4AT5A

Crystal structure of trkb kinase domain in complex with gw2580
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
299
structure length
294
Chain Sequence
GAMDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords BDNF/NT-3 GROWTH FACTORS RECEPTOR
publication title The Crystal Structures of Trka and Trkb Suggest Key Regions for Achieving Selective Inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 99
structure length 294
sequence length 299
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4at5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4at5A01
2PMLX 5KMLA 3HEGA 4BWXA 2W4JA 1SVEA 3Q5IA 4S31A 3TNQB 3W16A 2WTKB 3CBLA 2VTLA 4PY1A 5AMNA 4CV8A 5AV4A 3LQ5A 4DFZE 3HRFA 4QMNA 1SZMA 4M14A 1E9HA 5LJJA 2ITVA 3UNJA 4C0TA 4JX7A 4HVHA 5EDQA 1PRYA 4WHZA 4KBKA 1R0PA 4Q2AA 4O91A 1XH7A 3GXLA 4I20A 4E4XA 5EI2A 2XM8A 3P7AA 2WMVA 3A7HA 4MKCA 3JVRA 2HWPA 5LCKA 3UTOA 4DH1A 4CGAA 3OT3A 2BZJA 3AC8A 5HBHA 4HW7A 4ZLZA 3DKCA 1WBOA 2JBPA 2B54A 4GIHA 4L42A 2X7OA 4D0XA 3AXWA 3G5DA 3HV3A 5HZNA 3IOPA 4EZ3A 3U6HA 3C1XA 4HPUE 4K11A 3V5JA 4L44A 3EMGA 3ROCA 4E5WA 2B4SB 2YHVA 3CY2A 5E8XA 3RK5A 2GQSA 4FV4A 4U8ZA 2XH5A 3HV5A 3T3UA 5BMSA 2WD1A 2GS7A 2CCHA 4KABA 5ANJA 5G1XA 4PF4A 4AGDA 1JKLA 3KF4A 1ERKA 5CQUA 1RW8A 2YIQA 4CTBA 4CRLA 5CNNA 4FG9A 4G3GA 5IEYA 5C4KA 4TN6A 4BCQA 3V5LA 3C4CA 3LKMA 4BB4A 4DYMA 2W1EA 4I0TA 4E6QA 4JAIA 4GCJA 3NYXA 4O81A 3VF9A 2WTKC 4FIJA 4IVCA 4JNWA 2ONLC 4FR4A 2BRGA 4EQMA 2CGVA 4L43A 4MWHA 3OOMA 2RFSA 4KRDA 5M07A 3KRJA 4ZTSA 2Y6MA 4M13A 3H0YA 4W9WA 3LQ3A 2J0KA 1UNLA 1YHVA 5KMNA 1H27A 3F3ZA 4BF2A 1Q4LA 2GHGA 4QPMA 3A8XA 3CKXA 5JFSA 3F66A 5ICPA 5M4UA 3NVMB 2QHMA 2OI4X 1JAMA 3PVBA 3IPHA 4KUJA 3R1NA 3BLQA 5HTCA 4DEDA 2QR7A 3C4XA 3MH2A 5F95A 5D11A 1UWJA 3UO6A 4H3BA 5F1ZA 3R2BA 2PSQA 3GCQA 4QQCA 3K5UA 4IZ7A 5TO8A 4BZOA 5F4NA 3QLGA 4ZSAA 5JKGA 3TKHA 3S00A 3EB0A 3A7JA 3QX2A 3EYHA 4FT7A 3IG7A 1JSVA 2JDSA 4CKIA 1H1PA 3DQWA 1Q62A 2HZ0A 4O84A 3ZUTA 4TPTA 2OICA 3UYTA 2NRUA 3UO4A 3HV6A 4JXFA 4NH1A 2OXDA 4ONAA 4XG6A 5CI6A 3R7VA 4EQUA 4FEQA 5AAEA 2WTDA 3ACKA 4CKJA 3DCVA 3V3VA 3C5UA 4J97A 3RI1A 5HU3A 4I92A 3ZLSA 4X3FB 4EORA 1URCA 3E8DA 4F6SA 1VZOA 1HCLA 2ESMA 2GTMA 5CVHA 2HELA 3R63A 2AC3A 2E9OA 3SQQA 3SX9A 2V22A 4FSZA 2J0MB 5LVPA 4RC2A 4FV9A 1Q3WA 3D5UA 3EH9A 3E93A 4BRXA 3PA4A 4WT6A 4MXAA 2PYWA 1EH4A 4RLLA 3ZXTA 2C6IA 4CEGA 4XYFA 2PU8A 3PWDA 2VTNA 4E73A 3BBWA 4NTSA 5DEWA 5CY3A 5JZNA 4ANOA 4D9TA 4USFA 2PUIA 3ULZA 5EW8A 3W8LA 3UJGA 5CAPA 5JFWA 4NCTC 4OTRA 2ITNA 2C3KA 3SD0A 2EXCX 3BZ3A 3LJ1A 2CGUA 3PIYA 2XIYA 3BHTA 5CAVA 1H8FA 4FV3A 5CF5A 3PP1A 2ZV2A 4F0FA 3CJFA 2C69A 3ZONA 3UNKA 5J7HA 2OO8X 3P79A 2FSMX 2PVFA 3FBVA 4FKQA 5CEQA 5TR6A 2R3OA 2WU7A 3D94A 3MB7A 4JG8A 4L46A 4QMOA 4DCAA 2AUHA 3NIEA 4NW5A 4Z16A 2OG8A 4F9YA 4OTGA 3L8XA 5G6VA 3AC5A 2CN8A 5DT0A 3ZFXA 5AR4A 2XK9A 3QL8A 3QKKA 4M69A 5ETAA 4ZY5A 4GKIA 3M11A 4FZ6A 3DJ7A 2QD9A 2UZTA 5ANIA 4NM0A 4AT5A 4M67A 4TL0A 2YDKA 3Q5ZA 4OLIA 3EFWA 4ITJA 4R5SA 1WCCA 3LFFA 4HGTA 4WD5A 3QHWA 4PTCA 4OBPA 3QRKA 4MNEB 5FTOA 4EK8A 2ONLA 2WTJA 2P2HA 3ZEPA 3VUIA 4O7NA 3WF6A 1P5EA 3RPYA 4EK5A 3K2LA 1U54B 5AUWA 4L6QA 3ZO3A 4U43A 3FHIA 1B38A 3JS2A 3L9PA 2JAMA 4LOOA 3V6SA 4M66A 3CS9A 4C3PA 4IANA 5EG3A 5EYMA 4BIEA 3AMYA 2C5NA 3R1QA 2QC6A 4ERWA 4XRJA 1P2AA 4WO5A 4XLVA 3SA0A 3E8NA 2YWVA 3BHYA 2P0CA 3IGOA 4FIIA 4D2PA 2I7QA 4IVDA 3DB6A 3E92A 1WVXA 4I4FA 1QMZA 2ZM1A 3NRMA 1VEBA 1UNGA 4ASZA 3WE8A 4X2KA 4DH3A 4WG3A 5E9EA 3VULA 4ZSEA 5C27A 1PXNA 2A1AB 2CLQA 4B7TA 4E5AX 5E92A 3R2YA 1OKYA 4UALA 3E7OA 1R78A 4EH8A 3TZ7A 2BAJA 1Z9XA 5AJQA 3PXFA 3DDQA 3O17A 4U3ZA 1G8SA 3IW5A 2WB8A 2OBJA 5A4CA 4NK9A 2Y4PA 2ITPA 4YMJA 5JGBA 4FOBA 4UMRA 5GINE 4GG7A 4KB8A 4AA5A 2WEIA 1GJOA 4FEXA 4EYJA 3UODA 3FDNA 3VWAA 4KWPA 2QG7A 4II5A 4YJSA 3BCEA 4PMPA 5LVOA 3O71A 2OFUA 2UW6A 4G5PA 5ACKA 1YHWA 4BTJA 4NUSA 1HCKA 4RIXB 5AX9A 5IQHA 4AT3A 4F09A 5KKRB 1Z57A 4ZY6A 1W82A 4O0WA 5A46A 3ZBFA 4AWIA 4MHAA 5B2LA 2R9SA 4G16A 3W10A 4EWQA 2WNTA 4BL1A 2VNYA 4UV0A 4QP3A 3I60A 4GT3A 2C3IB 5CVGA 1A06A 2C1AA 2GTNA 1LR4A 3MPTA 2QHNA 3AT4A 1M2RA 3PJ2A 2J4ZA 2W17A 2FSOX 3FMEA 5LMAA 3AGMA 3ZRKA 4DGOA 4ZZOA 4Q9SA 2Z7SA 2WMWA 4AG8A 2C3LA 3DT1A 5HTBA 5EQEA 3UNZA 3BKBA 1H25A 2WELA 3A2CA 4AGWA 4MF0A 3Q04A 4MXZA 4F7SA 3RMFA 5HO6A 3IO7A 4ANNA 3HMOA 3Q96A 3F2NA 4JBVA 4TWNA 1KE9A 2G9XA 3CGOA 4FV5A 4IX3A 2OIQA 4IWPA 4NM5A 4WNPA 1H0WA 3TACA 4BWPA 5IH5A 5J87A 2IG7A 2XIXA 5B7VA 4GUEA 4R3PA 3FXWA 4IVBA 4X3FA 3OY1A 5EDPA 4AT4A 1M2PA 4YPSA 5FBOA 2WQEA 3HMMA 4KBAA 5A14A 2ITYA 4IEBA 3TV7A 2PZYA 2WMQA 2O64A 4M3QA 5CU4A 4DFXE 2JFMA 3MFSA 2VV9A 2X1NA 3I7BA 3TJCA 3PSBA 5T6KA 5C4LA 2C6KA 3G6HA 4FNZA 4NWMA 3VHEA 5I9XA 5DOSA 2C6OA 1Q8UA 5KKRC 1PMUA 3QQLA 3WE4A 4J1RA 2PVLA 5DRBA 5L4QA 3A62A 4IB5A 2W05A 3U9CA 4IAZA 3HVCA 2OJGA 1VYWA 1OB3A 3TN8A 4IWOA 4TYHB 4FZ7A 4EZ5A 3D9VA 3C4FA 2GNHA 5K0KA 1V0BA 2RGPA 3PZEA 2E9NA 5HX6A 2HAKA 2VWYA 3HUCA 3LFDA 3OEZA 4GUBA 5BVWA 2OF4A 1CKPA 5L2QA 3WI6A 4Y5QA 3QD2B 5C8MA 4CNHA 5D10A 3GCUA 3KRRA 2J6MA 5EI8A 4TT7A 3MWUA 4AZTA 4NEUA 4BCNA 4EEVA 4O86A 3V01A 2X2LA 3OT8A 4UMPA 1YWRA 3ZSIA 3BYOA 3ZEWA 4EL9A 5DMZA 3TG1A 3NYOA 2EUFB 4U9AA 3SXFA 4FNYA 4R1VA 3OWPA 5CU2A 3EFLA 5I9WA 5DRDA 4XHKB 1GZOA 2W1ZA 1OITA 3GBZA 3BPRA 4E4MA 5AA9A 4LMNA 4C59A 2WFYA 4QMSA 3A99A 2WGJA 4QTDA 2PTKA 4MNEA 4HVDA 1QPCA 3TDVA 3HAMA 4J98A 4EH7A 4QTAA 2HOGA 4DTKA 4K9YA 1PXMA 1Q99A 1U54A 3PXYA 4TW9A 3PXZA 5FQDC 2HZIA 4RBLA 5HD7A 1PMNA 2YLFA 2WOUA 4BGHA 4JQEA 1KV2A 2QOHA 2R3FA 4ZJJA 4XP3A 3SW7A 3D2IA 3KK9A 2HWOA 1AD5A 3B8QA 3MVLA 1CKJA 4V01A 4O96A 3OVVA 5HU9A 5BVOA 1Q8YA 5M53A 1E1XA 3QCSA 2YA9A 1R0EA 5A4LA 3W55A 3K3IA 4RFYA 4RZWA 2B52A 5FUTA 4BCGA 4QTCA 3QBNA 3DFCB 4JT3A 4I5HA 3BWFA 5E8WA 3R8UA 1H24A 3GU8A 3LIJA 2CKEA 4PV0A 2OFVA 2PZRA 3NNUA 3GU4A 3TUBA 4GH2A 5IQEA 1JSTA 2VD5A 3OXTA 2W1DA 4YZMA 5EK7A 4CLJA 5CF4A 2VZ6A 3UPZA 1SYKA 4FUYA 3E64A 3THBA 4O7ZA 4J96A 5CT0A 3QRTA 2V62A 3F2RA 2G2HA 3C0IA 2WKMA 2R3QA 3GU7A 1BMKA 5FM3A 3IDPA 4EWHA 2XB7A 4IACA 5IMEA 4TYJA 1JOWB 4E4NA 4QMQA 3PA3A 1G3NA 4WSYA 1BX6A 2IVUA 5E90A 5HEZA 4BGGA 2H8HA 1H08A 4NL0A 4DEHA 3MIAA 4D2SA 5LMKC 1FVTA 3KKVA 4RIXA 3ORTA 4FT9A 5EW9A 3UDBA 4QP6A 2DUVA 4FSTA 3NUAA 2BUJA 3BI6A 3IQ7A 4AW1A 1H07A 4WNMA 3R71A 5TF9A 5DLSA 4AZFA 4BCIA 4E20A 2XNPA 3GI3A 4Y83A 3GGFA 4RWJA 3OTVA 4GW8A 5IA5A 4QMYA 1LEWA 5IEVA 3KMUA 2W0JA 2FB8A 4UB7A 1WAKA 3ZZWA 4YNEA 2RSVA 2X4ZA 4FSRA 1PXKA 2FSLX 5AUTA 3VUMA 5IQCA 4Z7GA 2Y0AA 1P4OA 2P2IA 4O0VA 4F7LA 2GPHA 1XH4A 1W84A 3I0OA 3NDMA 4RWKA 3EYGA 5FEEA 4O7RA 4PDSA 5EYDA 5KHXA 5EHOA 2I1MA 3C4WA 5D12A 3D5VA 5JZJA 4NYEA 2Z7RA 4LGDA 3QAME 1K2PA 1ZARA 4FSQA 1QL6A 3Q3BA 4XBUA 5H2UA 2CKOA 1KOBA 2Z02A 1TKIA 5HO7A 2BDJA 2R3GA 2BRNA 3R9OA 2RIOA 4EHZA 4CFMA 5B0XA 1FMKA 3I81A 2XKCA 4YSMA 4AOTA 2OH4A 5M4FA 1OM1A 3QC4A 3ENMA 2RFEA 3ACJA 4FNXA 3ZZEA 3PXQA 3QTRA 3BV2A 4GYIA 4EONA 3QRIA 3MY0A 4EK6A 5AIRA 3ZHPC 1CKIA 1IASA 3IW4A 1YXUA 4IE9A 5KO1A 1M2QA 2VX1A 1R39A 4D2RA 2Z7LA 5FXSA 4DEGA 4XOZA 2OGVA 3UQCA 2XBAA 1DS5A 3WOWA 5BUIA 2R3IA 4ZJVA 4O7TA 4W4VA 1Q61A 1Y91A 5D41A 5AUYA 4C38A 1V0PA 4TYHA 3MTLA 5HNGA 4FYOA 4JQ7A 1ZYCA 4FIHA 4L67A 4XV1A 3SXRA 5KMKA 4DEIA 5IH6A 2XJ2A 3S95A 2QOFA 1WBWA 3VQUA 2F7ZE 1KE8A 3IDBA 4Y8DA 4C4JA 5AV2A 5CSHA 3HX4A 4AGUA 1YI4A 2W1HA 4HJOA 3H9FA 3COIA 4A9YA 1M7QA 3NUXA 4YURA 4UX9A 5K5XA 3SXSA 3IKAA 4USDA 4WBBB 2XNGA 4FMQA 2YJRA 3AD5A 4UWCA 5E4HA 2EXEA 1L3RE 4UMUA 5M44A 4D58A 5GIOE 3R8VA 2YZLA 4KINA 1Q5KA 4FL2A 2V7AA 3NPCA 4FKRA 4FV2A 4L3LA 1H00A 4QPAA 5A6NA 3GFWA 5A6OA 4O22A 4IZYA 4ITHA 4P4CA 5KZIA 3OC1A 2BRHA 4I3ZA 2A2AA 4WOVA 1FBNA 3OXZA 3ALOA 3E3PA 5TKDA 4GV1A 4BKZA 4Q5EA 5AP1A 4RX7A 3DGKA 2WIHA 1PJKA 2BDFA 2DYLA 3AC2A 4XLIA 3E88A 3GVUA 5J7BA 1U5QA 3E7VA 3DAJA 3E5AA 5FEQA 2CNQA 3I5NA 2WTVA 5LMBA 4F63A 3FMMA 3VVHA 4BIDA 3RPRA 4DAWA 3ATSA 1K3AA 3KEXA 4JX3A 3A4OX 4YC3A 3QRJA 1PYXA 2OJIA 3C9WA 3QXPA 3P5KA 3W2RA 3R1SA 3HA8A 4AFJA 4USEA 4OBQA 5K5NA 4HCUA 3ENHA 1XR1A 1BYGA 4RMZA 4ZY4A 3IGGA 4UXQA 5L6WL 3OFMA 5BPYA 2PVRA 3PVGA 5EHLA 1WFCA 5IA0A 2WQOA 2XMYA 4UYNA 3FKNA 3MVHA 4H39A 3MH1A 4I6QA 4O7WA 2Y8OA 4CMUA 2RG5A 2XVDA 1MQ4A 4G17A 4APCA 2BCJA 1W7HA 3HMPA 2G1TA 2C4GA 2XIKA 4BY9E 5EM8A 2JIVA 5BVNA 1O6YA 4Y85A 4EOPA 2H96A 2F49A 3MFUA 4C4GA 5LVNA 4PTEA 4R8QA 1ATPE 1FGKA 3NWWA 3NR9A 4GYGA 5CEKA 4CYIA 4IAIA 1F0QA 4WNKA 4C8BA 4ZTMA 4FV0A 2BKZA 4RGJA 3VS7A 4IW0A 4YZNA 3FZOA 4QRCA 5A54A 4AOIA 2ZOQA 2BILB 4ALWA 4H1JA 1RDQE 5HIBA 5M56A 4AUAA 3R9DA 2X8IA 3TKUA 3KXHA 3FMDA 2WOTA 3ZS5A 4KSQA 4BI2A 1F5QA 2W06A 2OK1A 3JVSA 4EHEA 3AOXA 3KFAA 5I9YA 4GS6A 3WIGA 2ITOA 2X39A 4E3CA 4GKHA 2R0UA 3EQDA 3KVWA 3QWKA 3U8WA 5C8NA 2F7XE 2HCKA 2ETKA 3AD6A 3DPKA 2VO3A 4TY1A 4IQ6A 4OTPA 2P33A 3P1AA 4C2VA 4F0IA 5CSXA 1SVGA 3GENA 2IZRA 2IW9A 1OUKA 2XF0A 3QTQA 3DNDA 4FL3A 2B0QA 1OIUA 4D2VA 4I23A 3KXNA 4BDHA 4D2TA 4E26A 5L6PA 3VNTA 5H9BA 4YHFA 1FMOE 4ZTNA 2VWUA 1Y8YA 4H3PA 2PE0A 3QZFA 3G9NA 4LL5A 4AZWA 3FXXA 4U0IA 5ITAA 5DT3A 4EH9A 3UIXA 4FICA 5IF1A 4W9XA 5IU2A 4PX6A 4A7CA 3VHKA 5EM5A 4QOXA 3AT3A 2RFNA 3BHUA 4FKOA 4QMZA 3LHJA 3JPVA 2HY0A 3DY7A 4MBJA 2YIRA 4F9WA 4H3QA 4UN0C 2IZUA 4XX9A 5HVKA 3QD4A 4RIOA 1ZOHA 3GFEA 2P55A 1PXPA 2QURA 2WTCA 4C4HA 5J79A 3N4VA 3NUUA 3TJDA 2GCDA 4BCMA 4U6RA 5FWKK 3TNWA 3RTPA 5GZ8A 3QKMA 5GJFA 1V1KA 4KAOA 1RE8A 1XH5A 3FMJA 2H34A 3K54A 3UOKA 3V6RA 4O6LA 3N9XA 2VN9A 3LE6A 2Z7QA 4X2FA 3G0FA 4YJRA 1ZMVA 2WZJA 3FC1X 4F6UA 3QKLA 4I6HA 2BZKB 1WBVA 3O7LB 2GQRA 3FJQE 1NA7A 3R7EA 3V5TA 2J0JA 2JITA 4XUFA 4H36A 2R3JA 3KRWA 4JR7A 4DTAA 2QLUA 5I3OA 5LXMA 5H8BA 4JDHA 3NSZA 3P7CA 4I21A 1NW1A 2ITTA 4G34A 4HYIA 4FTCA 4MF1A 3ZBXA 4K8AA 4D9UA 5HCXA 4RC3A 2JDTA 1REKA 3Q32A 5IQIA 4O1OA 2AC5A 2CJMA 2QKRA 3GCVA 2X81A 4YTCA 3O8TA 3RAHA 3VBYA 1ZAOA 5ETIA 3SGCA 1JWHA 2Y4IB 3EQIA 4K33A 4MNFA 4FE2A 2IZSA 4FV8A 5CT7A 4ACDA 4JDJA 4OTIA 2G15A 2WQBA 3G51A 4JIAA 2Y9QA 4YJOA 5E8TA 3EFKA 3PFQA 3T9IA 5JSMA 4GSBA 2EU9A 1OGUA 2ZV8A 4K1BA 3ORMA 5HCZA 4ACMA 3BU3A 3FZRA 4I0RA 4R1YA 4IJPA 3CSVA 2BRBA 1KE5A 2UVXA 5BVKA 3PVWA 1W83A 4F7JA 4XG3A 5EDRA 4LRJA 4ZK5A 3GEQA 4YSJA 2ZM4A 1P4FA 5EM6A 3HDNA 2HK5A 4MD8E 2WXVA 3VS0A 1M7NA 2VO7A 2O0UA 4FG7A 4AA4A 1ZLTA 2O8YA 3VBTA 5L2WA 3SC1A 3POOA 3QUEA 5AP5A 3ZUVA 3A4PA 1K9AA 4RVLA 3SOAA 5K3YA 1YOJA 4QPSA 5DGZA 2VTHA 3A7GA 4JAJA 3RWQA 3SW4A 3M42A 4KSPA 4G9CA 4G3DA 4U79A 3VF8A 5AAGA 4CYJA 1XH8A 3DKOA 4HYSA 4BIBA 5DH3A 3A60A 3H4JA 2I0EA 5B2KA 2Y4IC 5HHWA 1ZZ2A 1PXIA 3AG9A 4WIHA 5DI1A 3QALE 4XV9A 3I7CA 4BCJA 3DQXA 1LPUA 4JL9A 1KSWA 1GZ8A 2VTTA 4I1ZA 3HGKA 4EH5A 4LQMA 4GJ2A 4DGLC 4IWQA 4WBOA 3E8EA 4FZDB 3NYNA 5ACBC 3ZC6A 3ZYAA 4ZZMA 4BTKA 5H8EA 3R8PA 3PIXA 4EOIA 3COKA 4TWOA 4LV5A 4MEDA 5FXRA 5DWRA 3Q52A 4ITIA 2HY81 1JSUA 1TQPA 4D5KA 2PMNX 2NP8A 1VR2A 3FLZA 4R78A 4ZJIA 2V55A 3FZ1A 5ETCA 3DZOA 5KMJA 3UMWA 5F20A 3OW4A 3BYMA 1TQMA 4GK3A 4CFVA 4D4VA 3OCTA 1YXSA 3FL5A 4PTGA 5EKOA 4YC8A 2KTYA 2GFSA 3DZQA 3IONA 2W1FA 3QZGA 5FBNC 4O7SA 4PL4A 4CMTA 3H3CA 3GCPA 5AFVA 3JY0A 2J0IA 3TIYA 4BN1A 4RVTA 5BUEA 3ZSGA 3R30A 5IG1A 4JDKA 4QMLA 2I0HA 2X0GA 3CD3A 3QCXA 3BHVA 5CAOA 1Y6BA 1TVOA 2R7IA 3HV7A 4IBMA 5M4IA 4RJ6A 4PNKA 3IW7A 2X8EA 3MI9A 2VX3A 3MN3A 3ORLA 2QKWB 4CKRA 3KXGA 1S9IA 1XJDA 1YHSA 4IH8A 5CU3A 3QQGA 4PMTA 2XNBA 2VNWA 3MH3A 4YP8A 3SLSA 4AW0A 5JN2A 2J0LA 4K77A 4BHNA 2J51A 2G2IA 1WZYA 1BKXA 3EKKA 3JUHA 3QX4A 4AE6A 1JNKA 2CGXA 3S0OA 3UQFA 1UU3A 3IW8A 3MDYA 4U81A 4ANMA 3KRLA 4ID7A 4C34A 4B0GA 1YDTE 4LGHA 4APPA 4OAUC 3DBEA 3C7QA 2O65A 2Z2WA 3D15A 1FQ1B 3EL7A 3U51A 4YBJA 2UZOA 4OGRA 4HOKA 4F0GA 3PXKA 3ID6C 2X9FA 4RJ3A 5KE0A 4EI4A 5C1QB 4J99A 3FQSA 4EK3A 2ZAZA 4A9SA 2H9VA 1PKDA 5IQFA 3RPSA 1NY3A 3VBXA 2UW9A 4J8NA 4DFYA 5J8IA 3ET7A 2ZMDA 5IMXA 1PW2A 4G9RA 3F2AA 5GZ9A 3VUTA 4YZ9A 5CEIA 4FKLA 4D4YA 2SRCA 3TUCA 1MRVA 3GOPA 4PUZA 3EZRA 4I5MA 1GIHA 4RJ8A 3FQEA 3KCFA 3H10A 3O23A 3F5XA 1PMEA 3BGZA 5IQGA 4OTFA 4ENYA 4QP9A 2FVDA 3PZHA 4FV6A 5AV0A 5DN3A 4IADA 4TXCA 1WBNA 2OW3A 3R8LA 3UVRA 1XBAA 5DYJA 3O51A 3C50A 2HW7A 4YC6A 3UQGA 3DK6A 4KD1A 4DGNA 2VTQA 4A4LA 4FK3A 4QP4A 1STCE 2XIRA 4JLCA 2WTIA 4XS2A 4O2ZA 2I40A 3OZ6A 2FYSA 3B8RA 4JBPA 5EI6A 4ZSJA 3LFNA 5J5SA 2J50A 5H8GA 2OJ9A 4YZBA 4YJNA 4C4IA 4L3PA 2UZEA 4E4LA 2VWXA 4BDEA 2P3GX 3UZTA 4FT0A 4U5JA 5JFVA 4L7FA 2PVKA 4C3FA 1OI9A 1BL7A 4YLKA 3POZA 2GNGA 2OZAB 3F3WA 3C5IA 5M51A 3W2QA 4DN5A 4WRSA 4FUXA 4EOSA 5LMKA 3VRYA 2CKQA 1YI3A 1YKRA 2OU7A 3O50A 2VTAA 5K0XA 3KY2A 4IM2A 4ACHA 2C6LA 3O0GA 3PE2A 1KV1A 3RNYA 5IUHA 5IQBA 4AZEA 3HKOA 5J9LA 4I41A 4WKQA 3A8WA 5FG8A 3PJ8A 4QYFA 5CS6A 3SOCA 4Q9ZA 3TL8A 4Z7HA 2QQ7A 3V8SA 1Q8ZA 4RJ7A 3FV8A 1QPEA 2R3HA 4PL5A 3R0TA 4QMWA 3RHXA 4QQTA 4GU9A 4X2JA 5K4JA 4FTLA 3VW6A 4ZLOA 4AOJA 1NT2A 5AV1A 3TDWA 5FDXA 2RL5A 2BFYA 2UW0A 2QNJA 1ZRZA 3OOGA 5CI7A 2B7AA 4IC8A 5A4QA 3CP9A 3QXOA 3ZO1A 3MBLA 3OBGA 2GFCA 3SRVB 5LOHA 4NSTA 2PWLA 5J95A 2UZNA 2GNLA 3PLSA 1GIJA 3AC1A 4NCTA 4NFNA 3GC7A 3OXIA 2YDIA 3FMNA 3PUPA 5L6OA 2UZDA 5ANEA 5CSVA 2YM7A 2UZLA 2W5AA 3F3VA 3H9RA 2EVAA 4O38A 1KE7A 3T8OA 3FAAA 3M1SA 4RA4A 4Z9LA 3KMMA 1B6CB 2X7FA 3EQFA 3PY3A 4I4EA 4X3JA 3CXWA 4F1TA 3QA8A 3VS5A 1Q41A 2WMBA 3FKOA 2IN6A 4FEWA 3BHHA 2BAQA 3EOCA 4NTTA 2DWBA 3K3JA 2ZMCA 4IAFA 4RIWB 2F2CB 4RIYB 3R8MA 4OTHA 4DH8A 1IA9A 1KUTA 4EJ7A 3FLQA 5LCJA 2XJ1A 4EOJA 2PVYA 3VS3A 5HI2A 2ERZE 3L9LA 3VBVA 2OJFE 2X7GA 4QNAA 2BZIB 3QA0A 2YIXA 1LUFA 2F4JA 3TV6A 2BHEA 2XCKA 2XUUA 4L3JA 3L9NA 2CNUA 3COHA 4OR5A 2FSTX 2XK3A 3UIUA 5M08A 3QYWA 3OWLA 2QO2A 4J95A 3DXQA 2X9EA 2AYPA 3RZBA 1AGWA 3FI2A 4C61A 4KRCA 5CZHA 4IVAA 3NX8A 3PSDA 2HZNA 4H05A 4TYEA 4DBXA 2ZDUA 1DAWA 3DJ6A 5FTQA 5HX8A 5JK3A 2YISA 3UE4A 4BBMA 4M7IA 4G6LA 3FE3A 4PP9A 3R8ZA 4DITA 3BV3A 2NO3A 2WAJA 2C3JA 4FEUA 4J52A 4EOKA 3PA5A 4RVKA 2A27A 4FF8A 5JQ8A 2W1GA 3WILA 3C0HA 3UVPA 4OAVB 3OHTA 5DEYA 2HZ4A 3OBJA 4RJ5A 3P7BA 4YJTA 4Y73A 4O7LA 2UW5A 3HL7A 1JBPE 4G31A 1OL1A 4Y72A 3FY0A 2GSFA 4HYHA 2GHLA 2OWBA 3DTWA 3R9NA 5AIKA 4R7HA 5CAUA 5HBJA 4FKJA 1XBCA 2IVTA 4L52A 4NW6A 4PRJA 5D7AA 5IQDA 4M8TA 3DJ5A 5DR2A 4ZTLA 1DM2A 3JXWA 4KKEA 3P9JA 2YITA 3FMKA 3QQKA 3FZPA 4R3RA 4KIPA 4ANBA 4DG3E 3WARA 2C5XA 3FKLA 3QTSA 5AR3A 1DAYA 4MAOA 5E91A 3UVQA 3LFEA 3VUKA 4BTMA 4CCBA 3DTCA 2QODA 1GAGA 3E63A 5BVEA 4Y5HA 4X21A 2OIDA 2O2UA 3OCGA 4B8MA 4YO6A 1WBTA 3NEWA 3R28A 3BYSA 4BFMA 2CGWA 4FTUA 2XIZA 4TYIA 1RJBA 2ETMA 3EN9A 3EN6A 1Q24A 2PVJA 3F5PA 4AW5A 5BMMA 4QP2A 1R3CA 3EKNA 3L8VA 4BCHA 3EQBA 1OL6A 1ZZLA 4LV8A 5LARA 3UC4A 2OZAA 5IA4A 2OLCA 5IZFA 2VWBA 4EH2A 3NS9A 2BVAA 3I5ZA 2CKPA 5HE0A 4ASXA 5L2IA 3R9RA 3VJOA 3V8WA 5J9ZA 5IDPA 3WZKA 1OL7A 2C5YA 3P23A 3R1YA 5L3AA 2JDRA 3DOGA 4RRVA 5IEXA 3P08A 2C0IA 3PPKA 3QD0A 1OVEA 3PY0A 4EK4A 3DK3A 4GK4A 4LRKA 2IPXA 3HZTA 2PK9A 5HTIA 4V0GB 5EQYA 3ZRLA 3FMLA 2GNIA 4ZIMA 4EHVA 2VO6A 4ZSLA 4D0WA 3KREA 3D2KA 3MTFA 3ATTA 2F9GA 4C7TA 3UZPA 2WEVA 2UVYA 5CU6A 5CNOA 4IM0A 4NFMA 2RFDA 5HG9A 3FYKX 4QTBA 5HLNA 3HP5A 3FI8A 2F7EE 4IFCA 3SRVA 3KCKA 3O2MA 4GVAA 4RLKA 4U41A 4F4PA 4KIOA 4CD0A 4CT2A 3RHKA 5JT2A 4FV1A 2J2IB 3PXRA 3V51A 4BDAA 1WVYA 4FT5A 4JQ8A 4FGRA 1XQZA 2YERA 1URWA 2JKOA 1IRKA 4DHFA 4AQCA 4FA2A 3RPOA 1YXVA 4BZDA 2YACA 1YXTA 2A19B 2WMRA 3PP0A 4BDFA 4I5CA 5A3XA 4CFXA 5JFXA 2YAKA 2VAGA 3DBQA 3DS6A 3W8QA 5IPJA 1LP4A 3QYZA 4ZOGA 2HIWA 5J1WA 4OT6A 5T68A 4FT3A 1ZXEA 2EB2A 5GNKA 2ZM3A 3HMIA 5DPVA 4D2WA 3U6JA 3VAPA 4NZWB 2WMSA 4RIWA 4RIYA 2W99B 3QQUA 4RWLA 4QYGA 2BIKB 5CXHA 4BWKA 3C13A 1J3HA 2JKKA 3P86A 2W5BA 4FL1A 3UP2A 3FHRA 3NCGA 2QOBA 4JS8A 3NW5A 3WZUA 2OIBA 4ZTRA 5M57A 3ORKA 4QP8A 4UWYA 5E8SA 5CSPA 3QQHA 4FTMA 4FK6A 5AP3A 4DEAA 2H6DA 3T9TA 1OBDA 4FKWA 5DNRA 3LFQA 4GRBA 2UZVA 4BBFA 3L9MA 4GL9A 4N0SA 4EH3A 1M17A 2XK7A 4DLJA 3BX5A 4NKSA 4E6CA 2O3PA 3G2FA 3AGLA 2BZHB 5I3RA 4R7IA 3CQUA 4FTJA 4CZTA 4JVGA 4FODA 2Q83A 2C6DA 4HNFA 4BHZA 3B2TA 3CKWA 2EXMA 3UC3A 3B2WA 4BYIA 4EOOA 5BUJA 3D7ZA 4EH4A 3NIZA 1XH6A 4FSUA 3RAKA 3ZUUA 5IUGA 2BALA 3LXLA 4BI1A 4ENXA 4ZAUA 2XM9A 4O0UA 2GHMA 5EYKA 2QOOA 3BWJA 3OCSA 4BKJA 1ZYSA 4L9IA 1U46A 2ITWA 4DGGA 4BDCA 1W8CA 3RKBA 3U4UA 4NT4A 4CQEA 2XCHA 4FTIA 5I0BA 3FSFA 4FSYA 2IVSA 3SKCA 2ZDTA 3EZVA 5E1SA 3TNHA 2F57A 3PVUA 4TWCA 3ZDIA 3Q60A 4QP1A 2E9PA 2FUMA 3JR1A 4F99A 3MPAA 5J9YA 4F65A 1IA8A 4O7YA 3QUDA 3Q9WA 4XJ0A 2HXLA 3SAYA 5L2SA 3R7OA 4ALUA 5KX8A 3DBDA 3G90X 2PULA 4G1WA 3FQHA 2QOIA 3ZLWA 4G2FA 4XV3A 3R7YA 3VC4A 3RPVA 2J9MA 3R6XA 3VS2A 5HO8A 3UG2A 3MFTA 4M84A 4ANLA 3F7ZA 4L8MA 1BL6A 2YM8A 2C6MA 3VUHA 2J90A 4O6EA 3QQFA 4N70A 5CF6A 4LG4A 4MD9E 4IX4A 4FX3A 4EBVA 3CJGA 1CM8A 4N57A 2VTOA 3MV5A 3QC9A 5HGIA 3ZOSA 1WMKA 5A4EA 3OWKA 1ZYJA 3PG1A 4LMUA 4U7ZA 5DT4A 1GZNA 3DXPA 5M09A 4AU8A 4EOMA 4BBEA 2VTMA 5I9ZA 4HPTE 3R7GA 4RFZA 4GFGA 4PNIA 4YLLA 3ANQA 2R4BA 1JKKA 4XH6A 5D9HA 3NYVA 4IDTA 3DLSA 2WHBA 2GNJA 4XP2A 3R7IA 2VX0A 3LVPA 3MPMA 1Y6AA 3DAEA 4ORKA 4GK2A 4UY9A 1G8AA 1W98A 4WNOA 2BPMA 4ZZNA 3LMHA 3PYYA 1IR3A 5HG8A 2PY3A 2QI8A 5I9UA 4FKSA 3ZU7A 4C4EA 4V0GA 4OTDA 4QMXA 4AA0A 3NUNA 2HYYA 4QNYA 1OIYA 5HIEA 3FPMA 5AUZA 4CRSA 4MX9A 4QTEA 2UVZA 3I0QA 1FINA 5JRSA 4C36A 4AZVA 4FIGA 4P90A 5HESA 1SNXA 3HDMA 1YI6A 1FVRA 3KC3A 5BYLA 3MW1A 4K2RA 4NIFB 4S30A 4O7VA 4DFBA 3UOLA 3ITZA 4LOQA 4YHJA 5E1EA 5E8UA 1Q8TA 4IFGA 2C1BA 2IWIA 1BI7A 3KQ7A 3KULB 3Q9XA 2YJSA 1H1RA 1GY3A 3ULIA 1OECA 3CCNA 4LUDA 4CSVA 1OIRA 1T46A 3TV4A 4UMQA 5AP0A 4MXOA 3TXOA 3H30A 5IH4A 3OP5A 3ORZA 4FZAB 4M15A 3NNXA 5ETFA 3RGFA 4CFWA 4F9CA 4G5JA 4IC7A 5CWZA 2J7TA 4FKVA 4HNIA 3LXKA 3VS6A 4QYEA 3LM5A 3I4BA 4G3EA 4I5PA 5GHVA 2YLEA 3Q4UA 5FRIA 3F9NA 4AAAA 3PG3A 4RQKA 5DG5A 3MJ1A 5EOLA 3E62A 4C62A 4F1MA 4RT7A 3AMBA 5EQPA 4FTRA 1B39A 3DKFA 5BX0A 1SVHA 1CMKE 3UPXA 3F6XA 2DQ7X 5FP5A 4E1ZA 2LGCA 3NUPA 3FXZA 3LLAA 2BKKA 3PPJA 5JEBA 3EN5A 2WMXA 1J7IA 3F82A 3UGCA 3OD6X 4XMOA 4M12A 3P78A 4IZAA 4BCKA 4P5QA 3RWPA 4AX8A 4RX9A 4TNDA 5TE0A 5AUVA 3N4UA 4I24A 3LW0A 3HRBA 2QR8A 3GB2A 4HGLA 5HE1A 3R83A 4EC9A 1U59A 3RJCA 4LM5A 5KMMA 3FLNC 1QPJA 1OKZA 4XG9A 5LVLA 3TT0A 3U6IA 5C9CA 2EB3A 1LEZA 2XP2A 4P7EA 2W9ZB 5DHJA 2PVMA 2WIPA 2WQMA 3RINA 2GMXA 2VTSA 3EFJA 3A7IA 4D4RA 2QU6A 4K18A 2CCIA 3V04A 4M68A 4ZMEA 1WBPA 3BGPA 2RG6A 2W7XA 2XKDA 3QHRA 2X8DA 4IXPA 1UU9A 3VJNA 1TQIA 2O63A 3F88A 4QD6A 3E8CA 4FI1A 4XOYA 3TTIA 4YPDA 3S4QA 1UWHA 3BLHA 1PYEA 2JDVA 1J1CA 5AR8A 2BDWA 1KWPA 3KXZA 5AR2A 3EWHA 5HICA 4AN3A 2XKFA 1YRPA 5EOBA 3WF8A 3RZFA 1L8TA 3KRXA 4M97A 4RWIA 3KXXA 3BLRA 3QZIA 4OUCA 3BEAA 1OPLA 4R3CA 2W1CA 3BYVA 4GT5A 2IO6A 4RVMA 4BC6A 3LCDA 2WMTA 3RP9A 4NJ3A 3VBWA 5HG5A 3KB7A 1JVPP 4S34A 3F5GA 2NPQA 5JRQA 3FI3A 4WG4A 4XNEA 3CPBA 5CX9A 3VUGA 4BCFA 4CZUA 1M52A 1PMVA 2ACXA 5AM7A 4BDKA 1BI8A 1SNUA 2R64A 4ZEGA 3IK3A 4I22A 3EIDA 3T3VA 2OSCA 5DBXA 4S2ZA 2W96B 3ZDUA 2E2BA 3D5WA 4JG7A 3ZRMA 5FTGA 4C35A 2VU3A 4PP7A 4DA5A 4HVGA 3I6UA 4EKLA 2B9FA 2OZOA 4FC0A 4DLIA 5JGDA 1BLXA 2R2PA 1JKTA 3ORPA 5KUPA 4X2NA 3RBWA 4E6AA 3VUDA 3LCKA 2W4KA 4XG4A 3UMXA 3R04A 3KL8A 3S2PA 4PPBA 1JQHA 4X0MA 3BELA 3DFAA 2BHHA 4GU6A 3Q6UA 3TIZA 4Z55A 3H0ZA 1JKSA 2XK8A 2BRMA 2R3NA 3F5UA 3LAUA 4XCUA 2UW3A 4B8LA 4IMYA 1H26A 4AGCA 4FBXA 4YTIA 2GU8A 4QYHA 5HKMA 3O96A 3I1AA 2G2FA 1MRYA 5C8KA 1ZMUA 4RA5A 1P14A 3UG1A 4U80A 4QMUA 3L1SA 5CEMA 3MESA 2UW4A 4ARKA 3MGYA 1Q3DA 3L8PA 3NUSA 5KBRA 4JIKA 2X4FA 3QFVA 3LFSA 5CENA 3LJ2A 4QP7A 5BYZA 5AP6A 3HNGA 1S9JA 4JR3A 3NZ0A 1ZY4A 4LYNA 4M0YA 2QOCA 4A9TA 5GIPE 4CXAA 3PIZA 4AZSA 3QWJA 3GU6A 5TOZA 3QQJA 4KBCA 5AAFA 3VBQA 2EWAA 4NIFA 4DFLA 1ZY5A 5ANKA 3W2OA 5E8ZA 2B1PA 1GOLA 4TRLA 3CLYA 3EN7A 3BRBA 3F3UA 3G0EA 3PJ1A 2DS1A 3FSKA 3ZM9A 2CPKE 2FO0A 2G01A 3TM0A 4E93A 4U40A 3KULA 2XK6A 3RK7A 3R22A 2J5EA 3UIMA 4IHPA 1DI8A 1OKVA 4PDPA 2VTRA 4YTHA 4NM7A 4MD7E 4C3RA 4J7BA 2C0OA 4MQ2A 2BROA 4AS0A 4O0YA 3FC2A 5AUUA 1REJA 2QO9A 5IISA 2WMAA 2WMUA 4RPVA 1PHKA 2FA2A 4UZHA 5DIAA 4CCUA 2E9UA 5GJDA 4FSWA 1CTPE 2YCFA 2YCSA 5EW3A 5HCYA 2Z8CA 3KGAA 2BAKA 3PDTA 2QOKA 4RZVA 5C01A 3Q53A 2UV2A 2ITXA 5JH6A 4D4SA 2I0VA 2JBOA 5K4IA 4RQVA 4BVUA 3II5A 3OS3A 1NXKA 4LUEA 3D14A 2C0TA 3EQRA 2GS6A 4UMTA 4XV2A 4HCVA 3W2CA 2XS0A 3QTIA 5HE2A 3ZLYA 4EHGA 3OF0A 4L45A 3W2PA 4X7QA 4EQCA 2ZB1A 3S1HA 4F08A 5BVFA 4QYYA 1U4DA 1T45A 4TZRA 2JDOA 1BUHA 3R01A 3ZMMA 4HCTA 2F2UA 2GDOA 4IAAA 4EC8A 1XBBA 4JRNA 3PTGA 1XKKA 2A0CX 2IW6A 2YIYA 4LGGA 4IIRA 1PKGA 2QVSE 3KF7A 3UYSA 4KKHA 1V0OA 3PLAE 2JD5A 1MP8A 2A4LA 2C30A 2Q0BA 4HGEA 4UWBA 4CFFA 3BYUA 4PL3A 4HZRA 4MBIA 4O0TA 3U9NA 4L53A 2JC6A 3ZTXA 2WU6A 4FTKA 3LXNA 4FTAA 3HRCA 3VN9A 4EOQA 3QTZA 1H0VA 4L68A 3MY5A 4YJUA 3UO5A 2YM4A 2UW7A 5CYIA 2XEZA 4AXAA 5JMSA 3G33A 3CD8A 3MYGA 3RK9A 3MVJA 4QMMA 4RFMA 4L00A 3ORIA 4X6QC 2QG5A 4BR3A 3HV4A 4PPCA 4C02A 4DBNA 4NM3A 2REIA 3LZBA 4PDYA 3TUDA 3V5WA 4GEOA 1QCFA 4U3YA 2YABA 5C03A 4AW2A 3A7FA 4EKKA 2WO6A 2C5VA 3BIZA 5FGKA 2XK4A 5F9EA 4PMSA 3D5XA 4IAKA 3LCOA 3MB6A 3ZM4A 2JIUA 5HLWA 5ANGA 3FZTA 3R02A 4AE9A 4KKGA 5A4TA 4X3FC 5K9IA 3NVKI 4HZSA 3ZCLA 2PL0A 3DNEA 4A9UA 1GIIA 4TNBA 5EHYA 4DH7A 4B9DA 3W1FA 4E7WA 4R5YA 2V0DA 3KMWA 5IDNA 4GFMA 2XRWA 4ERKA 4FOCA 4K0YA 4FV7A 1VYZA 4JBOA 5DR6A 2CNVA 4XG8A 4DF3A 3UZRA 4X2GA 5CU0A 3U4WA 2I6LA 2OKRA 1IAHA 3I6WA 4HGSA 4NJDA 5H3QA 3Q2JA 3D83A 2QOLA 2VO0A 3D0EA 1ZYDA 5GZAA 4E5BA 3WF9A 4GFOA 1ND4A 2BTRA 5FEDA 3C4EA 4XG7A 1WVWA 2HW6A 1U5RA 1UNHA 3QGYA 4I93A 3COMA 4IX5A 4BGQA 5I4NA 4YO4A 4U45A 4O0RA 4B4LA 4F64A 3ORNA 4PQNA 5DE2A 3NMUF 2XRUA 2VTPA 2E9VA 3UP7A 2IJMA 3ELJA 5LQFA 3IECA 3S3IA 5I5ZA 3HA6A 4FVPA 4ZXTA 4EJNA 4U97A 5IKWA 2Z60A 3HMNA 4V04A 2JEDA 4H1MA 3QU0A 5CTPA 5DR9A 4AP7A 5CXZA 5HVJA 4N6YA 4DGMA 4LFIA 4F70A 1H1WA 5AEPA 1ZMWA 3D4QA 2VGPA 3GUBA 4F1OA 3DA6A 4ZSGA 5CVFA 1O6KA 2X6DA 4FZFB 4IB1A 5AM6A 3WF5A 2W4OA 4W8DA 3PJ3A 2XJ0A 3ORXA 4MBLA 1HOWA 4IB0A 5AP7A 2OH0E 2UZBA 3NAXA 3IOKA 3PE1A 1UU7A 2YM5A 5CQWA 1KE6A 5CZIA 4CFNA 2YCQA 4CMOA 3D7TB 2ZV9A 2IW8A 4F7NA 1KOAA 1M14A 2YCRA 3PJCA 2XNMA 4J8MA 4GMYA 3KA0A 5LWNA 1JPAA 3MVMA 4W8EA 3VIDA 3ZO4A 2PUUA 4ZMFA 4RSSA 4TKSA 1X8BA 4FTOA 1MQBA 2YEXA 2IZTA 4Y95A 4DINA 2CSNA 3IW6A 4I6FA 4ACCA 2Y7JA 4XBRA 1YDSE 2B55A 3F69A 4FNWA 4HYUA 4I0SA 4R6VA 3RVGA 3UIBA 4ACGA 1J91A 3QF9A 5CEOA 5HVYA 3U54A 1H01A 2XZSA 4RC4A 3EQHA 1CSNA 5AR7A 3W18A 4QO9A 5FM2A 4IX6A 3Q9YA 1VJYA 3DK7A 4YZDA 4U42A 3WF7A 3HAVA 1JLUE 4O0XA 4Y46A 3ZXZA 4MK0A 2FGIA 4XEYA 2ETRA 3DXNA 4N4SA 5CALA 2BMCA 4P2KA 3H9OA 1H1QA 2OXXA 3DBCA 2YIWA 3FL4A 3QLFA 2UZUE 4UYAA 5IUIA 4CVAA 1PF8A 3QCQA 3V5QA 3C51A 3HECA 4WG5A 2CN5A 4MCVA 5AADA 2OF2A 2R3KA 4W4YA 2CLXA 3C4ZA 3KVXA 5E7RA 1YOLA 2WTWA 5E8YA 5FXQA 4L7SA 3ZC5A 4DEBA 4QMTA 3DDPA 5HNBA 4BCOA 4DT8A 3CE3A 2JKQA 1IAJA 4RG0A 4JI9A 1PXOA 3MA3A 2PPQA 3ALNA 3CPCA 3TI1A 5L8LA 1GNGA 4I94A 3OEFX 4W4XA 3DV3A 3NUYA 4BZNA 5TT7A 3RM7A 1OL2A 4F6WA 5KMOA 4O2PA 4YJQA 4D1XA 3Q4TA 3KN5A 5M06A 4CV9A 4RJ4A 1APME 3Q4CA 4NU1A 5EH0A 2YWPA 3TZ8A 5CANA 4DEEA 2JFLA 5DFPA 4G3CA 3W33A 3LMIA 4UZDA 2CDZA 2UW8A 3ERKA 3NCZA 2QOQA 4RX5A 2C6EA 4S32A 4FKGA 2NNWB 2QU5A 3NLBA 1QPDA 3MSSA 4RX8A 4WUNA 2BFXA 2VRXA 3CC6A 3TNIA 3DAKA 2Q0NA 3RCJA 4OTWA 4FTTA 3V5PA 3QUPA 1Q97A 1Z5MA 3EQCA 3GU5A 2X2KA 2R5TA 4TWPA 4AACA 5LWMA 3F61A 4ZS0A 5JQ5A 4D28A 3F3TA 3RNIA 3NNWA 2ZB0A 1ZOEA 4DT9A 5KNJA 4C58A 3NW7A 5C26A 5BYYA 2XBJA 5BQ0A 3V8TA 2PZIA 4JJRA 5AP4A 2XEYA 5FP6A 3LPBA 4ZLYA 4D1SA 3DBFA 3Q2MA 3EHAA 4PDOA 2ERKA 4YTFA 4DFNA 4Z3VA 4R7BA 4JBQA 3Q4ZA 4MWIA 4D5HA 3BEGA 3A61A 3KN6A 1IG1A 2X6EA 3WZEA 5GJGA 4YLJA 1FPUA 1H1SA 3SDJA 4A07A 5J5TA 2B9IA 1MRUA 2ZYBA 3QD3A 1O6LA 2VWIA 1RQQA 2ZV7A 4YGAA 3SV0A 1G5SA 2VGOA 4AN2A 4BCPA 4LRMA 4PWNA 4GG5A 4MQ1A 3VO3A 4N6ZA 4F9AA 3UOHA 2B53A 5HLPA 3RCDA 5EKNA 5HQ0A 4EH6A 4UXLA 5CASA 3ZFYA 3UBDA 2VWZA 3NNVA 2Y6OA 3BU6A 3MA6A 3LQ8A 2XYNA 5T3QA 3ETAA 3WZJA 5L8JA 2C6TA 3R9HA 1OMWA 4PMMA 2YFXA 4MXYA 5EFQA 1OPKA 2O5KA 5AWMA 5M4CA 2PUNA 3GCSA 3FYJX 4IB3A 4IJ9A 5AA8A 3AMAA 3ZLXA 4ASEA 1Q8WA 3QRUA 2JLDA 4L01A 3ZH8A 3LFAA 4FKTA 1H28A 3QCYA 3D7TA 3QTWA 4CG8A 4O27B 3TEIA 2QLQA 4MYGA 2UZWE 3EN4A 2C5OA 2VWWA 3CIKA 4FSMA 4O1PA 4UEUA 5CF8A 1A48A 2J5FA 5AV3A 2PMIA 3E3BX 4FVQA 3K5VA 3ODZX 2KULA 2ZVAA 3QZHA 1IEPA 3FI4A 3FLYA 4C33A 5HD4A 3CY3A 4B99A 5FDPA 1ZYLA 4QT1A 5D1JA 1J1BA 1YOMA 1UKHA 3GOKA 5HORA 4CQGA 3PSCA 2PMOX 5HOAA 3ZFMA 4CTCA 2JAVA 2VTIA 4MH7A 3AQVA 5KBQA 5ANOA 2R3LA 3GNIB 3WZDA 4EZ7A 5DVRA 3AC3A 4MXCA 5IA3A 4D1ZA 3GC0A 4BI0A 5HG7A 4C4FA 1UA2A 3W2SA 3M2WA 4JOAA 3FPQA 4E6DA 1YQJA 4BICA 5BVDA 4YHTA 3GQLA 3PRFA 3BE9A 3PPZA 2QONA 5HNIX 3ZO2A 3QTXA 3REPA 3MS9A 3VW8A 3FY2A 4X6RA 2W9FB 3R00A 3OTUA 3JY9A 4KS7A 4A4XA 4DC2A 4BDDA 1R1WA 3MFRA 3KK8A 2XA4A 2XNEA 4MXXA 2LAVA 4BDIA 4IAYA 4E8AA 4C2WA 4ASDA 3OW3A 3QGWA 4KS8A 4QQ5A 4YUQA 3LM0A 2ITUA 1CDKA 3FWQA 3ZSHA 5BNJA 2JIIA 2YM6A 3OY3A 1FOTA 4ANQA 3SG9A 2BIYA 4B6LA 4G6OA 1E1VA 2R3MA 4KIKB 4O82A 2QO7A 4FVRA 1YWVA 2I0YA 4J53A 5IQAA 1YXXA 1W0XC 3CR0A 3HUBA 4J71A 4TYGA 1PXJA 5M55A 2VWVA 1OZ1A 1SMHA 1UVRA 3MIYA 3VS1A 3RAIA 2PE2A 2RF9A 3G9LX 3PWYA 3GC9A 4JG6A 5J1VA 4A4OA 5L2TA 4GT4A 5KMIA 4ZTHA 3EJ1A 3TKIA 5CSWA 3N51A 4C37A 2CHLA 5IA2A 4W4WA 5B2MA 3GP0A 3RALA 4CFUA 2YN8A 4FIFA 2GNFA 4OT5A 5EM7A 1MUOA 2CMWA 1ZOGA 3AC4A 4CT1A 3DU8A 1AQ1A 2BTSA 1YW2A 2GS2A 4KA3A 4EBWA 1OL5A 2UUEA 4FKUA 4WRGA 5KZ0A 3LFCA 4U44A 3F7WA 3WBLA 1A9UA 3OMVA 3P0MA 1UU8A 4ALVA 3TTJA 2OXYA 1Y8GA 3EQGA 4FTQA 4EYMA 3LCTA 3U87A 1SM2A 1OPJA 4CLIA 3CEKA 1OBGA 2BR1A 2RKUA 3LMGA 2ITZA 3TWJA 3RM6A 5AP2A 3BBTB 3SG8A 3R73A 3FZSA 3MH0A 3KXMA 3SHEA 5AR5A 5HE3A 3LJ0A 3P4KA 4OBOA 1XWSA 3TCPA 2FH9A 2XNNA 1XH9A 3GC8A 2P4IA 4A06A 4HVSA 5A9UA 4UBAA 2ITQA 4JRVA 1YDRE 2YAAA 2JGZA 5FLFA 1NVSA 4FKPA 4M0ZA 4WSQA 5FD2A 2PUPA 1Y57A 1GZKA 3KU2A 3LCSA 5KHWA 2R3PA 3BE2A 3O8PA 1OUYA 3EQPA 4H58A 4JDIA 3OROA 2JKMA 3FLWA 4TTHB 3NGAA 4DTBA 2HXQA 5D7VA 3TZ9A 2PE1A 5HIDA 5DA3A 2C47A 1FVVA 3AT2A 5AUXA 3AD4A 5CLPA 3QTUA 3BU5A 2QCSA 3N4TA 3WYXA 3NAYA 2XYUA 4XRLA 4BDGA 2XNOA 3FLSA 1YWNA 3PY1A 4K6ZA 4DE4A 3WYYA 3ANRA 3BQRA 1J7LA 3ODYX 1XHAA 4WA9A 4OTQA 4BYJA 3VS4A 4DH5A 4IZ5A 4FG8A 4WUAA 4BDBA 1OKWA 2YM3A 4DFUA 2B9HA 1F3MC 4XG2A 4LL0A 2PHKA 4NKAA 3G6GA 4FTNA 4FGBA 1PXLA 4IDVA 4PPAA 1J7UA 3TZMA 4G6NA 4BKYA 5CEPA 3LLTA 1DI9A 3LXPA 5EYCA 3MJ2A 3BQCA 5JGAA 4LI5A 5AX3A 5IA1A 1I44A 2WPAA 3C0GA 2V5QA 4MTAA 4XP0A 3FEGA 4O0SA 4FKIA 4QMVA 5E8VA 3CTQA 3BGQA 3DKGA 4FEVA 2W5HA 4C57A 4YJVA 1H4LA 4YZCA 4IM3A 4KIQA 2NRYA 4BTFA 4ZS4A 3FUPA 3SVVA 3LOKA 3PRIA 2V7OA 4BDJA 4QMPA 4EUUA 3VQHA 4YU2A 2XKEA 5CAQA 2HENA 2YZAA 3Q6WA 3OG7A 3ROYA 1YVJA 4AF3A 5LVMA 2YDJA 3MY1A 3Q9ZA 2C68A 2R7BA 2WQNA 2VTJA 3IDCA 4P5ZA 1NVRA 4V05A 4IWDA 5L8KA 1WBSA 4FSNA 4YBKA 5ANDA 3OUNB 3OWJA 3VRZA 4OW8A 4HVIA 4YR8A 4CG9A 4O83A 2GQGA 3DB8A 3O7LD 4Q5HA 4EUTA 2B9JA 3CTHA 1O9UA 4CZYB 3CTJA 3I79A 3W32A 4GIIA 4AFEA 3L8SA 4R77A 1UV5A 4GJ3A 4DG0E 1OIQA 3HP2A 4KNBA 4KIKA 5HBEA 1XO2B 3E87A 3DLZA 3RAWA 4DCEA 4QQJA 4A9RA 2PZPA 3R7UA 3HLLA 4YJPA 4D55A 2X2MA 4I6BA 4ZP5A 2PVHA 2IVVA 3OUKA 1UKIA 2ZJWA 2VUWA 4ANSA 4AN9A 1I09A 3WIKA 3CGFA 5F94A 3IS5A 3TNPC 4LOPA 3O8UA 3GQIA 3GT8A 3LFBA 3CQEA 1PY5A 4G3FA 4YNOA 2R3RA 1ZWSA 2PZ5A 3EL8A 4DG2E 3HYHA 1NVQA 4F9BA 4O21A 2OJJA 3NW6A 4FYNA 3G15A 4M69B 3R21A 2PVNA 3CQWA 1FGIA 4ZTQA 4EOLA 4MVFA 3FMHA 3OCBA 2W1IA 4GVJA 5I9VA 4S33A 3U55A 2R0IA 5KCVA 3UOJA 4FIEA 3JYAA
chains in the Genus database with same CATH superfamily
2PMLX 5KMLA 3HEGA 4BWXA 2W4JA 1SVEA 3Q5IA 4S31A 3TNQB 3W16A 2WTKB 3CBLA 2VTLA 4PY1A 5AMNA 4CV8A 5AV4A 3LQ5A 4DFZE 3HRFA 4QMNA 1SZMA 4M14A 1E9HA 5LJJA 2ITVA 3UNJA 4C0TA 4JX7A 4HVHA 5EDQA 1PRYA 4WHZA 4KBKA 1R0PA 4Q2AA 4O91A 1XH7A 3GXLA 4I20A 4E4XA 5EI2A 3UDZA 2XM8A 3P7AA 2WMVA 3A7HA 4MKCA 3JVRA 2HWPA 5LCKA 3UTOA 4DH1A 4CGAA 3OT3A 2BZJA 3AC8A 5HBHA 4HW7A 4ZLZA 3DKCA 1WBOA 2JBPA 2B54A 4GIHA 4L42A 2X7OA 4D0XA 3AXWA 3G5DA 3HV3A 4FRFA 5HZNA 3IOPA 4EZ3A 3U6HA 3C1XA 4HPUE 4K11A 3V5JA 4L44A 3EMGA 3ROCA 4E5WA 2B4SB 2YHVA 3CY2A 5E8XA 3RK5A 2GQSA 4FV4A 4U8ZA 2XH5A 3HV5A 3T3UA 5BMSA 2WD1A 2GS7A 2CCHA 4KABA 5ANJA 5G1XA 4PF4A 4AGDA 1JKLA 3KF4A 1ERKA 5CQUA 1RW8A 2YIQA 4CTBA 4CRLA 5CNNA 4FG9A 4G3GA 5IEYA 5C4KA 4TN6A 4BCQA 3V5LA 3C4CA 1W2DA 3LKMA 4BB4A 4DYMA 2W1EA 4I0TA 4E6QA 4JAIA 4GCJA 3NYXA 4O81A 3VF9A 2WTKC 4FIJA 4IVCA 4JNWA 2ONLC 4FR4A 2BRGA 4EQMA 2CGVA 4L43A 4MWHA 3OOMA 2RFSA 4KRDA 5M07A 3KRJA 4ZTSA 2Y6MA 4M13A 3H0YA 4W9WA 3LQ3A 2J0KA 1UNLA 1YHVA 5KMNA 1H27A 3F3ZA 4BF2A 1Q4LA 2GHGA 4QPMA 3A8XA 3CKXA 5JFSA 3F66A 5ICPA 5M4UA 3NVMB 2QHMA 2OI4X 1JAMA 3PVBA 3IPHA 4KUJA 3R1NA 3BLQA 5HTCA 4DEDA 2QR7A 2XANA 3C4XA 3MH2A 5F95A 5D11A 1UWJA 3UO6A 4H3BA 5F1ZA 3R2BA 2PSQA 3W0PA 3GCQA 4QQCA 3K5UA 4IZ7A 5TO8A 4BZOA 5F4NA 3QLGA 4ZSAA 5JKGA 3TKHA 3S00A 3EB0A 3A7JA 3QX2A 3EYHA 4FT7A 3IG7A 1JSVA 2JDSA 4CKIA 1H1PA 3DQWA 1Q62A 2HZ0A 4O84A 3ZUTA 4TPTA 2OICA 3UYTA 2NRUA 3UO4A 3HV6A 4JXFA 4NH1A 2OXDA 4ONAA 4XG6A 5CI6A 3R7VA 4EQUA 4FEQA 5AAEA 2WTDA 3ACKA 4CKJA 3DCVA 3V3VA 3C5UA 4J97A 3RI1A 5HU3A 4I92A 3ZLSA 4X3FB 4EORA 1URCA 3E8DA 4F6SA 4O4FA 1VZOA 1HCLA 2ESMA 2GTMA 5CVHA 2HELA 3R63A 2AC3A 2E9OA 3SQQA 3SX9A 2V22A 4FSZA 2J0MB 5LVPA 4RC2A 4FV9A 1Q3WA 3D5UA 3EH9A 3E93A 4BRXA 3PA4A 4WT6A 4MXAA 2PYWA 1EH4A 4RLLA 3ZXTA 2C6IA 4CEGA 4XYFA 2PU8A 3PWDA 2VTNA 4E73A 3BBWA 4NTSA 5DEWA 5CY3A 5JZNA 4ANOA 4D9TA 4USFA 2PUIA 3ULZA 5EW8A 3W8LA 3UJGA 5CAPA 5JFWA 4NCTC 4OTRA 2ITNA 4AXDA 2C3KA 3SD0A 2EXCX 2XAMA 3BZ3A 3LJ1A 2CGUA 3PIYA 2XIYA 3BHTA 5CAVA 1H8FA 4FV3A 5CF5A 3PP1A 2ZV2A 4F0FA 3CJFA 2C69A 3ZONA 3UNKA 5J7HA 2OO8X 3P79A 2FSMX 2PVFA 3FBVA 4FKQA 5CEQA 5TR6A 2R3OA 2WU7A 3D94A 3MB7A 4JG8A 4L46A 4QMOA 4DCAA 2AUHA 3NIEA 4NW5A 4Z16A 2OG8A 4F9YA 4OTGA 3L8XA 5G6VA 3AC5A 2CN8A 5DT0A 3ZFXA 5AR4A 2XK9A 3QL8A 3QKKA 4M69A 5ETAA 4ZY5A 4GKIA 3M11A 4FZ6A 3DJ7A 2QD9A 2UZTA 5ANIA 4NM0A 4AT5A 4M67A 4TL0A 2YDKA 3Q5ZA 4OLIA 3EFWA 4ITJA 4R5SA 1WCCA 3LFFA 4HGTA 4WD5A 3QHWA 3PFYA 4PTCA 4OBPA 3QRKA 4MNEB 5FTOA 4EK8A 2ONLA 2WTJA 2P2HA 3ZEPA 3VUIA 4O7NA 3WF6A 1P5EA 3RPYA 4EK5A 3K2LA 1U54B 5AUWA 4L6QA 3ZO3A 4U43A 3FHIA 1B38A 3JS2A 3L9PA 2JAMA 4LOOA 3V6SA 4M66A 3CS9A 4C3PA 4IANA 5EG3A 5EYMA 4BIEA 3AMYA 2C5NA 3R1QA 2XALA 2QC6A 4ERWA 4XRJA 1P2AA 4WO5A 4XLVA 3SA0A 3E8NA 2YWVA 3BHYA 2P0CA 3IGOA 4FIIA 4D2PA 2I7QA 4IVDA 3DB6A 3E92A 1WVXA 4I4FA 1QMZA 2ZM1A 3NRMA 3PUFC 1VEBA 1UNGA 4ASZA 3WE8A 4X2KA 4DH3A 4LV7A 4WG3A 5E9EA 3VULA 4ZSEA 5C27A 1PXNA 2A1AB 2CLQA 4B7TA 4E5AX 5E92A 3R2YA 1OKYA 4UALA 3E7OA 1R78A 4EH8A 3TZ7A 2BAJA 4AXCA 1Z9XA 5AJQA 3PXFA 3DDQA 3O17A 4U3ZA 1G8SA 3IW5A 2WB8A 2OBJA 5A4CA 4NK9A 2Y4PA 2ITPA 4YMJA 5JGBA 4FOBA 4UMRA 5GINE 4GG7A 4KB8A 4AA5A 2WEIA 1GJOA 4FEXA 4EYJA 3UODA 3FDNA 3VWAA 4KWPA 2QG7A 4II5A 4YJSA 3BCEA 4PMPA 5LVOA 3O71A 2OFUA 2UW6A 4G5PA 5ACKA 1YHWA 4BTJA 4NUSA 1HCKA 4RIXB 5AX9A 5IQHA 4AT3A 4F09A 5KKRB 1Z57A 4ZY6A 1W82A 4O0WA 5A46A 3ZBFA 4AWIA 4MHAA 5B2LA 2R9SA 4G16A 3W10A 4EWQA 2WNTA 4BL1A 2VNYA 4UV0A 4QP3A 3I60A 4GT3A 2C3IB 5CVGA 1A06A 2C1AA 2GTNA 1LR4A 3MPTA 2QHNA 3AT4A 1M2RA 3PJ2A 2J4ZA 2W17A 2FSOX 3FMEA 5LMAA 3AGMA 3ZRKA 4DGOA 4ZZOA 4Q9SA 2Z7SA 2WMWA 4AG8A 2C3LA 3DT1A 5HTBA 5EQEA 3UNZA 3BKBA 1H25A 2WELA 3A2CA 4AGWA 4MF0A 3Q04A 4MXZA 4F7SA 3RMFA 5HO6A 3IO7A 4ANNA 3HMOA 3Q96A 3F2NA 4JBVA 4TWNA 1KE9A 2G9XA 3CGOA 4FV5A 4IX3A 2OIQA 4IWPA 4NM5A 4WNPA 1H0WA 3TACA 4BWPA 5IH5A 5J87A 2IG7A 2XIXA 5B7VA 4GUEA 4R3PA 3FXWA 4IVBA 4X3FA 3OY1A 5EDPA 4AT4A 1M2PA 4YPSA 5FBOA 2WQEA 3HMMA 4KBAA 5A14A 2ITYA 4IEBA 3TV7A 2PZYA 2WMQA 2O64A 4M3QA 5CU4A 4DFXE 2JFMA 3MFSA 2VV9A 2X1NA 3I7BA 3TJCA 3PSBA 5T6KA 5C4LA 2C6KA 3G6HA 4FNZA 4NWMA 3VHEA 5I9XA 5DOSA 2C6OA 1Q8UA 5KKRC 1PMUA 3QQLA 4MUQA 3WE4A 4J1RA 2PVLA 5DRBA 5L4QA 3A62A 4IB5A 2W05A 3U9CA 4IAZA 3HVCA 2OJGA 1VYWA 1OB3A 3TN8A 4IWOA 4TYHB 4FZ7A 4EZ5A 3D9VA 3C4FA 2GNHA 5K0KA 1V0BA 2RGPA 3PZEA 2E9NA 5HX6A 2HAKA 2VWYA 3HUCA 3LFDA 3OEZA 4GUBA 5BVWA 2OF4A 1CKPA 5L2QA 1G8JA 3W0MA 3WI6A 4Y5QA 3QD2B 5C8MA 4CNHA 5D10A 3GCUA 3KRRA 2J6MA 5EI8A 4TT7A 3W0QA 3MWUA 4AZTA 4NEUA 4BCNA 4EEVA 4O86A 3V01A 2X2LA 3OT8A 4UMPA 1YWRA 3BL9A 3ZSIA 3BYOA 3ZEWA 4EL9A 5DMZA 3TG1A 3NYOA 2EUFB 4U9AA 3SXFA 4FNYA 4R1VA 3OWPA 5CU2A 3EFLA 5I9WA 5DRDA 4XHKB 1GZOA 2W1ZA 1OITA 3GBZA 3BPRA 4E4MA 5AA9A 4LMNA 4C59A 2WFYA 4QMSA 3A99A 2WGJA 4QTDA 2PTKA 4MNEA 4HVDA 1QPCA 3TDVA 3HAMA 4J98A 4EH7A 4QTAA 2HOGA 4DTKA 4K9YA 1PXMA 1Q99A 1U54A 3PXYA 4TW9A 3PXZA 5FQDC 2HZIA 4RBLA 5HD7A 1PMNA 2YLFA 2WOUA 4BGHA 4JQEA 1KV2A 2QOHA 2R3FA 4ZJJA 4XP3A 3SW7A 3D2IA 3KK9A 2HWOA 1AD5A 3B8QA 3MVLA 1CKJA 4V01A 4O96A 3OVVA 5HU9A 5BVOA 1Q8YA 5M53A 1E1XA 3QCSA 2YA9A 1R0EA 5A4LA 3AKKA 3W55A 3K3IA 4RFYA 4RZWA 2B52A 5FUTA 4BCGA 4QTCA 3QBNA 3DFCB 4JT3A 4I5HA 3BWFA 5E8WA 3R8UA 1H24A 3GU8A 3LIJA 2CKEA 4PV0A 2OFVA 2PZRA 3NNUA 3GU4A 3TUBA 4GH2A 5IQEA 1JSTA 2VD5A 3OXTA 2W1DA 4YZMA 5EK7A 4CLJA 5CF4A 2VZ6A 3UPZA 1SYKA 4FUYA 3E64A 3THBA 4O7ZA 4J96A 5CT0A 3QRTA 2V62A 3F2RA 2G2HA 3C0IA 2WKMA 2R3QA 1XMMA 3GU7A 1BMKA 5FM3A 3IDPA 4EWHA 2XB7A 4IACA 5IMEA 4TYJA 1JOWB 4E4NA 3KIOC 4QMQA 3PA3A 1G3NA 4WSYA 1BX6A 2IVUA 5E90A 5HEZA 4BGGA 2H8HA 1H08A 4NL0A 4DEHA 3MIAA 4D2SA 5LMKC 1FVTA 3KKVA 4RIXA 3ORTA 4FT9A 5EW9A 3UDBA 4QP6A 2DUVA 4FSTA 3NUAA 2BUJA 3BI6A 3IQ7A 4AW1A 4DDGA 1H07A 4WNMA 3R71A 5TF9A 5DLSA 4AZFA 4BCIA 4E20A 2XNPA 3GI3A 4Y83A 3GGFA 4RWJA 3OTVA 4GW8A 5IA5A 3O5AA 4QMYA 1LEWA 4O4EA 5IEVA 3KMUA 2W0JA 2FB8A 4UB7A 1WAKA 3ZZWA 4YNEA 2RSVA 2X4ZA 4FSRA 1PXKA 2FSLX 5AUTA 3VUMA 5IQCA 4Z7GA 2Y0AA 1P4OA 2P2IA 4O0VA 4BJJB 4F7LA 2GPHA 1XH4A 1W84A 3I0OA 3NDMA 4RWKA 3EYGA 5FEEA 4O7RA 4O4BB 4PDSA 5EYDA 5EHOA 2I1MA 3C4WA 5D12A 3D5VA 5JZJA 5KHXA 2Z7RA 4LGDA 4NYEA 3QAME 1K2PA 1ZARA 4FSQA 1QL6A 3Q3BA 4XBUA 5H2UA 2CKOA 1KOBA 2Z02A 1TKIA 5HO7A 2BDJA 2R3GA 2BRNA 3R9OA 2RIOA 4EHZA 4CFMA 5B0XA 1FMKA 3I81A 2XKCA 4YSMA 4AOTA 2OH4A 5M4FA 1OM1A 3QC4A 3ENMA 2RFEA 3ACJA 4FNXA 3ZZEA 3PXQA 3QTRA 3BV2A 4GYIA 4EONA 3QRIA 3MY0A 4EK6A 5AIRA 3ZHPC 1CKIA 1IASA 3IW4A 1YXUA 4IE9A 5KO1A 1M2QA 2VX1A 1VLRA 1R39A 4D2RA 2Z7LA 5FXSA 4DEGA 4XOZA 2OGVA 3UQCA 2XBAA 1DS5A 3WOWA 5BUIA 2R3IA 4ZJVA 4O7TA 4W4VA 1Q61A 1Y91A 4O4DA 5D41A 5AUYA 1V0PA 4C38A 4TYHA 3MTLA 5HNGA 4FYOA 4JQ7A 1ZYCA 4FIHA 4L67A 4XV1A 3SXRA 5KMKA 4DEIA 5IH6A 2XJ2A 3S95A 2QOFA 1WBWA 3VQUA 2F7ZE 1KE8A 3IDBA 4Y8DA 4C4JA 4QDEA 5AV2A 5CSHA 3HX4A 4AGUA 1YI4A 2W1HA 4HJOA 3H9FA 3COIA 4A9YA 1M7QA 3NUXA 4YURA 4UX9A 5K5XA 3SXSA 3W0NA 3IKAA 4USDA 4WBBB 2XNGA 4FMQA 2YJRA 3AD5A 4UWCA 5E4HA 2EXEA 1L3RE 4UMUA 5M44A 4D58A 5GIOE 3R8VA 2YZLA 4KINA 1Q5KA 4FL2A 2V7AA 3NPCA 4FKRA 4FV2A 4L3LA 1H00A 4QPAA 5A6NA 3GFWA 5A6OA 4O22A 4IZYA 4ITHA 4P4CA 5KZIA 3OC1A 2BRHA 4I3ZA 2A2AA 4WOVA 1FBNA 3OXZA 3ALOA 3E3PA 5TKDA 4GV1A 4BKZA 4Q5EA 5AP1A 4RX7A 3DGKA 2WIHA 1PJKA 2BDFA 2DYLA 3AC2A 4XLIA 3E88A 3GVUA 5J7BA 1U5QA 3E7VA 3DAJA 3E5AA 5FEQA 2CNQA 3I5NA 2WTVA 5LMBA 4F63A 3FMMA 3VVHA 4BIDA 3RPRA 4DAWA 3ATSA 1K3AA 3KEXA 4JX3A 3A4OX 4YC3A 3QRJA 1PYXA 2OJIA 3C9WA 3QXPA 3P5KA 3W2RA 3R1SA 3HA8A 4AFJA 4USEA 4OBQA 5K5NA 4HCUA 3ENHA 1XR1A 1BYGA 4RMZA 2X0OA 4ZY4A 3IGGA 4UXQA 5L6WL 3OFMA 5BPYA 2PVRA 3PVGA 5EHLA 1WFCA 5IA0A 2WQOA 2XMYA 4UYNA 3FKNA 3MVHA 4H39A 1W2FA 3MH1A 4I6QA 4O7WA 2Y8OA 4CMUA 2RG5A 3UDSA 2XVDA 1MQ4A 4G17A 4APCA 2BCJA 1W7HA 3HMPA 3W0OA 2G1TA 2C4GA 2XIKA 4BY9E 5EM8A 2JIVA 5BVNA 1O6YA 4Y85A 4EOPA 2H96A 2F49A 3MFUA 4C4GA 5LVNA 4PTEA 4R8QA 1ATPE 1FGKA 3NWWA 3NR9A 4GYGA 5CEKA 4CYIA 4IAIA 1F0QA 4WNKA 4C8BA 4ZTMA 4FV0A 2BKZA 4RGJA 3VS7A 4IW0A 4YZNA 3FZOA 4QRCA 5A54A 4AOIA 2ZOQA 2BILB 4ALWA 4H1JA 1RDQE 5HIBA 5M56A 4AUAA 3R9DA 2X8IA 1W2CA 3KXHA 3FMDA 2WOTA 3TKUA 4KSQA 3ZS5A 4BI2A 1F5QA 2W06A 2OK1A 3JVSA 4EHEA 3AOXA 3KFAA 5I9YA 4GS6A 3WIGA 2ITOA 2X39A 4E3CA 4GKHA 2R0UA 3EQDA 3KVWA 3QWKA 3U8WA 5C8NA 2AEGA 2F7XE 2HCKA 2ETKA 3AD6A 3DPKA 2VO3A 4TY1A 4IQ6A 4OTPA 2P33A 3P1AA 4C2VA 4F0IA 5CSXA 1SVGA 3GENA 2IZRA 2IW9A 1OUKA 4BJJA 2XF0A 3QTQA 3DNDA 4FL3A 2B0QA 1OIUA 4D2VA 4I23A 3KXNA 4BDHA 4D2TA 4E26A 5L6PA 3VNTA 5H9BA 4YHFA 1FMOE 4ZTNA 2VWUA 1Y8YA 4H3PA 2PE0A 3AKJA 3QZFA 3G9NA 4LL5A 4AZWA 3FXXA 4U0IA 5ITAA 5DT3A 4EH9A 3UIXA 4FICA 5IF1A 4W9XA 5IU2A 4AQKA 4PX6A 4A7CA 3VHKA 5EM5A 4QOXA 3AT3A 2RFNA 3BHUA 4DHJA 4FKOA 4QMZA 3LHJA 3JPVA 2HY0A 3DY7A 4MBJA 2YIRA 4F9WA 4H3QA 4UN0C 2IZUA 4XX9A 5HVKA 3QD4A 4RIOA 1ZOHA 3GFEA 2P55A 1PXPA 2QURA 2WTCA 4C4HA 5J79A 3N4VA 3NUUA 3TJDA 2GCDA 4BCMA 4U6RA 5FWKK 3TNWA 3RTPA 5GZ8A 3QKMA 5GJFA 1V1KA 4KAOA 1RE8A 1XH5A 3FMJA 1G8KA 2H34A 3K54A 3UOKA 3V6RA 4O6LA 3N9XA 2VN9A 3LE6A 2Z7QA 4X2FA 3G0FA 4YJRA 1ZMVA 2WZJA 3FC1X 4F6UA 3QKLA 4I6HA 2BZKB 1WBVA 3O7LB 2GQRA 3FJQE 1NA7A 3R7EA 3V5TA 2J0JA 2JITA 2IEWA 4XUFA 4H36A 2R3JA 3KRWA 4JR7A 4DTAA 2QLUA 5I3OA 5LXMA 5H8BA 4JDHA 3NSZA 3P7CA 4I21A 1NW1A 2ITTA 4G34A 4HYIA 4FTCA 4MF1A 3ZBXA 4K8AA 4D9UA 5HCXA 4RC3A 2JDTA 1REKA 3Q32A 5IQIA 4O1OA 2AC5A 2CJMA 2QKRA 3GCVA 2X81A 4YTCA 3O8TA 3RAHA 3VBYA 1ZAOA 5ETIA 3SGCA 1JWHA 2Y4IB 3EQIA 4K33A 3UDTA 4MNFA 4FE2A 2IZSA 4FV8A 5CT7A 4ACDA 4JDJA 4OTIA 2G15A 2WQBA 3G51A 4JIAA 2Y9QA 4YJOA 5E8TA 3EFKA 3PFQA 3T9IA 5JSMA 4GSBA 2EU9A 2AQXA 1OGUA 2ZV8A 4K1BA 3ORMA 5HCZA 4ACMA 3BU3A 3FZRA 4I0RA 4R1YA 4IJPA 3CSVA 2BRBA 1KE5A 2UVXA 5BVKA 3PVWA 1W83A 4F7JA 4XG3A 5EDRA 4LRJA 4ZK5A 3GEQA 4YSJA 2ZM4A 1P4FA 5EM6A 3HDNA 2HK5A 4MD8E 2WXVA 3VS0A 1M7NA 2VO7A 2O0UA 4FG7A 4AA4A 1ZLTA 2O8YA 3VBTA 5L2WA 3SC1A 3POOA 3QUEA 5AP5A 3ZUVA 3A4PA 1K9AA 4RVLA 3SOAA 5K3YA 1YOJA 4QPSA 5DGZA 2VTHA 3A7GA 4JAJA 3RWQA 3SW4A 3M42A 4KSPA 4G9CA 4G3DA 4U79A 3VF8A 5AAGA 4CYJA 1XH8A 3DKOA 4HYSA 4BIBA 5DH3A 4JMQA 3A60A 3H4JA 2I0EA 5B2KA 2Y4IC 5HHWA 1ZZ2A 1PXIA 3AG9A 4WIHA 5DI1A 3QALE 4XV9A 3I7CA 4BCJA 3DQXA 1LPUA 4JL9A 1KSWA 1GZ8A 2VTTA 4I1ZA 3HGKA 4EH5A 4LQMA 4GJ2A 4DGLC 4IWQA 4WBOA 3E8EA 4FZDB 3NYNA 5ACBC 3ZC6A 3ZYAA 4ZZMA 4BTKA 5H8EA 3R8PA 3PIXA 4EOIA 3COKA 4TWOA 4LV5A 4MEDA 5FXRA 5DWRA 3Q52A 4ITIA 2HY81 1JSUA 1TQPA 4D5KA 2PMNX 2NP8A 1VR2A 3FLZA 4R78A 4ZJIA 2V55A 3FZ1A 5ETCA 3DZOA 5KMJA 3UMWA 5F20A 3OW4A 3BYMA 1TQMA 4GK3A 4CFVA 4D4VA 3OCTA 1YXSA 3FL5A 1ST4A 4PTGA 5EKOA 4YC8A 2KTYA 2GFSA 3DZQA 3IONA 2W1FA 3QZGA 5FBNC 4O7SA 4PL4A 4CMTA 3H3CA 3GCPA 5AFVA 3JY0A 2J0IA 3TIYA 4BN1A 4RVTA 5BUEA 3ZSGA 3R30A 1TFFA 5IG1A 4JDKA 4QMLA 2I0HA 2X0GA 3CD3A 3QCXA 3BHVA 5CAOA 1Y6BA 1TVOA 2R7IA 3HV7A 4IBMA 5M4IA 4RJ6A 4PNKA 3IW7A 2X8EA 3MI9A 2VX3A 3MN3A 3ORLA 2QKWB 4CKRA 3KXGA 1S9IA 1XJDA 1YHSA 4IH8A 5CU3A 3QQGA 4PMTA 2XNBA 2VNWA 3MH3A 4YP8A 3SLSA 4AW0A 5JN2A 2J0LA 4K77A 4BHNA 2J51A 2G2IA 1WZYA 1BKXA 3EKKA 3JUHA 3QX4A 4AE6A 1JNKA 2CGXA 3S0OA 3UQFA 1UU3A 3IW8A 3MDYA 4U81A 4ANMA 3KRLA 4ID7A 4C34A 4B0GA 1YDTE 4LGHA 4APPA 4OAUC 3DBEA 3C7QA 2O65A 2Z2WA 3D15A 1FQ1B 3EL7A 3U51A 4YBJA 2UZOA 4OGRA 4HOKA 4F0GA 3PXKA 3ID6C 2X9FA 4RJ3A 5KE0A 4EI4A 5C1QB 4J99A 3FQSA 4EK3A 2ZAZA 4A9SA 2H9VA 1PKDA 5IQFA 3RPSA 1NY3A 3VBXA 2UW9A 4J8NA 4DFYA 5J8IA 3ET7A 2ZMDA 5IMXA 1PW2A 4G9RA 3F2AA 5GZ9A 3VUTA 4YZ9A 5CEIA 4FKLA 4D4YA 2SRCA 3TUCA 1MRVA 3GOPA 4PUZA 3EZRA 4I5MA 1GIHA 4RJ8A 3FQEA 3KCFA 3H10A 3O23A 3F5XA 1PMEA 3BGZA 5IQGA 4OTFA 4ENYA 4QP9A 2FVDA 3PZHA 4FV6A 5AV0A 5DN3A 4IADA 4TXCA 1WBNA 2OW3A 3R8LA 3UVRA 1XBAA 5DYJA 3O51A 3C50A 2HW7A 4YC6A 3UQGA 3DK6A 4KD1A 4DGNA 2VTQA 4A4LA 4FK3A 4QP4A 1STCE 2XIRA 2X0PA 2WTIA 4JLCA 4O2ZA 2I40A 3OZ6A 2FYSA 3B8RA 4JBPA 4XS2A 5EI6A 3LFNA 4ZSJA 5J5SA 2J50A 5H8GA 2OJ9A 4YZBA 4YJNA 4C4IA 4L3PA 2UZEA 4E4LA 2VWXA 4BDEA 2P3GX 3UZTA 4FT0A 4U5JA 5JFVA 4L7FA 2PVKA 4C3FA 1OI9A 1BL7A 4YLKA 3POZA 2GNGA 2OZAB 3F3WA 3C5IA 5M51A 3W2QA 4DN5A 4WRSA 4FUXA 4EOSA 5LMKA 3VRYA 2CKQA 1YI3A 1YKRA 2OU7A 3O50A 2VTAA 5K0XA 3KY2A 4IM2A 4ACHA 2C6LA 3O0GA 3PE2A 1KV1A 3RNYA 5IUHA 5IQBA 4AZEA 3HKOA 5J9LA 4I41A 4WKQA 3A8WA 5FG8A 3PJ8A 4QYFA 5CS6A 3SOCA 4Q9ZA 3TL8A 4Z7HA 2QQ7A 3V8SA 1Q8ZA 4RJ7A 3FV8A 1QPEA 2R3HA 4PL5A 3R0TA 4QMWA 3RHXA 4QQTA 4GU9A 4X2JA 5K4JA 4FTLA 3VW6A 4ZLOA 4AOJA 1NT2A 5AV1A 3TDWA 5FDXA 2RL5A 2BFYA 2UW0A 2QNJA 1ZRZA 3OOGA 5CI7A 2B7AA 4IC8A 5A4QA 3CP9A 3QXOA 3ZO1A 3MBLA 3OBGA 2GFCA 3SRVB 5LOHA 4NSTA 2PWLA 5J95A 2UZNA 2GNLA 3PLSA 1GIJA 3AC1A 4NCTA 4NFNA 3GC7A 3OXIA 2YDIA 3FMNA 3PUPA 5L6OA 2UZDA 5ANEA 5CSVA 2YM7A 2UZLA 2W5AA 3F3VA 3H9RA 2EVAA 4O38A 1KE7A 3T8OA 3FAAA 3M1SA 4RA4A 4Z9LA 3KMMA 1B6CB 2X7FA 3EQFA 3PY3A 4I4EA 4X3JA 3CXWA 4F1TA 3QA8A 3VS5A 1Q41A 2WMBA 3FKOA 2IN6A 4FEWA 3BHHA 2BAQA 3EOCA 4NTTA 2DWBA 3K3JA 2ZMCA 4IAFA 4RIWB 2F2CB 4RIYB 3R8MA 4OTHA 4DH8A 1IA9A 1KUTA 4EJ7A 3FLQA 5LCJA 2XJ1A 4EOJA 2PVYA 3VS3A 5HI2A 2ERZE 3L9LA 3VBVA 2OJFE 2X7GA 4QNAA 2BZIB 3QA0A 2YIXA 1LUFA 2F4JA 3TV6A 2BHEA 2XCKA 2XUUA 4L3JA 3L9NA 2CNUA 3COHA 4OR5A 2FSTX 2XK3A 3UIUA 5M08A 3QYWA 3OWLA 2QO2A 4J95A 3DXQA 2X9EA 2AYPA 3RZBA 1AGWA 3FI2A 4C61A 4KRCA 5CZHA 4IVAA 3NX8A 3PSDA 2HZNA 4H05A 4TYEA 4DBXA 2ZDUA 1DAWA 3DJ6A 5FTQA 5HX8A 5JK3A 2YISA 3UE4A 4BBMA 4M7IA 5BV3A 4G6LA 3FE3A 4PP9A 3R8ZA 4DITA 3BV3A 2NO3A 2WAJA 2C3JA 4FEUA 4J52A 4EOKA 3PA5A 4RVKA 2A27A 4FF8A 5JQ8A 2W1GA 3WILA 3C0HA 3UVPA 4OAVB 3TMOA 3OHTA 5DEYA 2HZ4A 3OBJA 4RJ5A 3P7BA 4YJTA 4Y73A 4O7LA 2UW5A 3HL7A 1JBPE 4G31A 1OL1A 4Y72A 3FY0A 2GSFA 4HYHA 2GHLA 2OWBA 3DTWA 3R9NA 5AIKA 4R7HA 5CAUA 5HBJA 4FKJA 1XBCA 2IVTA 4L52A 4NW6A 4PRJA 5D7AA 5IQDA 4M8TA 3DJ5A 5DR2A 4ZTLA 1DM2A 3JXWA 4KKEA 3P9JA 2YIT