5TOZA

Jak3 with covalent inhibitor pf-06651600
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
286
structure length
278
Chain Sequence
TIFEERHLKYISQLGKGNFGSVELCRYDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGSLRLVMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESEAHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYELFTYCDKSCSPSAEFLRMMDVPALSRLLELLEEGQRLPAPPACPAEVHELMKLCWAPSPQDRPSFSALGPQLDMLWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK3
publication title Discovery of a JAK3-Selective Inhibitor: Functional Differentiation of JAK3-Selective Inhibition over pan-JAK or JAK1-Selective Inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 278
sequence length 286
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2016-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5tozA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5tozA01
2YIRA 5LJJA 2REIA 3QXOA 4MAOA 4E6AA 3CGOA 1OL5A 4FVPA 1PMUA 4KAOA 4FMQA 2HWPA 2YCRA 3HRFA 4F09A 5CF5A 4D55A 3NW5A 5C9CA 5KMKA 3SXRA 1M2PA 3D7ZA 1BMKA 4FZAB 3NW6A 4MQ1A 4PP9A 4RFYA 4UWYA 4L7SA 5FXQA 3QCSA 4DF3A 4LOOA 3RK7A 5CSHA 3F7WA 1M7QA 3GENA 1YI4A 4FSRA 1UU8A 3QUDA 4PNIA 5EI2A 4E73A 5A14A 2VWVA 4I41A 3RAKA 5EDRA 4HVSA 3ORXA 2QO7A 4W4YA 4EK4A 1WFCA 5KBRA 4E4XA 3EN9A 2YDIA 5AWMA 4M67A 4OTQA 4G6NA 2H8HA 4QP2A 5AM7A 1OB3A 1RQQA 3F2RA 4Q9SA 2X2LA 3SC1A 2W5BA 5KX8A 1OIQA 3ZDUA 3AG9A 3RCDA 4U41A 5CAUA 2ONLC 3VUIA 5CWZA 2PMLX 2V7AA 4JXFA 4AG8A 2CGWA 4D5HA 2QQ7A 4C4FA 4EHGA 3OG7A 3O7LD 3VAPA 4AAAA 4WSYA 1OIYA 2XYUA 2WFYA 3C0HA 5M51A 5H8BA 3SVVA 2W1CA 3RM6A 5EKOA 4NZWB 3H10A 2XM9A 4HVDA 3FKLA 5JEBA 4C3RA 3V5PA 1QPCA 4H58A 5IA4A 4EQMA 2XCHA 3GOKA 4GYIA 3LFSA 5HCXA 3V6RA 4R5YA 3KRRA 3MA3A 2ETRA 4UXLA 3TN8A 2C3JA 2ESMA 2VTQA 2XK6A 4QTAA 3TTJA 1BL6A 5AM6A 2QHNA 2R3OA 5E8XA 2I0HA 3UIMA 1PMEA 4FA2A 5FQDC 4CYJA 3SOAA 3IDBA 3ORTA 4IMYA 4CKRA 4M0ZA 4EQCA 3DB6A 3P7BA 4C58A 4OBPA 4F7NA 4G3GA 4DEDA 2WOTA 3EN5A 3A61A 4AGUA 2HELA 3QGWA 3AD6A 2QOFA 3QU0A 1YHSA 1Y8GA 2JEDA 4IANA 5KNJA 4FZ7A 3V01A 4O27B 3R8ZA 2JDSA 4DA5A 3Q5IA 5IMXA 4FSMA 3MVHA 4RJ3A 3BQCA 4TZRA 4XBRA 3PJ8A 4QMSA 3ZSGA 5FP5A 4HGLA 3VNTA 2EXCX 2C5YA 4C4IA 4ACHA 5BVNA 1XBCA 5KMLA 3ZDIA 3RPOA 2CNVA 2CGVA 3BBWA 5E1SA 1GY3A 5KBQA 1V1KA 3SAYA 1ZAOA 4FTNA 5FD2A 3ZUTA 4C59A 3NUUA 3HUBA 3D7TB 4K77A 3HGKA 1KOAA 2ZV9A 3VRZA 4A06A 4EYJA 4F6UA 3Q6UA 5A46A 4XH6A 5LVLA 5CEKA 2F7ZE 3PXZA 2CKOA 4MF0A 3MFSA 2PE1A 1IASA 3GXLA 3EN4A 5LMBA 5AP2A 3V8TA 4M66A 2R3QA 1B38A 1OGUA 4D1SA 4Q5EA 3ZSIA 4EZ3A 3RAIA 1PW2A 3K5VA 2XJ0A 4EK6A 4Z3VA 4WIHA 5CF6A 2BRHA 3UIBA 4O0WA 3Q4ZA 3FMMA 3AC8A 3I1AA 3CY3A 1FMKA 4QYYA 3WZJA 3NSZA 2W1DA 5E90A 4L9IA 4FTJA 2GQGA 1Q97A 2CKPA 2E9UA 1H28A 4X2GA 3FYJX 2WTVA 3PTGA 3NEWA 3ORPA 1SNXA 2DYLA 4O7YA 4QP6A 3FC2A 5CTPA 3D0EA 2J0KA 2C6MA 3ERKA 4QPSA 3EL8A 4ARKA 2O63A 2OFVA 3MDYA 2C0OA 2WPAA 4AT4A 4D4RA 4WKQA 4R77A 2BALA 1JOWB 3BRBA 1W0XC 4C36A 2UW9A 5IA5A 5A4TA 3HX4A 5F94A 4YPDA 4LFIA 3NCZA 1GJOA 2UW4A 3I0OA 5HBEA 3LMGA 2I7QA 4R8QA 5D41A 4CEGA 2RFSA 3UG2A 3E5AA 3RWPA 4BRXA 4S2ZA 2FSTX 1ZARA 5IF1A 2WOUA 4USEA 3TL8A 5CAVA 5E7RA 3BGZA 4EOSA 2ZDTA 2IPXA 3ROYA 5IA1A 4O0UA 2B53A 5FGKA 2RG6A 3KULB 3FZTA 4CRLA 5EHOA 3H9FA 1H26A 3ZO4A 4XOZA 4BDIA 3DBFA 2IN6A 4BCIA 2QOKA 4FSUA 1J1CA 4TW9A 1SVGA 2BTSA 4AZEA 4F9WA 1Q62A 3O8UA 4NL0A 4PDPA 3R8UA 4BZOA 3VJNA 4CXAA 4D2WA 5CS6A 3D14A 3MVLA 5HX8A 4X3FC 5T3QA 3QRTA 3HLLA 4QMOA 2VTNA 4V05A 1OVEA 3NYNA 4QPAA 3COMA 5J9LA 1OIUA 2BDJA 3COIA 4K0YA 4X2FA 2XNEA 4W8DA 2UZUE 5G6VA 4LMUA 4ZSAA 4TYHB 3RHKA 5E8SA 5IDNA 4R7BA 4NH1A 2NNWB 1X8BA 4QP8A 4FV2A 1XQZA 3BLHA 2XIXA 1IG1A 5DEWA 2P4IA 3Q4CA 4YJVA 3Q6WA 3Q9YA 2ITWA 5L6WL 2J51A 2PZ5A 3LFEA 5JKGA 2F49A 5L2IA 3DPKA 3I0QA 4NJ3A 2PL0A 5HCZA 3MA6A 3SD0A 4ZJJA 5JSMA 3OEFX 4PRJA 4FSNA 4ZK5A 3UMWA 4HVHA 5IQCA 1GIIA 2VTIA 4DFLA 3UBDA 4EH8A 5HTIA 3Q5ZA 3AC3A 4XUFA 5CF4A 4FNZA 4NU1A 2JAVA 3PP1A 4ZZMA 4CZYB 4EK8A 4JJRA 4DYMA 3C4FA 2F9GA 1PXPA 3KQ7A 1URCA 1YXVA 5I9XA 4YUQA 2H96A 5I9VA 4GIIA 1Y6BA 3PVGA 2C3LA 2PMIA 3VBQA 3G90X 3QKMA 4XG9A 5F9EA 4Y5QA 3OF0A 1O6KA 4FV8A 4DGOA 2CKQA 2VTJA 1VYZA 2FSMX 4XLIA 5ACBC 3E62A 1ZYCA 2WMBA 3DKCA 3IW8A 2O64A 2ZB0A 4ZZOA 4H05A 1OM1A 4QTCA 5CI7A 2B0QA 3QTWA 4FT5A 4ZMFA 3EYHA 4FV9A 4ZLYA 2FO0A 3MY5A 2OZOA 3LFAA 4FG7A 5EQPA 1PXOA 3OCTA 2W1IA 2G2HA 4IB5A 3W1FA 4CNHA 4ZTRA 2PTKA 5IA2A 3EQGA 4QTBA 5EH0A 1ZOHA 2WAJA 2QKRA 3IGGA 5T68A 3DY7A 3HZTA 2ZAZA 4GW8A 2XNMA 2XK3A 3MV5A 3Q9ZA 5DHJA 4BGQA 2X6DA 3LXKA 3BU5A 4L46A 4FIEA 3DXQA 3UPZA 3E87A 3FQHA 2PZPA 4IZAA 2E9NA 5HLWA 3UO5A 4AFJA 4E3CA 4YJPA 5DRDA 3UQGA 4I21A 4U97A 5IMEA 5EG3A 3LPBA 4V0GB 4CTBA 2WQNA 4M8TA 3W2OA 5D12A 4DAWA 2W17A 4YPSA 3U4UA 2B7AA 3VHKA 4H39A 4IAYA 4D2PA 2BROA 4AP7A 4BTMA 4DEIA 5K4JA 1Q4LA 4PDSA 3WZUA 2OICA 4WRSA 3M11A 4JAJA 4FV6A 1PYEA 2R3HA 4YJNA 3EIDA 1TVOA 2R7IA 2EVAA 2VAGA 5AP4A 4BKYA 2EXMA 2VN9A 3NCGA 4O0VA 3DJ6A 3P23A 4IWOA 1XBAA 4M69B 3O8TA 1M2RA 3KRWA 3PYYA 2I1MA 3D5VA 1REKA 4CZTA 5JFSA 5AP7A 3AD5A 2WIPA 4LM5A 2W4KA 3R9OA 2BDFA 2YJSA 3LM5A 3RK5A 3R8MA 2YN8A 3TKHA 5CENA 4D9UA 3OXTA 4PMTA 3QX2A 2UW6A 3IKAA 3KKVA 3QX4A 4F7JA 3DOGA 4IIRA 4IXPA 4AGWA 1H1WA 2PE0A 4ZTSA 1G5SA 5HD4A 2YM4A 4F9AA 3KK8A 2DS1A 1XBBA 5FDXA 4KRCA 5F4NA 3BYOA 4ZY5A 3UGCA 2YM7A 4FI1A 4L44A 1S9JA 4KRDA 3C4XA 2BAKA 3GNIB 5L8LA 3S3IA 3L8SA 2PMNX 5EM5A 1ZZ2A 4JDKA 3T9TA 5BQ0A 2KTYA 2Q0NA 1S9IA 3UTOA 4OTDA 4BB4A 4B8LA 4LUEA 3CLYA 4MD8E 4UWBA 1NY3A 3LLAA 2BMCA 2XIRA 4IM3A 4DCAA 5M06A 4LV5A 2P33A 3GC7A 1YHWA 4NM3A 5EQYA 4BCPA 3NYOA 5CT0A 5M57A 4N57A 4FV3A 4YJUA 4MBJA 3KVXA 1PJKA 4EC8A 3QTQA 3TI1A 4EONA 2HOGA 3NUPA 4J97A 2CGXA 4RQKA 4S33A 4ZEGA 2UW7A 4FZFB 5BNJA 4RVTA 2BR1A 2XIZA 3NVKI 2YZLA 4PDOA 2YCQA 4BBEA 2A2AA 1VJYA 3IW5A 4P5ZA 2BIKB 4RA4A 3GGFA 3CP9A 1OL2A 5HX6A 2ZV8A 2UZTA 5H9BA 3V8SA 3FMDA 4G3CA 3PA5A 2OLCA 4FYNA 3C0IA 2BFXA 5HE2A 5FEQA 2V5QA 1UU7A 2IZRA 1H4LA 4ZTNA 3W18A 3W2QA 5EI6A 3EYGA 3PSDA 4AQCA 4U5JA 2C6EA 3UG1A 1UNGA 4DH1A 1ZYSA 2VO0A 3WF8A 4W9XA 2RSVA 4QP7A 5BUEA 4FK6A 3F3UA 2C5VA 3NNXA 3LAUA 3QRKA 2ERZE 4U7ZA 3GFWA 4NIFB 2YHVA 4I5MA 4NYEA 5M4UA 2JDVA 2UZWE 3FLZA 4FODA 4XG3A 2QLUA 3N51A 4FNYA 4H3BA 3H30A 1Q8WA 1REJA 2YABA 2GHMA 4QNAA 3U8WA 3WILA 5IZFA 3D7TA 4UY9A 1H08A 2NO3A 4BDHA 3ZS5A 5AAGA 3Q60A 4IDVA 4MHAA 3QYZA 3C7QA 5LARA 4QMYA 4J71A 2PHKA 3NIZA 4KBKA 3W8QA 4DEAA 4LUDA 5HIDA 1TQIA 3LQ8A 5LVPA 3VBVA 3QALE 5CQWA 3DCVA 4IWQA 3R71A 4HPTE 3OCGA 1IRKA 1Q41A 2YCFA 3KU2A 3VQHA 4TXCA 2W9ZB 4OBOA 4WUNA 1ZRZA 2VWWA 4F0GA 2VX1A 3IGOA 4CKJA 3Q2JA 3RMFA 4FZDB 4BCKA 3VF8A 5GJFA 2AC5A 1WMKA 3T8OA 3VUKA 3MB7A 4CV9A 4ITIA 4M68A 3A7FA 3TCPA 3TIZA 3MPAA 1DAWA 5LWMA 2R3FA 1UNHA 3JY0A 5D7VA 3W55A 1CDKA 1FVVA 2C0TA 3F2AA 3I79A 1FVRA 3MY0A 2UVYA 2C3IB 2V22A 3R04A 3KY2A 4Q2AA 4OTWA 2OIQA 3H3CA 2HY81 3PWYA 3DKFA 2VTOA 4G5PA 3WOWA 4GK4A 2OXYA 5C26A 2PVHA 3ZHPC 4O7NA 4IE9A 2X81A 5IEVA 4D58A 4DLIA 4XEYA 4V01A 4CG9A 5DGZA 4BL1A 4ANSA 2UW5A 5ANKA 2O0UA 4FICA 2YCSA 4YR8A 1U54A 4FTUA 4L01A 4GT3A 5B2MA 1EH4A 5E9EA 4J98A 2YLFA 1KE5A 3BHYA 5GINE 3LE6A 1PKGA 1O6LA 4X0MA 3V6SA 3EHAA 4BHNA 4PF4A 3PY0A 3ATTA 4TNDA 5HG7A 1V0OA 2P3GX 4E6DA 4FIFA 4JVGA 4WBBB 4C0TA 4M0YA 4E93A 3R30A 3G6GA 2GTMA 3Q9WA 3U9NA 4G1WA 5AX3A 4C3FA 3FY0A 1ZYDA 3U6JA 5K5NA 1JBPE 4BI0A 2CLQA 5H8GA 2C5XA 4FSTA 5IISA 4QP9A 2BKKA 2GS7A 4BTKA 2HK5A 1PXJA 4EKKA 4YLJA 4C62A 2HXQA 4M14A 5CSPA 5AUWA 3CS9A 3GU8A 3MFUA 4PPCA 2EXEA 1A9UA 3RAWA 4B6LA 4BF2A 4DT9A 4D4YA 4JDJA 3TV7A 2E9VA 2QCSA 4YLLA 4EBWA 3FKOA 1WBPA 1H0VA 4RIWA 4JX3A 5J79A 3QGYA 3ZUUA 3BHVA 3WIGA 4O81A 3BV3A 2RIOA 3TT0A 1JWHA 3KMUA 3OWLA 3PJCA 4IADA 3IO7A 3NUSA 4IVDA 4XLVA 4B0GA 4F1OA 1Y91A 4CYIA 3PRFA 4RX8A 3HV3A 4MK0A 4I4FA 3UO4A 2PY3A 3VJOA 1DM2A 5J5TA 4RFZA 1W82A 3R28A 5EW3A 3OCBA 5KMNA 1OMWA 4EWHA 3GUBA 1KE9A 5DEYA 3TV4A 3E92A 4J99A 5CU2A 4GFGA 4NTSA 4XS2A 2BAJA 4KWPA 4ID7A 3MTLA 1Q99A 3AMBA 4S32A 4W8EA 3QYWA 3PZHA 4K1BA 3V04A 4O96A 1YWVA 4WA9A 3DLSA 1MRYA 1ERKA 1WBNA 4RVLA 4L8MA 3AQVA 3ANQA 4IVCA 2J0MB 4X3JA 4EJNA 1R3CA 3KRXA 3ITZA 1P4FA 3OUKA 2RGPA 3CQUA 5K4IA 2CNUA 3LMHA 1OIRA 1PKDA 3CE3A 2WIHA 4RIXB 4C37A 2XYNA 3BYVA 3NNVA 5J8IA 3SX9A 2JFMA 3C1XA 3BI6A 2IW9A 3EFLA 5JK3A 5K0KA 3I4BA 4YZCA 3C5UA 5AP0A 4RZWA 3NRMA 5EOLA 3RM7A 2YM8A 5CU0A 4R1YA 2BFYA 4F65A 4DE4A 3C5IA 3DDPA 4FNWA 4XBUA 5K3YA 2B52A 4HYHA 2O3PA 2FGIA 3F9NA 4F7SA 4FE2A 4H1JA 3ZUVA 5AADA 4C35A 4Z9LA 4U6RA 4DGNA 4GEOA 4YTCA 3FKNA 5JFWA 1FGKA 2X8DA 4MXXA 1H1PA 1OECA 1UNLA 3AMYA 3E8DA 3CJFA 2QO9A 3EN7A 3OTUA 4EOLA 2ITZA 5CU6A 1BUHA 3BHUA 1UWHA 4C34A 1E1XA 3FUPA 3O50A 5ANDA 4ANLA 4V0GA 4A9YA 1HOWA 1Y6AA 5EM8A 3WYXA 3MH3A 2WTCA 5DVRA 3R8VA 3SOCA 3L9NA 3EKKA 3PY1A 4UMPA 2ZM3A 4EQUA 1JSTA 2YLEA 3CQWA 2XIYA 3LLTA 4DFNA 2QODA 4XG4A 4A9TA 4IZ5A 3OW4A 3LIJA 2Y4PA 3L8PA 5HVYA 4P90A 4F9BA 1IR3A 5EM6A 5FUTA 1YDRE 2BAQA 3C4EA 5EOBA 1WAKA 5AR5A 5HTCA 5EQEA 3PIZA 3TZMA 5JZJA 3GU5A 4AW0A 4IACA 3SG8A 1P4OA 3QQLA 3RZBA 4TL0A 4Z7HA 3P79A 4XV2A 3NPCA 2NRUA 5DFPA 3QD3A 4AOJA 3LCOA 4RJ4A 5A4CA 3E7VA 2OXXA 2ZVAA 3RGFA 5FEEA 4K2RA 4EH2A 2PVLA 5C1QB 2UZDA 3C4CA 4S31A 2W0JA 3C50A 3T9IA 5FBNC 3HYHA 1H27A 4YJQA 3E3BX 3T3VA 5M56A 3W33A 3ZFYA 4BBFA 5EDPA 3KMWA 4DH3A 4OGRA 3Q52A 4FIIA 3FMJA 4FKRA 4MNFA 3UOHA 4ONAA 4U0IA 4FSQA 4QQCA 5CNNA 5LCKA 2Y4IB 4KBAA 2BKZA 1L8TA 4APCA 4UMTA 4JR3A 1KUTA 2BHEA 2XMYA 3CY2A 4QYHA 4C02A 3HMMA 1JVPP 3BYSA 2CPKE 2B9IA 5AIKA 2C6DA 5IQGA 2OF2A 1LR4A 1JKSA 2NRYA 4C8BA 1YRPA 4KA3A 3R7EA 5LCJA 4L45A 5BVOA 4Y85A 3A8WA 1IA8A 3HECA 2GNIA 2BVAA 5FTOA 4YSMA 5D1JA 5DIAA 5HU3A 2R3GA 2ITUA 2XNGA 2BZHB 1U4DA 1UKHA 3Q32A 3R8LA 2X4FA 2OJGA 4F9CA 3P86A 2VTSA 4V04A 4WBOA 4R7IA 5DG5A 2XK7A 3SRVA 5HG5A 5CAOA 3UYTA 4NCTA 2X2KA 5JMSA 4HPUE 4AGCA 2JKMA 3R21A 3CXWA 3RPYA 3GC9A 3R7OA 3LFBA 2GTNA 2DQ7X 3G5DA 3PXRA 2YERA 4U42A 5ANEA 3SV0A 3VO3A 2ZV2A 1KV2A 1MP8A 3AGMA 3PRIA 3UVPA 5DE2A 1Z9XA 3GFEA 4RMZA 1YWRA 3QWKA 4KS7A 4IAAA 4CTCA 4D1XA 4HNIA 5IQHA 3B2WA 4BKJA 2R3JA 3ALNA 4NCTC 4CD0A 1QL6A 3QA8A 4IW0A 4JQ8A 1SNUA 4QYEA 5E8ZA 4BCHA 1YOJA 4GFOA 1OKZA 4JG7A 3EWHA 3MYGA 5KMMA 5LMKC 2ONLA 2WMAA 3PWDA 3WE8A 3ZLSA 5FEDA 3PLAE 4YJRA 3VQUA 3KRLA 2P2HA 2PK9A 5AIRA 4XMOA 1BYGA 3VBYA 5A4LA 5LVNA 2X7FA 4YC3A 2ITOA 3DT1A 4OW8A 3BYUA 2VTLA 4XOYA 4WNMA 1YOMA 3POOA 3PJ1A 1NXKA 3C4ZA 3FI4A 3ENMA 3FLWA 4RRVA 4WSQA 5BUIA 3W2PA 2GU8A 4DGLC 5L8KA 2JDRA 2CCIA 5AUVA 2Z8CA 3BEGA 4FK3A 4IM0A 4CMTA 2YM6A 2AYPA 2UV2A 4FOCA 3D5UA 3FSKA 3F3WA 3ORIA 4R3RA 2HZ4A 4DFUA 3VIDA 4HVGA 5ANGA 4Y73A 4IX5A 4U81A 3NZ0A 1OKWA 4BCMA 5BMSA 4I6BA 3FL4A 3VS6A 4C33A 2E2BA 2XRUA 3ENHA 4HYSA 5J1WA 2JLDA 3WZKA 3ZM9A 4OBQA 2JC6A 3R7YA 4R1VA 4TYGA 2FA2A 4DTKA 4KIQA 4UZDA 5FLFA 4ZTLA 1KWPA 2YM3A 4O83A 5KZ0A 2OBJA 1OBDA 2H6DA 4DT8A 2OKRA 2BCJA 4O86A 1P14A 3OT3A 3R63A 4NM5A 3ZTXA 1BX6A 3JPVA 3TV6A 4BCJA 5LVOA 4AZWA 1Q5KA 3HKOA 1H00A 2JBOA 2XK9A 3GVUA 4I6HA 4E4NA 2IVUA 3UIUA 4Z7GA 3FI2A 1TQPA 5L2QA 3VS7A 4FT0A 4GFMA 4DH7A 3UOKA 5DI1A 2VV9A 2B55A 1PXLA 4BC6A 5M4FA 1P5EA 5HLPA 2HW7A 5DR2A 1Q8YA 2XKCA 3BPRA 1MRUA 4B99A 3NNWA 2XZSA 3NGAA 3FHRA 3OBJA 4NW5A 5HI2A 3UZRA 4AZFA 2VTAA 3R7GA 2X8EA 2XS0A 2GMXA 4L67A 4RWLA 4ZS0A 5B2KA 3OT8A 4TT7A 5HO6A 4C4GA 3ZLXA 3HDNA 4O6LA 2CNQA 5BYLA 3QFVA 3DXPA 4U80A 5DN3A 2C5OA 2JGZA 4RJ5A 4QOXA 2HCKA 3TWJA 4PMPA 2I0EA 3JY9A 4JBVA 3O71A 3QTUA 3CBLA 4USFA 5DR6A 4DTBA 4GSBA 3DNEA 4JOAA 1RDQE 1XH7A 2FVDA 2VGOA 3GU4A 4EBVA 2C5NA 1ND4A 3PIXA 3PXKA 4PWNA 3Q96A 3M42A 5EDQA 3V5WA 2R64A 4RWKA 2R3NA 5T6KA 3TG1A 3AMAA 3AOXA 3O51A 2QO2A 4H3QA 5HGIA 4O2ZA 3UPXA 4EK5A 1M52A 4ACDA 2PUPA 2Y6OA 5IQDA 3FJQE 1Q8UA 3LCTA 4Y5HA 2JAMA 4TRLA 5ETCA 5IQEA 1BI8A 4MYGA 2ZM1A 2FUMA 5DR9A 3KCKA 2XNOA 5E1EA 5HO8A 3QCQA 5GZ8A 4DINA 3UC4A 5CANA 4UB7A 1WZYA 3BX5A 3LOKA 3CSVA 4QQ5A 3W10A 3HDMA 5J9YA 3OS3A 3FAAA 4F6WA 4A4XA 1IAJA 1KE6A 2OSCA 3CTQA 4ZTHA 4A7CA 2G01A 1YXTA 5D9HA 4ALVA 4C4JA 5C4LA 4QQTA 5AV0A 2R3IA 1F3MC 3O23A 2WQBA 3KXHA 4D1ZA 4AOTA 3HV7A 3IQ7A 2WB8A 2B9FA 4K18A 1L3RE 4X3FA 3ODYX 2OJFE 2PUUA 3MPMA 3BLQA 4DGGA 4R7HA 4F63A 3QTSA 2OZAA 3WF6A 4HVIA 2CN5A 3FY2A 4WG3A 1W8CA 2GNJA 4GG7A 3VS1A 1XH4A 3DTCA 3F66A 4RX7A 3V5QA 3VF9A 3LFFA 4NK9A 4FL1A 2Y6MA 4NFNA 4H1MA 1RW8A 4FTTA 1NVQA 3CJGA 2Y9QA 4FEXA 3E8NA 4QP3A 4K6ZA 5H8EA 4YHJA 3OUNB 4BDEA 5HD7A 3P0MA 3IONA 4ZSJA 4BWXA 2UZVA 2VGPA 4IZ7A 2XIKA 4FKLA 2YEXA 3DK7A 3IW6A 4NUSA 3FMNA 1LEZA 3EFWA 4O0TA 2DUVA 4OTGA 3E3PA 3UQFA 2HY0A 3UZPA 3R9NA 3ORZA 3ZLWA 1MQ4A 3F7ZA 4AACA 4GG5A 2QONA 3EQFA 3UIXA 2O8YA 3MH2A 4OTPA 3HV5A 4EZ7A 5HHWA 4IZYA 2VD5A 2XCKA 3CD8A 3FC1X 4KB8A 5IPJA 5IEXA 5AR7A 3BGQA 3TJDA 4EH4A 2OIDA 3ZMMA 3I6WA 3NIEA 4BTFA 4O84A 4OTIA 3ORMA 1CSNA 3ORKA 3BYMA 2IVVA 3GCUA 3RINA 3ZONA 1GOLA 2UZEA 5CSVA 2YM5A 3FV8A 4YJTA 4YZMA 1XJDA 4MVFA 4QTEA 2Q0BA 4PP7A 4TY1A 3PVWA 2VWBA 4PMMA 4XNEA 4U3ZA 4FKUA 5JQ5A 3F88A 3G6HA 5B7VA 2GHLA 1OL6A 2PU8A 4QYGA 5J95A 2WO6A 5AJQA 3D83A 4A07A 4K33A 3LXLA 4PL3A 4D2VA 4TWNA 5HORA 1PY5A 1J7IA 3DNDA 4UBAA 2GCDA 3GQLA 2IW6A 4FIGA 4QMXA 1VR2A 2Z7LA 5CEIA 4I94A 4NW6A 4U43A 4I5HA 3ZO2A 1RE8A 3P9JA 4RJ7A 5A3XA 1QPEA 3M2WA 4YO4A 3I6UA 3B8RA 1Q8TA 1QPDA 4TN6A 4AW1A 3DGKA 4YGAA 3LJ0A 3AC2A 3PG3A 2OFUA 5IUIA 1GZOA 2B54A 2F7XE 4EOJA 3I7BA 3EJ1A 3OCSA 3TTIA 3UODA 5AR2A 4BVUA 2I0YA 3KN5A 5AUYA 5L2TA 3QZGA 4XHKB 5BPYA 2X8IA 1J1BA 3O2MA 1CTPE 4G6LA 2HAKA 3HUCA 4S34A 3QAME 5FTQA 4PDYA 4A9RA 1IAHA 3SW7A 4BR3A 4YZ9A 3VUMA 4CFUA 3PXQA 3LQ3A 3IDCA 3L9LA 1ZOEA 5CSXA 2Y4IC 3FPMA 4GVAA 2XJ1A 2G2FA 3FE3A 4A9UA 4AOIA 2WTJA 2AUHA 5CYIA 3DB8A 4JRVA 5A4QA 1YVJA 5AP1A 2UZNA 3VW6A 4EJ7A 3NNUA 4JT3A 4HZRA 4I22A 1E9HA 3WF5A 4BFMA 4LL5A 1NT2A 4MCVA 1ZYJA 3BE2A 3ORNA 1KE7A 1WCCA 5IU2A 2C4GA 4MXCA 3NYVA 3QQFA 5AUUA 2X1NA 3SKCA 3TZ7A 4DEHA 4PL4A 4UMQA 4YSJA 4IC8A 2F57A 4JDHA 4P2KA 3EQHA 3CC6A 4UWCA 4GK2A 3P1AA 3UZTA 3EZVA 5BVKA 3U6HA 2VO6A 1WBTA 4EH6A 5KCVA 1YXSA 3DLZA 5AAFA 4RC4A 3RWQA 3K3JA 3BHHA 2ERKA 2ETKA 4IX3A 4O82A 3FZRA 4RIYB 4WOVA 3AC5A 4DG2E 4YNEA 3C51A 4WG4A 4YTFA 2BUJA 4TTHB 1YDSE 4H36A 3KRJA 4WO5A 4CSVA 3LFCA 4GCJA 5TR6A 3JVRA 4DCEA 3A7HA 4GT4A 4JQEA 5CSWA 2YZAA 3ULZA 3ZZWA 4HW7A 5JH6A 4AUAA 3Q4TA 4BKZA 3L9MA 4FL2A 1T45A 1STCE 2WTDA 2HZIA 1I44A 1B6CB 3F5PA 3PA3A 1GZ8A 3A2CA 5GHVA 3ATSA 1FPUA 4J8MA 2WEVA 1ZMVA 3CKWA 5AV3A 5FDPA 1J7UA 4EOPA 4AFEA 3CPBA 4C2WA 2PZYA 2JD5A 4FV0A 5DLSA 4EH9A 4CGAA 4CMOA 2PVKA 2JKOA 3OOMA 4L68A 3PLSA 3BGPA 1P2AA 2CGUA 3E8CA 4I23A 5HE3A 3UYSA 5DPVA 3TNPC 4C4HA 5HIEA 3MIYA 5ACKA 1H0WA 5AP3A 3KGAA 4AN3A 3HVCA 3KN6A 2CHLA 3MH0A 3WBLA 4RJ8A 2WQEA 1KV1A 2CN8A 2VWZA 4K11A 5CNOA 5CEQA 4D0WA 3AXWA 2JIIA 3PXFA 3VBWA 1I09A 5GIPE 4BCFA 3TUBA 4GUEA 4F0IA 1TQMA 3V5TA 2X9FA 3ZEWA 4O7SA 1YDTE 5FBOA 2YWVA 4HCTA 4BIBA 4EWQA 4AA5A 4JIAA 4XP3A 4DFXE 2XH5A 5EFQA 3ZXZA 1KOBA 2I6LA 4HOKA 4AN2A 4BDDA 1SM2A 2XF0A 5CU3A 4FVRA 2BDWA 4WHZA 3UOLA 4II5A 1PYXA 2VWXA 3FMEA 3A7JA 4RT7A 1URWA 4XX9A 5DRBA 5TF9A 3L8VA 4U45A 3MB6A 4BCGA 2C47A 2OI4X 3MW1A 4NSTA 2XP2A 4Z16A 4JLCA 4FF8A 5K5XA 1CM8A 4GH2A 2UVXA 2QNJA 3QC9A 3LJ1A 2GS6A 2QI8A 3NW7A 1UWJA 4BBMA 4FKWA 4TYJA 5FM2A 5FTGA 5GIOE 4DTAA 3A60A 3OZ6A 2WMQA 4M84A 3L1SA 2RFDA 4LGGA 4U8ZA 2YIXA 5HEZA 4RX9A 4ZOGA 3REPA 5JRSA 4PX6A 4S30A 4BYJA 4ZS4A 5JQ8A 4LI5A 3NLBA 4O1OA 5AP5A 4AE9A 5CEMA 3HL7A 1SVEA 1W98A 2ITQA 1K2PA 1AD5A 1V0BA 3MH1A 5HICA 4F4PA 3DU8A 4QMZA 3R9RA 3MIAA 2YDJA 4ZSGA 2PYWA 4LMNA 3DAKA 5CXZA 4LYNA 4IB3A 3I81A 4YC6A 4U9AA 2XK8A 5DWRA 3QKKA 3ZOSA 2GQRA 2ZMDA 5EKNA 4BGHA 2YIYA 3F5XA 5HCYA 3EKNA 5HZNA 4DLJA 2JIVA 1GNGA 2B9HA 4MXZA 2OW3A 3D94A 2A27A 4ASDA 3N4UA 3BBTB 5D7AA 3P4KA 3SXFA 2PUNA 2HWOA 3FBVA 3RTPA 2P55A 1W7HA 2WMWA 3RI1A 4UALA 4E1ZA 5J5SA 2R5TA 3MI9A 1Q3WA 5DBXA 1MUOA 4CLJA 3R83A 2B4SB 3G2FA 3O0GA 3HV4A 4AA0A 1XH6A 4MXAA 3MSSA 4IAZA 5AMNA 4RFMA 3S0OA 1H01A 3FQEA 2WQOA 4ZXTA 4HZSA 5C8MA 2RF9A 2WHBA 5IH6A 2CDZA 4HCVA 1K3AA 3Q3BA 2R3MA 4Y95A 3HP5A 5M4IA 4N70A 1ZMUA 5L3AA 1WBOA 3UNKA 4PMSA 3AT3A 3ET7A 3KULA 2QG5A 3BCEA 4O21A 4JRNA 4AU8A 4BWPA 4R3CA 4FSYA 3VBXA 4YNOA 5HNBA 2C6KA 4EK3A 1BI7A 3IG7A 4RLLA 1GAGA 2XNNA 4FTOA 4M7IA 3TNWA 3ZZEA 1YXUA 4TYIA 4O7RA 3SG9A 4JG8A 1VEBA 3LKMA 4FSZA 1SZMA 4L3LA 3LXPA 3QD2B 5CU4A 3BEAA 3JYAA 3LJ2A 2IZTA 4U3YA 4EOIA 4AWIA 3QTXA 3CTHA 3D5WA 1WBSA 3DAEA 2C0IA 3SLSA 5B2LA 2PZRA 2UW3A 3TNIA 2OH4A 4JQ7A 3OWJA 4APPA 4AW5A 3N4VA 5HG8A 1WBWA 2WTIA 4TYHA 4PL5A 4FEUA 4FX3A 1PHKA 3DBEA 3IDPA 3RNYA 3PSBA 2OK1A 1CKJA 3U54A 5JFVA 4GV1A 2GFCA 3HP2A 3AC4A 1OPKA 3PVBA 4MWHA 5D11A 4ZZNA 5AAEA 3GCQA 3QUEA 3ZFXA 4DN5A 2EB3A 2W1GA 5A54A 3UJGA 1GIHA 1B39A 4QP1A 3PJ2A 3RCJA 2VUWA 2BRGA 3WE4A 2G9XA 4QTDA 3ZU7A 3LM0A 4IQ6A 3AT2A 3RPVA 5CZHA 4NWMA 4BI1A 1JSVA 5IA0A 4IWDA 4FC0A 4I93A 3R7IA 3POZA 1G3NA 2JDTA 4L6QA 4TWCA 4LOQA 4C4EA 5HQ0A 3AGLA 4RWJA 3UP7A 4GT5A 4F9YA 2OF4A 2GFSA 4YC8A 4N6YA 1H24A 5GJGA 3T3UA 4EOQA 3RPSA 2VWYA 1YOLA 5EW8A 4ZY6A 2IG7A 1ZLTA 5AR8A 5CQUA 2W4OA 2R0IA 4QNYA 5HVJA 1XH8A 2BRMA 3TIYA 2PVMA 2ITVA 1JKLA 3KCFA 1PXNA 5CVGA 1W83A 3V3VA 5IH4A 4ORKA 4XG6A 3VC4A 3VHEA 3MGYA 5DOSA 1R78A 4YJSA 1XH5A 2I0VA 2V62A 3U51A 4MQ2A 5BVFA 5F95A 3TNQB 4CRSA 1FOTA 2W99B 2R7BA 5J7HA 4PQNA 2AC3A 2R0UA 2UZBA 4HGEA 3HMPA 4LV8A 3ZRKA 1NVRA 4O2PA 5BVDA 4MD9E 4JAIA 1YHVA 3OWKA 5H3QA 3MVMA 4PUZA 4L3PA 2BRNA 2J2IB 4MTAA 4ALUA 4BGGA 4ASEA 5FM3A 3VS0A 3Q53A 3DXNA 5HO7A 5C01A 4ZJVA 2WMVA 3NUYA 4L52A 1YXXA 2FSLX 2BPMA 4IC7A 3QCYA 1E1VA 3KB7A 3LCSA 5CI6A 3UQCA 4EC9A 4O1PA 1AGWA 4NEUA 3A62A 3F3ZA 4LRKA 4LGHA 4HYIA 1WVXA 3ZO1A 3IECA 4KSQA 2F2CB 4CQEA 4KIPA 3N9XA 4O7LA 4BDCA 1PMNA 4ENYA 3OP5A 2ACXA 1JKKA 4NKSA 3HA8A 1Q8ZA 4O0YA 1V0PA 2IWIA 3R7UA 4QMTA 5HLNA 4M69A 3OWPA 2O2UA 1PXKA 2YIQA 3ODZX 5ANOA 4UV0A 4CQGA 3RPRA 3FLYA 4WD5A 4AW2A 2G1TA 2GSFA 3MPTA 2XRWA 3BE9A 4X6QC 3QLGA 1ZXEA 4G9CA 5EYDA 3TUDA 5HIBA 3QQHA 3EQPA 1OUKA 4L53A 4YZNA 4FIHA 4XV3A 4AZSA 2WTWA 1OL1A 4EEVA 3R8PA 4YBKA 4EUTA 2E9PA 3QUPA 3VUGA 1WBVA 3GCVA 4FG9A 2J6MA 4FT7A 4I6FA 3UDBA 3LFQA 4FTIA 5I9UA 3LHJA 2OO8X 4ASZA 3QXPA 2A1AB 3FZSA 3A8XA 4BIEA 2XBJA 4XV9A 4EH5A 3R1NA 4KUJA 3PA4A 4DEEA 4N4SA 1DI9A 1QMZA 2H34A 4O38A 4MXYA 2PVYA 4G5JA 2J4ZA 3FL5A 1OITA 3FLSA 5ETFA 4Z55A 3E88A 3UVQA 3GU7A 2W1FA 3CEKA 4I5PA 4XP2A 5KZIA 5BMMA 2RG5A 5KUPA 3QBNA 5KO1A 3R2YA 2OGVA 3PZEA 5CALA 4F1TA 5CX9A 3BWFA 1SVHA 4FOBA 5KMOA 5EYCA 3WI6A 5L4QA 4Y83A 4U79A 3FLQA 3ZC6A 3OY1A 5E92A 3QD0A 4P7EA 4PTCA 1Q3DA 1QCFA 3Q4UA 2R9SA 4XG7A 5EI8A 4MXOA 4OTRA 4MBIA 3ULIA 2J0JA 3R02A 1APME 1XKKA 4G31A 3V8WA 5LMKA 4AS0A 2QG7A 3R22A 4GJ3A 2BZIB 2ZV7A 3ZC5A 5HTBA 5J7BA 4MD7E 4ASXA 5EYMA 4GU9A 5CEOA 2HIWA 5ETAA 3WARA 3CCNA 4QMQA 5C27A 3HV6A 5JZNA 4CVAA 3MFRA 4IVBA 5AA9A 3S1HA 4LGDA 5KMJA 1BLXA 4O0SA 1R39A 2WGJA 4FBXA 1Q24A 4X21A 5FRIA 1ZOGA 4Y46A 4YMJA 2JITA 3WF7A 3BV2A 3PSCA 2HENA 4TNBA 3U9CA 1ZMWA 3HMOA 3HMIA 4YLKA 2PE2A 2QOQA 2W1ZA 2YITA 4GJ2A 4O7ZA 2IVTA 3BIZA 3QL8A 5KKRB 3FYKX 4NIFA 2XA4A 3R2BA 5AV2A 3COHA 1IA9A 2OJIA 1W84A 2XUUA 3GCPA 3LCKA 4BYIA 4FKSA 2C6IA 3DKGA 4YP8A 4J52A 2R2PA 3AC1A 3DKOA 3ZSHA 5AEPA 3W2RA 3NR9A 4KINA 3LFNA 5CZIA 1ZY4A 5FP6A 2P2IA 4AGDA 4RBLA 2OWBA 4RA5A 5DMZA 3DAJA 4EYMA 4ZIMA 4EZ5A 3SW4A 3E63A 2VTHA 5CXHA 5HNIX 4XV1A 3JUHA 5TOZA 3EB0A 3F82A 3OVVA 5G1XA 3QD4A 2PVRA 2CCHA 3EOCA 4FTLA 3NDMA 2VNYA 3NAYA 5E4HA 2OXDA 4ZAUA 3OY3A 3QTRA 3VBTA 3RBWA 2UVZA 2XEZA 2XKEA 4ANBA 5EM7A 2Y8OA 5IUHA 1M2QA 4D2SA 3E8EA 2QLQA 4D5KA 3R9DA 5TO8A 3I7CA 5M09A 5AP6A 4FNXA 1O9UA 2UW8A 4N6ZA 3TDVA 4C38A 1JPAA 4AT5A 4IAKA 4KABA 4FT9A 1VZOA 3FSFA 3UMXA 5HU9A 2J9MA 4QMVA 4YBJA 4ZSLA 1J3HA 3LFDA 4FG8A 4LOPA 3HA6A 4R5SA 4WT6A 2ITPA 5AUTA 4L43A 2QU5A 1K9AA 4LRJA 2FH9A 2DWBA 3A4PA 2Z2WA 3QQKA 1LEWA 3MY1A 4O7VA 5JGBA 3C0GA 4KIOA 3AT4A 1R0PA 4LRMA 4QD6A 5JGAA 1XR1A 5M08A 4NTTA 1YKRA 4HGTA 5A4EA 2EU9A 5C8NA 2QVSE 5F1ZA 4KBCA 2PVJA 5FXRA 1JSUA 3OXIA 3EN6A 4MF1A 3FI3A 2X6EA 4TWPA 5M4CA 4X2NA 2OIBA 5CY3A 2YAAA 2UZLA 4KIKB 3UNZA 5KHXA 4ZMEA 2YJRA 1J7LA 1SMHA 2QU6A 3EH9A 3UP2A 4EKLA 1R1WA 3FLNC 4EUUA 4DC2A 4ERKA 3OROA 4MBLA 2C68A 3WYYA 3MS9A 4AZTA 3H0ZA 1H1SA 3TEIA 4C2VA 5JFXA 4NKAA 2RKUA 2HYYA 3F3VA 3NUNA 3PDTA 1H8FA 4DBXA 1NVSA 2KULA 5IA3A 1NW1A 2A4LA 3QZFA 4F0FA 4KNBA 1UU3A 5BVEA 4GUBA 1H1QA 2BHHA 3P78A 3BU3A 3CR0A 3IK3A 2X7GA 2QURA 3W2SA 2PPQA 2PUIA 3MJ2A 2J50A 4G6OA 4PPBA 5DT0A 5HESA 4K8AA 1FVTA 3S4QA 4BTJA 4GKHA 4ANNA 5DYJA 3B2TA 3FHIA 3TUCA 3QQJA 4FEQA 4PPAA 2XNPA 4HCUA 1PXMA 2B9JA 3KVWA 2ETMA 4X2JA 3WIKA 4CMUA 2VTPA 1BL7A 3TZ9A 3LMIA 3O7LB 4FIJA 5EHLA 2VX3A 4IHPA 4J95A 1BKXA 2A19B 1UVRA 2VTTA 2IJMA 4L42A 3CTJA 4N0SA 4FL3A 4RC3A 4JX7A 4J96A 4QMMA 4U40A 4HGSA 5E8UA 3VRYA 5BYZA 2JKKA 3C9WA 1U46A 5C8KA 4EHVA 5K0XA 2WMRA 2GPHA 2V7OA 3W16A 3GB2A 4F70A 4ACMA 3MN3A 5E8VA 3UOJA 5BX0A 1FMOE 1KSWA 2ZJWA 4WNPA 3K2LA 3QTZA 3RHXA 3GQIA 5BYYA 3CIKA 4BDAA 3ZO3A 3UVRA 5A9UA 1U54B 5K9IA 4AN9A 3GC0A 3WZEA 3OHTA 3IS5A 4RIXA 3A7IA 4I20A 4IEBA 4A9SA 3VUDA 1M14A 2WU7A 3R00A 4FV4A 5ITAA 4USDA 4JBPA 3PE2A 4JBOA 4XG2A 5LWNA 5AUZA 3ACJA 4IJPA 3R7VA 3EFJA 2OJ9A 2SRCA 4FZ6A 4UYAA 4YO6A 2E9OA 1Y8YA 4XYFA 3R9HA 3VUTA 4E4LA 3QCXA 3R6XA 5FXSA 2JIUA 3QC4A 4O0RA 2Q83A 4E4MA 1VYWA 4BIDA 3RP9A 2F7EE 4MH7A 3KF7A 5M07A 4G16A 4D4SA 1OI9A 2XB7A 4IBMA 4ALWA 5CEPA 3L9PA 5DA3A 4GS6A 4D28A 5JN2A 4BDGA 1LP4A 4I0SA 4QMUA 4RIWB 4J1RA 4W4WA 3GC8A 3ALOA 4EHEA 5EK7A 2ITXA 1PF8A 4FKQA 4AT3A 4FTCA 3GI3A 2Z7RA 3EFKA 4GK3A 4MKCA 4O6EA 5KMIA 4J8NA 5I9ZA 2H9VA 3ZBXA 4AX8A 4R3PA 4K9YA 3RZFA 3O96A 4IB0A 2VU3A 3M1SA 3MTFA 4FTAA 3F69A 4NT4A 4IB1A 4M3QA 1DI8A 1JQHA 3SXSA 1OKVA 3PIYA 5CAQA 1UKIA 2F2UA 5H2UA 3QQGA 3TKUA 2Z7SA 3QHRA 4ZJIA 4I92A 4BCQA 3FEGA 4MWIA 2GS2A 2R3PA 4RLKA 5IDPA 1LPUA 1OZ1A 3NYXA 4DH5A 2C30A 4I24A 1J91A 2WTKB 3DV3A 3JVSA 4RGJA 2RL5A 3PPKA 3KXZA 5L2WA 5LVMA 5GNKA 3DK3A 2NPQA 4QMNA 4YHFA 4FYOA 1AQ1A 4AE6A 3QLFA 4ZTQA 3ELJA 3HRBA 5C4KA 3GEQA 4QMWA 2QD9A 3BWJA 4YZBA 2W1EA 1OPLA 3I5ZA 1M7NA 3CQEA 4TKSA 1T46A 2GNHA 2GNFA 3QTIA 2HXLA 4FKVA 2QOBA 2WU6A 5TE0A 3RNIA 3UC3A 2UUEA 4BZDA 3COKA 3JS2A 1XH9A 4YJOA 4L00A 3S95A 4BDJA 4JI9A 3O8PA 2IVSA 4IH8A 3OFMA 4AZVA 4LL0A 1GZNA 3QRIA 2QOOA 3VS3A 4JNWA 5HG9A 1O6YA 4FTKA 4R6VA 1G8SA 4QT1A 3TNHA 4ZY4A 1JKTA 4XRJA 2R4BA 4DH8A 4CT2A 4GKIA 4HJOA 2J7TA 3ZBFA 3R1YA 4BICA 1GZKA 5DNRA 3EQRA 2OJJA 3GBZA 4J7BA 4CV8A 3DS6A 4ENXA 4OAUC 4FUXA 4PY1A 4P5QA 4UYNA 1YI3A 3FMKA 2VO3A 5F20A 4YHTA 5GZAA 5AR3A 3U55A 5I3OA 3FZ1A 2W5AA 3CPCA 2X0GA 3RALA 3KK9A 1UA2A 5CLPA 2QOHA 2YIWA 3BHTA 3DFAA 3EQCA 4TPTA 2YDKA 3IW4A 3NS9A 3P08A 4G34A 1U59A 4UZHA 4IWPA 4ACCA 5ICPA 4U44A 2WMTA 2F4JA 2J0IA 4IAIA 1OUYA 5C03A 4A4LA 4DG0E 2JBPA 3C13A 3H0YA 3TM0A 1H07A 2HZNA 3OEZA 4UX9A 1M17A 2BILB 4EOOA 3SHEA 1F5QA 4L3JA 4GU6A 2ZOQA 4FGBA 1A06A 3FQSA 3A7GA 4QMLA 3DBCA 3JXWA 4E26A 5I5ZA 4G3EA 4IAFA 4GMYA 1XWSA 4MNEB 3EZRA 4FKIA 3EQIA 2FYSA 2PMOX 2PVFA 3ZFMA 1ZYLA 3KEXA 5LXMA 5D10A 3GU6A 4CFNA 4G3FA 1WVYA 2X9EA 3CGFA 3Q2MA 4RJ6A 2QOCA 3FZPA 4XRLA 4FV5A 5DT4A 4PNKA 3LCDA 4FTMA 5L2SA 1JLUE 3SGCA 4YZDA 5IG1A 3KXGA 3DK6A 1HCLA 4I5CA 2CLXA 5LOHA 3LW0A 1FQ1B 1OBGA 3QZIA 3ANRA 2IZSA 4PTGA 4CFMA 5HBJA 4JBQA 1Z57A 3FPQA 5I9WA 1QPJA 3ZH8A 5KKRC 4E8AA 1FINA 4YURA 4FEVA 4DFYA 3ACKA 3G9LX 3LZBA 2ZB1A 4M13A 5ANIA 5EW9A 3MBLA 4NM7A 2RFNA 2PZIA 2CJMA 2YISA 3R1SA 4DBNA 3D4QA 3F2NA 5KE0A 3H4JA 4I0RA 4FGRA 4OLIA 3NMUF 4QYFA 2LAVA 4O7WA 4IM2A 4BDKA 2VX0A 4NM0A 5CVFA 4AXAA 4CFWA 1GIJA 3VWAA 4RPVA 3W8LA 3IOKA 4X6RA 4XP0A 3NX8A 3QQUA 3P7AA 4ANOA 4O91A 3SRVB 3ZXTA 2BZKB 1ZY5A 2VTRA 4EH3A 2W1HA 3EL7A 5AA8A 4OTHA 2QOLA 4P4CA 3DDQA 3SQQA 4G17A 4DFBA 2X4ZA 3WZDA 2O65A 3U87A 1MQBA 2OU7A 3II5A 2JFLA 3Q9XA 2VNWA 2NP8A 1OKYA 2ZDUA 2GDOA 5B0XA 3ZCLA 4CG8A 4IX4A 2W4JA 4IJ9A 4BN1A 3P7CA 1JNKA 4AA4A 3HEGA 4Q5HA 3H9RA 3AD4A 2W9FB 4MEDA 2XEYA 4F99A 2EUFB 4ITJA 4CT1A 3DFCB 4IFGA 5J87A 3RK9A 4BHZA 2QKWB 4G2FA 1XHAA 3MESA 2QHMA 5JGDA 2R3KA 5I9YA 5KHWA 4KIKA 3VVHA 4PV0A 3PP0A 4RX5A 2YWPA 3KL8A 4D2RA 3KREA 1XO2B 4ZSEA 3UNJA 3ROCA 2P0CA 2QR7A 1HCKA 4IFCA 4A4OA 1F0QA 4B8MA 5FG8A 3E64A 1OPJA 4JS8A 2W5HA 3KA0A 4CKIA 4E7WA 5JRQA 5M44A 4BCOA 3FDNA 4YTHA 3SA0A 5AV4A 5IQIA 2WEIA 2CKEA 3HRCA 2Z7QA 4E5BA 2GNLA 2W05A 4LQMA 3PXYA 1PXIA 3E7OA 2J5EA 2XVDA 5CASA 3F61A 5CT7A 4D9TA 3FI8A 4OUCA 5AV1A 4KSPA 2C6LA 4UEUA 4XJ0A 3S2PA 2V0DA 3PE1A 3HAMA 4M97A 4BCNA 3ZRLA 1CKPA 5E8TA 4RSSA 4FT3A 5HE1A 2WXVA 3MVJA 4ZP5A 4DEBA 4DEGA 3PG1A 5DT3A 2QOIA 4OR5A 4IDTA 4NFMA 2BZJA 4HYUA 2CMWA 1H1RA 3DBQA 5A6OA 2R3RA 2WNTA 3IW7A 4BZNA 3I5NA 4LG4A 3CKXA 4W9WA 3WF9A 2HZ0A 3D9VA 1ZWSA 2JKQA 1A48A 5IQFA 4C7TA 4CFVA 2XKFA 4CCUA 2VO7A 3O17A 1G8AA 5HOAA 2W06A 3R1QA 1R0EA 4F7LA 4I1ZA 5EHYA 4W4XA 3NUAA 3EMGA 4EHZA 2VZ6A 3QRJA 2XM8A 5HKMA 1YW2A 4AF3A 4FV7A 4C57A 5JT2A 2C69A 3GOPA 3BQRA 1ATPE 2J90A 4FKOA 4M12A 4RG0A 4RIOA 2C1BA 2PVNA 2ZYBA 3GCSA 4FKTA 4RVMA 4F1MA 3HAVA 4CCBA 2LGCA 3LQ5A 2WD1A 1CMKE 2WKMA 4PTEA 5GZ9A 4FR4A 3H9OA 3D15A 1MRVA 3ZRMA 3HMNA 4F08A 5IEYA 2J5FA 2ZM4A 3K5UA 3BELA 3QWJA 1OL7A 4OTFA 3VUHA 4C3PA 4X7QA 4G3DA 3ZYAA 2B1PA 3ETAA 2GQSA 2BRBA 4DFZE 2VRXA 3R01A 5TT7A 4O22A 1KE8A 3W2CA 4NJDA 4Q9ZA 3OW3A 3FWQA 3QA0A 4DG3E 2A0CX 3A4OX 3RJCA 3F5GA 3QHWA 3PJ3A 4HNFA 3L8XA 5M53A 4O0XA 4RQVA 3QRUA 5TKDA 5AFVA 3VW8A 2J0LA 1FBNA 3A99A 3THBA 3K54A 4I4EA 3F6XA 4KS8A 3PPJA 4EH7A 3DZQA 2Y0AA 3HNGA 4TWOA 3G0EA 3KC3A 2PWLA 2RFEA 3IPHA 4UN0C 2C3KA 3BZ3A 2EWAA 3ZM4A 1JAMA 4GVJA 1Y57A 5I3RA 3EQBA 3DQWA 3IOPA 3OOGA 4FKJA 3D5XA 4GIHA 3VN9A 4RVKA 3DTWA 5IUGA 3DBDA 3PY3A 4FVQA 4OAVB 4QPMA 2G15A 4D0XA 3KFAA 1PMVA 5AR4A 3KXMA 4RC2A 4R78A 5GJDA 2C6TA 4DGMA 5J9ZA 4MX9A 4BWKA 4BY9E 3KXNA 1ZZLA 3BLRA 4FUYA 4GYGA 3V5LA 1NA7A 4XG8A 3FMLA 4RWIA 4C61A 2PSQA 3QF9A 5HBHA 1WVWA 3PVUA 5LMAA 3W32A 3ZLYA 3GP0A 5CAPA 4QMPA 4GL9A 4E6CA 2YAKA 3C4WA 4BDFA 5E8YA 2WZJA 4CZUA 4UMUA 5BUJA 4X3FB 5L6PA 2VTMA 3V51A 4B4LA 3OXZA 2V55A 4FKPA 5IQAA 3PPZA 4RZVA 4Y72A 3BU6A 5CF8A 2OZAB 4QO9A 1YI6A 2W7XA 5ANJA 3TXOA 3TZ8A 1FGIA 3G9NA 3BKBA 4W4VA 3G33A 2WTKC 1SYKA 3TACA 4EOMA 4B9DA 2OH0E 4F6SA 5AUXA 2JDOA 4D4VA 2G2IA 4E6QA 3R73A 2EB2A 2YFXA 4UMRA 3OTVA 4ITHA 2C6OA 2X39A 3E93A 3KF4A 3ZEPA 4ANMA 4JR7A 1IEPA 4CFFA 4ZTMA 4L7FA 4QRCA 4IX6A 4UXQA 4WG5A 4CLIA 4KD1A 2XK4A 3DJ5A 4JG6A 2WMUA 2YACA 2YA9A 4YTIA 1RJBA 4KKHA 3NWWA 5E8WA 1Z5MA 1PRYA 3B8QA 2O5KA 1U5RA 3OD6X 3RVGA 4ANQA 3TKIA 2X2MA 1YWNA 2VWIA 5J1VA 3KXXA 5HNGA 3MWUA 4FSWA 1DS5A 1DAYA 2QR8A 3VULA 1TKIA 3DA6A 3OC1A 4IVAA 3G51A 2WELA 3NAXA 4OT5A 3U6IA 3FXWA 3UE4A 4QQJA 2IZUA 4ERWA 2BIYA 2OG8A 3G0FA 2ITTA 3SDJA 4WUAA 4XCUA 4WNOA 1LUFA 5E91A 3FXZA 2I40A 3PUPA 4DITA 2UW0A 3VS2A 2UZOA 4TYEA 5HE0A 2QC6A 4RIYA 5EYKA 4FTRA 3K3IA 4QP4A 2FB8A 2VWUA 3I60A 3P5KA 4Y8DA 4ZLZA 2GHGA 3FXXA 2C1AA 4FEWA 4FTQA 4X2KA 3Q04A 3D2KA 4KKEA 4EORA 4E20A 5L6OA 3N4TA 4WRGA 2XNBA 4EL9A 1Q61A 2HW6A 3OBGA 4MNEA 2FSOX 4FV1A 4ACGA 1H25A 1U5QA 3F5UA 3RAHA 4EOKA 2XJ2A 4GRBA 5L8JA 4DHFA 3S00A 5HVKA 1YQJA 3JR1A 3PFQA 4BI2A 2W96B 5DH3A 4E5WA 3VS5A 3D2IA 5IQBA 2ITYA 4D2TA 2GNGA 2ZMCA 5CVHA 3UO6A 4F64A 3R0TA 2IW8A 2IO6A 5FWKK 2BTRA 2R3LA 3MFTA 4I3ZA 4JL9A 5ETIA 2PULA 4I0TA 4M15A 3DQXA 1CKIA 4G9RA 2Z60A 3F3TA 3U4WA 3TJCA 3ID6C 5IKWA 2WMXA 4ZLOA 4CFXA 1UV5A 3QKLA 2WQMA 4J53A 3DJ7A 5I0BA 3KMMA 5I4NA 3OMVA 3RKBA 4OT6A 4EI4A 3VS4A 2XBAA 2Y7JA 5LQFA 5IH5A 3TDWA 3G15A 5AX9A 5A6NA 2ITNA 4JDIA 3GT8A 2X7OA 3MJ1A 2Z02A 3DZOA 4WNKA 2CSNA 4JIKA 3NVMB 4BDBA 3ORLA 5M55A 2WMSA 3FMHA 4E5AX 3LVPA 1UU9A 4O7TA 5BVWA 4YU2A 3CD3A 3FZOA 4H3PA 3EQDA 4B7TA 3QZHA 3V5JA 4FKGA 3NUXA 3LXNA 4KKGA 2XKDA 4I6QA
chains in the Genus database with same CATH superfamily
2YIRA 5LJJA 2REIA 3QXOA 4MAOA 4E6AA 3CGOA 1OL5A 4FVPA 1PMUA 4KAOA 4FMQA 2HWPA 2YCRA 3HRFA 3P5JC 4F09A 5CF5A 4D55A 3NW5A 5C9CA 5KMKA 3SXRA 1M2PA 3D7ZA 1BMKA 4FZAB 3NW6A 4MQ1A 4PP9A 4RFYA 4UWYA 4L7SA 5FXQA 3QCSA 4DF3A 4LOOA 3RK7A 5CSHA 3F7WA 1M7QA 3GENA 1YI4A 4FSRA 1UU8A 3QUDA 4PNIA 5EI2A 4E73A 5A14A 2VWVA 4I41A 3RAKA 5EDRA 4HVSA 3ORXA 2QO7A 4W4YA 4EK4A 1WFCA 5KBRA 4E4XA 3EN9A 2YDIA 5AWMA 4M67A 4OTQA 4G6NA 2H8HA 4QP2A 5AM7A 1OB3A 1RQQA 3F2RA 4Q9SA 2X2LA 3SC1A 2W5BA 5KX8A 1OIQA 3ZDUA 3AG9A 3RCDA 4U41A 5CAUA 2XARA 2ONLC 3VUIA 5CWZA 2PMLX 2V7AA 4JXFA 4AG8A 2CGWA 4D5HA 2QQ7A 4C4FA 4EHGA 3OG7A 3O7LD 3VAPA 4AAAA 4WSYA 1OIYA 2XYUA 2WFYA 3C0HA 5M51A 5H8BA 3SVVA 2W1CA 3RM6A 5EKOA 4NZWB 3H10A 2XM9A 4HVDA 3FKLA 5JEBA 4C3RA 3V5PA 1QPCA 4H58A 5IA4A 4EQMA 2XCHA 3GOKA 4GYIA 3LFSA 5HCXA 3V6RA 4R5YA 3KRRA 3MA3A 2ETRA 4UXLA 3TN8A 2C3JA 2ESMA 2VTQA 2XK6A 4QTAA 3TTJA 1BL6A 5AM6A 2QHNA 2R3OA 5E8XA 2I0HA 3UIMA 1PMEA 4FA2A 5FQDC 4CYJA 3SOAA 3IDBA 3ORTA 4IMYA 4CKRA 4M0ZA 4EQCA 3DB6A 3P7BA 4C58A 4OBPA 4F7NA 4G3GA 4DEDA 2WOTA 3EN5A 3A61A 4AGUA 2HELA 3QGWA 3AD6A 2QOFA 3QU0A 1YHSA 1Y8GA 2JEDA 4IANA 5KNJA 4FZ7A 3V01A 4O27B 3R8ZA 2JDSA 4DA5A 3Q5IA 5IMXA 4FSMA 3MVHA 4RJ3A 3BQCA 4TZRA 4XBRA 3PJ8A 4QMSA 3ZSGA 5FP5A 4HGLA 3VNTA 2EXCX 2C5YA 3BL7A 4C4IA 4ACHA 5BVNA 1XBCA 5KMLA 3ZDIA 3RPOA 2CNVA 2CGVA 3BBWA 5E1SA 1GY3A 5KBQA 1V1KA 3SAYA 1ZAOA 4FTNA 5FD2A 3ZUTA 4C59A 3NUUA 3HUBA 3D7TB 4K77A 3HGKA 1KOAA 2ZV9A 3VRZA 4A06A 4EYJA 4F6UA 3Q6UA 5A46A 4DHIB 4XH6A 5LVLA 5CEKA 2F7ZE 3PXZA 2CKOA 4MF0A 3MFSA 2PE1A 1IASA 3GXLA 3EN4A 5LMBA 5AP2A 3V8TA 4M66A 2R3QA 1B38A 1OGUA 4D1SA 4Q5EA 3ZSIA 4EZ3A 3RAIA 1PW2A 3K5VA 2XJ0A 4EK6A 4Z3VA 4WIHA 5CF6A 2BRHA 3UIBA 4O0WA 3Q4ZA 3FMMA 3AC8A 3I1AA 3CY3A 1FMKA 4QYYA 3WZJA 3NSZA 2W1DA 5E90A 4L9IA 4FTJA 2GQGA 1Q97A 2CKPA 2E9UA 1H28A 4X2GA 3FYJX 2WTVA 3PTGA 3NEWA 3ORPA 1SNXA 2DYLA 4O7YA 4QP6A 3FC2A 5CTPA 3D0EA 2J0KA 2C6MA 3ERKA 4QPSA 3EL8A 4ARKA 2O63A 2OFVA 3MDYA 2C0OA 2WPAA 4AT4A 4D4RA 4WKQA 4R77A 2BALA 1JOWB 3BRBA 1W0XC 4C36A 2UW9A 5IA5A 5A4TA 3HX4A 5F94A 4YPDA 4LFIA 3NCZA 1GJOA 2UW4A 3I0OA 5HBEA 3LMGA 2I7QA 4R8QA 5D41A 4CEGA 2RFSA 3UG2A 3E5AA 3RWPA 4BRXA 4S2ZA 2FSTX 1ZARA 5IF1A 2WOUA 4USEA 3TL8A 5CAVA 5E7RA 3BGZA 4EOSA 1G8KA 2ZDTA 2IPXA 3ROYA 5IA1A 4O0UA 2B53A 5FGKA 2RG6A 3KULB 3FZTA 4CRLA 5EHOA 3H9FA 1H26A 3ZO4A 4XOZA 4BDIA 3DBFA 2IN6A 4BCIA 2QOKA 4FSUA 1J1CA 4TW9A 1SVGA 2BTSA 4AZEA 4F9WA 1Q62A 3O8UA 4NL0A 4PDPA 3R8UA 4BZOA 3VJNA 4CXAA 4D2WA 5CS6A 3D14A 3MVLA 5HX8A 4X3FC 5T3QA 3QRTA 3HLLA 4AQKA 4QMOA 2VTNA 4V05A 1OVEA 3NYNA 4QPAA 3COMA 5J9LA 1OIUA 2BDJA 3COIA 4K0YA 4X2FA 3W0OA 2XNEA 4W8DA 2UZUE 5G6VA 4LMUA 4ZSAA 4TYHB 3RHKA 5E8SA 5IDNA 4R7BA 4NH1A 2NNWB 1X8BA 4QP8A 4FV2A 1XQZA 3BLHA 2XIXA 1IG1A 5DEWA 2P4IA 3Q4CA 4YJVA 3Q6WA 3Q9YA 2ITWA 5L6WL 2J51A 2PZ5A 3LFEA 5JKGA 2F49A 5L2IA 3DPKA 3I0QA 4NJ3A 2PL0A 5HCZA 3MA6A 3SD0A 4ZJJA 5JSMA 3OEFX 4PRJA 4FSNA 4ZK5A 2IEWA 3UMWA 4HVHA 5IQCA 1GIIA 2VTIA 4DFLA 3UBDA 4EH8A 5HTIA 3Q5ZA 3AC3A 4XUFA 5CF4A 4FNZA 4NU1A 2JAVA 3PP1A 4ZZMA 4CZYB 4EK8A 4JJRA 4DYMA 3C4FA 2F9GA 1PXPA 3KQ7A 1URCA 1YXVA 5I9XA 4YUQA 2H96A 5I9VA 4GIIA 1Y6BA 3PVGA 2C3LA 2PMIA 3VBQA 3G90X 3QKMA 4XG9A 5F9EA 4Y5QA 3OF0A 1O6KA 4FV8A 4DGOA 2CKQA 2VTJA 1VYZA 2FSMX 4XLIA 5ACBC 3E62A 1ZYCA 2WMBA 3DKCA 3IW8A 2O64A 2ZB0A 4ZZOA 4H05A 1OM1A 4QTCA 5CI7A 2B0QA 3QTWA 4FT5A 4ZMFA 3EYHA 4FV9A 4ZLYA 2FO0A 3MY5A 2OZOA 3LFAA 4FG7A 5EQPA 1PXOA 3OCTA 2W1IA 2G2HA 4IB5A 3W1FA 4CNHA 4ZTRA 2PTKA 5IA2A 3EQGA 4QTBA 5EH0A 1ZOHA 2WAJA 2QKRA 3IGGA 5T68A 3DY7A 3HZTA 2ZAZA 4GW8A 2XNMA 2XK3A 3MV5A 3Q9ZA 5DHJA 4BGQA 2X6DA 3LXKA 3BU5A 4L46A 4FIEA 3DXQA 3UPZA 3E87A 3FQHA 2PZPA 4IZAA 2E9NA 5HLWA 3UO5A 4AFJA 4E3CA 4YJPA 5DRDA 3UQGA 4I21A 4U97A 5IMEA 5EG3A 3LPBA 4V0GB 4CTBA 2WQNA 4M8TA 3W2OA 5D12A 4DAWA 2W17A 4JMQA 4YPSA 3U4UA 2B7AA 3VHKA 4H39A 4IAYA 4D2PA 2BROA 4AP7A 4BTMA 4DEIA 5K4JA 1Q4LA 4PDSA 3WZUA 2OICA 4WRSA 3M11A 4JAJA 4FV6A 1PYEA 2R3HA 4YJNA 3EIDA 1TVOA 2R7IA 2EVAA 2VAGA 5AP4A 4BKYA 2EXMA 2VN9A 3NCGA 4O0VA 3DJ6A 3P23A 4IWOA 1XBAA 4M69B 3O8TA 1M2RA 3KRWA 3PYYA 2I1MA 3D5VA 1REKA 4CZTA 5JFSA 5AP7A 3AD5A 2WIPA 4LM5A 2W4KA 3R9OA 2BDFA 2YJSA 3LM5A 3RK5A 3R8MA 2YN8A 3TKHA 5CENA 4D9UA 1XMLA 3OXTA 4PMTA 3QX2A 2UW6A 3IKAA 3KKVA 3QX4A 4F7JA 3DOGA 4IIRA 4IXPA 4AGWA 1H1WA 2PE0A 4ZTSA 1G5SA 5HD4A 2YM4A 4F9AA 3KK8A 2DS1A 1XBBA 5FDXA 4KRCA 5F4NA 3BYOA 4ZY5A 3UGCA 2YM7A 4FI1A 4L44A 1S9JA 4KRDA 3C4XA 2BAKA 3GNIB 5L8LA 3S3IA 3L8SA 2PMNX 5EM5A 1ZZ2A 4JDKA 3T9TA 5BQ0A 2KTYA 2Q0NA 1S9IA 3UTOA 4OTDA 4BB4A 4B8LA 4LUEA 3CLYA 4MD8E 4UWBA 1NY3A 3LLAA 2BMCA 2XIRA 4IM3A 4DCAA 5M06A 4LV5A 2P33A 3GC7A 1YHWA 4NM3A 5EQYA 4BCPA 3NYOA 5CT0A 5M57A 4N57A 4FV3A 4YJUA 4MBJA 3KVXA 1PJKA 4EC8A 3QTQA 3TI1A 4EONA 2X0OA 2HOGA 3NUPA 4J97A 2CGXA 4RQKA 4S33A 4ZEGA 2X0PA 2UW7A 4FZFB 5BNJA 4RVTA 2BR1A 2XIZA 3NVKI 2YZLA 4PDOA 2YCQA 4BBEA 2A2AA 1VJYA 3IW5A 4P5ZA 2BIKB 4RA4A 3GGFA 3CP9A 1OL2A 5HX6A 2ZV8A 2UZTA 5H9BA 3V8SA 3FMDA 4G3CA 3PA5A 2OLCA 4FYNA 3C0IA 2BFXA 5HE2A 5FEQA 2V5QA 1UU7A 2IZRA 1H4LA 4ZTNA 3W18A 3W2QA 5EI6A 3EYGA 3PSDA 4AQCA 4U5JA 2C6EA 3UG1A 1UNGA 4DH1A 1ZYSA 2VO0A 3WF8A 4W9XA 3BLAA 2RSVA 4QP7A 5BUEA 4FK6A 3F3UA 2C5VA 3NNXA 4DDIA 3LAUA 3QRKA 2ERZE 4U7ZA 3GFWA 4NIFB 2YHVA 4I5MA 4NYEA 5M4UA 2JDVA 2UZWE 3FLZA 4FODA 4XG3A 2QLUA 3N51A 4FNYA 4H3BA 3H30A 1Q8WA 1REJA 2YABA 2GHMA 4QNAA 3U8WA 3WILA 5IZFA 3D7TA 4UY9A 1H08A 2NO3A 4BDHA 3ZS5A 5AAGA 3Q60A 4IDVA 4MHAA 3QYZA 3C7QA 5LARA 4QMYA 4J71A 2PHKA 3NIZA 4KBKA 3W8QA 4DEAA 4LUDA 5HIDA 1TQIA 3LQ8A 5LVPA 3VBVA 3QALE 5CQWA 3DCVA 4IWQA 3R71A 4HPTE 3OCGA 1IRKA 1Q41A 2YCFA 3KU2A 3VQHA 4TXCA 2W9ZB 4OBOA 4WUNA 1ZRZA 2VWWA 4F0GA 2VX1A 3IGOA 4CKJA 1W2FA 3Q2JA 3RMFA 4FZDB 4BCKA 3VF8A 5GJFA 2AC5A 1WMKA 3T8OA 3VUKA 3MB7A 4CV9A 4ITIA 4M68A 3A7FA 3TCPA 3TIZA 3MPAA 1DAWA 5LWMA 2R3FA 1UNHA 3JY0A 5D7VA 3W55A 1CDKA 1FVVA 2C0TA 3F2AA 3I79A 1FVRA 3MY0A 2UVYA 2C3IB 2V22A 3R04A 3KY2A 4Q2AA 4OTWA 2OIQA 3H3CA 2HY81 3PWYA 3DKFA 2VTOA 4G5PA 3WOWA 4GK4A 2OXYA 5C26A 2PVHA 3ZHPC 4O7NA 4IE9A 2X81A 5IEVA 4D58A 4DLIA 4XEYA 4V01A 4CG9A 5DGZA 4BL1A 4ANSA 2UW5A 5ANKA 2O0UA 4FICA 2YCSA 4YR8A 1U54A 4FTUA 4L01A 1ST4A 4GT3A 5B2MA 1EH4A 5E9EA 4J98A 2YLFA 1KE5A 4LV7A 3BHYA 5GINE 3LE6A 1PKGA 1O6LA 4X0MA 3V6SA 3EHAA 4BHNA 4PF4A 3PY0A 3ATTA 4TNDA 5HG7A 1V0OA 2P3GX 4E6DA 4FIFA 4JVGA 4WBBB 4C0TA 4M0YA 4E93A 3R30A 3G6GA 2GTMA 3Q9WA 3U9NA 4G1WA 5AX3A 4C3FA 3FY0A 1ZYDA 3U6JA 5K5NA 1JBPE 4BI0A 2CLQA 5H8GA 2C5XA 4FSTA 5IISA 4QP9A 2BKKA 2GS7A 4BTKA 2HK5A 1PXJA 4EKKA 4YLJA 4C62A 2HXQA 4M14A 5CSPA 2A98A 5AUWA 3CS9A 3GU8A 3MFUA 4PPCA 2EXEA 1A9UA 3RAWA 4B6LA 4BF2A 4DT9A 4D4YA 4JDJA 3TV7A 2E9VA 2QCSA 4YLLA 4EBWA 3FKOA 1WBPA 1H0VA 4RIWA 4JX3A 5J79A 3QGYA 3ZUUA 3BHVA 3WIGA 4O81A 3BV3A 2RIOA 3TT0A 1JWHA 3KMUA 3OWLA 3PJCA 4IADA 3IO7A 3NUSA 4IVDA 4XLVA 4B0GA 4F1OA 1Y91A 4CYIA 3PRFA 4RX8A 3HV3A 4MK0A 4I4FA 3UO4A 2PY3A 3VJOA 1DM2A 5J5TA 4RFZA 1W82A 3R28A 5EW3A 3OCBA 5KMNA 1OMWA 4EWHA 3GUBA 1KE9A 5DEYA 3TV4A 3E92A 4J99A 5CU2A 4GFGA 4NTSA 4XS2A 2BAJA 4KWPA 4ID7A 3MTLA 1Q99A 3AMBA 4S32A 4W8EA 3QYWA 3PZHA 4K1BA 3V04A 4O96A 1YWVA 4WA9A 3DLSA 1MRYA 1ERKA 1WBNA 4RVLA 4L8MA 3AQVA 3ANQA 4IVCA 2J0MB 4X3JA 4EJNA 1R3CA 3KRXA 3ITZA 1P4FA 3OUKA 2RGPA 3CQUA 5K4IA 2CNUA 3LMHA 1OIRA 1PKDA 3CE3A 2WIHA 4RIXB 4C37A 2XYNA 3BYVA 3NNVA 5J8IA 3SX9A 2JFMA 3C1XA 3BI6A 2IW9A 3EFLA 5JK3A 5K0KA 3I4BA 4YZCA 3C5UA 5AP0A 4RZWA 3NRMA 5EOLA 3VRYA 3RM7A 2YM8A 1ST0A 5CU0A 4R1YA 2BFYA 4F65A 4DE4A 3C5IA 3DDPA 4FNWA 4XBUA 4FRFA 5K3YA 2B52A 4HYHA 2O3PA 2FGIA 3F9NA 4F7SA 4FE2A 4H1JA 3ZUVA 5AADA 4AXFA 4C35A 4Z9LA 4U6RA 4DGNA 4GEOA 4YTCA 3FKNA 5JFWA 1FGKA 4AAYA 2X8DA 4MXXA 1H1PA 1OECA 1UNLA 3AMYA 3E8DA 3CJFA 2QO9A 3EN7A 3OTUA 4EOLA 2ITZA 5CU6A 1BUHA 3BHUA 1UWHA 4C34A 1E1XA 3FUPA 3O50A 5ANDA 4ANLA 3W0SA 4V0GA 4A9YA 1HOWA 1Y6AA 5EM8A 3WYXA 3MH3A 2WTCA 5DVRA 3R8VA 3SOCA 3L9NA 3EKKA 3PY1A 4UMPA 2ZM3A 4EQUA 1JSTA 2YLEA 3CQWA 2XIYA 3LLTA 4DFNA 2QODA 4XG4A 4A9TA 4IZ5A 3OW4A 3LIJA 2Y4PA 3L8PA 5HVYA 4P90A 4F9BA 1IR3A 5EM6A 5FUTA 1YDRE 2BAQA 3C4EA 5EOBA 1WAKA 5AR5A 5HTCA 5EQEA 3PIZA 3TZMA 5JZJA 3GU5A 4AW0A 4IACA 3SG8A 1P4OA 3QQLA 3RZBA 4TL0A 4Z7HA 3P79A 4XV2A 3NPCA 2NRUA 5DFPA 3QD3A 4AOJA 3LCOA 4RJ4A 5A4CA 3E7VA 2OXXA 2ZVAA 3RGFA 5FEEA 4K2RA 4EH2A 2PVLA 5C1QB 2UZDA 3C4CA 4S31A 2W0JA 3C50A 3T9IA 5FBNC 1W2CA 3HYHA 1H27A 4YJQA 3E3BX 3T3VA 5M56A 3W33A 3ZFYA 4BBFA 5EDPA 3KMWA 4DH3A 4OGRA 3Q52A 4FIIA 3FMJA 4FKRA 4MNFA 3UOHA 4ONAA 4U0IA 4FSQA 4QQCA 5CNNA 5LCKA 2Y4IB 4KBAA 2BKZA 1L8TA 4APCA 4UMTA 4JR3A 1KUTA 2BHEA 2XMYA 3CY2A 4QYHA 4C02A 3HMMA 1JVPP 3BYSA 2CPKE 2B9IA 5AIKA 2C6DA 5IQGA 2OF2A 1LR4A 1JKSA 2NRYA 4C8BA 1YRPA 4KA3A 3R7EA 5LCJA 4I6LA 4L45A 5BVOA 4Y85A 3A8WA 1IA8A 3HECA 2GNIA 2BVAA 5FTOA 4YSMA 5D1JA 5DIAA 5HU3A 2R3GA 2ITUA 2XNGA 2BZHB 1U4DA 1UKHA 3Q32A 3R8LA 2X4FA 2OJGA 3KIOC 4F9CA 3P86A 2VTSA 4V04A 4WBOA 4R7IA 5DG5A 2XK7A 3SRVA 5HG5A 5CAOA 3UYTA 4NCTA 2X2KA 5JMSA 4HPUE 4AGCA 2JKMA 3R21A 3CXWA 3RPYA 3GC9A 3R7OA 3LFBA 2GTNA 2DQ7X 3G5DA 3PXRA 2YERA 4U42A 5ANEA 3SV0A 3VO3A 2ZV2A 1KV2A 1MP8A 3AGMA 3PRIA 3UVPA 5DE2A 1Z9XA 3GFEA 4RMZA 1YWRA 3QWKA 4KS7A 4IAAA 4CTCA 4D1XA 4HNIA 5IQHA 3B2WA 4BKJA 2R3JA 3ALNA 4NCTC 4CD0A 1QL6A 3QA8A 4IW0A 4JQ8A 1SNUA 4O4CA 4QYEA 5E8ZA 4BCHA 1YOJA 4GFOA 1OKZA 3TMOA 4JG7A 3EWHA 3MYGA 5KMMA 5LMKC 2ONLA 2WMAA 3PWDA 3WE8A 3ZLSA 5FEDA 3PLAE 4YJRA 3VQUA 3KRLA 2P2HA 3NFFB 2PK9A 5AIRA 4XMOA 1BYGA 3VBYA 5A4LA 5LVNA 2X7FA 4YC3A 2ITOA 3DT1A 4OW8A 3BYUA 2VTLA 4XOYA 4WNMA 1YOMA 3POOA 3PJ1A 1NXKA 3C4ZA 3FI4A 3ENMA 3FLWA 4RRVA 4WSQA 5BUIA 3W2PA 2GU8A 4DGLC 5L8KA 2JDRA 2CCIA 5AUVA 2Z8CA 3BEGA 4FK3A 4IM0A 4CMTA 2YM6A 2AYPA 2UV2A 4FOCA 3D5UA 3FSKA 3F3WA 3ORIA 4R3RA 2HZ4A 4DFUA 3VIDA 4HVGA 5ANGA 4Y73A 4IX5A 4U81A 3NZ0A 1OKWA 4BCMA 5BMSA 4I6BA 3FL4A 3VS6A 4C33A 2E2BA 2XRUA 3ENHA 4HYSA 5J1WA 2JLDA 3WZKA 3ZM9A 4OBQA 2JC6A 3R7YA 4R1VA 4TYGA 2FA2A 4DTKA 4KIQA 4UZDA 5FLFA 4ZTLA 1KWPA 2YM3A 4O83A 5KZ0A 2OBJA 1OBDA 2H6DA 4DT8A 2OKRA 2BCJA 4O86A 1P14A 3OT3A 3R63A 4NM5A 3ZTXA 1BX6A 3JPVA 3TV6A 4BCJA 5LVOA 4AZWA 1Q5KA 3HKOA 1H00A 2JBOA 2XK9A 3GVUA 4I6HA 4E4NA 2IVUA 3UIUA 4Z7GA 3FI2A 1TQPA 5L2QA 3VS7A 4FT0A 4GFMA 4DH7A 3UOKA 5DI1A 2VV9A 2B55A 1PXLA 4BC6A 5M4FA 1P5EA 5HLPA 2HW7A 5DR2A 1Q8YA 2XKCA 3BPRA 1MRUA 4B99A 3NNWA 2XZSA 3NGAA 3FHRA 3OBJA 4NW5A 5HI2A 3UZRA 4AZFA 2VTAA 3R7GA 2X8EA 2XS0A 2GMXA 4L67A 4RWLA 4ZS0A 5B2KA 3OT8A 4TT7A 5HO6A 4C4GA 3ZLXA 3HDNA 4O6LA 2CNQA 5BYLA 3QFVA 3DXPA 4U80A 5DN3A 2C5OA 2JGZA 4RJ5A 4QOXA 2HCKA 3TWJA 2ZFYA 4PMPA 2I0EA 3JY9A 4JBVA 3O71A 3QTUA 3CBLA 4USFA 5DR6A 4DTBA 4GSBA 3DNEA 4JOAA 1RDQE 1XH7A 2FVDA 2VGOA 3GU4A 4EBVA 2C5NA 1ND4A 3PIXA 3PXKA 4PWNA 3Q96A 3M42A 5EDQA 3V5WA 2R64A 4RWKA 2R3NA 5T6KA 3TG1A 3AMAA 3AOXA 3O51A 2QO2A 4H3QA 5HGIA 4O2ZA 3UPXA 4EK5A 1M52A 4ACDA 2PUPA 4DHJA 2Y6OA 5IQDA 3FJQE 4BJJA 1Q8UA 3LCTA 4Y5HA 2JAMA 4TRLA 5ETCA 5IQEA 1BI8A 4MYGA 2ZM1A 2FUMA 5DR9A 3KCKA 2XNOA 5E1EA 5HO8A 3QCQA 5GZ8A 4DINA 3UC4A 5CANA 4UB7A 1WZYA 3BX5A 3LOKA 3CSVA 4QQ5A 3W10A 3HDMA 5J9YA 3OS3A 3FAAA 4F6WA 4A4XA 1IAJA 1KE6A 2OSCA 3CTQA 4ZTHA 4A7CA 2G01A 1YXTA 5D9HA 4ALVA 4C4JA 5C4LA 4QQTA 5AV0A 2R3IA 1F3MC 3O23A 2WQBA 3KXHA 4D1ZA 4AOTA 3HV7A 3IQ7A 2WB8A 2B9FA 4K18A 1L3RE 3VONA 4X3FA 3ODYX 2OJFE 4AXEA 2PUUA 3MPMA 3BLQA 4DGGA 4R7HA 4F63A 3QTSA 2OZAA 3WF6A 4HVIA 2CN5A 2AEGA 3FY2A 4WG3A 1W8CA 2GNJA 4GG7A 3VS1A 1XH4A 3DTCA 3F66A 4RX7A 3V5QA 3VF9A 3LFFA 4NK9A 4FL1A 2Y6MA 4NFNA 4H1MA 1RW8A 4FTTA 1NVQA 3CJGA 2Y9QA 4FEXA 3E8NA 4QP3A 4K6ZA 5H8EA 4YHJA 3OUNB 4BDEA 5HD7A 3P0MA 3IONA 4ZSJA 4BWXA 2UZVA 2VGPA 4IZ7A 2XIKA 4FKLA 2YEXA 3DK7A 3IW6A 4NUSA 3FMNA 4DDGA 1LEZA 3EFWA 4O0TA 2DUVA 4OTGA 3E3PA 3UQFA 2HY0A 3UZPA 3R9NA 3ORZA 3ZLWA 1MQ4A 3F7ZA 4AACA 4GG5A 2QONA 3EQFA 3UIXA 2O8YA 3MH2A 4OTPA 3HV5A 4EZ7A 5HHWA 4IZYA 2VD5A 2X0QA 2XCKA 3CD8A 3FC1X 4KB8A 5IPJA 5IEXA 5AR7A 3BGQA 3TJDA 4EH4A 2OIDA 3ZMMA 3I6WA 3NIEA 4BTFA 4O84A 4OTIA 3ORMA 1CSNA 3ORKA 3BYMA 2IVVA 3GCUA 3RINA 3ZONA 1GOLA 2UZEA 5CSVA 2YM5A 3FV8A 4YJTA 4YZMA 1XJDA 4MVFA 4QTEA 2XALA 2Q0BA 4PP7A 4TY1A 3PVWA 2VWBA 4PMMA 4XNEA 4U3ZA 4FKUA 5JQ5A 3F88A 3G6HA 5B7VA 2GHLA 1OL6A 2PU8A 4QYGA 5J95A 2WO6A 5AJQA 3D83A 4A07A 4K33A 3LXLA 4PL3A 4D2VA 4TWNA 5HORA 1PY5A 1J7IA 3DNDA 4UBAA 2GCDA 3GQLA 2IW6A 4FIGA 4QMXA 1VR2A 2Z7LA 5CEIA 4I94A 4NW6A 4U43A 4I5HA 3ZO2A 1RE8A 3P9JA 4RJ7A 5A3XA 1QPEA 3M2WA 4YO4A 3I6UA 3B8RA 1Q8TA 1QPDA 4TN6A 4AW1A 3DGKA 4YGAA 3LJ0A 3AC2A 3PG3A 2OFUA 5IUIA 1GZOA 2B54A 2F7XE 4EOJA 3I7BA 3EJ1A 3OCSA 3TTIA 3UODA 5AR2A 4BVUA 2I0YA 3KN5A 5AUYA 5L2TA 3QZGA 4XHKB 5BPYA 2X8IA 1J1BA 3O2MA 1CTPE 4G6LA 2HAKA 3HUCA 4S34A 3QAME 5FTQA 4PDYA 4A9RA 1IAHA 3SW7A 4BR3A 4YZ9A 3VUMA 4CFUA 3PXQA 2AQXA 3LQ3A 3IDCA 3L9LA 1ZOEA 5CSXA 2Y4IC 3FPMA 4GVAA 2XJ1A 2G2FA 3FE3A 4A9UA 4AOIA 2WTJA 2XANA 2AUHA 5CYIA 3DB8A 4JRVA 5A4QA 1YVJA 5AP1A 2UZNA 3VW6A 4EJ7A 3NNUA 4JT3A 4HZRA 4I22A 1E9HA 3WF5A 4BFMA 4LL5A 1NT2A 4MCVA 1ZYJA 3BE2A 3ORNA 1KE7A 1WCCA 5IU2A 2C4GA 4MXCA 3NYVA 3QQFA 5AUUA 2X1NA 3SKCA 3TZ7A 4DEHA 4PL4A 4UMQA 4F78A 4YSJA 4IC8A 2F57A 4JDHA 4P2KA 3EQHA 3CC6A 4UWCA 4GK2A 3P1AA 3UZTA 3EZVA 5BVKA 3U6HA 2VO6A 1WBTA 4EH6A 5KCVA 1YXSA 3DLZA 5AAFA 4RC4A 3RWQA 3K3JA 3BHHA 2ERKA 2ETKA 4IX3A 4O82A 3FZRA 4RIYB 4WOVA 3AC5A 4DG2E 4YNEA 3C51A 4WG4A 4YTFA 2BUJA 4TTHB 1YDSE 4H36A 3KRJA 4WO5A 4CSVA 3LFCA 4GCJA 5TR6A 3JVRA 4DCEA 3A7HA 4GT4A 4JQEA 5CSWA 2YZAA 3ULZA 3ZZWA 4HW7A 5JH6A 4AUAA 3Q4TA 4BKZA 3L9MA 3AKJA 4FL2A 1T45A 1STCE 2WTDA 2HZIA 1I44A 1B6CB 3F5PA 3PA3A 1GZ8A 3A2CA 5GHVA 3ATSA 1FPUA 4J8MA 2WEVA 1ZMVA 3CKWA 5AV3A 5FDPA 1J7UA 4EOPA 4AFEA 3CPBA 4C2WA 2PZYA 2JD5A 4FV0A 5DLSA 4EH9A 4CGAA 4CMOA 2PVKA 2JKOA 3OOMA 4L68A 3PLSA 3BGPA 1P2AA 2CGUA 3E8CA 4I23A 5HE3A 3UYSA 5DPVA 3TNPC 4C4HA 5HIEA 3MIYA 5ACKA 1H0WA 5AP3A 3KGAA