4AT5A

Crystal structure of trkb kinase domain in complex with gw2580
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
299
structure length
294
Chain Sequence
GAMDTFVQHIKRHNIVLKRELGEGAFGKVFLAECYNLKILVAVKTLKDASDNARKDFHREAELLTNLQHEHIVKFYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNPPTELTQSQMLHIAQQIAAGMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPQEVYELMLGCWQREPHMRKNIKGIHTLLQNLAKASPVYLDILG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structures of Trka and Trkb Suggest Key Regions for Achieving Selective Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords BDNF/NT-3 GROWTH FACTORS RECEPTOR
total genus 99
structure length 294
sequence length 299
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4at5A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4at5A01
3I81A 2WQOA 4I5CA 3TI1A 1XH8A 1PXOA 3RK7A 1KUTA 4KABA 4O96A 4AFJA 1XJDA 2OJ9A 1YWNA 3VIDA 4WT6A 3S2PA 2I7QA 3KRRA 1OMWA 2CNUA 5J9YA 3Q96A 5KCVA 2GFCA 3WE8A 4MXAA 3KMMA 2VTOA 1M7QA 3L8SA 4ZTSA 3QX4A 2BRNA 3CTHA 4PDSA 4K9YA 3FLQA 5B2KA 4ASXA 5I9YA 3EQRA 4O86A 3DK3A 2X7FA 3C0GA 3DKOA 4I5PA 3TWJA 2XKCA 2JDOA 5ETCA 5TKDA 4V0GA 4RFMA 5E8YA 3ZM9A 3KC3A 2GQGA 4WBBB 1JPAA 3GU8A 2IVVA 3D5VA 5CI6A 5LJJA 2OGVA 2R3KA 5I5ZA 1JOWB 5EYMA 3POZA 4BDIA 4JAIA 3MPAA 5HCZA 4BYIA 3O8TA 4XLIA 4BDHA 4R7IA 5HVJA 2HY0A 5CVHA 4Z55A 4FGRA 3TNQB 3CJGA 3E8NA 4FOBA 1MRVA 3NUSA 2ZV9A 2WZJA 4A9TA 4TWOA 5J79A 3F7WA 1UNHA 3W1FA 3O71A 4ZTRA 5CI7A 1XH7A 4C4IA 4OAUC 3OWKA 4TZRA 5LMAA 3C50A 4D4SA 3ZZWA 3G0FA 4QMTA 4PY1A 3MTLA 4FTIA 3E93A 5L2WA 3NNUA 3V6RA 1U54B 5FD2A 3RJCA 3ZBXA 2ITZA 5AV2A 4CV8A 1JBPE 1P4FA 2Y4PA 1JSVA 3IGGA 3HMMA 3HV7A 1OIYA 1KE5A 4V01A 5E8WA 5IH5A 1UNLA 2HZIA 3BU3A 3TTIA 1IAHA 2VWXA 3PY0A 3R01A 2IO6A 5IEXA 5K4IA 5H8BA 4KA3A 2PE0A 1PYEA 3C0HA 2XIXA 2HZ0A 2I40A 4JX3A 4HGTA 5CS6A 5IA5A 3VWAA 2ZM1A 2ZV7A 4WHZA 5KX8A 2GNHA 2QOOA 3Q52A 3TV6A 2ITYA 5J8IA 4M15A 3DS6A 5AP0A 4RZWA 5BX0A 1ZAOA 4C8BA 3B2TA 4KKHA 1MRYA 4BRXA 3FXZA 4E73A 4R5SA 4D2TA 3LFAA 2R4BA 5CQUA 3DXPA 4RIXA 5DYJA 4BKYA 2CCHA 2Y7JA 1JLUE 2IVTA 4MD9E 3FQEA 3FYKX 3VC4A 2W1DA 4RX8A 4WOVA 3LMHA 2ITTA 2XNGA 3V8WA 4DTKA 5CEKA 2JD5A 1YI4A 3K2LA 4IVCA 3FMDA 2VTHA 5IUIA 2VU3A 2OU7A 4CSVA 3DKGA 2R3RA 5DT0A 4YTIA 4EOOA 3UIXA 2X6EA 3R7UA 2ITWA 3QC9A 4BCMA 3EQPA 3R7IA 1JAMA 3LFFA 3DLSA 4E5WA 2G2HA 1LP4A 4TL0A 2I0VA 3MESA 4RVTA 4EZ7A 5A4CA 3E88A 4O0WA 3FLZA 1WAKA 2VD5A 1SNXA 3LFDA 3ZC6A 2Y0AA 2WD1A 3OTVA 2O5KA 4FZAB 5JZJA 3FHIA 4O2PA 4QP9A 4ZIMA 2BZHB 3EB0A 1FQ1B 2Z60A 4HYUA 2GS6A 4PPAA 4FTQA 1L8TA 2BAKA 3BZ3A 4L6QA 2VWWA 4UXQA 1Y6BA 3HV3A 4MXZA 3NDMA 4AFEA 2REIA 4QTAA 4DFYA 4MAOA 3MWUA 4E26A 4GG7A 2UZEA 4JXFA 2KTYA 5JRQA 4DBNA 4ALUA 3LFEA 4DG3E 4MD7E 3KXGA 2AC3A 5AP2A 2XM9A 3FZTA 3BLQA 5EW8A 3O0GA 4HPUE 5I4NA 3EMGA 4Y95A 2CN8A 2HXLA 4PP9A 4LRMA 4IW0A 5K4JA 4NJ3A 2R7IA 3MB7A 4R7HA 3VW8A 2QNJA 4ALVA 1UKHA 3HA6A 4BGQA 5I9VA 3TDVA 1UA2A 2HZNA 3CGOA 1J1CA 2YM6A 3MFSA 5LVLA 2C0IA 2PVFA 3BELA 3LLTA 4QMYA 4V0GB 4ENYA 4U0IA 2C3JA 3VBTA 2C5VA 4JG7A 4ZY5A 5FDXA 1CMKE 5B0XA 1CSNA 1FOTA 4I6HA 3ZFXA 5EQPA 3OZ6A 4G9CA 3ZO3A 2VZ6A 4I1ZA 4ZZNA 5GJGA 4YR8A 5A3XA 3NVMB 5EQYA 2PVYA 5D41A 1YW2A 5KKRC 4FVPA 3CD3A 3G5DA 2XKFA 4CZTA 3Q60A 3WBLA 4ORKA 3DPKA 5DEYA 1X8BA 3SGCA 3CS9A 1ZY4A 2EU9A 3DB8A 3GXLA 3GCVA 4FKLA 3QHWA 2C6TA 4RBLA 2I0HA 2QOCA 4AT5A 5CEIA 3ZMMA 4BIDA 4ZLZA 5ICPA 4XMOA 3VS2A 1ZYSA 5K5NA 2BZKB 2JKOA 1W98A 3LCKA 5CSVA 4F0IA 4ZS0A 1UKIA 3QZFA 2UW4A 4GG5A 5IISA 4O7NA 4X6RA 5IQGA 3JR1A 3BLRA 1ATPE 2YAKA 4GFMA 4F08A 4X2NA 3FLWA 3AT4A 2W5AA 4G1WA 3QAME 4RC4A 3IPHA 3PXZA 3BYOA 4YHTA 3VS5A 4BDCA 3ZRKA 5HNIX 5EDPA 3C4WA 3DZOA 4MBLA 3CTJA 2WMXA 4YTCA 1KWPA 5ETFA 4UMTA 4AZSA 4DHFA 3SG9A 2OWBA 4NSTA 2G1TA 3ORLA 5AMNA 2YLEA 4YBKA 4DEBA 2VWZA 4YMJA 4I21A 4F09A 4IJPA 3WOWA 4G3FA 2V5QA 4PP7A 2VNWA 3G51A 4H3QA 3ZDIA 3KRWA 2PE2A 1DM2A 4M97A 3ORMA 2IVSA 4E93A 2F7XE 4E4MA 2PUUA 4YC6A 4O0XA 1NXKA 2HYYA 3ACJA 4WG5A 5K5XA 3EFLA 3SV0A 2J9MA 3IOPA 5CSWA 2WIHA 3EN4A 2Z7LA 1V1KA 5AR8A 2PMOX 4O7LA 5BUIA 3EFWA 4CNHA 3C7QA 5EFQA 4CQGA 4CRLA 5JFWA 2PVNA 4DINA 1M7NA 4D1XA 3QTQA 5IDPA 4XEYA 3GU5A 4UWBA 4FE2A 2F2UA 3D14A 4OTHA 4X7QA 4ZMFA 3FL4A 2W1EA 4YZDA 5EM6A 4AZVA 2OFUA 3R28A 1Q8ZA 4O0YA 2UVYA 4P4CA 5CWZA 3UBDA 3PPJA 3R8ZA 2YDIA 5KMIA 4K8AA 4NWMA 4EQCA 3NNXA 4EC9A 4H58A 4DFNA 1PRYA 5ANJA 3AGLA 2Z8CA 4IDVA 3RINA 1R0PA 4C61A 2E9VA 2PMLX 4HOKA 2XRWA 4O1PA 4XRJA 4HCTA 5DNRA 3RK5A 3ZTXA 2OF4A 4LV5A 3LCTA 4F7SA 2ZDUA 1GOLA 3D0EA 2J0LA 5FEEA 3ZXZA 5K0KA 2BCJA 2GNGA 2J7TA 3ZS5A 2PZYA 3P78A 1VJYA 2YIXA 4OT6A 4UYAA 5EKNA 1OPKA 3IW6A 4EH3A 3E8CA 2C6IA 4E4XA 3BQRA 3MPMA 3UYTA 3JXWA 2V7AA 4YURA 2JDSA 3BHTA 4L46A 4BN1A 1IA9A 4DYMA 3ZO1A 3EQHA 1OITA 1EH4A 1WVWA 2R3NA 3HV5A 3QQFA 4M3QA 2QD9A 2B9JA 2VX0A 2WMVA 4RQVA 5ANEA 4H1JA 3R8VA 5CSHA 3TL8A 4EK3A 3GEQA 5CZIA 4E3CA 3KK9A 3C0IA 5CNNA 5DVRA 4NEUA 4EOPA 3RNYA 4QNAA 4XG3A 5EH0A 4XS2A 2ZB1A 2RFNA 4RLKA 3UPZA 2GSFA 4BZOA 2YFXA 3Q2JA 4O38A 4BB4A 3BBWA 4D0WA 2XK6A 3RPYA 4UYNA 3BIZA 4FIHA 4JDHA 3ZXTA 3SG8A 2OKRA 4OTWA 1H1PA 2XK7A 3OOGA 4YO4A 2CLXA 4EBWA 5A4EA 4AN2A 4EWHA 1U5RA 4O7WA 2BKKA 1H27A 1KE8A 2UV2A 3OY3A 4NTTA 5CAQA 3F3WA 1YDSE 4JAJA 4DGMA 3QRJA 4D0XA 3DZQA 3FMJA 2W5BA 1PXKA 1JKSA 1YI3A 3AOXA 3FMKA 3H0ZA 3TXOA 4AOIA 4AX8A 2O3PA 3G6HA 4I5MA 1VEBA 4N0SA 4QMZA 2PZ5A 2HWOA 3FZ1A 1B6CB 5LCKA 4O1OA 5D10A 4IAKA 1ZLTA 1RDQE 3QYZA 3QF9A 2J2IB 3MFUA 5CU3A 3EWHA 1TQMA 1T46A 3GU4A 1V0BA 3UYSA 2VRXA 3RKBA 1E9HA 3F7ZA 4YHFA 4FV6A 1ZMWA 2QC6A 4CTCA 3EJ1A 4S30A 2XRUA 2VTLA 2H8HA 3NUNA 2F4JA 2O0UA 2C0OA 4XG6A 3MFTA 4GEOA 1QPDA 3M1SA 5H9BA 4AGUA 4H3BA 3DOGA 4HYHA 4S32A 5IQAA 3ZBFA 1F5QA 4MTAA 5I9UA 1IR3A 2I0YA 2VO6A 4ZAUA 5LQFA 4C37A 4AGCA 3FBVA 1PXNA 4FV5A 3GCUA 5ANOA 4DEGA 3FMLA 5CQWA 3CCNA 2GNFA 3QTZA 2UW6A 3S00A 2ZV2A 2B9HA 5EKOA 2HOGA 3Q9ZA 4IDTA 5ANIA 5DA3A 2YZAA 4YC3A 4HVGA 1JKLA 2J0JA 4DEEA 4AQCA 4OTQA 2BALA 1SMHA 1Q8UA 2UW5A 3UODA 4MF0A 2BTSA 2F2CB 2PTKA 3PSCA 4F9AA 2PVMA 3DV3A 4YJNA 2W1HA 3KRLA 3Q4UA 4EEVA 4XNEA 3QCYA 3QQKA 5E1EA 4Y73A 2W1GA 4UWCA 3WIGA 4NKAA 4C7TA 2IZRA 2R3GA 3ORIA 4LGGA 4EBVA 4ACDA 3CR0A 1Z5MA 2X8IA 5TT7A 1PXLA 4JBQA 1TQPA 5HD4A 2CKQA 4L67A 4NM0A 4R7BA 2GQSA 4ZY6A 5J7BA 3V5QA 1ZYLA 4LRJA 2BILB 5AFVA 4F6SA 3VF9A 3R21A 1PF8A 2WMTA 3ORNA 3FMMA 3FY2A 4HYSA 3AC1A 4E5BA 3MVLA 3Q2MA 3P0MA 5KMKA 1FINA 1KV1A 2RFSA 1UWJA 2BPMA 3SQQA 3UOLA 2JAVA 3DBFA 3F5GA 4YHJA 3WYXA 2UZNA 4BDGA 2PMIA 2WAJA 4FKJA 4I6FA 4N57A 3DK6A 4FSNA 4PX6A 4U81A 3LPBA 4JG6A 5AJQA 4AGDA 4OTPA 3U4WA 2UZWE 3IDPA 4GT4A 4MWHA 3SOAA 3HAVA 3OHTA 1ZYJA 2WIPA 4FKWA 3ZUTA 4C62A 5JEBA 3ULIA 3LCSA 4UMRA 4FKPA 4QNYA 4EK4A 1HCKA 3SD0A 4EJNA 5M09A 5GZ8A 1Q24A 2QLUA 3I0QA 4I94A 4RX7A 4B99A 3ZONA 3EN5A 4H05A 4UWYA 3B8RA 3L9PA 1J7UA 1R1WA 3BHVA 4Y85A 4DCAA 3PA5A 4HGLA 3HUBA 5C27A 3KMWA 4AW5A 1UNGA 3BV3A 5LARA 3HMNA 3D5XA 4YZCA 5C8MA 3U54A 1KE9A 2WOTA 2ZB0A 2J4ZA 2XJ0A 4MXXA 4ZK5A 1PXMA 1XH4A 1O6YA 3TNIA 5AP3A 3LCOA 4GK2A 3VUHA 4FIJA 2W7XA 1QPJA 4M7IA 3TIYA 1G8SA 4A4LA 4AWIA 3BLHA 4IM2A 3R9RA 1OUYA 3HP2A 5ITAA 3WF8A 2BVAA 1PXJA 1XKKA 4BCOA 2I1MA 3A7GA 5AR5A 1SVEA 4U79A 3KXNA 3ZCLA 4BDFA 1Y8YA 5FBNC 2Q83A 4FZFB 4MKCA 3PLAE 2B9FA 3PA4A 3T8OA 4ZMEA 3MGYA 3E62A 3FMEA 4L00A 5M08A 4DGNA 1YXUA 3V6SA 2EVAA 2YAAA 4BHNA 5HO7A 4QO9A 1S9JA 2HIWA 3F3TA 2FO0A 4BZNA 2V55A 2C6MA 4N70A 4C0TA 5AEPA 1B38A 3RZFA 3VO3A 1M2PA 3DNDA 4IVDA 4AT4A 4MVFA 3MYGA 1F0QA 2H6DA 2XUUA 3H9FA 3HX4A 2C1BA 3OTUA 3P4KA 5DR2A 3PVGA 1YVJA 4L45A 1GIJA 1STCE 3BGQA 3TNHA 3LLAA 4O7RA 3G2FA 5BQ0A 3PFQA 2DYLA 4IBMA 4W4WA 3E8EA 4RQKA 4LYNA 4F0GA 5HIBA 3ZYAA 3HECA 4QOXA 5C1QB 2ITVA 2V0DA 4QP2A 5GJDA 3VUMA 4FNZA 5GNKA 1RQQA 3R00A 4BIBA 4IZAA 4J71A 3LQ8A 4WIHA 3N51A 3OMVA 5GINE 3W2SA 3QLGA 3FZSA 4F9YA 2PU8A 3EN6A 4IWDA 1URCA 3ZRLA 3UVQA 4BY9E 4FL2A 5FLFA 4E6CA 3UGCA 4LGHA 2J6MA 4FNYA 4WUNA 3PP1A 2ITPA 1ZARA 2X2KA 4TKSA 4D5HA 2YLFA 4YSJA 3MH2A 1AD5A 4CCUA 1ZOHA 3F5XA 5FGKA 2GHLA 4GYIA 3UNKA 4MBJA 4J98A 5EM7A 3D83A 2NRYA 3DNEA 4FNXA 4IZ7A 5HU3A 4RIWA 1OL2A 3SHEA 3JVSA 4YNEA 4BI2A 2BIKB 1PMVA 1Q5KA 2HK5A 2WMRA 3EQCA 2IG7A 2XK4A 4EHVA 1OGUA 5JKGA 5DG5A 2VO3A 2Y8OA 4FTMA 4UMPA 3CPCA 3NUYA 2FA2A 2CKPA 3TNPC 3DFAA 4EONA 3EL7A 2BKZA 2G15A 4DFBA 4RT7A 3VBXA 4C38A 3NUUA 3ORZA 4MD8E 4MX9A 4AOJA 5J1VA 4RGJA 2VTJA 3KREA 2EUFB 4OLIA 3TACA 4HZSA 4TY1A 3OW4A 4JBPA 3L9MA 3GBZA 3RNIA 4UALA 4FEUA 5EK7A 1H1SA 1UU3A 3LFBA 3UVPA 4RVMA 3WZUA 4WRGA 4DC2A 5HICA 5IEVA 3GCSA 2ZV8A 4CG9A 4F1OA 2QKWB 3SX9A 5A4QA 2CSNA 3C4EA 1TVOA 2PL0A 3E87A 3VBVA 4RWKA 3VUIA 2X2MA 4ZTHA 1J7LA 3AD4A 3U55A 5HTCA 1J7IA 2PVJA 3Q5IA 2X8EA 4D55A 3CC6A 2YN8A 1OL5A 3MBLA 4FKTA 3KN6A 4AUAA 3F5UA 5A46A 3P7CA 1BI8A 2F7ZE 2VWIA 2ZYBA 4IX5A 4CFNA 3D15A 4DH8A 3SXFA 4USEA 1GAGA 5C4KA 4D58A 4ZSGA 1CKJA 3DBCA 3K3JA 3HYHA 4FVRA 3M2WA 1G5SA 4ZJJA 3KY2A 4M67A 2JDRA 4AT3A 4E4NA 2P2HA 5KHWA 5M4FA 2QG5A 5IA1A 4C59A 4WRSA 3SKCA 3C5UA 4Y83A 5H8EA 5HO8A 4DCEA 4D28A 3IKAA 4RA4A 4XG9A 3QXPA 5K0XA 2FSLX 2BFXA 3QTIA 4DF3A 1GJOA 1YWRA 4P2KA 4XOZA 3HUCA 4WUAA 5EYDA 3EN7A 5BYLA 4JR7A 3HA8A 3WZDA 2J51A 4EYJA 3JVRA 2W4JA 4GUBA 5CEPA 2O63A 4ANNA 2VUWA 3R1SA 3C4XA 1FBNA 4KAOA 4L44A 4FICA 4RIOA 2HY81 4I24A 3VW6A 2WTIA 5AM7A 5CF5A 2PULA 3Q4CA 1DI9A 4FKSA 5M53A 4F9WA 5EYCA 4IB3A 1ZXEA 4HCUA 1GZNA 3UP2A 4WNPA 4JLCA 2C6KA 3R8UA 3CE3A 4LV8A 4L68A 4YJUA 4E20A 2IZSA 3NAYA 4PQNA 1PHKA 5DRDA 4MQ1A 4EI4A 2YCRA 1DI8A 3HDMA 5JN2A 2O8YA 3O8UA 1RW8A 5L2IA 1J1BA 2YDJA 5HLNA 3D9VA 3I0OA 5HLPA 4FF8A 4JDKA 3WIKA 4C3RA 4EHGA 2FSOX 3WF9A 3V01A 3VUTA 4V04A 3DJ6A 4M12A 4JVGA 5IMXA 3FLNC 4B4LA 4K11A 4O22A 4FKUA 2NO3A 3VRYA 5LVNA 3ORTA 3ENMA 4OUCA 4DH1A 4O0UA 2WMUA 4R6VA 5DH3A 1R0EA 3OCSA 4IX6A 4X0MA 3T3VA 3KQ7A 4UY9A 3WI6A 5EOLA 4NW6A 3A7IA 3QALE 3ID6C 2C3KA 3TKHA 3EH9A 4TYIA 1JSTA 5T3QA 2YHVA 1Y8GA 3V04A 3VS6A 1Q8TA 3LJ0A 3SRVB 3R2YA 4EHZA 4I3ZA 3A99A 3R22A 5KHXA 4GH2A 4YTHA 3S3IA 4TWCA 3DTWA 4EH7A 5GZAA 3A8XA 2XEZA 3A60A 3R7VA 4FEVA 4L53A 3RM6A 1K9AA 4TXCA 1MP8A 4D2VA 5EM8A 4C4JA 3MIAA 4S2ZA 2OXDA 3RZBA 4ZSAA 3OT8A 5D11A 2VGPA 3VF8A 4KSPA 2G9XA 3NYXA 4JOAA 4U8ZA 2PVKA 4QT1A 5HGIA 4AZTA 4LL0A 2GTMA 4U41A 4P90A 3I5NA 2EXEA 4BTKA 4JNWA 3HAMA 4DG0E 2PZPA 2OIQA 2C6LA 2B54A 3COIA 4YO6A 2ONLA 4WA9A 2XKDA 2ZJWA 3C4CA 5AX3A 1H08A 3SXSA 3DKFA 3LM0A 2UZVA 2X4ZA 4C3PA 2FVDA 4QTBA 4FG9A 5FXRA 3ITZA 3W32A 1E1XA 4AW2A 3GCQA 2VWUA 2Q0NA 2RF9A 3PE1A 5DHJA 5AV1A 3OBGA 1JQHA 3R63A 4AA4A 4D1SA 2V22A 4O6EA 1BX6A 5E4HA 3ODZX 5CLPA 4M0YA 4DH7A 4D9TA 2C0TA 2Z7SA 5LXMA 3FL5A 5CY3A 3AT3A 5TR6A 5LOHA 4UN0C 3FMNA 4J99A 3JY0A 4WG3A 3BRBA 5AP1A 5LWNA 3W18A 5CAUA 3W8QA 2W5HA 5HEZA 4D9UA 4FYNA 4QMPA 4O83A 4DG2E 3MW1A 1BLXA 5E8TA 3KXMA 2XBAA 3RVGA 4BI1A 3UVRA 2GDOA 3BEAA 4IHPA 4DFLA 4HVHA 2XYNA 4X3FC 4MHAA 2PWLA 2YM7A 4DFXE 1JNKA 5L2SA 3VULA 3ZHPC 5CASA 3GU6A 2HW6A 4P7EA 5DFPA 4I5HA 3SOCA 4ERWA 4TWNA 4GYGA 4AAAA 2O65A 4HYIA 4NM3A 2HZ4A 3Q04A 5AUWA 4H36A 3IS5A 5CT7A 5KZIA 4CZUA 3QGYA 4QMSA 2GTNA 2YIQA 4RSSA 5DLSA 3F61A 3GU7A 4CG8A 3HRCA 4IAAA 4C02A 3TZ9A 2ITNA 4XHKB 3VJNA 4HNIA 2R3HA 3V5PA 3F6XA 4JL9A 5IUGA 3NSZA 3I6WA 3NWWA 4NT4A 4E7WA 4WO5A 3NUAA 2OBJA 3G6GA 3EFJA 3PVUA 4J8MA 3MDYA 2C5NA 2A4LA 2GNIA 2BROA 2VTMA 3QWJA 1BI7A 5FXSA 4GKIA 3MPTA 4FTNA 4LGDA 1NA7A 4IH8A 3C13A 5HX6A 3PZEA 4UXLA 3FI3A 3R30A 4LMUA 2IZUA 4CKJA 3GQLA 4CQEA 3FLYA 4BHZA 2ERZE 3TJDA 4EKLA 4ZZMA 3UE4A 1GIHA 3HDNA 4IE9A 3UOJA 1H1RA 3BX5A 5G6VA 4F4PA 5B2MA 5C4LA 2J90A 4MXYA 4APPA 3FC1X 5ETAA 2QOKA 1XBCA 4GK4A 3P7BA 4G6NA 2AYPA 4FBXA 1KV2A 4DITA 2YISA 3L8XA 4EYMA 4C2VA 3NZ0A 2RG5A 3Q9WA 5EDQA 2JLDA 2XF0A 3H9OA 4QP8A 3MH1A 1GNGA 4NK9A 3MY1A 3CBLA 5FG8A 2RFDA 4YSMA 2OG8A 3BYUA 3ZM4A 4BZDA 4Q2AA 4EOMA 4AG8A 3H10A 4FL3A 3PPZA 4W9XA 2HENA 2IPXA 5EI8A 5I3OA 3VS3A 1OL1A 1Q62A 1QMZA 2CGXA 4U44A 4YJTA 3R9DA 3DDQA 5D7AA 3NNWA 3P5KA 3Q4ZA 5HZNA 5FTQA 2GHGA 2C6EA 4M14A 1YXTA 1XH9A 5FP6A 3A7HA 3VRZA 3GFWA 3HRFA 4UMUA 4GS6A 1M52A 1PXIA 3K3IA 4RC2A 4FTCA 3W16A 4YPDA 3BI6A 1NVSA 2QOBA 5M57A 3TZ7A 5KMOA 1F3MC 5AP5A 5HCYA 4FK3A 3DJ7A 5FDPA 3KCKA 4YJRA 4TYGA 4ASEA 3C5IA 1FPUA 3MA3A 2W17A 3U8WA 3H0YA 2RL5A 3W55A 4ZSEA 3DQXA 4C58A 4ALWA 5A14A 3K5VA 1Q61A 2Z2WA 4U3YA 5CEQA 3NYNA 3C51A 3B2WA 1ZOGA 4YZ9A 2UZLA 1ZZLA 4MYGA 4D2RA 5K9IA 4JQ7A 2LAVA 4KNBA 2B0QA 3ZU7A 3ETAA 1H24A 3KB7A 5AUVA 2ESMA 3NVKI 3RI1A 4Y8DA 1H1QA 2UW0A 2CPKE 1M2RA 5HG8A 1NT2A 2QURA 3M42A 2B7AA 3DBDA 1QCFA 2UVZA 3DKCA 3LHJA 1PKGA 2OW3A 4RX9A 5DI1A 4E6QA 4G3EA 4KKEA 5BMMA 3W10A 3UZTA 3AXWA 4GMYA 4R1VA 4XLVA 2Y4IB 1P2AA 4KIPA 4DH5A 5LMKC 5AR2A 3QD3A 4EORA 3P86A 5AV4A 2W05A 2C3IB 4W4YA 1QPCA 1TKIA 5E92A 4ID7A 3QQHA 5EHYA 4KS8A 2CGUA 2E2BA 4KBCA 4YUQA 3KVWA 3FE3A 4NIFA 2QQ7A 4JR3A 5CANA 2YERA 3TUCA 1CM8A 5L6OA 3CKWA 3AC5A 2YM5A 5HBJA 2R2PA 4I6QA 4WSYA 3DB6A 3COHA 2WTKC 3G9NA 3BGPA 3LE6A 2XBJA 4BCPA 1OBDA 5M07A 3BEGA 3DU8A 4OBQA 3NW5A 4YC8A 3AG9A 2W9ZB 4E6AA 1BKXA 3QA0A 1B39A 3OROA 3BV2A 4G9RA 4PMMA 2CDZA 3Q6UA 3QUEA 3FMHA 4XV2A 2YZLA 1A06A 3OWJA 2BFYA 2JIIA 3OP5A 3QYWA 4A07A 4HW7A 4O7SA 4YJOA 4GCJA 2FH9A 3NCZA 4FV4A 3NR9A 5JGBA 4IX4A 3U9CA 2O64A 2YA9A 3PXQA 2EWAA 4NW5A 5A6OA 4PPCA 3IO7A 4YZMA 4BI0A 3EKNA 3UQGA 4TYHB 3MV5A 4K2RA 4YLLA 4BCFA 4LFIA 4ENXA 2F9GA 4J8NA 3NW7A 2Q0BA 3SRVA 4MXCA 3RBWA 3FYJX 4A4OA 4D4RA 4QMNA 3LJ1A 4B6LA 1GZKA 2C68A 2F7EE 4IC7A 2JIUA 2OSCA 3VS0A 4BDJA 1W83A 1SM2A 2OH0E 3NGAA 5HIEA 3VVHA 4I0SA 4QPAA 2WMWA 5JFXA 3RPOA 1Q8YA 2XJ2A 3EQGA 4KWPA 3BQCA 3UOKA 4X2JA 2GNJA 3VN9A 5J1WA 4CXAA 5J7HA 3OD6X 3CSVA 3F3VA 4GT5A 3KK8A 4A7CA 4DEHA 2YJSA 3JS2A 1REJA 3AC4A 4ZZOA 3R9OA 3R04A 4P5QA 3ENHA 2BR1A 3PXYA 5IMEA 2GU8A 3LW0A 4EOIA 5C8NA 3G33A 2R3QA 3NIEA 3ZLYA 2FSMX 4XG7A 4BCGA 3DTCA 4PMSA 4PDOA 2XCKA 4EHEA 3IW7A 1PW2A 3F2RA 1V0PA 3BPRA 4ACMA 1P5EA 2PHKA 3FSKA 3KXZA 3W2OA 1ZYCA 3SVVA 4RFZA 3E5AA 1J3HA 3GCPA 3IOKA 1QPEA 4GFGA 4TYJA 5IQDA 4GW8A 2HAKA 3DCVA 4M68A 5LVPA 4MBIA 4O0TA 3GOPA 4YGAA 3F2AA 5DWRA 3PJ1A 4FR4A 4K77A 2X2LA 3E63A 4Y5QA 2UW3A 1G3NA 2PVRA 5ANKA 5IQFA 3PZHA 4FKIA 4NCTA 2PUNA 3QXOA 1BL7A 2WHBA 4MF1A 1JVPP 4CZYB 4KS7A 2YDKA 3OVVA 3PG3A 3R8LA 1L3RE 3HGKA 5AP7A 3O23A 5AA9A 4FEXA 4GKHA 4BR3A 1OVEA 4H1MA 4IEBA 3P08A 5CVFA 4EOLA 5TE0A 3Q53A 3UDBA 2YM4A 4E8AA 4G34A 1YXXA 5BVNA 1UWHA 4CVAA 4B7TA 4O0SA 5AUYA 2WTWA 2YM3A 3VNTA 3MY0A 4TYEA 5DGZA 2JITA 4BBFA 3C4FA 2DUVA 3OXZA 3SAYA 5IDNA 5FP5A 4DN5A 3LIJA 2I0EA 4IWOA 5FWKK 4PUZA 3TCPA 4W4XA 5AV0A 3BE2A 3HV4A 3HL7A 1Q3WA 2OJJA 4FTOA 3V5LA 3R6XA 1YRPA 2YCFA 2YEXA 3OY1A 3BYMA 1YHSA 4FTRA 4MXOA 1LUFA 4O82A 3AC2A 3IDBA 3G90X 4W9WA 4FT0A 4YJSA 5DPVA 5HI2A 2JKKA 4ARKA 4L01A 2W96B 3DJ5A 3FPMA 3POOA 2P55A 3CJFA 4ACGA 3UO6A 4M13A 4D4VA 2WOUA 3MH0A 3FJQE 1OL6A 3QLFA 2VTRA 2CKEA 3EZVA 1O6LA 4QYFA 3T9IA 3NPCA 4CD0A 5GIPE 3IGOA 5M44A 4QYEA 4FTUA 4X3FB 3ZEPA 4FG7A 5IQIA 4BDAA 2SRCA 1WZYA 3KN5A 4EQMA 2X0GA 2V62A 5KZ0A 5HNBA 4D2SA 2QOQA 3DAEA 2F57A 4RJ8A 4IX3A 4Z9LA 5E90A 4J52A 4EWQA 3LFQA 4DH3A 3PVBA 3RPVA 3PDTA 4PV0A 3CEKA 3FZPA 2WQMA 5CSXA 3RCJA 3AMYA 3AQVA 3QRIA 4XYFA 3FWQA 3PIYA 3OWPA 1FGKA 4KBAA 4O21A 4XG2A 5TOZA 2F49A 2YACA 5LVOA 4G3CA 4TRLA 3U6HA 2CMWA 1Z9XA 5TF9A 3P1AA 5GJFA 5IH4A 2PUPA 3UZRA 2HCKA 5BVKA 4AW0A 2B53A 1IG1A 2GS7A 3KULA 3L9NA 4BWXA 4F7NA 4M8TA 4CFUA 2UZDA 3QD2B 1URWA 2AC5A 3FKNA 3EYGA 3GGFA 4FL1A 2UUEA 3UPXA 1PMEA 3BYVA 4OTIA 5KKRB 4A06A 3CKXA 4YU2A 4W8DA 5DEWA 3ZLSA 5HCXA 5LMBA 4NCTC 4O27B 4QMXA 3ULZA 4BDBA 4DLIA 4C57A 3BE9A 5IEYA 3GT8A 5KBQA 4MWIA 4Z7HA 2WGJA 4WNKA 5DR6A 4Z16A 4OTRA 3OF0A 3PIZA 3PE2A 5DN3A 1MQBA 3LXKA 3GC9A 1NVRA 3MI9A 3NEWA 4X21A 4E6DA 3E7VA 4R1YA 3WF5A 3PTGA 2XK3A 4G2FA 3ZSIA 1H07A 4PTCA 4PMPA 4F65A 3VS7A 3RPRA 3PYYA 4KIKB 5FUTA 4MK0A 3RALA 4FG8A 2YWPA 2ZVAA 3TZMA 4Q9ZA 4OTDA 4DLJA 2W99B 1Q99A 3QKKA 4RJ3A 4OTFA 5HIDA 5JK3A 3RHKA 1A9UA 3ZRMA 4O7TA 3OCBA 3LCDA 1OPJA 2VTIA 5CEMA 3UC3A 3EL8A 3MSSA 4FV9A 5KO1A 2UW8A 1YOMA 4G31A 4IAFA 4W4VA 1IA8A 3L1SA 2X39A 3CY3A 2P33A 1O9UA 3BHUA 4CYIA 2GCDA 2XIKA 3A7JA 3GC7A 5FTOA 1MRUA 1Z57A 4DGOA 3ZFYA 2CJMA 4GFOA 1OKVA 3NUXA 3CQUA 3NLBA 5CEOA 4NKSA 2GS2A 4RWLA 4MH7A 2HELA 2QODA 4XOYA 4BCHA 5IQBA 4EH8A 5CU6A 4F99A 3REPA 4WBOA 2E9OA 4BDEA 4CMUA 5BUEA 5FRIA 1H00A 2OXYA 1DAYA 1PYXA 3RMFA 3L8PA 1R78A 5E91A 4AOTA 5FM2A 3NMUF 2JAMA 4CKIA 2XK8A 3QFVA 5ACBC 3RP9A 4JBOA 4FEWA 3VUGA 5BNJA 4K18A 4BCJA 4EOSA 3TJCA 2QR8A 2IVUA 3FZOA 3CTQA 1OUKA 3FC2A 1GY3A 2W4KA 3PJ2A 2BRGA 2CHLA 3RM7A 2XKEA 3PXKA 3ORXA 2W4OA 3F88A 2OFVA 4CKRA 3BBTB 3ANQA 3BU6A 3U6JA 4DEAA 1U4DA 2QVSE 3DQWA 2FB8A 4IMYA 3FAAA 4FX3A 4U97A 5DBXA 3BKBA 4FTJA 3TKIA 5KMMA 1H0VA 3D5UA 4RJ6A 4FT9A 1OL7A 3COKA 4HNFA 3TIZA 3L8VA 4Y46A 3FDNA 3OBJA 3RK9A 1P14A 5HHWA 4PNKA 4RJ7A 5IQCA 5LMKA 3DBEA 2NP8A 3HRBA 3CQEA 1NVQA 5F4NA 3SC1A 3VQUA 3N4UA 4V05A 1LPUA 3U6IA 1CKIA 3ZFMA 4GVAA 3GFEA 3ANRA 3LXNA 3PUPA 2X6DA 2FUMA 3R9HA 5JFSA 3I6UA 4I41A 4OTGA 5AAFA 3TEIA 3P9JA 4O84A 4FA2A 5CAPA 4CT2A 1VR2A 3WZKA 1I09A 2OF2A 4GK3A 2XIZA 5IQEA 1QL6A 4QYHA 5CYIA 5HG9A 4FEQA 4BIEA 4QMWA 5CZHA 3NX8A 5DT3A 4RX5A 4UEUA 5JFVA 3ACKA 3D2IA 4I4FA 2CCIA 4D5KA 1PMNA 2ITXA 3VBWA 3OWLA 5AA8A 5M4IA 5M4CA 4J53A 1PY5A 5EI6A 1UU9A 2P3GX 3PJ8A 3QRKA 2XNPA 1P4OA 5IA3A 1APME 5IUHA 3HVCA 2C5XA 1I44A 3HEGA 2JDVA 4AGWA 5JH6A 4IAYA 3O17A 4JQ8A 3LKMA 1R39A 4ZEGA 4X2FA 1IAJA 2C6DA 2VNYA 3KCFA 4ASDA 4BVUA 4O7ZA 3O7LD 4XG4A 5AAGA 5HNGA 4P5ZA 4Y72A 5BVDA 3IW5A 3ZZEA 3BHHA 3OUKA 4EC8A 3H3CA 4QP6A 3UMWA 4B8LA 5IPJA 4XH6A 2PZRA 4IADA 4ZXTA 1ZY5A 5FTGA 2WTJA 5LVMA 2XVDA 3LMIA 4C3FA 1K2PA 1Q8WA 4QYGA 4FTTA 4UB7A 4O7VA 4AE9A 2J5FA 3ZLWA 3LQ3A 3A8WA 1YXSA 3ELJA 3V5JA 1DAWA 3FKOA 5IG1A 3NRMA 3R1QA 4C4HA 5KMJA 1KOAA 5H3QA 3BGZA 3W2CA 1CKPA 4FZ6A 2YCQA 5M56A 3R83A 2VGOA 4EOKA 3LQ5A 3R8PA 2IW8A 4KSQA 3UIMA 5FQDC 3GOKA 4DGLC 2VTQA 2WELA 5BUJA 2BZJA 5D12A 4ZS4A 3VBQA 3LXPA 4RIWB 4ZLOA 3B8QA 5IQHA 3CQWA 4YLJA 3OXIA 4FKRA 3RWPA 4FKOA 3T3UA 3JUHA 4ACHA 3GC8A 4OAVB 3VS4A 5HORA 2Y6MA 1WBTA 4C4EA 4TYHA 3PXFA 3OCTA 2RIOA 4M84A 2WEVA 3EQFA 3P7AA 4TN6A 4KINA 1YDTE 3UQFA 2JEDA 3IECA 3ORKA 4FSRA 3CP9A 3QA8A 5HTBA 2QR7A 3EQBA 5EHLA 4U40A 3T9TA 5C9CA 3EOCA 4A9RA 2WTDA 4MEDA 5HESA 5IA0A 5BVFA 5AUTA 1KE6A 4KRDA 4NIFB 3VJOA 2XNEA 3WE4A 4ZSJA 4IB5A 4CCBA 2VTPA 4D2WA 5CVGA 5I0BA 4QRCA 4QTCA 3QHRA 4MCVA 5G1XA 3OCGA 2EB3A 3FXWA 3O8PA 2Z7RA 3F9NA 4R78A 3R2BA 1W7HA 2ETKA 5HE3A 1OB3A 5I3RA 3M11A 3VHEA 4DT9A 3OS3A 1XO2B 1WBWA 2G2FA 3MJ2A 3DDPA 5JQ8A 3HV6A 4FOCA 3NS9A 4HVDA 4IQ6A 4RIXB 4UZDA 3UP7A 2JC6A 2BRHA 4LOOA 4YJQA 5D9HA 2DQ7X 4JJRA 2JBOA 1Y91A 2W0JA 3V5WA 3CD8A 1M14A 3RWQA 1G8AA 1NY3A 5BMSA 4BWPA 5E8SA 2G2IA 3R1YA 3Q9XA 4ANBA 3VUKA 3FHRA 2UZOA 5KUPA 2VTNA 3U51A 3E3BX 4BTJA 4JT3A 5EQEA 1H4LA 4O0VA 3RPSA 2WKMA 5CF8A 3UNJA 4FV8A 1OPLA 3CXWA 1UV5A 2WMSA 4HCVA 3HNGA 3MS9A 4FKVA 3TG1A 2WQNA 4QD6A 4EH2A 5F20A 2IJMA 2J0MB 5HBEA 4FC0A 4FSTA 4CFVA 4LI5A 2OK1A 3ALNA 3R1NA 3RTPA 2B1PA 5A54A 2DS1A 1Q3DA 4S34A 3HZTA 2VWBA 3BYSA 1S9IA 2ZM3A 2ERKA 2PVHA 3HKOA 3LOKA 3Q6WA 5AV3A 1Q41A 3DLZA 4GT3A 2OZAA 4MNEB 3WARA 4Q5HA 4EL9A 5J5TA 5AUUA 4L42A 2XMYA 1FMOE 3E64A 5IKWA 2XNOA 1IASA 5E9EA 3D7ZA 5FXQA 3MN3A 5HE1A 4RPVA 2WFYA 3R8MA 3AGMA 3KMUA 3EZRA 1WBNA 3P23A 2UW7A 3MY5A 4D4YA 4U45A 4ITJA 4WG4A 4UX9A 3FQHA 2JGZA 3GVUA 4Z7GA 3LJ2A 4KBKA 4F64A 3GB2A 4U43A 3F2NA 3UG2A 5BYZA 4FMQA 2WMQA 4LUDA 4QQJA 3AMBA 4ITIA 1T45A 2PE1A 4IB0A 4L52A 4R3PA 4O7YA 2VO0A 4JRVA 3QQGA 3UIUA 4JI9A 3EQIA 4BDDA 2UZTA 4OW8A 3S95A 2JFLA 4ZTQA 3BCEA 3F3ZA 4XG8A 5KMNA 2XA4A 1BL6A 1XBAA 4LL5A 1VYWA 3K5UA 4R3RA 1YOLA 1BUHA 1UU7A 2QOFA 3U9NA 3TM0A 2P4IA 3OT3A 3KA0A 2JDTA 2X7OA 4I93A 5EHOA 2IW9A 5HU9A 2PK9A 1WBOA 5KE0A 4GU9A 2YIYA 2KULA 3E8DA 4EK6A 5GZ9A 3RAIA 3TUDA 3I7CA 5ANGA 4IB1A 1SVGA 4FSMA 5HE2A 3ZSHA 2QOIA 3NNVA 4NL0A 2NPQA 3TUBA 5AAEA 4FTKA 4CLJA 3II5A 5AP6A 5BVWA 1XR1A 4CEGA 2Y4IC 3QZIA 2VX3A 4EUUA 2X8DA 2XYUA 2ETMA 4C36A 1SZMA 3OEZA 1V0OA 4IZ5A 1WVYA 4M69B 3UG1A 4BICA 1WBPA 2Z7QA 4JG8A 5EW3A 2RGPA 2JIVA 1OKWA 4IAIA 1Q97A 4BL1A 3QQUA 2WMBA 3CGFA 4YPSA 3ET7A 3O2MA 2FGIA 3WILA 4CFWA 2HXQA 2VTSA 3LVPA 1YQJA 3W2PA 2ACXA 3MB6A 3E7OA 3KVXA 4UZHA 4DT8A 1R3CA 1LEWA 4B8MA 5FBOA 4IM3A 3LFCA 3MTFA 3UC4A 4FV3A 3DAJA 3FI4A 4ZY4A 4KB8A 4S31A 4NFNA 4ZTNA 5AIKA 4JS8A 4BKZA 4QMVA 1W84A 4C34A 1YHVA 4IFCA 1BMKA 5AUXA 3WF7A 3PJ3A 1OIQA 1OIUA 3OEFX 3KFAA 1SYKA 2BAJA 4QPSA 4WKQA 5A4LA 3MJ1A 4FK6A 4C4GA 3NCGA 1CDKA 3HMPA 3TN8A 2ETRA 1W82A 4I22A 4AU8A 3HP5A 1LR4A 3IW4A 4RVLA 2NNWB 3OFMA 2H96A 3S4QA 4ANQA 3G9LX 4PDYA 4K1BA 3D4QA 4AN3A 3K54A 4HJOA 4EOJA 1A48A 4EJ7A 2OXXA 1WBVA 3IQ7A 4BBEA 4LOPA 4TNDA 2C47A 4WD5A 2XP2A 3MFRA 3PVWA 3PJCA 4KIKA 3KGAA 3KU2A 5HQ0A 2ITQA 3FLSA 1YI6A 1ZWSA 2AUHA 4FV0A 4LG4A 4ANLA 4GRBA 3EIDA 5DMZA 4O81A 4K0YA 1IRKA 1WCCA 4RVKA 4EZ3A 1W0XC 1RE8A 4PWNA 1PJKA 3H30A 4NZWB 2IZTA 3ZH8A 4ITHA 4JX7A 4ZJVA 3VHKA 2PSQA 2X9FA 3ZUUA 4KRCA 2VWVA 5ANDA 4L9IA 4BF2A 3LMGA 4J7BA 5E8XA 3SXRA 4BC6A 4AF3A 3ZO2A 4N6YA 4CT1A 4AW1A 2B55A 1YOJA 2BRMA 4L8MA 3DK7A 2BHEA 3LFSA 4RIYA 5AUZA 5H2UA 2BUJA 3ORPA 2EB2A 5HG5A 4XBUA 2CLQA 3FXXA 3MVJA 4HZRA 2ONLC 3P79A 4DE4A 5L3AA 4TT7A 3MVHA 4RMZA 1K3AA 5FEQA 1OECA 5I9ZA 1LEZA 4CTBA 3G15A 4O0RA 1SVHA 3PG1A 4U7ZA 2WO6A 4WSQA 4NM7A 4XP2A 3I1AA 3PRIA 5J87A 5CSPA 3FI2A 2OI4X 3AT2A 3SDJA 3BHYA 4KUJA 4XX9A 1KE7A 2XIRA 3OC1A 3PWDA 4AZWA 5L6PA 1REKA 2IWIA 2R3LA 2W1FA 3KEXA 4X2KA 2OIBA 4QQTA 5GIOE 4JQEA 3KF7A 3EN9A 1H25A 2A19B 2QHNA 4K33A 2QKRA 3UTOA 4BCNA 5CF4A 2RKUA 3IDCA 1HCLA 3DXQA 4EOQA 4YZNA 3QZHA 4FI1A 4DEIA 2IN6A 5M4UA 2J50A 2QO7A 3QRUA 4TNBA 2X4FA 3O96A 4L7FA 3NYVA 2VWYA 3QGWA 4C4FA 3ATTA 4FSZA 5JRSA 1ERKA 2R3IA 4FUYA 5F94A 2BAQA 3JPVA 4YLKA 2OJGA 5HVKA 4DGGA 4U9AA 2BDFA 4F7JA 2V7OA 4LM5A 3L9LA 3W2QA 3PSBA 3R7YA 3A4OX 2JFMA 2BDWA 2O2UA 4C2WA 4G3GA 4Z3VA 5M06A 4AP7A 2WQBA 3UOHA 1KOBA 2GQRA 3D7TB 4M69A 2UW9A 3C4ZA 4EZ5A 4F9CA 3IW8A 4BCIA 5HBHA 2DWBA 3FEGA 3QX2A 4RJ5A 4ANSA 3V3VA 3A4PA 1WFCA 4APCA 4IACA 5JMSA 5E8ZA 4IANA 4LRKA 4X3JA 3JYAA 2VO7A 3A2CA 4X6QC 4QQCA 4QYYA 4FIIA 4R3CA 1PXPA 4PRJA 3LAUA 5HOAA 2CNVA 4IAZA 4EQUA 4FZDB 5HX8A 4GUEA 4ONAA 3D2KA 4MQ2A 4O6LA 5J95A 2CKOA 4FODA 2LGCA 4DBXA 4QP7A 2PVLA 3PXRA 4A4XA 3R02A 2GFSA 2A0CX 3MVMA 4BFMA 2NRUA 1VYZA 2EXCX 5L2TA 3GENA 2QOLA 3HLLA 4I92A 2OJIA 3PRFA 4ZSLA 4ERKA 3U4UA 5CU0A 3G0EA 5D7VA 4U42A 4FV2A 3PPKA 2A1AB 5BYYA 4CMOA 5E7RA 4HGSA 1XQZA 5CAVA 2CGWA 2YITA 1H28A 4NYEA 4XUFA 2PUIA 3ALOA 2Y6OA 3QTUA 1OBGA 3GQIA 1WBSA 4CV9A 5HG7A 2XZSA 3BWJA 4FV7A 2UZUE 5T68A 5AM6A 4RC3A 5IF1A 4YJPA 4A9SA 3EYHA 5C26A 2P2IA 5J5SA 2YWVA 3KL8A 5DE2A 3QBNA 5M55A 2CN5A 5TO8A 3ODYX 3KXHA 4M66A 4HPTE 3KRXA 2WU7A 3TNWA 3RAHA 2R7BA 4L3JA 4XV1A 1VZOA 1ZYDA 2RSVA 3CPBA 3IG7A 4GVJA 4CFFA 3DAKA 5B2LA 4QMQA 2B9IA 3O50A 4FTAA 2X1NA 1FGIA 4FV1A 2QU6A 3O7LB 1TQIA 5IZFA 3OUNB 1W8CA 4HVSA 5C8KA 3OOMA 4FVQA 1M2QA 4CFMA 2OLCA 2GMXA 2XNMA 2E9PA 4F63A 1XHAA 1ZMVA 4XRLA 4TPTA 4AA5A 5DOSA 2R0IA 2VV9A 5IU2A 1YXVA 3R0TA 4ZTMA 4I23A 5D1JA 3AMAA 3RCDA 3THBA 3DGKA 4FSUA 2QI8A 4RRVA 3KF4A 4XP3A 5AR4A 4BGHA 5A9UA 2WNTA 4NUSA 3F69A 3UNZA 4ACCA 4FKGA 4G6OA 2X81A 3TV7A 4F7LA 2I6LA 2C5YA 4PPBA 5LCJA 2W1CA 3I4BA 1OKYA 2B52A 4BBMA 5I9WA 2JBPA 5C01A 1YDRE 5EG3A 2R5TA 4JDJA 2GNLA 4G5JA 4FZ7A 1XH5A 3PY3A 4AACA 4KIQA 1Y57A 1OKZA 5IA2A 5JT2A 1H01A 4HGEA 4XCUA 5CU2A 1NW1A 3DY7A 5H8GA 4PTGA 2XM8A 3NIZA 2ZOQA 4PF4A 5EOBA 4A9UA 2PPQA 1UVRA 2R3MA 3NW6A 5HKMA 2W1IA 3N9XA 3QCSA 4UV0A 5KNJA 3LXLA 4OGRA 4AZFA 5CU4A 3KKVA 2WTKB 4BDKA 3R7OA 5B7VA 5JQ5A 1JWHA 4RWIA 2PY3A 3V5TA 4C35A 3R9NA 3TV4A 4Y5HA 3H9RA 3COMA 5AADA 3QD4A 2R3PA 2OZOA 4BTFA 4F0FA 4ZP5A 5CF6A 2E9UA 2H9VA 3I79A 4FSQA 4NM5A 1RJBA 5AWMA 4FSWA 3R71A 5E1SA 3KRJA 5DR9A 3ROCA 2QO9A 4R5YA 2WB8A 2BTRA 3R7GA 5BPYA 3SA0A 1U5QA 3F82A 3VBYA 4ANMA 3QC4A 2WMAA 4UBAA 2EXMA 5JGDA 2FYSA 2ITOA 3HMIA 4Q5EA 4QMLA 3CY2A 4R77A 3QUDA 1AQ1A 4H39A 2OIDA 4FTLA 3AD5A 2BHHA 3PWYA 4NJDA 4CFXA 3VAPA 3GP0A 4AE6A 4QQ5A 4D2PA 3OG7A 4XJ0A 2R3FA 2WXVA 5CTPA 3DBQA 3FI8A 4LUEA 5HTIA 2G01A 3KULB 4G16A 2WQEA 5J9LA 2JKQA 2QG7A 3QTXA 3GNIB 3ZDUA 4U80A 2Z02A 4KD1A 2C4GA 3MH3A 1E1VA 4L7SA 4ASZA 4QPMA 5M51A 3FV8A 3KXXA 4F70A 3ATSA 1XH6A 1BYGA 2R9SA 4TW9A 3VS1A 4FIFA 4IC8A 5FEDA 1OIRA 3A61A 4OBPA 2OH4A 3QCXA 4J1RA 5HO6A 3DA6A 4M0ZA 5CXHA 3ERKA 4J97A 1KSWA 4IIRA 3R7EA 2OO8X 1Q4LA 4DEDA 4QMUA 2J0KA 4YP8A 1PKDA 2QOHA 3A7FA 4B0GA 3UIBA 4EH9A 4JBVA 5ETIA 2CGVA 1SNUA 3QU0A 1UU8A 3ZC5A 4X3FA 1FMKA 3WYYA 4S33A 3ZO4A 1U59A 3NAXA 2A27A 5ACKA 3UZPA 1AGWA 2QHMA 2XB7A 2PMNX 4B9DA 4HVIA 2XIYA 3LZBA 5BVEA 3QQJA 3V8SA 3ZEWA 4G3DA 3RGFA 4JIKA 3H4JA 3OXTA 4R8QA 4GU6A 4U3ZA 3UQCA 5AIRA 4DTAA 2BMCA 4I6BA 3S1HA 3D5WA 4NH1A 2B4SB 2XEYA 5L4QA 4FYOA 3QQLA 4CLIA 3UMXA 4I0RA 4W8EA 4QTEA 1ZMUA 4ZTLA 5HVYA 2OJFE 4L3LA 4I0TA 3Q5ZA 5AR3A 2VX1A 4FNWA 2WTVA 1FVVA 4FT3A 3W33A 2OICA 4IVAA 4EH5A 4OR5A 4GSBA 5LWMA 3VUDA 2VN9A 2X9EA 1XWSA 3PY1A 5L6WL 4ZJIA 4BYJA 4H3PA 4BCKA 4OT5A 2QONA 2C1AA 3QTSA 3DT1A 5K3YA 1ZZ2A 2W9FB 3NYOA 1H0WA 3QTRA 3QUPA 5EW9A 4BKJA 5AR7A 4RWJA 3GI3A 4PNIA 5CXZA 4GL9A 2OZAB 4MNEA 5EYKA 3HMOA 5HLWA 1GZOA 4FGBA 3R73A 3RHXA 4RLLA 2UZBA 3GUBA 3FY0A 4RA5A 4WNOA 1JKTA 5DT4A 5F95A 1DS5A 2C69A 4G6LA 4LMNA 3WZJA 3QWKA 2R0UA 4ANOA 4AXAA 5A6NA 4FIGA 4U6RA 3QRTA 3E92A 4EH4A 4XV3A 5JZNA 3O51A 3V8TA 3DFCB 4D1ZA 4TWPA 2YCSA 4GIIA 4FT5A 4O2ZA 5CENA 4PL3A 3E3PA 2H34A 1IEPA 2ITUA 1FVTA 4N4SA 2C5OA 3IK3A 4OBOA 4XP0A 3UJGA 4F6UA 4IWPA 5EM5A 4IJ9A 3AD6A 4LQMA 2R3JA 4QMMA 4O91A 5AP4A 4EK8A 5CAOA 1H1WA 2BZIB 3D7TA 2PYWA 4K6ZA 4PL4A 4NFMA 4PTEA 4BTMA 2YIRA 3EFKA 3Q4TA 4USFA 3DXNA 5L8LA 3AC8A 3WZEA 2RG6A 2CNQA 4C33A 3Q9YA 4J96A 4DFUA 3FKLA 5F1ZA 4QTDA 3WF6A 4E1ZA 4FKQA 4CMTA 3UO5A 4USDA 4F1TA 5KBRA 4RG0A 5CT0A 2C6OA 2YABA 3F3UA 3S0OA 2GPHA 4EK5A 2IW6A 5EDRA 5HE0A 3TTJA 1PMUA 3RAKA 4BCQA 2VAGA 3JY9A 4I4EA 4WNMA 4YZBA 3ZUVA 2P0CA 2J5EA 5EI2A 2ZMDA 1WMKA 1GZ8A 3CLYA 4I20A 5CX9A 3A62A 4L43A 3F5PA 3F66A 3QD0A 5L8JA 4ZLYA 4II5A 1JKKA 2R3OA 4MNFA 3I7BA 3BU5A 4YJVA 4KIOA 4X2GA 3TDWA 4E4LA 4XV9A 1XBBA 2A2AA 3C9WA 4CYJA 5DRBA 4IVBA 1MUOA 2GHMA 3FSFA 3QCQA 4GIHA 4RZVA 2RFEA 2ZAZA 4QMOA 3PA3A 4EH6A 2BIYA 4JIAA 4QP3A 5JSMA 4IWQA 4AN9A 1HOWA 2WU6A 1M17A 5IH6A 3FPQA 4IXPA 5F9EA 1OI9A 4G5PA 2X7GA 3QKLA 4DTBA 3ZOSA 3SW4A 3QZGA 3LFNA 4G17A 4RFYA 5DIAA 3FQSA 2WEIA 4YNOA 3EQDA 4DA5A 3QTWA 2QCSA 2W06A 3MIYA 4PDPA 2WTCA 4RIYB 1ZRZA 3N4VA 3W8LA 1OZ1A 4IFGA 5CALA 5JGAA 3UO4A 4FUXA 1O6KA 2YJRA 4Q9SA 2W1ZA 2ZMCA 1ZOEA 4QP1A 1H26A 2E9NA 2J0IA 3FZRA 4CGAA 3FUPA 2ZM4A 4F6WA 1ND4A 4BWKA 2PZIA 3VQHA 5AX9A 3Q3BA 4FIEA 3IONA 4NTSA 4DAWA 5KMLA 2QLQA 1YKRA 4CRSA 4EKKA 2XCHA 2ZDTA 5L2QA 1OM1A 3QL8A 3OW3A 3TKUA 4NU1A 4UMQA 3C1XA 2C3LA 2XNNA 2HW7A 3PSDA 4FT7A 4JDIA 3SLSA 4E5AX 2XK9A 4FSYA 4TTHB 5L8KA 4KKGA 3Q32A 2YM8A 1WVXA 1YWVA 4LOQA 4XBRA 2FSTX 3EHAA 3TZ8A 3CIKA 4GJ3A 4J95A 3TT0A 2WPAA 1GIIA 1JSUA 3SW7A 5CNOA 4GV1A 2YIWA 3D94A 3V51A 2Y9QA 4IZYA 5IA4A 1MQ4A 3AC3A 2JKMA 4QP4A 1H8FA 4YBJA 4N6ZA 5T6KA 2VTAA 4DFZE 3I60A 1FVRA 5GHVA 3RAWA 4AZEA 4RJ4A 1U46A 3GC0A 3ZSGA 4F9BA 1U54A 3I5ZA 3PP0A 4PL5A 3EKKA 3NUPA 5C03A 4YTFA 2VTTA 2XS0A 4EUTA 5J9ZA 4IM0A 3ZLXA 3MA6A 4AA0A 4PMTA 2UVXA 3N4TA 4U5JA 3U87A 1Y6AA 2BDJA 4A9YA 1CTPE 2BRBA 2XNBA 2QU5A 2XJ1A 4L3PA 4AS0A 4JRNA 5E8UA 5BVOA 3LM5A 5A4TA 5I9XA 3ROYA 3W2RA 4F1MA 2HWPA 2R64A 3PIXA 1J91A 2XH5A 2C30A 3PLSA 5E8VA 5HD7A 4GJ2A 1YHWA 5FM3A 4ZOGA 4BGGA 3QKMA 2QO2A 3BWFA
chains in the Genus database with same CATH superfamily
3I81A 2WQOA 4I5CA 3TI1A 1XH8A 1PXOA 3RK7A 1KUTA 4KABA 4O96A 4AFJA 1XJDA 3ML1A 2OJ9A 1YWNA 3VIDA 4WT6A 4DHJA 3S2PA 2I7QA 3KRRA 1OMWA 2CNUA 5J9YA 3Q96A 5KCVA 2GFCA 3WE8A 4MXAA 3KMMA 2VTOA 1M7QA 3L8SA 4ZTSA 3QX4A 2BRNA 3CTHA 4PDSA 4K9YA 3FLQA 5B2KA 4ASXA 5I9YA 3EQRA 4O86A 3DK3A 2X7FA 3C0GA 3DKOA 4I5PA 3TWJA 2XKCA 2JDOA 5ETCA 5TKDA 4V0GA 4RFMA 5E8YA 3ZM9A 3KC3A 2GQGA 4WBBB 1JPAA 3GU8A 2IVVA 3D5VA 5CI6A 5LJJA 2OGVA 2R3KA 5I5ZA 1JOWB 5EYMA 3POZA 4BDIA 4JAIA 3MPAA 5HCZA 4BYIA 3O8TA 4XLIA 4BDHA 4R7IA 5HVJA 2HY0A 5CVHA 4Z55A 4FGRA 3TNQB 3CJGA 3E8NA 4FOBA 1MRVA 3NUSA 2ZV9A 2WZJA 4A9TA 4TWOA 5J79A 3F7WA 1UNHA 3W1FA 3O71A 4ZTRA 5CI7A 1XH7A 4C4IA 4OAUC 3OWKA 4TZRA 5LMAA 3C50A 4D4SA 3ZZWA 3G0FA 4QMTA 4PY1A 3MTLA 4FTIA 3E93A 5L2WA 3NNUA 3V6RA 1U54B 5FD2A 3RJCA 3ZBXA 2ITZA 5AV2A 4CV8A 1JBPE 1P4FA 2Y4PA 1JSVA 3IGGA 3HMMA 3HV7A 1OIYA 1KE5A 4V01A 5E8WA 5IH5A 1UNLA 4AXCA 2HZIA 3BU3A 3TTIA 1IAHA 2VWXA 3PY0A 3R01A 2IO6A 5IEXA 5K4IA 5H8BA 4KA3A 2PE0A 1PYEA 3C0HA 2XIXA 2HZ0A 2I40A 4JX3A 4HGTA 5CS6A 5IA5A 3VWAA 2ZM1A 2ZV7A 4WHZA 5KX8A 2GNHA 2QOOA 3Q52A 3TV6A 2ITYA 5J8IA 4M15A 3DS6A 5AP0A 4RZWA 5BX0A 1ZAOA 4C8BA 3B2TA 4KKHA 4DDGA 1MRYA 4BRXA 3FXZA 4E73A 4R5SA 4D2TA 3LFAA 2IF8A 2R4BA 5CQUA 4RIXA 3DXPA 5DYJA 4BKYA 2CCHA 2Y7JA 1JLUE 2IVTA 4MD9E 3FQEA 3FYKX 3VC4A 2W1DA 4RX8A 4WOVA 3LMHA 2ITTA 2XNGA 3V8WA 4DTKA 5CEKA 2JD5A 1YI4A 3K2LA 4IVCA 3FMDA 2VTHA 5IUIA 2VU3A 2OU7A 4CSVA 3DKGA 2R3RA 5DT0A 4YTIA 4EOOA 3UIXA 2X6EA 3R7UA 2ITWA 3QC9A 4BCMA 3EQPA 3R7IA 1JAMA 3LFFA 3DLSA 4E5WA 2G2HA 1LP4A 4TL0A 2I0VA 3MESA 1W2CA 4RVTA 4EZ7A 5A4CA 3E88A 4O0WA 3FLZA 1WAKA 2VD5A 1SNXA 3LFDA 3ZC6A 2Y0AA 2WD1A 3OTVA 2O5KA 4FZAB 5JZJA 3FHIA 4O2PA 4QP9A 4ZIMA 2BZHB 3EB0A 1FQ1B 2Z60A 4HYUA 2GS6A 4PPAA 4FTQA 1L8TA 2BAKA 3BZ3A 4L6QA 2VWWA 4UXQA 1Y6BA 3HV3A 4MXZA 3NDMA 4AFEA 1ST4A 2REIA 3NFFB 4QTAA 4DFYA 4MAOA 3MWUA 4E26A 4GG7A 2UZEA 4JXFA 2KTYA 5JRQA 4DBNA 4ALUA 3LFEA 4DG3E 4MD7E 3KXGA 2AC3A 5AP2A 2XM9A 3FZTA 3BLQA 5EW8A 3O0GA 4HPUE 5I4NA 3EMGA 4Y95A 2CN8A 2HXLA 4PP9A 4LRMA 4IW0A 5K4JA 4NJ3A 2R7IA 3MB7A 4R7HA 3VW8A 2QNJA 4ALVA 1UKHA 3HA6A 4BGQA 5I9VA 3TDVA 1UA2A 2HZNA 3CGOA 1J1CA 2YM6A 3MFSA 5LVLA 2C0IA 2PVFA 3BELA 3LLTA 4QMYA 4V0GB 4ENYA 4U0IA 2C3JA 3VBTA 2C5VA 4JG7A 4ZY5A 5FDXA 1CMKE 5B0XA 1CSNA 1FOTA 4I6HA 3ZFXA 5EQPA 3OZ6A 4G9CA 3ZO3A 2VZ6A 4I1ZA 4ZZNA 5GJGA 4YR8A 5A3XA 3NVMB 5EQYA 2PVYA 5D41A 1YW2A 5KKRC 4FVPA 3CD3A 3G5DA 2XKFA 4CZTA 3Q60A 3WBLA 4ORKA 3DPKA 5DEYA 1X8BA 3SGCA 3CS9A 1ZY4A 2EU9A 3DB8A 3GXLA 3GCVA 4FKLA 3QHWA 2C6TA 4RBLA 2I0HA 2QOCA 4AT5A 5CEIA 3ZMMA 4BIDA 4ZLZA 5ICPA 4XMOA 3VS2A 1ZYSA 5K5NA 2BZKB 2JKOA 1W98A 3LCKA 5CSVA 4F0IA 4ZS0A 1UKIA 3QZFA 2UW4A 4GG5A 5IISA 4O7NA 4X6RA 5IQGA 3JR1A 3BLRA 1ATPE 2YAKA 4GFMA 4F08A 4X2NA 3FLWA 3AT4A 2W5AA 4G1WA 3QAME 4RC4A 3IPHA 3PXZA 3BYOA 4YHTA 4AXFA 3VS5A 4BDCA 3ZRKA 5HNIX 5EDPA 3C4WA 3DZOA 4MBLA 3CTJA 2WMXA 4YTCA 1KWPA 5ETFA 4UMTA 4AZSA 4DHFA 3SG9A 2OWBA 4NSTA 2G1TA 3ORLA 5AMNA 2YLEA 4YBKA 4DEBA 2VWZA 4YMJA 4I21A 4F09A 4IJPA 3WOWA 4G3FA 2V5QA 4PP7A 2VNWA 3G51A 4H3QA 4O4BB 3ZDIA 3KRWA 2PE2A 1DM2A 4M97A 3ORMA 2IVSA 4E93A 2F7XE 4E4MA 2PUUA 4YC6A 4O0XA 1NXKA 2HYYA 3ACJA 4WG5A 5K5XA 3EFLA 3SV0A 2J9MA 3IOPA 5CSWA 2WIHA 3EN4A 2Z7LA 1V1KA 5AR8A 2PMOX 4O7LA 5BUIA 3EFWA 3W0MA 4FRFA 4CNHA 3KIOC 3C7QA 5EFQA 4CQGA 4CRLA 5JFWA 2PVNA 4DINA 1M7NA 4D1XA 3QTQA 5IDPA 4XEYA 3GU5A 4UWBA 4FE2A 2F2UA 3D14A 4OTHA 4X7QA 4ZMFA 3FL4A 2W1EA 4YZDA 5EM6A 4AZVA 2OFUA 3R28A 1Q8ZA 4O0YA 2UVYA 4P4CA 5CWZA 3UBDA 3PPJA 3R8ZA 2YDIA 5KMIA 4K8AA 4NWMA 4EQCA 3NNXA 4EC9A 4H58A 4DFNA 1PRYA 5ANJA 3AGLA 2Z8CA 4IDVA 3RINA 1R0PA 4C61A 2E9VA 2PMLX 4HOKA 2XRWA 4O1PA 4XRJA 4HCTA 5DNRA 3RK5A 3ZTXA 2OF4A 4LV5A 3LCTA 4F7SA 2ZDUA 1GOLA 3D0EA 2J0LA 5FEEA 3ZXZA 5K0KA 2BCJA 2GNGA 2J7TA 3ZS5A 2PZYA 3P78A 1VJYA 2YIXA 4OT6A 4UYAA 5EKNA 1OPKA 3IW6A 2XARA 4EH3A 3E8CA 2C6IA 4E4XA 3BQRA 3MPMA 3UYTA 3JXWA 2V7AA 4YURA 2JDSA 3BHTA 4L46A 4BN1A 1IA9A 2AQXA 4DYMA 3ZO1A 3EQHA 1OITA 1EH4A 1WVWA 2R3NA 3HV5A 3QQFA 4M3QA 2QD9A 2B9JA 2VX0A 2WMVA 4RQVA 5ANEA 4H1JA 3R8VA 5CSHA 3TL8A 4EK3A 3GEQA 5CZIA 4E3CA 3KK9A 3C0IA 5CNNA 5DVRA 5BV3A 4NEUA 4EOPA 3RNYA 4QNAA 4XG3A 5EH0A 4XS2A 2ZB1A 2RFNA 4RLKA 3UPZA 2GSFA 4BZOA 2YFXA 3Q2JA 4O38A 4BB4A 3BBWA 4D0WA 2XK6A 3RPYA 4UYNA 3BIZA 4FIHA 4JDHA 3ZXTA 3SG8A 2OKRA 4OTWA 1H1PA 2XK7A 3OOGA 4YO4A 2CLXA 4EBWA 5A4EA 4AN2A 4EWHA 1U5RA 4O7WA 2BKKA 1H27A 1KE8A 2UV2A 3OY3A 4NTTA 5CAQA 3F3WA 1YDSE 4JAJA 4DGMA 3QRJA 4D0XA 3DZQA 3FMJA 2W5BA 1PXKA 1JKSA 1YI3A 3AOXA 3FMKA 3H0ZA 3TXOA 4AOIA 4AX8A 2O3PA 3G6HA 4I5MA 1VEBA 4N0SA 4QMZA 2PZ5A 2HWOA 3FZ1A 1B6CB 5LCKA 4O1OA 5D10A 4IAKA 1ZLTA 1RDQE 3QYZA 3QF9A 2J2IB 3MFUA 5CU3A 3EWHA 1TQMA 1T46A 3GU4A 1V0BA 3UYSA 2VRXA 3RKBA 1E9HA 3F7ZA 4YHFA 4FV6A 1ZMWA 2QC6A 4CTCA 3EJ1A 4S30A 2XRUA 2VTLA 2H8HA 3NUNA 2F4JA 2O0UA 2C0OA 4XG6A 3MFTA 4GEOA 1QPDA 3M1SA 5H9BA 4AGUA 4H3BA 3DOGA 4HYHA 4S32A 5IQAA 3ZBFA 1F5QA 4MTAA 5I9UA 1IR3A 2I0YA 2VO6A 4ZAUA 5LQFA 4C37A 4AGCA 3FBVA 1PXNA 4FV5A 3GCUA 5ANOA 4DEGA 3FMLA 5CQWA 3CCNA 2GNFA 3QTZA 2UW6A 3S00A 2ZV2A 2B9HA 5EKOA 2HOGA 3Q9ZA 4IDTA 5ANIA 5DA3A 2YZAA 4YC3A 4HVGA 1JKLA 2J0JA 4DEEA 4AQCA 4OTQA 2BALA 1SMHA 1Q8UA 2UW5A 3UODA 4MF0A 2BTSA 2F2CB 2PTKA 3PSCA 4F9AA 2PVMA 3DV3A 4YJNA 2W1HA 3KRLA 3Q4UA 4EEVA 3UDTA 4XNEA 4AXDA 3QCYA 3QQKA 5E1EA 4Y73A 2W1GA 4UWCA 3WIGA 4NKAA 4C7TA 2IZRA 2R3GA 3ORIA 4LGGA 4EBVA 4ACDA 3CR0A 1Z5MA 2X8IA 5TT7A 1PXLA 4JBQA 1TQPA 5HD4A 2CKQA 4L67A 4NM0A 4R7BA 2GQSA 4ZY6A 5J7BA 3V5QA 2A98A 1ZYLA 4LRJA 2BILB 5AFVA 4F6SA 3VF9A 3R21A 1PF8A 1W2DA 2WMTA 3ORNA 3FMMA 3FY2A 4HYSA 3AC1A 4E5BA 3MVLA 3Q2MA 3P0MA 5KMKA 1FINA 1KV1A 2RFSA 1UWJA 2BPMA 3SQQA 3UOLA 2JAVA 3DBFA 2IEWA 3F5GA 4YHJA 3WYXA 2UZNA 4BDGA 2PMIA 2WAJA 4FKJA 4I6FA 4N57A 3DK6A 4FSNA 4PX6A 4U81A 3LPBA 4JG6A 5AJQA 4AGDA 4OTPA 3U4WA 2UZWE 3IDPA 4GT4A 4MWHA 3SOAA 3HAVA 3OHTA 1ZYJA 2WIPA 4FKWA 3ZUTA 4C62A 5JEBA 3ULIA 3LCSA 4UMRA 4FKPA 4QNYA 4EK4A 1HCKA 3SD0A 4EJNA 5M09A 5GZ8A 1Q24A 2QLUA 3I0QA 4I94A 4RX7A 4B99A 3ZONA 3EN5A 4H05A 4UWYA 3B8RA 3L9PA 1J7UA 1R1WA 3BHVA 4Y85A 4DCAA 3PA5A 4HGLA 3HUBA 5C27A 3KMWA 4AW5A 1UNGA 3BV3A 5LARA 3HMNA 3D5XA 4YZCA 5C8MA 3U54A 1KE9A 3W0QA 2WOTA 2ZB0A 2J4ZA 2XJ0A 4MXXA 4ZK5A 1PXMA 1XH4A 1O6YA 3TNIA 5AP3A 3LCOA 4GK2A 3VUHA 4FIJA 2W7XA 1QPJA 4M7IA 3TIYA 1G8SA 4BJJA 4A4LA 4AWIA 3BLHA 4IM2A 3R9RA 1OUYA 3HP2A 5ITAA 3WF8A 2BVAA 1PXJA 1XKKA 4BCOA 2I1MA 3A7GA 5AR5A 1SVEA 4U79A 3KXNA 3ZCLA 4BDFA 1Y8YA 5FBNC 2Q83A 4FZFB 4MKCA 3PLAE 2B9FA 3PA4A 3T8OA 4ZMEA 3MGYA 3E62A 3FMEA 4L00A 5M08A 4DGNA 1YXUA 3V6SA 2EVAA 2YAAA 4BHNA 5HO7A 4QO9A 1S9JA 2HIWA 3F3TA 2FO0A 4BZNA 2V55A 2C6MA 4N70A 4C0TA 5AEPA 1B38A 3RZFA 3VO3A 1M2PA 3DNDA 2X0OA 4IVDA 4AT4A 4MVFA 3MYGA 1F0QA 2H6DA 2XUUA 3H9FA 3HX4A 2C1BA 3OTUA 3P4KA 5DR2A 3PVGA 1YVJA 4L45A 1GIJA 1STCE 3BGQA 3TNHA 3LLAA 4O7RA 3G2FA 5BQ0A 3PFQA 2DYLA 4IBMA 4W4WA 3E8EA 4RQKA 4LYNA 4F0GA 4QDVA 5HIBA 3ZYAA 3HECA 4QOXA 5C1QB 2ITVA 2V0DA 4QP2A 5GJDA 3VUMA 4FNZA 5GNKA 1RQQA 3R00A 4BIBA 4IZAA 4J71A 3LQ8A 4WIHA 3N51A 3OMVA 5GINE 3W2SA 3QLGA 3FZSA 4F9YA 2PU8A 3EN6A 4IWDA 1URCA 3ZRLA 3UVQA 4BY9E 4FL2A 5FLFA 4E6CA 3UGCA 4LGHA 2J6MA 4FNYA 4WUNA 3PP1A 2ITPA 1ZARA 3BL9A 2X2KA 4TKSA 4D5HA 2YLFA 4YSJA 3MH2A 1AD5A 4CCUA 1ZOHA 3F5XA 5FGKA 2GHLA 4GYIA 3UNKA 4O4FA 4MBJA 4J98A 5EM7A 3D83A 2NRYA 3DNEA 4FNXA 4IZ7A 5HU3A 4RIWA 1OL2A 3SHEA 3JVSA 4YNEA 4BI2A 2BIKB 1PMVA 1Q5KA 2HK5A 2WMRA 3EQCA 2IG7A 2XK4A 4EHVA 1OGUA 5JKGA 5DG5A 2VO3A 2Y8OA 4FTMA 4UMPA 3CPCA 3NUYA 2FA2A 2CKPA 3TNPC 3DFAA 4EONA 3EL7A 2BKZA 2G15A 4DFBA 4RT7A 3VBXA 4C38A 3NUUA 3ORZA 4MD8E 4MX9A 4AOJA 5J1VA 4RGJA 2VTJA 3KREA 2EUFB 4OLIA 3TACA 4HZSA 4TY1A 3OW4A 4JBPA 3L9MA 3GBZA 3RNIA 4UALA 4FEUA 5EK7A 1H1SA 1UU3A 3LFBA 3UVPA 4RVMA 3WZUA 4WRGA 4DC2A 5HICA 5IEVA 3GCSA 2ZV8A 3W0OA 4F1OA 4CG9A 2QKWB 3SX9A 5A4QA 2CSNA 3C4EA 1TVOA 2PL0A 3E87A 3VBVA 4RWKA 3VUIA 2X2MA 4ZTHA 1J7LA 3AD4A 3U55A 5HTCA 1J7IA 2PVJA 3Q5IA 2X8EA 4D55A 3CC6A 2YN8A 1OL5A 3MBLA 4FKTA 3KN6A 4AUAA 3F5UA 5A46A 3P7CA 1BI8A 2F7ZE 2VWIA 2ZYBA 4IX5A 4CFNA 3D15A 4DH8A 3SXFA 4USEA 1GAGA 5C4KA 4D58A 4ZSGA 1CKJA 3DBCA 4I6LA 3K3JA 3HYHA 4FVRA 3M2WA 1G5SA 4ZJJA 3KY2A 4M67A 2JDRA 4AT3A 4E4NA 2P2HA 5KHWA 5M4FA 2QG5A 5IA1A 4C59A 4WRSA 3SKCA 3C5UA 4Y83A 5H8EA 5HO8A 4DCEA 4D28A 3IKAA 4RA4A 4XG9A 3QXPA 5K0XA 2FSLX 2BFXA 3QTIA 4DF3A 1GJOA 1YWRA 4P2KA 4XOZA 3HUCA 4WUAA 5EYDA 3EN7A 5BYLA 4JR7A 3HA8A 3WZDA 2J51A 4EYJA 3JVRA 2W4JA 4GUBA 3TYKA 5CEPA 2O63A 4ANNA 2VUWA 3R1SA 3C4XA 1FBNA 4KAOA 4L44A 4FICA 4RIOA 2HY81 4I24A 3VW6A 2WTIA 5AM7A 5CF5A 2PULA 3Q4CA 1DI9A 4FKSA 3AKKA 5M53A 4F9WA 5EYCA 4IB3A 1ZXEA 4HCUA 1GZNA 3UP2A 4WNPA 4JLCA 2C6KA 3R8UA 3CE3A 4LV8A 4L68A 4YJUA 4E20A 2IZSA 3NAYA 4PQNA 1PHKA 5DRDA 4MQ1A 4EI4A 2YCRA 1DI8A 3HDMA 5JN2A 2O8YA 3O8UA 1RW8A 5L2IA 1J1BA 2YDJA 5HLNA 3D9VA 3I0OA 5HLPA 4FF8A 4JDKA 3WIKA 4C3RA 4EHGA 2FSOX 3WF9A 3V01A 3VUTA 4V04A 3DJ6A 4M12A 4JVGA 5IMXA 3FLNC 4B4LA 4K11A 4O22A 4FKUA 2NO3A 3VRYA 5LVNA 3ORTA 3ENMA 4OUCA 4DH1A 4O0UA 2WMUA 4R6VA 5DH3A 1R0EA 3OCSA 4IX6A 4X0MA 3T3VA 3KQ7A 4UY9A 3WI6A 5EOLA 4NW6A 3A7IA 3QALE 3ID6C 2C3KA 3TKHA 3EH9A 4TYIA 1JSTA 5T3QA 2YHVA 1Y8GA 3V04A 3VS6A 1Q8TA 3LJ0A 3SRVB 3R2YA 4EHZA 4I3ZA 3A99A 3R22A 5KHXA 4GH2A 4YTHA 3S3IA 4TWCA 3DTWA 4EH7A 5GZAA 3A8XA 2XEZA 3A60A 3R7VA 4FEVA 4L53A 3RM6A 1K9AA 4TXCA 1MP8A 4D2VA 5EM8A 4C4JA 3PUFC 3MIAA 4S2ZA 2OXDA 3RZBA 4ZSAA 3OT8A 5D11A 2VGPA 3VF8A 4KSPA 2G9XA 3NYXA 4JOAA 4U8ZA 2PVKA 4QT1A 5HGIA 4AZTA 4LL0A 2GTMA 4U41A 4P90A 3I5NA 2EXEA 4BTKA 4JNWA 3HAMA 4DG0E 2PZPA 2OIQA 2C6LA 2B54A 3COIA 4YO6A 2ONLA 4WA9A 2XKDA 2ZJWA 3C4CA 5AX3A 1H08A 3SXSA 3DKFA 3LM0A 2UZVA 2X4ZA 4C3PA 2FVDA 4QTBA 4FG9A 5FXRA 3ITZA 3W32A 1E1XA 4AW2A 3GCQA 2VWUA 2Q0NA 2RF9A 3PE1A 5DHJA 5AV1A 3OBGA 3W0PA 1JQHA 3R63A 4AA4A 4D1SA 2V22A 4O6EA 1BX6A 5E4HA 3ODZX 5CLPA 4M0YA 4DH7A 4D9TA 2C0TA 2Z7SA 5LXMA 3FL5A 5CY3A 3AT3A 5TR6A 5LOHA 4UN0C 3FMNA 4J99A 3JY0A 4WG3A 3BRBA 5AP1A 5LWNA 3W18A 5CAUA 3W8QA 2W5HA 5HEZA 4D9UA 4FYNA 4QMPA 4O83A 4DG2E 3MW1A 1BLXA 5E8TA 3KXMA 2XBAA 3RVGA 4BI1A 3UVRA 2GDOA 3BEAA 4IHPA 4DFLA 4HVHA 2XYNA 4X3FC 4MHAA 2PWLA 2YM7A 4DFXE 1JNKA 5L2SA 3VULA 3ZHPC 5CASA 3GU6A 2HW6A 4P7EA 5DFPA 4I5HA 3SOCA 4ERWA 4TWNA 4GYGA 4AAAA 2O65A 4HYIA 4NM3A 2HZ4A 3Q04A 5AUWA 4H36A 3IS5A 5CT7A 5KZIA 4CZUA 3QGYA 4QMSA 2GTNA 2YIQA 4RSSA 5DLSA 3F61A 3GU7A 4CG8A 3HRCA 4IAAA 4C02A 3TZ9A 2ITNA 4XHKB 3VJNA 4HNIA 2R3HA 3V5PA 3F6XA 4JL9A 5IUGA 3NSZA 3I6WA 3NWWA 4NT4A 4E7WA 4WO5A 3NUAA 2OBJA 3G6GA 3EFJA 3PVUA 4J8MA 3MDYA 2C5NA 2A4LA 2GNIA 2BROA 2VTMA 3QWJA 1BI7A 5FXSA 4GKIA 3MPTA 4FTNA 4LGDA 1NA7A 4IH8A 3C13A 5HX6A 3PZEA 4UXLA 3FI3A 3R30A 4LMUA 2IZUA 4CKJA 3GQLA 4CQEA 3FLYA 4BHZA 2ERZE 3TJDA 4EKLA 4ZZMA 3UE4A 1GIHA 3HDNA 4IE9A 3UOJA 1H1RA 3BX5A 5G6VA 4F4PA 5B2MA 5C4LA 2J90A 4MXYA 4APPA 3FC1X 5ETAA 2QOKA 1XBCA 4GK4A 3P7BA 4G6NA 2AYPA 4FBXA 1KV2A 4DITA 2YISA 3L8XA 4EYMA 4C2VA 3NZ0A 2RG5A 3Q9WA 5EDQA 2JLDA 2XF0A 3H9OA 4QP8A 3MH1A 1GNGA 4NK9A 1XMLA 3MY1A 3CBLA 5FG8A 2RFDA 4YSMA 2OG8A 3BYUA 3ZM4A 4BZDA 4Q2AA 4EOMA 4AG8A 3H10A 4FL3A 3PPZA 4W9XA 2HENA 2IPXA 5EI8A 5I3OA 3VS3A 1OL1A 1Q62A 1QMZA 2CGXA 4U44A 4YJTA 3R9DA 3AKJA 3DDQA 4LDTA 5D7AA 3NNWA 3P5KA 3Q4ZA 5HZNA 5FTQA 2GHGA 2C6EA 4M14A 1YXTA 1XH9A 5FP6A 3A7HA 3VRZA 3GFWA 3HRFA 4UMUA 4GS6A 1M52A 1PXIA 3K3IA 4RC2A 4FTCA 3W16A 4YPDA 3BI6A 1NVSA 2QOBA 5M57A 3TZ7A 5KMOA 1F3MC 5AP5A 5HCYA 4FK3A 3DJ7A 5FDPA 3KCKA 4YJRA 4TYGA 4ASEA 3C5IA 1FPUA 3MA3A 2W17A 3U8WA 3H0YA 2RL5A 3W55A 4ZSEA 3DQXA 4C58A 4ALWA 5A14A 3K5VA 1Q61A 2Z2WA 4U3YA 5CEQA 3NYNA 3C51A 3B2WA 1ZOGA 4YZ9A 2UZLA 1ZZLA 4MYGA 4D2RA 5K9IA 4JQ7A 2LAVA 4KNBA 2B0QA 3ZU7A 3ETAA 1H24A 3KB7A 5AUVA 2ESMA 3NVKI 3RI1A 4Y8DA 1H1QA 2UW0A 2CPKE 1M2RA 5HG8A 1NT2A 2QURA 3M42A 2B7AA 3DBDA 1QCFA 2UVZA 3DKCA 3LHJA 1PKGA 2OW3A 4RX9A 5DI1A 4E6QA 4G3EA 4KKEA 5BMMA 3W10A 3UZTA 3AXWA 4GMYA 4R1VA 4XLVA 2Y4IB 1P2AA 4KIPA 4DH5A 5LMKC 5AR2A 3QD3A 4EORA 3P86A 5AV4A 2W05A 2C3IB 4W4YA 1QPCA 1TKIA 5E92A 4ID7A 3QQHA 5EHYA 4KS8A 2CGUA 2E2BA 4KBCA 4YUQA 3KVWA 3FE3A 4NIFA 2QQ7A 4JR3A 5CANA 2YERA 3TUCA 1CM8A 5L6OA 3CKWA 3AC5A 2YM5A 5HBJA 2R2PA 4I6QA 4WSYA 3DB6A 3COHA 2WTKC 3G9NA 3BGPA 3LE6A 2XBJA 4BCPA 1OBDA 5M07A 3BEGA 3DU8A 4OBQA 3NW5A 4QDEA 4YC8A 3AG9A 2W9ZB 4E6AA 1BKXA 3QA0A 1B39A 3OROA 3BV2A 4G9RA 4PMMA 2CDZA 3Q6UA 3QUEA 3FMHA 4XV2A 2YZLA 1A06A 3OWJA 2BFYA 2JIIA 3OP5A 3QYWA 4A07A 4HW7A 4O7SA 4YJOA 4GCJA 2FH9A 3NCZA 4FV4A 3NR9A 5JGBA 4IX4A 3U9CA 2O64A 2YA9A 3PXQA 2EWAA 4NW5A 5A6OA 4PPCA 3IO7A 4YZMA 4BI0A 3EKNA 3UQGA 4TYHB 3MV5A 4K2RA 4YLLA 4BCFA 4LFIA 4ENXA 2F9GA 4J8NA 3NW7A 2Q0BA 3SRVA 4MXCA 3RBWA 3FYJX 4A4OA 4D4RA 4QMNA 3LJ1A 4B6LA 1GZKA 2C68A 2F7EE 4IC7A 2JIUA 2OSCA 3VS0A 4BDJA 1W83A 1SM2A 2OH0E 3NGAA 5HIEA 3VVHA 4I0SA 4QPAA 2WMWA 5JFXA 3RPOA 1Q8YA 2XJ2A 3EQGA 4KWPA 3BQCA 3UOKA 4X2JA 2GNJA 3VN9A 5J1WA 4CXAA 5J7HA 3OD6X 3CSVA 3F3VA 4GT5A 3KK8A 4A7CA 4DEHA 2YJSA 3JS2A 1REJA 3AC4A 4ZZOA 3R9OA 3R04A 4P5QA 3ENHA 2BR1A 3PXYA 5IMEA 2GU8A 3LW0A 4EOIA 5C8NA 3G33A 2R3QA 3NIEA 3ZLYA 2FSMX 4XG7A 4BCGA 3DTCA 4PMSA 4O4EA 4PDOA 2XCKA 4EHEA 3IW7A 1PW2A 3F2RA 1V0PA 3BPRA 4ACMA 1P5EA 2PHKA 3FSKA 3KXZA 3W2OA 1ZYCA 3SVVA 4RFZA 3E5AA 1J3HA 3GCPA 3IOKA 1QPEA 4GFGA 4TYJA 5IQDA 4GW8A 2HAKA 3DCVA 4M68A 5LVPA 4MBIA 4O0TA 3GOPA 4YGAA 4LV7A 3F2AA 5DWRA 3PJ1A 4FR4A 4K77A 2X2LA 3E63A 4Y5QA 2UW3A 1G3NA 2PVRA 5ANKA 5IQFA 3PZHA 4FKIA 4NCTA 2PUNA 3QXOA 1BL7A 2WHBA 4MF1A 3PFYA 1JVPP 4CZYB 4KS7A 2YDKA 3OVVA 3PG3A 3R8LA 1L3RE 3HGKA 5AP7A 3O23A 5AA9A 4FEXA 4GKHA 4BR3A 1OVEA 4H1MA 4IEBA 3P08A 5CVFA 4EOLA 5TE0A 3Q53A 3UDBA 2YM4A 4E8AA 4G34A 1YXXA 5BVNA 1UWHA 4CVAA 4B7TA 4O0SA 5AUYA 2WTWA 2YM3A 3VNTA 3MY0A 4TYEA 5DGZA 2JITA 4BBFA 3C4FA