QMPA 3CD3A 4TYJA 4L42A 3SC1A 2CKEA 2CCIA 2JIUA 3C4WA 3GQIA 4YTHA 5I9VA 4G9RA 2HW6A 3WILA 4X6RA 2ZOQA 4FVPA 3AOXA 3DK6A 4F09A 5AA9A 3VWAA 2GFCA 2UZDA 3K2LA 2UVYA 4LGHA 3VAPA 1P5EA 4MWIA 3SW7A 2XUUA 1WCCA 3E92A 4MQ1A 2H96A 3VF8A 5HLWA 4XLVA 1CMKE 4EOSA 1VJYA 3QF9A 3F6XA 4EBVA 2FUMA 4FNWA 4YZ9A 4QEBA 4BFMA 3GU7A 5GJGA 1JAMA 3DAEA 3MW1A 2G2IA 4HPUE 5JZNA 2X39A 2V22A 5AR4A 2GCDA 3HKOA 3FHRA 3VUHA 3HV7A 3ITZA 4XV3A 1U5RA 3FMMA 1TQPA 1X8BA 3IK3A 4DHJA 4NTTA 2XJ0A 3GCQA 3HZTA 3P79A 3LXKA 2QKRA 4PPAA 4GU9A 4A4OA 3QZGA 4FG9A 2XJ1A 4JMQA 3V6SA 4C57A 4MD9E 4QYHA 4DFZE 3BLAA 5L6WL 1WBNA 3Q2JA 2OZOA 4M68A 3QRIA 4QMUA 4ZEGA 4BI2A 2VWYA 4J7BA 1PRYA 2BTRA 2ITQA 4A07A 1IA9A 3EFLA 2AQXA 4EL9A 3FC2A 5CF8A 2QODA 3EQFA 4BDAA 4BTFA 4EC8A 3PIZA 4E93A 4YR8A 3OEFX 5IQGA 4I3ZA 3EN5A 4TWCA 4G6LA 5M56A 2CMWA 5FRIA 4FOBA 2JLDA 2Y4IC 3UQGA 1WMKA 3FLQA 4CTCA 5ACKA 2C6LA 4E5AX 5DPVA 1W8CA 4FOCA 1J7IA 4ITHA 4L46A 4EK3A 3N4UA 3TN8A 4DLJA 1XMLA 3F5PA 5IA1A 3DA6A 3QAME 4D4RA 1JKLA 1LUFA 5DT0A 2GU8A 4EKKA 3FYKX 4GG5A 5GNKA 3IOKA 1H26A 5EDPA 1FBNA 5EQEA 1Y6AA 2DWBA 3EJ1A 1GZOA 2HXLA 4R6VA 2VZ6A 2PMOX 3PLSA 2ETKA 3L1SA 3Q6UA 4XHKB 4I20A 4BICA 2H6DA 5IISA 1ZZLA 3MA3A 3F82A 5D9HA 4HVHA 4DFUA 1KE5A 3CJFA 3EYHA 3TTIA 4YZDA 1QPJA 3NAYA 3ANRA 3OT3A 4FNYA 1M14A 1MP8A 3ELJA 3V5JA 3U6JA 4IX4A 1G8AA 5HG9A 2YCFA 4LYNA 3PG3A 3RWQA 1XQZA 3S3IA 3ZZEA 5FEEA 3G33A 4NTSA 3W10A 3S4QA 5EOLA 5KKRC 4U6RA 3HMOA 3DKFA 3R22A 5HCYA 3CQEA 3F3WA 4J8MA 4X7QA 4CFFA 5HU9A 3ENHA 2ZMCA 3I79A 3MI9A 4AN2A 4YU2A 1LPUA 4EZ5A 3C4EA 3FMNA 4EOIA 3UPZA 3O8TA 5G1XA 3N9XA 2C3IB 2A27A 3HP5A 5BVDA 5AV0A 3IECA 5CT0A 2UZLA 2Y9QA 2VD5A 3BLRA 2HYYA 2J5FA 2W99B 4FC0A 4I22A 4D4VA 3PDTA 3NMUF 5HD7A 2WMSA 4GU6A 3RBWA 1PXKA 3FLSA 4BHZA 3KCFA 4EOOA 4BR3A 4KINA 4YJUA 5KMKA 4RLLA 3HUCA 3D5WA 4ACMA 4EZ7A 1YI4A 5F1ZA 3UTOA 3WF9A 4OW8A 3TDVA 1H1RA 4NU1A 4TTHB 1G8KA 3IKAA 3ZXTA 5HG7A 1JKSA 3F3VA 4F7SA 5E4HA 1YOJA 4O84A 3N4TA 1MRYA 4DG3E 2CNQA 2IJMA 3LMHA 2I0VA 3KRRA 4CFMA 2YM8A 2EVAA 3RI1A 4K18A 5HX8A 4YZBA 3H4JA 1OPJA 1WBWA 4U45A 1YVJA 3RAHA 3SW4A 3BYUA 2HY81 2E9PA 3ZYAA 2NRYA 4XG9A 5IH5A 4FBXA 5K3YA 3UQFA 4U97A 2C6MA 2CJMA 3ENMA 2WAJA 4ZSLA 3THBA 4CVAA 4BRXA 3E63A 4DITA 2J0KA 2OFVA 4IW0A 4WBBB 5G6VA 4KIKA 5AWMA 5AV4A 3D5VA 4FV2A 1PXIA 3F69A 3AMBA 3TXOA 1YI3A 2XMYA 1Q5KA 4MXCA 1PKDA 2RG6A 3LCSA 4FTNA 4L67A 5HKMA 2XEZA 4FICA 4LFIA 4KBKA 2Y4PA 4PMSA 4MBIA 4PWNA 4EWQA 3OXIA 4LRJA 3EN4A 5K5XA 4WSQA 4NK9A 3DT1A 3CLYA 4FV1A 5HIEA 3FSFA 4L6QA 3KN5A 5AR3A 4RZVA 4AOJA 4CFUA 4RPVA 5A4CA 4F0FA 2J7TA 1SMHA 3JPVA 5HZNA 5DIAA 2QR8A 4IZ7A 4R78A 3V8SA 3HMNA 4RWLA 4U40A 3AC5A 4YJOA 5ETCA 4P90A 3LFFA 3LFEA 4L43A 2VNYA 3UOHA 3FHIA 4YNOA 2I1MA 1ERKA 3ZH8A 2B52A 4OGRA 3RVGA 2HIWA 4Q5HA 2V0DA 1PMUA 5HNBA 5FLFA 5HGIA 5J95A 1H08A 5H8GA 3WF5A 3ID6C 2XAMA 5KMMA 3BHTA 4N0SA 3GC7A 3VUMA 1LEWA 3DAKA 3RGFA 3ALOA 1DM2A 4KIOA 5KMJA 4CFNA 5IDNA 4G31A 5H8EA 5AUYA 2XNPA 2GNJA 4FKLA 2ZB1A 4FTJA 3GUBA 4XMOA 5A3XA 4KKEA 2JAMA 2WPAA 2UVZA 5HHWA 4YSMA 3P7AA 4UMTA 3NW6A 5IKWA 3R7EA 1NVSA 3QQFA 3W32A 5DEWA 5IEYA 3FBVA 4KIKB 4HYHA 3W8LA 3NCGA 3O0GA 2ZM3A 3JYAA 4DYMA 2J6MA 3RNYA 3E87A 4DH7A 2CKOA 4IAFA 3D15A 2QOLA 4JAIA 2IVSA 3R1QA 4YZMA 4RJ6A 3LIJA 5J9YA 3H30A 3AD5A 2CN8A 1Q24A 3CTJA 3I4BA 3OCTA 3W2RA 4ZSEA 4PQNA 1M7QA 4YO4A 4AQKA 2W17A 3DOGA 3ERKA 3G5DA 3KVWA 1OGUA