3F5PA

Complex structure of insulin-like growth factor receptor and 3-cyanoquinoline inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
307
structure length
299
Chain Sequence
SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIETDRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Insulin-like growth factor 1 receptor
publication title Lead identification to generate 3-cyanoquinoline inhibitors of insulin-like growth factor receptor (IGF-1R) for potential use in cancer treatment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 299
sequence length 307
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, R, S, T
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3f5pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3f5pA01
3Q60A 1IAJA 3SG8A 2XKEA 3UE4A 4OTWA 3WARA 4BDAA 5E8TA 1YW2A 4IE9A 3FI4A 3EQFA 5ETFA 3IW7A 4JAJA 4NEUA 3L8SA 5CVGA 4A7CA 4FG8A 4P5QA 3NX8A 4IC8A 3OG7A 2VD5A 4ZXTA 5ANDA 1Q4LA 4MXYA 3KA0A 4NH1A 4RVMA 2GS6A 1GZKA 2J51A 3BGPA 4JOAA 4WOVA 4DH5A 3BLHA 4EYMA 5HZNA 5HI2A 4DH8A 2X2LA 4OW8A 4L9IA 3REPA 2JAMA 4F7LA 3KN6A 2CKOA 5EQPA 2C69A 1JKTA 3QZFA 4EK3A 2OWBA 3IO7A 1QPJA 5BPYA 1OBGA 2QCSA 1GIIA 4HNFA 4NJDA 3KVXA 3D7TA 3QRUA 2CHLA 4NYEA 2YZAA 4LOPA 1FQ1B 4YZ9A 1ZLTA 4TYEA 5GJDA 4B7TA 4QTDA 5AP3A 4CMTA 3DAJA 4G31A 4EOSA 1G8AA 1YWNA 4BGHA 3HX4A 4EK6A 4YZBA 1BMKA 1FPUA 3DNDA 5DFPA 3FMEA 1L8TA 3KRXA 5CXHA 4XNEA 1J3HA 2UW4A 3A4PA 3A60A 3ZFYA 4ACCA 4ASXA 5AA8A 3MGYA 1YRPA 4MTAA 5M06A 3ZO4A 4USEA 1OPKA 2C1AA 2QOOA 3AD6A 3B2TA 3QTUA 4S33A 2W1HA 3LQ5A 4FG7A 2CSNA 3KF4A 4UV0A 3AT3A 3RK5A 3W2PA 4CTBA 3ZO3A 1ZMWA 4C35A 3I7CA 4FTTA 5KZ0A 3DDQA 3PVWA 1Q97A 4ALUA 5LQFA 3P1AA 4FV0A 3W2SA 4JQ8A 2XA4A 2JEDA 1SVEA 5IEYA 5LOHA 5M53A 2CDZA 4O7NA 4G3GA 4ZAUA 2JKQA 2PVHA 1JSTA 3FAAA 1HCLA 3R1SA 3FLYA 4FV9A 3QWKA 4IM3A 4H39A 4L43A 3CPCA 4QMNA 1ZWSA 3CQWA 4NFNA 5T6KA 3HECA 3HGKA 3ZZWA 4FV1A 4F9WA 4JAIA 1NVRA 3PLAE 3GCSA 2ZV2A 4CFXA 2ETRA 3DS6A 4YC6A 5L2QA 4GK3A 4BZDA 1W0XC 2PPQA 2JLDA 4AN3A 4GU9A 1GNGA 3OHTA 3W2OA 5IA5A 5DG5A 3IG7A 3ORLA 4DG2E 3CJFA 2OZAB 3FE3A 4AOTA 3DV3A 2V7AA 3UP2A 4FSQA 3KXNA 2XUUA 1WBTA 5HESA 3CKXA 2XMYA 3SGCA 2UZNA 4XX9A 4DG3E 4IXPA 5EK7A 2LGCA 3GI3A 4K8AA 4WT6A 4H58A 3C0HA 4ACDA 3FYKX 3FMJA 4CYJA 3T3VA 4ANOA 4FA2A 4N4SA 4HZSA 3LFAA 4AT4A 3W1FA 3FMDA 4F6WA 2W9FB 3W32A 2WXVA 1RJBA 2VX0A 2R3JA 4KS8A 3E93A 4FKWA 2EUFB 3NNWA 4BI0A 4EJNA 4BKZA 5LVPA 1TVOA 3WF7A 2B9IA 4EKLA 3O50A 3QTRA 4G9RA 3D0EA 3QZIA 4D1ZA 5AUUA 2C5OA 2VWYA 2JFLA 1SMHA 3ANRA 3EFLA 4XP3A 1KE7A 3FXZA 5KBQA 3FDNA 4FSRA 1XQZA 1ZRZA 3B8RA 3DBQA 4X3FC 5BVOA 3EMGA 3P4KA 2C5NA 2XNGA 4MAOA 4FNWA 4BCHA 4FL2A 5KMKA 4E6CA 4BTKA 4XLIA 1F3MC 3S4QA 1WAKA 2E9OA 3I5ZA 3KXXA 4J96A 1B38A 4WNKA 1W82A 1WFCA 4XMOA 3UO4A 2J5FA 5LMKA 4RGJA 5AR7A 3UIUA 3ULIA 4NL0A 1G5SA 5E9EA 3MYGA 5DR9A 3DKCA 5AP7A 4AOIA 3Q2MA 4Q5HA 5DLSA 4D55A 5LXMA 5JKGA 3GC8A 5KO1A 2GMXA 4IX3A 1YXXA 2HOGA 4QTAA 5JN2A 2VGOA 4O27B 4EOKA 4PDOA 2CGXA 4BCPA 2QC6A 5TE0A 4ALWA 4WSQA 2V62A 4DFXE 5HX6A 3CTJA 3MJ2A 2I0EA 3O23A 3FUPA 2VTIA 3KEXA 4O7TA 4GEOA 4PTCA 1Q8ZA 4AW2A 4DBNA 4FGRA 5CAUA 4FNXA 2Q83A 4BIDA 5KUPA 2XEZA 3DZQA 3QKMA 5CS6A 4D5KA 2O63A 4O7RA 4CSVA 4BHNA 2YAKA 1KE6A 2V7OA 4JDIA 1W98A 2YCRA 4UZDA 1JKKA 4FTJA 5L8LA 1MQBA 2EXCX 3Q5IA 3NIZA 4GG7A 2IVTA 4PMTA 3R9NA 2QU5A 3RKBA 3PVBA 5EM7A 5IPJA 2C6EA 5JZNA 5ETAA 5LARA 4MXAA 1F0QA 5HTBA 4IVDA 5HBEA 4MBJA 3UO5A 3ZCLA 4QNYA 3AMBA 4BF2A 5KHWA 4NKSA 5K4IA 2HW7A 3KN5A 3MDYA 4ZY4A 4YO4A 3KVWA 3ZDIA 4ERWA 3TXOA 3QTXA 2X9FA 4P7EA 4FV4A 2G2FA 2RG5A 4FV2A 4AFEA 3COIA 2O5KA 5AR5A 5DOSA 3MH0A 2B7AA 4PDSA 3WF6A 2UZBA 4FT0A 2W1CA 3P23A 2WELA 1M2RA 3ACKA 3BELA 2NP8A 2VTAA 4FKQA 4U9AA 4ZJJA 4EH7A 5CANA 5IQCA 1YOMA 1K2PA 3QXOA 4KIKA 3UIXA 4HNIA 3UBDA 4DFYA 2X7FA 3UGCA 4WUNA 5HG5A 1KWPA 4LG4A 4ID7A 3OOMA 5M55A 5LVOA 3MPTA 3DK3A 5A4TA 5IDPA 2HWOA 3FSKA 3A61A 5J5SA 5AFVA 5LWNA 4AA0A 4YTIA 3QUDA 3ZRKA 1BUHA 2ETMA 2ETKA 1U5RA 2W5BA 4F70A 3RK7A 3KC3A 3MVMA 4HYSA 5C8NA 1A06A 3KY2A 2RFDA 2YDKA 4NFMA 5BX0A 2JDSA 3FZOA 1EH4A 4IX5A 5HHWA 4DG0E 2BTSA 3ORZA 3A7JA 4EHEA 4GKHA 1M14A 1WBOA 2IWIA 2YIRA 5L3AA 2W5HA 5C9CA 3E7OA 4HCTA 4V0GA 4D2WA 2XF0A 2W1DA 4CG8A 4YSJA 2ACXA 5LMAA 2CGUA 4HGEA 4GKIA 3WZDA 3LZBA 4LRJA 5H8BA 5JRSA 4EUUA 5F1ZA 5FQDC 2YCFA 1UVRA 2O3PA 3MPMA 5IQDA 5CF5A 3ZDUA 2IVVA 1GIHA 3F61A 2YIWA 3DZOA 3PWYA 3RM6A 3SA0A 2YM5A 1ZY5A 3W8LA 3AGMA 4TXCA 3PA3A 3ZLXA 3OXZA 4ARKA 3CE3A 4S32A 2YITA 1UNHA 2GS2A 4DGOA 2CNUA 2Q0NA 4JRVA 4UALA 5IA3A 4XJ0A 4BDFA 1R39A 2RKUA 3F3ZA 4BY9E 4O1PA 3QQHA 2ITXA 2X8DA 3BBTB 1Q8TA 5C03A 3AT4A 4NIFB 2YM4A 4YJUA 3WIGA 4EOQA 4U8ZA 1R0PA 2B9HA 3KXGA 3RNYA 5GINE 3QGYA 2PMLX 2XVDA 3EN7A 4OBPA 5D41A 4GL9A 2C68A 3NNUA 4EBWA 5AV2A 4R78A 4XOYA 2H9VA 2IZRA 3ZTXA 3GGFA 5FWKK 4O6LA 3ETAA 4FUXA 3BCEA 4FT5A 5CEIA 5JGAA 1SNUA 3HKOA 1KOBA 4RIXB 4OTGA 1H26A 4CXAA 4O0XA 5CSXA 4CKRA 4FSTA 4IAZA 2JKMA 2I40A 5DIAA 2CCIA 5HOAA 5BNJA 4GJ2A 1H00A 4BGQA 1JQHA 2UZVA 5B2MA 3F66A 4LRMA 3OCGA 5HE3A 5IMXA 3TDWA 3KXHA 4FOBA 3SDJA 3R0TA 2CKQA 2P3GX 4V04A 5AAGA 4CLJA 3I79A 5EYDA 3TJDA 3I5NA 4R3PA 5E8UA 4LMUA 4AGWA 2BUJA 3HEGA 4JDHA 5AV0A 2EU9A 3SLSA 4G5JA 3VS0A 4I20A 4J99A 3DJ6A 3FLSA 3EQHA 4Z3VA 1ZMVA 3KMMA 4BWXA 4HGLA 4GU6A 2NO3A 4L42A 4BVUA 4L6QA 4PNKA 4F7JA 3ULZA 3QQUA 5CEQA 5HTCA 5L6OA 1U59A 4GIIA 4XG2A 3D5UA 5B0XA 5A54A 2W5AA 4XCUA 4RWIA 4FV3A 3LIJA 4XRJA 4E5BA 3OBGA 3DBDA 4LOQA 4E4NA 2OJGA 3LFQA 4YNOA 4DEGA 4TYJA 4EZ5A 1BYGA 1YDRE 4N6ZA 3QCQA 4EK5A 4EH4A 3ZXZA 4BCIA 4XOZA 4FZFB 2OO8X 2VO0A 4I22A 3E8CA 2VWWA 2CPKE 4R1YA 2YZLA 2I0YA 2XCKA 1QPDA 4RVLA 5BVWA 5L2IA 4XG3A 3WYXA 4YTCA 5CY3A 4DEDA 5HIEA 1SM2A 3U9CA 4Y5QA 4ASEA 5IUIA 2W4KA 3ROYA 1GAGA 1LEWA 5HG9A 3RNIA 1PXPA 3ZUVA 2BRNA 2UZLA 2Z60A 3SRVA 1DAYA 5DBXA 3QKLA 4B99A 4AS0A 2P55A 5IH4A 5A4LA 3ZMMA 2R3QA 4RIWA 3TIZA 4AF3A 1ZZ2A 2R3MA 2FYSA 2VV9A 3Q4TA 1Q99A 2QD9A 3EN5A 3V8WA 4LV8A 1M52A 4M66A 2QQ7A 5H8GA 4TW9A 4BCJA 3PRIA 3UC4A 2BALA 1BI8A 4E93A 1IRKA 3O8PA 5EDPA 2PE2A 4TWOA 2C5XA 3BE9A 5I3RA 2CKPA 4IZAA 4R7HA 3FMKA 3Q53A 4FODA 4BCMA 4Z55A 3QU0A 3FMHA 4KIPA 2AC5A 2OKRA 3S0OA 5LVNA 4TPTA 3MSSA 5KX8A 2X4ZA 2OI4X 5K3YA 4FKSA 4O91A 4YPDA 5H9BA 2ZVAA 3R01A 4CNHA 5JQ8A 3JR1A 3FPMA 2C6MA 1Q8YA 2FSMX 3RPOA 4G6NA 4O0WA 5DR2A 1FVTA 2J0JA 4U3YA 4HJOA 2ZDUA 4J7BA 4L46A 2ITYA 3NIEA 2FA2A 4M69A 5JGDA 5JZJA 2GPHA 1Y8GA 1J7IA 3TEIA 5BYLA 3GCVA 5HO7A 3LXPA 4DH1A 5LMKC 1U54A 2X9EA 3I6WA 4BIEA 3LFEA 2W9ZB 5IUHA 2X39A 1WVXA 3QCYA 3AC8A 4MBLA 4RJ5A 3FC1X 2EXEA 3SV0A 4GT5A 3ODYX 3PJ3A 5DHJA 4RX5A 2JC6A 4O0VA 4CRLA 2UW8A 2B55A 5CEMA 4O6EA 4IC7A 4U97A 5BVNA 3ZXTA 1F5QA 1M2PA 3PVGA 5E8WA 3FL4A 5GNKA 3EQCA 2VO7A 2QKWB 4AAAA 4HCUA 4BGGA 4DEAA 2W06A 4WIHA 3TUDA 3R7IA 3O7LB 3AC3A 3AT2A 3OXIA 3V5QA 2JBPA 4W9XA 5ETIA 3FKOA 3GU4A 4EH6A 1JLUE 3MY5A 4LGHA 4I21A 4ZIMA 3ZYAA 1ND4A 2GSFA 1FVVA 4RWKA 4O0SA 3LXNA 4E6AA 3R28A 5D11A 3P9JA 4NW6A 2IN6A 4ITIA 3QKKA 4YJRA 5AX9A 4OTHA 4RZVA 4D2RA 4MQ2A 2JKKA 4PL5A 3M1SA 3P7BA 4U80A 4ORKA 3KGAA 4UMRA 4QMOA 3ELJA 3MFUA 5E8ZA 2UW3A 2PE1A 4NTTA 2FVDA 4FKPA 2QHNA 1S9JA 4DA5A 2R7BA 3LFBA 1CM8A 2DYLA 5A9UA 3OT8A 3QLFA 4C4EA 4LV5A 5ACBC 3U4WA 4U6RA 3VC4A 4PUZA 2WMSA 5F95A 4O82A 3NAXA 3QQLA 4U42A 3JXWA 3DQWA 3I4BA 3VUHA 3O2MA 2YIYA 4RIYB 3V01A 4X6RA 5CX9A 3TL8A 4EWHA 2UW0A 4CT1A 4MXOA 4YJOA 5EKOA 3ALOA 2I6LA 2VU3A 3V5JA 1O6KA 3VBTA 2HY0A 3VWAA 5BUIA 4J1RA 3R6XA 3MB6A 5CQUA 4FX3A 4RJ4A 2XJ1A 4N70A 4U7ZA 3HMMA 4L52A 4UWBA 5EOBA 5GJFA 5BMMA 3I60A 4DEEA 3U6JA 4MWHA 1FINA 5JH6A 4DGGA 2BDFA 4FBXA 4HZRA 5E1EA 4GT4A 4NU1A 3TV4A 1JNKA 4F7NA 1XH8A 2JGZA 2JIVA 2X6DA 3SQQA 4EQCA 5M51A 1WZYA 3EQBA 5BYYA 3F5GA 3HMOA 1ZAOA 4GFGA 3HP2A 3RVGA 1ZOEA 2OICA 3MPAA 5A3XA 2CNVA 4H05A 5I9XA 4UBAA 2V22A 3I7BA 3IDPA 4FSWA 2VWVA 5KMIA 1NT2A 5CVHA 2AYPA 3NS9A 2B9JA 2R64A 4LGDA 3ODZX 3DY7A 4JXFA 5AIRA 1G8SA 3DKFA 1IG1A 4C57A 1QPCA 4GMYA 4BDJA 2VTTA 2ZYBA 4FEUA 5L2WA 2B52A 5C8KA 3DA6A 2R3GA 3MTLA 3THBA 4BBEA 3L9NA 4H3PA 2ZV8A 2VNYA 3OT3A 4BWKA 5HICA 4DCEA 4QMZA 3QC4A 4R5SA 2ITUA 3TWJA 2VTSA 2WOUA 3FZ1A 5HCZA 4AT3A 4C4IA 3F3TA 2YIQA 5HGIA 4FE2A 3P78A 1URWA 5F94A 3G15A 4FL3A 2HY81 3UQCA 1AGWA 2YM3A 3COHA 2XNOA 2UZDA 3LOKA 2NRUA 2WQEA 4Y85A 5A6OA 4IM2A 3EQDA 3OF0A 4DTKA 4YLLA 3VIDA 4DEHA 1J1CA 4FT9A 2BZJA 3ZS5A 4O7VA 2JFMA 4FVPA 3E88A 3O17A 3KK9A 4DEBA 4ANQA 4D1SA 3PP0A 2O8YA 5FXRA 3TTJA 3UZRA 5JGBA 1CTPE 2IW6A 4OR5A 2R3KA 1UU3A 5AEPA 4E5AX 4CZUA 3ANQA 3EYHA 5M08A 4GYGA 4IAKA 3LM5A 3BYOA 5C27A 2XEYA 3NUAA 4JNWA 3HAMA 3R7OA 4Y73A 4D2PA 5BMSA 5AX3A 3SHEA 2GQGA 2XYNA 1LEZA 5I9YA 4EK4A 1M7NA 3T3UA 4QMYA 4A9YA 1XHAA 4AW1A 3ZU7A 4O7LA 3H30A 3VUIA 3KMWA 3L9PA 3HV5A 3L8VA 3V6RA 3NCGA 3EZRA 5I3OA 5CAOA 4EH9A 3PA4A 4EH5A 3VF8A 3COKA 2WU7A 2YHVA 4Y95A 4XG7A 1KE5A 3AD4A 3FY2A 1LR4A 1UKHA 3PA5A 2FUMA 4C8BA 4C02A 4EBVA 3LJ0A 4YSMA 1OL2A 3ORKA 4BBFA 3R83A 3NYVA 4GSBA 2WPAA 3Q6WA 3TIYA 4RVTA 2HZ4A 5AAEA 3UG1A 3PYYA 2ZV9A 3O71A 1IAHA 5E1SA 1PKGA 3AGLA 4U3ZA 4D58A 5F9EA 1GZ8A 2ITQA 3OP5A 2BRMA 5CWZA 5EH0A 2I0VA 2ZOQA 1SYKA 4ZSEA 1H1SA 3PZEA 2CN8A 5AV3A 5TT7A 4UMUA 5FTGA 2GNJA 3KREA 5I9VA 4IFGA 2F7XE 4XH6A 5HEZA 4CQGA 4O84A 3U4UA 3HMNA 3OWLA 3BBWA 4M15A 2X7OA 5J8IA 4XBRA 4X2FA 3WI6A 4UN0C 3KKVA 5DT0A 5EHOA 3DLSA 3CY3A 3PIYA 4RLKA 1ZARA 4RX9A 4QPSA 1P4OA 2C6DA 3R22A 3ZSGA 3NRMA 2UVXA 3PP1A 4KWPA 5J1VA 5AP5A 2WMBA 5EI8A 3QTWA 5K0KA 3Q4ZA 4DH3A 4F7SA 2XKFA 2GNGA 4PMSA 3RZBA 3I6UA 5CF4A 2BR1A 3K3IA 4FKUA 4ITHA 4Q2AA 4YU2A 2QR8A 3HRBA 4MXZA 5IDNA 4UMPA 1UNLA 4C37A 1H01A 2WMTA 1OKWA 2ERKA 4OGRA 4PRJA 4UYNA 3F3WA 1PKDA 2R3LA 3DKOA 2Z7LA 3GFEA 3OVVA 1PMEA 1RW8A 4EONA 3IOPA 1STCE 2UZTA 3LFDA 4HPTE 4FIHA 2Q0BA 4BDCA 3GFWA 4JIKA 2J0KA 5K9IA 4ZMFA 2O2UA 1YXSA 5FRIA 2QO7A 3BHVA 4R77A 5E92A 3S95A 5DPVA 2C0OA 5DYJA 3HV4A 4L00A 2Y9QA 4HPUE 3CSVA 2P33A 2FSLX 5AR3A 3DNEA 4NTSA 3RPSA 1MRUA 4BCNA 2IVSA 4YTFA 3H0ZA 3MW1A 4AW5A 2AUHA 2J4ZA 2JIUA 3KL8A 3QFVA 4JBPA 4RVKA 3RAIA 2X8EA 3FXWA 4LL5A 4USFA 4X2KA 3I81A 3F82A 5IZFA 3FWQA 1WBNA 3IW8A 5HVJA 5J95A 3R8PA 1YOLA 4FYOA 5DN3A 5T68A 4XLVA 3U87A 3DT1A 4ZY6A 4APCA 4NJ3A 2DS1A 2XM9A 3R71A 2GTMA 3QQFA 3P7AA 3TNQB 4DBXA 2YLEA 5IF1A 1ZYSA 5TF9A 1UNGA 2XIXA 5EW3A 3P0MA 4JBQA 3BHHA 4AE9A 4KIOA 3TZ8A 3D7ZA 4QP8A 2GQRA 2PUIA 3H9RA 1XH5A 3TM0A 2IG7A 4M12A 4K1BA 3IS5A 3WBLA 2C6LA 4CCBA 3KRWA 3QHWA 2BHEA 2XIYA 3DDPA 4IQ6A 4FT7A 4XYFA 2PMOX 2YJRA 3OCSA 4L7SA 5FD2A 4E4XA 5M57A 1DM2A 3CD3A 3R7EA 2F57A 4GW8A 2OIDA 4E1ZA 1MRYA 4USDA 2FSOX 1T46A 2VUWA 3CC6A 4O7WA 3VHKA 3FLNC 4WO5A 4QP1A 3WF5A 3E5AA 5A4QA 4BTFA 2XKCA 4N0SA 1AD5A 3FHRA 4QMWA 4M84A 3DKGA 4J52A 4FT3A 5B7VA 3HMPA 1Q3WA 3PXKA 3OWJA 4FTIA 4PP7A 4FGBA 4ALVA 2IZUA 2OW3A 4HYIA 1H1RA 4NM7A 4IM0A 5ANIA 4D9TA 2WB8A 3R8LA 4O22A 4TNBA 1PJKA 3LLTA 3NEWA 4UYAA 4AXAA 3HUBA 3PSBA 4R8QA 1E1XA 4RQVA 5M09A 1NXKA 4FTNA 1Q62A 2RGPA 4J53A 4J8NA 2J90A 1JOWB 1H4LA 2RFNA 3TNIA 2OH4A 3QLGA 3F2AA 3SXRA 4C4HA 4JL9A 3QD2B 5AV1A 4FSUA 4ZLOA 5BVFA 4E26A 4RG0A 3NSZA 5JFVA 4GUEA 5JEBA 4O0RA 3V51A 1XH9A 3WF8A 5CVFA 1UU8A 4D4VA 4QMTA 3FQSA 3HYHA 3ZO2A 3ZC5A 4BI1A 1XH7A 2Z7SA 1G3NA 4C3PA 3SX9A 4EOPA 5KKRC 5KNJA 5IQAA 3A7GA 2OGVA 4QP7A 3ZM4A 3OW4A 3AMAA 4FF8A 4FKGA 1LP4A 3MVJA 2C47A 2F49A 4IMYA 3PWDA 3R7GA 1W84A 5EI6A 1CMKE 1E9HA 3UIBA 4Y5HA 4UXQA 4V0GB 4UB7A 3JUHA 2OG8A 3PXQA 5DR6A 5L8KA 4DT9A 2IZTA 2F7EE 3W2CA 2WKMA 2UVYA 3RMFA 3ZEWA 2GQSA 1Q61A 1IASA 3G2FA 4C34A 3MJ1A 2WQMA 4G17A 2ITVA 4L01A 3OCBA 4PV0A 2HENA 3IPHA 3LAUA 4C7TA 4HVHA 1PMUA 3ORTA 2VTLA 3Q9XA 4QYGA 3LMGA 3R63A 4O1OA 5FM3A 5I4NA 5KMOA 4NKAA 3OWKA 3HDMA 3K5UA 4YBJA 4EJ7A 1H0VA 4TT7A 4L3LA 1K9AA 1X8BA 4C61A 3F3UA 4G9CA 3DAKA 3QCSA 2WGJA 5BVEA 3VUMA 4A9UA 2QURA 3UNJA 2BKZA 3ZO1A 3UNZA 3TUCA 3FL5A 3ET7A 4I1ZA 4ANNA 4TWCA 3GC7A 4RA4A 4DFUA 1R78A 4HOKA 3PE1A 4LUEA 4Q9ZA 2XNMA 4FIIA 3F3VA 3FI8A 2VTMA 4CT2A 3G9NA 2PVMA 5AV4A 2WTKB 4A4LA 4BCKA 4G34A 4ZSAA 4FTMA 4G5PA 2YAAA 2ZJWA 4FICA 3PPKA 3NUNA 3UC3A 3PJCA 2WTWA 3VRZA 1GIJA 4B8LA 2FGIA 3PPZA 1UU9A 2XIRA 3CTQA 5J5TA 3PY3A 1YWVA 3EN4A 2XK7A 4E73A 4ZTSA 1JPAA 3BHTA 1REKA 2GHGA 3DAEA 3OXTA 4PTGA 2WNTA 2RL5A 1TQIA 3RPVA 5FP5A 4HW7A 4L7FA 4YJQA 5DT3A 4W8DA 3R9OA 4FIJA 4WNOA 3UOJA 4CKIA 3VUDA 4FIEA 1XBCA 2OU7A 3C4XA 4QYEA 4Z9LA 3NYOA 4QP9A 4KIQA 3BHUA 5HU3A 2UUEA 5EM6A 2ERZE 3BIZA 2XS0A 5K4JA 1W8CA 1V0BA 2X81A 3BEAA 3HRFA 4NK9A 3U55A 2C3KA 3ZSHA 4K6ZA 5HKMA 4EH8A 2J50A 2P0CA 4FV7A 3R8UA 4DYMA 3DQXA 5HNBA 2QOBA 1YQJA 4YZMA 4J95A 3GOPA 3N51A 4IAIA 3E3BX 1ZYCA 3F7WA 4M0YA 2C3JA 4W8EA 4S31A 1OL5A 1H07A 3BGQA 3E92A 4ITJA 2YM7A 3VJNA 5BUEA 3F9NA 3MN3A 5EOLA 2JD5A 2PVNA 2XIKA 3S1HA 4KUJA 1RE8A 1H8FA 4JVGA 3NWWA 4C4FA 1CKIA 1DI8A 4K0YA 2QOHA 5A4EA 3GB2A 2CKEA 2VTQA 4BHZA 4PPCA 4QQJA 1W7HA 2E2BA 1Y6AA 4IB3A 2KULA 3NLBA 3QX4A 5HD4A 3H3CA 1V0OA 3QC9A 3QTSA 3O51A 3FMLA 5FBNC 3VQUA 2PYWA 1WBSA 3VUTA 5K5NA 5DT4A 2OZAA 4X2NA 2XCHA 2X2KA 3RCDA 3WOWA 3ZOSA 3AXWA 3R7VA 2CGWA 1E1VA 4FZDB 4QP3A 2OXYA 4YR8A 4DF3A 1H24A 3UQGA 3PJ2A 5M4UA 4FSYA 4TYHB 3F88A 3PSDA 4YPSA 3VS1A 3DFCB 3IW4A 4YHJA 2WIPA 5EYMA 1H1PA 4AOJA 4E5WA 5CSPA 2QOCA 3QBNA 5J9ZA 3BZ3A 3MV5A 3M11A 5AADA 4ANMA 1OM1A 4F1MA 2QOKA 3AC2A 3ZH8A 4ZZNA 3BE2A 1PW2A 2IW9A 3BV3A 2XK6A 3PY1A 4FKTA 3D14A 3NW5A 3A7HA 5LVLA 3OWPA 5CF6A 5AM7A 3SW7A 3K3JA 4FZ6A 3KULB 2W1IA 3GEQA 4A06A 1PMVA 3ZC6A 4ZSJA 5GJGA 2PVKA 2GFSA 3I0QA 4Q5EA 4H3QA 4BKJA 4QQTA 3K54A 3PPJA 4D4SA 2XIZA 2QVSE 2UW5A 3C0GA 2YACA 4OAVB 5HE1A 5BYZA 2XNPA 3FLZA 3NUSA 4XEYA 5L8JA 1V1KA 4KSPA 3F6XA 4XUFA 5HQ0A 1H08A 3IKAA 3B8QA 4PF4A 1NY3A 3P7CA 4WBOA 5HTIA 2G15A 3EFWA 2ITPA 5E8YA 3ATTA 3UIMA 4YURA 2Y4IC 2WMAA 2WEIA 2V55A 4TTHB 4A9SA 2E9PA 4BYIA 3UYSA 3LFSA 3LKMA 3SC1A 1HCKA 3QA8A 4CYIA 5F4NA 3ZLYA 4XP0A 4MNEB 3POZA 4MVFA 4B6LA 2Y7JA 3U6IA 2BFYA 2W1FA 2R3PA 4RQKA 5EW8A 2VTNA 1H28A 1Q5KA 3ZHPC 1OIUA 3WZKA 4I93A 1WBPA 1KOAA 3R2YA 1U4DA 4GYIA 3JPVA 5F20A 4IIRA 1ZMUA 2PY3A 4WNMA 1JAMA 3KQ7A 1ERKA 2J0MB 4KAOA 4FTUA 3GQLA 3W18A 2X8IA 1GY3A 2EXMA 4GK2A 4K11A 3TUBA 4A07A 2QODA 4JQEA 4ZEGA 2VRXA 4D0XA 4CLIA 2WMXA 3IDBA 4GVJA 4L44A 3VBVA 2OXDA 4K33A 5HO8A 2C4GA 3AC5A 4NZWB 1VR2A 4BRXA 4QTEA 2PUUA 3UVQA 5HX8A 2H8HA 4II5A 4B0GA 3SKCA 2BFXA 5IA2A 4ZMEA 3CPBA 2WTJA 4UX9A 4RFMA 2ZMDA 3DBFA 4LM5A 4YLKA 3BLRA 4O0TA 5FLFA 4M13A 2JKOA 4RMZA 5KMNA 5D12A 2WIHA 4EOLA 4IZ5A 3VS5A 4PNIA 4I0TA 4I6QA 3WE8A 5E8VA 4LUDA 4YZCA 4O7YA 1LUFA 2ONLC 5IEVA 2BZHB 2B54A 4IDVA 5CZIA 4R7BA 2G2HA 2BAKA 3T9IA 1OBDA 3BQCA 4CV9A 3ORIA 5H2UA 1YWRA 3PJ1A 4XG6A 3E7VA 2QI8A 4L67A 2QONA 3EKNA 2R9SA 5HBHA 1QPEA 1L3RE 4TWPA 3C13A 3VN9A 5IQGA 3CGFA 2G1TA 3EQIA 4AE6A 3IGOA 2OSCA 2PMNX 4XRLA 1YHSA 3WZEA 3OS3A 4OT6A 3OD6X 1ZXEA 4DFBA 5D1JA 4KRDA 1OI9A 1P14A 4FK6A 3NCZA 5FEQA 2VWXA 4KKHA 2ZM4A 3HUCA 3W2QA 4QOXA 4FTCA 2CN5A 3DPKA 1PXOA 2PZ5A 4RWJA 3B2WA 1XBBA 2P2HA 3PXFA 4FEXA 3R1YA 1M7QA 4MEDA 3FC2A 4YMJA 4X3FB 1IA8A 5DRDA 2WFYA 1P2AA 3TDVA 4ZS0A 4AFJA 2YISA 3PFQA 3C9WA 3R7UA 2OIQA 4P4CA 4APPA 5AWMA 5CI6A 4DAWA 4OUCA 4JT3A 4M3QA 1UWJA 3ALNA 1JKLA 2WMWA 3JVSA 3H9FA 4O96A 4QP4A 4G6OA 4RJ7A 2XKDA 3DBEA 3KU2A 4H36A 4PMMA 2C5YA 4WRGA 3VS7A 4MK0A 3UNKA 4O81A 5IKWA 1JBPE 1VYWA 3IOKA 3QTQA 4YZDA 3V5WA 3GUBA 4D9UA 1NVQA 1WBWA 1WVWA 5I9UA 5A4CA 4FKOA 4OTIA 4LMNA 5AIKA 3D15A 3EFJA 3CP9A 2HW6A 3TI1A 3TG1A 4HVGA 4CTCA 2JITA 3P79A 4OLIA 4WNPA 4F08A 1Q8UA 4NM0A 4EH2A 3R30A 2WMVA 5CT7A 3FI2A 4F1OA 3G6HA 4MD9E 3V3VA 3V5LA 2NNWB 3C0IA 1FVRA 3C4CA 1YXTA 4D2VA 4DN5A 2CLQA 4NIFA 4MNFA 1PF8A 3LMIA 2UV2A 2VWZA 3DU8A 4I5CA 4YC8A 3A2CA 5J7BA 3SXFA 3UMWA 3EKKA 4J8MA 5EI2A 3CLYA 2QU6A 4G6LA 2ZDTA 3SOCA 5JFXA 4O0UA 4YC3A 2WTCA 4FOCA 3AQVA 2R3RA 4BICA 4DLIA 4RIXA 3NMUF 4XP2A 3D2IA 3TZMA 3PRFA 2IZSA 3LFCA 3QQGA 4IVBA 3ZBFA 4IFCA 2VO6A 2ZB0A 3KK8A 4AUAA 4DE4A 3RWQA 1XH4A 2G2IA 5EM5A 2PL0A 4CMUA 4O83A 2W4JA 2XK8A 1J91A 3GXLA 4KSQA 3TTIA 4MBIA 5CZHA 3D4QA 4B8MA 5J7HA 4I41A 3AOXA 4MF1A 1ZZLA 4XV1A 3RHXA 1DAWA 3VW6A 3N4UA 4F64A 4IB1A 4A9RA 4AX8A 4JG7A 1Q24A 4E7WA 2UZOA 3RHKA 2XM8A 2R0UA 4YBKA 4QNAA 5GZ9A 2CLXA 1HOWA 1UKIA 2OFUA 4P2KA 3K5VA 3KRLA 4HYHA 3A8XA 4QO9A 3GVUA 4IAFA 4XG9A 5CSWA 4EORA 3HZTA 1PYXA 5IQFA 4AZWA 4FR4A 3ZLWA 4W9WA 4QMQA 3NAYA 5DEYA 2HK5A 4C36A 1PYEA 4JG6A 4UZHA 3CY2A 4ZK5A 5EDQA 2W4OA 4QYFA 4ZSGA 4QTCA 2YM8A 2PWLA 4TZRA 3G0FA 3ZUUA 4U43A 4RX7A 4CMOA 1CKPA 5KMLA 4MWIA 3RK9A 2BILB 4CFNA 1R3CA 4AW0A 4BTMA 5HVKA 3ORXA 1Y57A 3Q04A 4K9YA 4WSYA 4C58A 3IECA 2XP2A 3FBVA 2G9XA 3CIKA 4BDGA 2QG5A 2HXQA 2UZUE 3ZM9A 1U5QA 3MA6A 4OTFA 3DOGA 3C5UA 3NUYA 3QL8A 1MUOA 4C2WA 4DC2A 2FO0A 2YDIA 4PX6A 4KKEA 3GC0A 4LFIA 5HG7A 5H8EA 1OUYA 3JY0A 3GCUA 3ROCA 3PXZA 3LE6A 4J97A 3BYMA 3HNGA 3BKBA 2JDOA 3DBCA 3QTZA 4YLJA 5HLPA 3F69A 3A7IA 2WQOA 4YTHA 5JFWA 4EK8A 5JRQA 2QOIA 4HGSA 3BYUA 2V5QA 4O2PA 4ZJVA 2UZWE 1J7UA 2E9NA 3VS4A 3BEGA 3ITZA 3G33A 2JAVA 2KTYA 5IQEA 3BX5A 2BAJA 4I6BA 2GDOA 3DXQA 1K3AA 4ZY5A 1OL7A 3H10A 5KHXA 2J2IB 5KMJA 4YJPA 3JVRA 2C0IA 3LFNA 1BL6A 4AG8A 3PXRA 3HRCA 2P4IA 2WD1A 4IVCA 2HZIA 5J79A 3IONA 4BBMA 3EOCA 3D7TB 1JWHA 2ITZA 2XBAA 3EFKA 3FZPA 4FNYA 4EOMA 1H27A 3UODA 2W7XA 1Z9XA 3E63A 2HWPA 4KB8A 2G01A 4WHZA 4WKQA 4A9TA 4QRCA 1NW1A 4RC3A 3FHIA 5EG3A 2PSQA 3BLQA 4FV8A 1OVEA 2P2IA 4I4FA 3WIKA 5HORA 3HDNA 2IPXA 2X4FA 4B9DA 2F7ZE 3AD5A 2C6TA 3GOKA 4FIGA 3GU5A 2A0CX 3N4VA 4S2ZA 5HLNA 2FH9A 2OF4A 4CG9A 2UZEA 4QT1A 5HIDA 4W4XA 2A19B 3FZSA 2PK9A 3UO6A 4HCVA 3QGWA 3DJ7A 3R00A 1XBAA 3QYZA 4R7IA 1GOLA 2XJ0A 4S34A 2BTRA 4U44A 5AP0A 5HBJA 4DTBA 2VWBA 5I9WA 3Q4CA 4YJSA 2W96B 4FEWA 4O0YA 3F2NA 5E7RA 4M0ZA 5IA0A 1JKSA 3BI6A 1OL1A 2H6DA 4I6FA 3M42A 4YP8A 3QQJA 4K77A 4RSSA 1JVPP 4IWOA 4EH3A 4FIFA 4RFZA 4IBMA 2BIKB 3WILA 5IH6A 3LLAA 5ANEA 4KABA 2HYYA 5JMSA 3FLWA 4AZSA 5HNGA 2VGPA 5AAFA 3G51A 1FMOE 1S9IA 3QRIA 4ZTNA 5IQIA 3EHAA 3W33A 3K2LA 4BWPA 2VWUA 3BPRA 4PL4A 2C6IA 4LQMA 3NUXA 3A62A 4AACA 5DGZA 4B4LA 3RAKA 4IAAA 5CNOA 3ZONA 3BU6A 2QLQA 2WHBA 1JSUA 4U5JA 4RC2A 3AC1A 3EQPA 4OTPA 4PMPA 4R1VA 2PUPA 4NSTA 2Y4PA 5LCKA 1YXUA 4AU8A 1FOTA 3CXWA 4CV8A 4E8AA 5EKNA 3R1QA 4G3CA 2WEVA 2BRGA 4FKJA 4BN1A 4CCUA 3C4WA 4WBBB 1PXJA 3OCTA 5KCVA 2O64A 5D7VA 1IA9A 1GZNA 4EI4A 4YJTA 2OFVA 4RJ6A 2YCSA 4FG9A 3G90X 1IR3A 3NNVA 3IDCA 2QHMA 1PXNA 3IK3A 3OTVA 5ANOA 2R7IA 3GBZA 4ZTQA 1XO2B 4O38A 4GJ3A 2W99B 3CTHA 4I0SA 4C59A 1PHKA 3QRTA 5HD7A 2YN8A 3QHRA 4KBAA 5AA9A 3LM0A 3NGAA 4NCTA 3GT8A 3TZ9A 2JDVA 3PY0A 4F09A 4IVAA 2XYUA 4O7ZA 3LJ1A 4CZTA 4ONAA 2W1EA 4MKCA 3OROA 5KZIA 3R7YA 3VW8A 4U79A 5CXZA 3FKLA 3ID6C 3DCVA 3MA3A 5G1XA 1Y91A 3LHJA 4O2ZA 4DFZE 4AGDA 3Q6UA 5HLWA 5E90A 2BAQA 4WD5A 5LCJA 1Z57A 1B39A 4O86A 4J98A 1VEBA 2OIBA 3OBJA 4JG8A 2ESMA 4FVQA 3SAYA 5FTQA 2FB8A 4C33A 3S2PA 3SG9A 1YOJA 4M8TA 3W8QA 3MH2A 3ERKA 4JR7A 3OY1A 4Q9SA 3TN8A 3VS6A 4TRLA 5G6VA 2Z8CA 4Z16A 3DLZA 3WE4A 4BZNA 2A1AB 2XNEA 5E8SA 5TO8A 4EYJA 4E3CA 2PVRA 3QZHA 4F9AA 3LCKA 5AJQA 3EQGA 3BQRA 3ZUTA 2BIYA 4L3PA 1M2QA 2QNJA 4XS2A 5FEDA 5HE2A 4AGCA 1REJA 2F4JA 4RZWA 4QMLA 2PZPA 4A4OA 1FBNA 1P5EA 4G3FA 4BL1A 3LCSA 5EHLA 4L53A 4QYYA 3UOLA 4F9CA 3W10A 1YXVA 5B2KA 4IWQA 5M4IA 2I7QA 2ZM1A 2BRBA 2PTKA 3ORNA 4ZTRA 4FKLA 4U40A 3S3IA 3NVKI 5J1WA 4EQUA 3MVLA 4HYUA 2HAKA 5DH3A 1YHVA 4DFLA 3DK6A 2CGVA 3TJCA 5HO6A 4YGAA 4FC0A 4JIAA 1O6YA 3E3PA 2Y0AA 3UG2A 4BCOA 2RSVA 3LXLA 4MXCA 5ETCA 3TKUA 2XRWA 1OB3A 3GQIA 3V04A 3PTGA 2ONLA 4ACHA 4NM5A 4WG3A 3UPXA 3FY0A 4C0TA 2PMIA 1WMKA 2RG6A 1CDKA 4IHPA 2C0TA 4ANLA 4ACMA 4DHFA 4S30A 5CAPA 3ORMA 5M4FA 4X0MA 2VTRA 2YA9A 4KIKB 4M67A 1O6LA 5DEWA 4F9YA 1PXIA 2EWAA 3PE2A 4A4XA 4OTRA 5AUXA 2BRHA 4D4YA 1FGKA 3FI3A 3LJ2A 5AR8A 3VS2A 2GTNA 3LMHA 5FEEA 5I9ZA 3QCXA 5JQ5A 5FDPA 3HV6A 1T45A 1PRYA 4ZP5A 4F0GA 3OEFX 2YEXA 2ZV7A 1XR1A 2A4LA 3P5KA 3PG3A 5AMNA 5GHVA 2UW9A 3G0EA 4CFMA 3CGOA 4I3ZA 5CSHA 4GFOA 4LOOA 4DH7A 2BDJA 3D5WA 4GS6A 4XHKB 5H3QA 3KRRA 3P86A 3R2BA 5CI7A 3AMYA 3QF9A 4G3EA 1BKXA 2YERA 5HVYA 3C50A 4NUSA 2R4BA 3EQRA 3HV7A 2BDWA 2X7GA 4BR3A 3NDMA 1PY5A 4BDBA 5CF8A 2XK3A 3GNIB 1UV5A 4LL0A 4C2VA 2PU8A 3OC1A 4DCAA 3LQ3A 4IWPA 3Q52A 4H1JA 4FEVA 4E6DA 4LGGA 3CBLA 4IANA 4WG5A 1CKJA 1ZYLA 5J9YA 3NYXA 3QD0A 1Y6BA 4DGMA 3UVPA 3OFMA 3WYYA 2XZSA 3LCDA 4F0IA 4QQCA 4P5ZA 2IW8A 4PP9A 1UU7A 4GRBA 4JRNA 4UWYA 2B1PA 4L8MA 4AA5A 4C3RA 2RFSA 3C4FA 3DK7A 4GFMA 4H3BA 2OZOA 4FTQA 4RX8A 3NYNA 1R1WA 1A9UA 2IVUA 3D83A 4GG5A 4JJRA 2Y8OA 4IZ7A 3VUGA 3Q96A 4G2FA 4BFMA 4DEIA 1KE8A 4QMUA 1H0WA 5C01A 2H96A 3HV3A 2WMQA 2LAVA 1OKZA 1OKYA 3R02A 4N6YA 1J7LA 2X6EA 4CD0A 4D0WA 1KE9A 3UOKA 5FUTA 3DXPA 3ZSIA 3MFSA 4G3DA 4FVRA 2YABA 3BYSA 2ZMCA 4MHAA 5ACKA 3RP9A 4XBUA 5M56A 4BDDA 3W2RA 5I5ZA 3GU6A 5AUYA 5C4LA 4QTBA 5FG8A 3Q4UA 2RF9A 2WO6A 4OT5A 1XKKA 3QUEA 3A4OX 3VBYA 4IX6A 4EUTA 5JT2A 4RFYA 4ZTMA 4YJVA 3RAHA 4ZTLA 3ZZEA 2QKRA 1P4FA 3HAVA 3ZFMA 2F9GA 4LI5A 3D94A 2HCKA 3V6SA 4PDYA 4FZ7A 2VTOA 5HU9A 2W17A 5CTPA 4ZZMA 5D10A 2WMUA 2XK9A 4YZNA 3VHEA 1ZOGA 4E20A 4PWNA 2F2CB 3AC4A 5B2LA 2CNQA 3MH1A 4ENXA 3OY3A 2A27A 5EYKA 4EWQA 4LRKA 4IWDA 4Z7GA 2VZ6A 3FZTA 3JY9A 3CQEA 2IO6A 3WF9A 4IZYA 3O8TA 4F4PA 4R5YA 2PVJA 5EHYA 4FTLA 4TKSA 4C62A 2VO3A 4EZ3A 2WOTA 4I94A 5TOZA 5IH5A 1PXMA 4E6QA 2OBJA 3MI9A 3MTFA 5IMEA 5CNNA 3QRKA 4JR3A 2EB3A 1I09A 4D1XA 3S00A 4FV5A 4BDHA 4I4EA 1SVGA 3BWJA 5EW9A 3LCOA 3VBXA 1BI7A 2C6OA 2HZ0A 3KXMA 3II5A 3MIAA 3NZ0A 1I44A 4UEUA 5CEOA 5IA4A 5JSMA 4GIHA 1ATPE 4YHFA 1DI9A 5K5XA 1TQPA 2PZRA 5CENA 3NNXA 2WTIA 3GCPA 3RJCA 4KBCA 2UVZA 4IAYA 3A8WA 5L6PA 2QG7A 1WCCA 4FKVA 4EOJA 1YDTE 3QA0A 5CAQA 3BYVA 2VTJA 3QWJA 1QCFA 4ACGA 3RZFA 3FV8A 3SW4A 5BVDA 3GP0A 3KMUA 3TACA 5FDXA 3UVRA 3PG1A 5EDRA 5I0BA 3V5TA 3SRVB 4D2TA 3PIZA 2J0LA 4JX7A 2XB7A 4JDKA 1VYZA 2R2PA 4RIWB 5GIOE 2BPMA 3UMXA 5CT0A 5AUVA 1YKRA 3LQ8A 5JK3A 3VULA 2O65A 1FGIA 3VO3A 4IJ9A 2VX3A 2XNBA 4P90A 4WA9A 3KCFA 3ZEPA 3QTIA 3EN6A 4L45A 3LVPA 2YDJA 4JBVA 5DNRA 5C26A 5L4QA 4DTAA 2C5VA 3C1XA 4IJPA 4XV9A 4TYGA 2X1NA 3UQFA 4IEBA 4KA3A 2WQNA 4G1WA 3TCPA 3ENHA 4EEVA 1BLXA 4OTDA 1Z5MA 2PVLA 4EC8A 2VWIA 3KF7A 4NCTC 2GNIA 5ANJA 4Z7HA 4N57A 4QMPA 1Y8YA 5EM8A 4RC4A 4K2RA 4RT7A 3UOHA 4TL0A 4JX3A 3UPZA 3COMA 4G16A 4CFWA 1UWHA 4PQNA 4OAUC 4NT4A 4CKJA 5KE0A 3UTOA 3L8PA 3CJGA 3DB8A 3GU7A 3RM7A 2YFXA 2B0QA 1UA2A 3BGZA 3OTUA 4ASDA 2WTDA 4M69B 3E8DA 3R04A 4EHZA 4MYGA 4BI2A 3VAPA 3SVVA 4V01A 5CYIA 5HCYA 4E4MA 3MFRA 1OL6A 4EHGA 1U54B 5JFSA 3DXNA 5GZ8A 3EH9A 4M14A 2J0IA 4F1TA 2ITWA 3UYTA 1ZYJA 3BU3A 3P08A 5DA3A 5IISA 1CSNA 5IG1A 2QOLA 5E8XA 1PXLA 1WBVA 2WU6A 2OF2A 1QL6A 5DVRA 3QD3A 2I1MA 2YCQA 3D9VA 2VTHA 3ENMA 3G9LX 4KNBA 4F99A 4C3FA 4BDIA 2JDRA 1APME 1ZOHA 3KFAA 2EVAA 4D5HA 1XWSA 2E9UA 4FTOA 2PVFA 3VVHA 3PDTA 3Q2JA 1MRVA 3FSFA 3KXZA 3I1AA 1H25A 5D9HA 4CRSA 4DGNA 2ZAZA 2C3LA 2WTVA 4OTQA 5L6WL 3EIDA 3EL7A 2E9VA 3OMVA 1PXKA 4IDTA 4CZYB 5DE2A 3R73A 3C4ZA 1YHWA 2JIIA 3FYJX 3LPBA 4L68A 2BZIB 4UWCA 4XG4A 2GHLA 1OUKA 5ANGA 5CASA 2GFCA 5ANKA 2JDTA 2C30A 2CMWA 2R3FA 4LYNA 3ORPA 3BRBA 3F5UA 4AWIA 3I0OA 4FV6A 5AR4A 4MXXA 2PVYA 3PXYA 3VF9A 3MIYA 5FXSA 2BVAA 4FKIA 5LWMA 5KMMA 2YWVA 3CEKA 3HA8A 5AUZA 3Q9YA 3OOGA 2Z7RA 4TWNA 5AP4A 3U51A 4EC9A 4XV3A 4BDEA 5IA1A 3WZUA 3RAWA 1KUTA 3SOAA 4ASZA 5KKRB 2B9FA 2XK4A 3F7ZA 4X6QC 3T8OA 3SXSA 3MY0A 2EB2A 3L8XA 4YHTA 3NUPA 5IEXA 4BCFA 4FK3A 3Q9ZA 4MQ1A 5FGKA 1GJOA 5C1QB 3FZRA 3VNTA 3G6GA 4QMXA 2BHHA 5A46A 1LPUA 2UW6A 5HCXA 3E8EA 5TR6A 4RWLA 4CEGA 2ITNA 2XRUA 4GCJA 5FTOA 3ATSA 5LMBA 3FMNA 4ZS4A 3MVHA 2OXXA 2Z2WA 4QMVA 2DUVA 2OK1A 3QD4A 3VQHA 4ZLZA 2RFEA 1BX6A 1H1WA 3IW6A 4YO6A 2DWBA 4R3RA 1OKVA 4EOOA 5FBOA 4KRCA 1RQQA 1YI4A 2B53A 3JYAA 3NR9A 3Q5ZA 4ENYA 3L9LA 1OIYA 4TYIA 4UMTA 5CU4A 5IU2A 3TNPC 5BUJA 1OECA 4QYHA 2GHMA 4ANSA 2R3IA 4TYHA 4I6HA 3O96A 4W4VA 3PLSA 1Q41A 4X7QA 4O7SA 4I5PA 1PMNA 4PY1A 1YVJA 3FEGA 4JS8A 3OZ6A 3ZFXA 3N4TA 3D5XA 3N9XA 4PPAA 2J9MA 3KRJA 3MS9A 3D2KA 3PVUA 2J5EA 3MY1A 4X21A 4DINA 2X2MA 2WZJA 5K0XA 3PIXA 4EHVA 4D28A 4EOIA 3LCTA 3U9NA 3VBWA 5M4CA 3MESA 3RI1A 5CSVA 4QPMA 3O8UA 5A14A 3KULA 3FPQA 4GT3A 1DS5A 4Y83A 2C1BA 5IUGA 5EFQA 1O9UA 5AUWA 4CFUA 3V8SA 3W55A 4I5HA 3Q3BA 4MF0A 4JI9A 1W83A 5CLPA 3TNWA 2W1ZA 3QALE 4QPAA 3M2WA 3HVCA 2GNHA 3QYWA 2WAJA 4CQEA 4YUQA 4WRSA 4AZEA 3JS2A 3PJ8A 4KS7A 5EQEA 3LW0A 5AM6A 3NW7A 4I92A 2QO9A 2XH5A 4QP2A 2X0GA 5HG8A 2YLFA 3HMIA 3RALA 4BB4A 2BCJA 4JBOA 3WZJA 5A6NA 3U54A 3VRYA 1B6CB 2VN9A 2RIOA 5DWRA 2PUNA 5FP6A 1OGUA 1OIQA 4FSZA 5TKDA 3FMMA 4MNEA 2C3IB 2HELA 3GC9A 4MH7A 4F6SA 4CVAA 2VTPA 4ZOGA 3TKHA 3EB0A 1AQ1A 3RPYA 3R9DA 5AUTA 5L2SA 5HE0A 3U8WA 3F5PA 1XH6A 3L1SA 5AR2A 4FMQA 2FSTX 4MCVA 3H0YA 4FKRA 4BZOA 4CFVA 1OITA 2R3NA 4OBQA 3NPCA 4WUAA 1WVYA 2WMRA 3OEZA 3PUPA 4R3CA 2BMCA 2GS7A 4IB0A 3A7FA 4M97A 3HA6A 4H1MA 2BZKB 4FTAA 2J6MA 5CQWA 3NVMB 2HZNA 3C7QA 3VJOA 5HNIX 4AN9A 3EN9A 1ZYDA 3DGKA 2JBOA 2Z7QA 3MBLA 3RBWA 2CCHA 4BCQA 3OW3A 4RJ8A 1OIRA 3EYGA 1BL7A 3C4EA 2VNWA 5E91A 4AGUA 3FXXA 3H4JA 2R3OA 5M07A 4IH8A 4BTJA 4AP7A 5EQYA 4XV2A 4DITA 4DLJA 3PSCA 4X2JA 3R9RA 3MFTA 4F65A 3VUKA 2XBJA 4IACA 3UP7A 3UZPA 3ZRMA 3EL8A 4K18A 5DRBA 3CKWA 5DI1A 3RPRA 1H1QA 3QQKA 3MB7A 3CD8A 3FJQE 3VBQA 1OPJA 3GCQA 3Q32A 1NVSA 2PZIA 2OLCA 3IW5A 2VX1A 3R8VA 4HVIA 3EWHA 4F6UA 5AP1A 2W05A 3NW6A 3R1NA 4RJ3A 3DFAA 2GU8A 3QRJA 4MD7E 4O21A 4RRVA 3KCKA 3MWUA 2ZM3A 5FM2A 4I23A 4HVDA 5L2TA 5C8MA 4GVAA 1URCA 5M44A 2V0DA 3RWPA 4JDJA 4Y46A 3RTPA 4PL3A 3CS9A 4BKYA 5HIBA 2DQ7X 4JLCA 5GZAA 4AZFA 3BWFA 4QP6A 3TV7A 5GIPE 4NM3A 5CU0A 5J9LA 2R0IA 5CU2A 3ZRLA 1RDQE 4Y8DA 4ZZOA 2I0HA 5T3QA 1MQ4A 4WG4A 3CCNA 3R9HA 4ZSLA 5IQHA 1R0EA 4Y72A 1GZOA 2OJJA 2YJSA 2NRYA 3DB6A 4GK4A 4M7IA 3OUKA 2R5TA 4AT5A 4AQCA 4C38A 3AG9A 2J7TA 3BHYA 3FQHA 2Y4IB 4YJNA 4CFFA 4J71A 1A48A 2YM6A 4X3FA 2YWPA 2BKKA 2REIA 4RBLA 1VZOA 2Y6MA 4RIOA 4UY9A 3FLQA 3TZ7A 4EQMA 2QLUA 3POOA 3LXKA 4QQ5A 4ZTHA 4BDKA 2ITOA 1OPLA 4M68A 4DGLC 1YI6A 2ITTA 3VS3A 4FUYA 2CJMA 5AP6A 4GUBA 3T9TA 1Q8WA 3V5PA 5J87A 4AZVA 5AP2A 4NWMA 5D7AA 4IW0A 3C51A 4JQ7A 1KV2A 4R6VA 4U0IA 4DT8A 3R8ZA 3E62A 4TY1A 4BC6A 4GV1A 4RPVA 4ANBA 2HIWA 2SRCA 2XNNA 3O0GA 4KINA 4FTKA 3ACJA 4BIBA 4QMSA 4HGTA 3C5IA 1SVHA 1JSVA 4KBKA 4AA4A 4EZ7A 3U6HA 5LVMA 2O0UA 1IEPA 2NPQA 2PHKA 3FQEA 3QAME 3BU5A 3Q9WA 4FL1A 4RLLA 3QXPA 3TV6A 4C4JA 4W4YA 4D2SA 5CALA 2YIXA 5CEKA 2XJ2A 1SZMA 2Y6OA 3OUNB 4MX9A 2OJ9A 1U46A 4PPBA 2WTKC 3A99A 1YDSE 2WQBA 4YNEA 3DJ5A 3QX2A 3R8MA 3L9MA 3RCJA 4I24A 4E4LA 1J1BA 3BV2A 2H34A 1VJYA 3DTCA 4MD8E 4D4RA 5CU3A 4C4GA 3F5XA 2W0JA 4XG8A 4BYJA 2AC3A 1NA7A 2B4SB 5ITAA 3NUUA 2PULA 3SD0A 1Q3DA 3EJ1A 3G5DA 3GENA 1QMZA 3MH3A 4UMQA 5FXQA 4FNZA 4ZJIA 3O7LD 4DFNA 3HP5A 1OMWA 4KKGA 4QD6A 4F0FA 5BQ0A 3ZBXA 3DTWA 1KV1A 2OJIA 5E4HA 2GCDA 1SNXA 3EZVA 1V0PA 4PDPA 4V05A 2ZB1A 5CU6A 3UDBA 3E8NA 5IQBA 4I0RA 3GU8A 3CR0A 1TKIA 2PZYA 3E64A 4TN6A 2QO2A 3QUPA 4HVSA 5CEPA 4W4WA 2IJMA 5KBRA 3E87A 4UXLA 2A2AA 1MP8A 3IGGA 4FYNA 4FTRA 4FSMA 4KD1A 1XJDA 2PE0A 2UW7A 3H9OA 3TNHA 3IQ7A 4L3JA 2HXLA 2QR7A 3FKNA 4RIYA 5EYCA 2QOFA 3HLLA 3TT0A 4FZAB 5DMZA 2QOQA 2C6KA 2W1GA 3RINA 1YI3A 3F2RA 1KSWA 4PTEA 4IB5A 2OJFE 4IADA 2Z02A 5ICPA 3HL7A 5CAVA 4FI1A 4BCGA 4EKKA 5LJJA 2BROA 4EL9A 4FEQA 1OZ1A 4F9BA 3PZHA 1TQMA 3D5VA 1M17A 3CQUA 4NW5A 4ERKA 4OBOA 2GNFA 4U45A 4IX4A 4TNDA 4I5MA 3LFFA 4X3JA 2F2UA 4U81A 3RGFA 4ZLYA 2GNLA 2OH0E 3UZTA 3W16A 3R21A 1FMKA 2R3HA 3KB7A 3V8TA 4GH2A 3TKIA 1ZY4A 4RA5A 4X2GA 3UJGA 4F63A 4QMMA 5C4KA 3ZLSA 5BVKA 4AZTA 3QZGA 4AN2A 4FSNA 4CGAA 2VAGA 4U41A
chains in the Genus database with same CATH superfamily
3Q60A 1IAJA 3SG8A 2XKEA 3UE4A 4OTWA 3WARA 4BDAA 5E8TA 1YW2A 4IE9A 3FI4A 3EQFA 5ETFA 3BLAA 3IW7A 4JAJA 4NEUA 3L8SA 5CVGA 4A7CA 4FG8A 4P5QA 3NX8A 4IC8A 3OG7A 2VD5A 4ZXTA 5ANDA 1Q4LA 4MXYA 3KA0A 4NH1A 4RVMA 2GS6A 1GZKA 2J51A 3BGPA 4JOAA 4WOVA 4DH5A 3BLHA 4EYMA 5HZNA 5HI2A 4DH8A 2X2LA 4OW8A 4L9IA 3REPA 2JAMA 4F7LA 3KN6A 2CKOA 5EQPA 2C69A 1JKTA 3QZFA 4EK3A 2OWBA 3IO7A 1QPJA 5BPYA 1OBGA 2QCSA 1GIIA 4HNFA 4NJDA 3KVXA 3D7TA 3QRUA 2CHLA 4NYEA 2YZAA 4LOPA 1FQ1B 4YZ9A 1ZLTA 4TYEA 5GJDA 4B7TA 4QTDA 5AP3A 4CMTA 3DAJA 4G31A 4EOSA 1G8AA 1YWNA 4BGHA 3HX4A 4EK6A 4YZBA 1BMKA 1FPUA 3DNDA 5DFPA 3FMEA 1L8TA 3KRXA 5CXHA 1TZDA 1J3HA 2UW4A 3A4PA 4XNEA 3A60A 3ZFYA 4ACCA 4ASXA 5AA8A 3MGYA 1YRPA 4MTAA 5M06A 3ZO4A 4USEA 1OPKA 2C1AA 2QOOA 3AD6A 3B2TA 3QTUA 4S33A 2W1HA 3LQ5A 4FG7A 2CSNA 3KF4A 4UV0A 3AT3A 3RK5A 4O4DA 3W2PA 3ZO3A 1ZMWA 4C35A 3I7CA 4FTTA 5KZ0A 3DDQA 3PVWA 1Q97A 4ALUA 5LQFA 3P1AA 4FV0A 3W2SA 4JQ8A 2XA4A 2JEDA 1SVEA 5IEYA 5LOHA 5M53A 3P5JC 2CDZA 4O4BB 4O7NA 4G3GA 4ZAUA 2JKQA 2PVHA 1JSTA 3FAAA 1HCLA 3R1SA 3FLYA 4FV9A 3QWKA 4IM3A 4H39A 4L43A 3CPCA 4QMNA 4DHIB 1ZWSA 3CQWA 4NFNA 5T6KA 3HECA 3HGKA 3ZZWA 4FV1A 4F9WA 4JAIA 1NVRA 3PLAE 3GCSA 2ZV2A 4CFXA 2ETRA 3DS6A 4YC6A 5L2QA 4GK3A 4BZDA 1W0XC 2PPQA 2JLDA 4AN3A 4GU9A 1GNGA 3OHTA 3W2OA 5IA5A 5DG5A 3IG7A 3ORLA 4DG2E 3CJFA 2OZAB 3FE3A 4AOTA 3DV3A 2V7AA 3UP2A 4FSQA 3KXNA 2XUUA 1WBTA 5HESA 3CKXA 2XMYA 3SGCA 2UZNA 4XX9A 4DG3E 4IXPA 5EK7A 2LGCA 3GI3A 4K8AA 4WT6A 4H58A 3C0HA 4ACDA 3FYKX 3FMJA 4CYJA 1W2FA 3T3VA 4ANOA 4FA2A 4N4SA 4HZSA 3LFAA 4AT4A 3W1FA 3FMDA 4F6WA 2W9FB 3W32A 2WXVA 4QDVA 1RJBA 4JMQA 2VX0A 2R3JA 4KS8A 3E93A 4FKWA 2EUFB 3NNWA 4BI0A 4EJNA 4BKZA 5LVPA 1TVOA 3WF7A 2B9IA 4EKLA 3O50A 3QTRA 4G9RA 3D0EA 3QZIA 4D1ZA 5AUUA 2C5OA 2VWYA 2JFLA 1SMHA 3ANRA 3EFLA 4XP3A 1KE7A 3FXZA 5KBQA 3FDNA 4FSRA 1XQZA 1ZRZA 3B8RA 3DBQA 4X3FC 5BVOA 3EMGA 3P4KA 2C5NA 2XNGA 4MAOA 4FNWA 4BCHA 4FL2A 5KMKA 4E6CA 4BTKA 4XLIA 1F3MC 3S4QA 1WAKA 2E9OA 3I5ZA 3KXXA 4J96A 1B38A 4WNKA 1W82A 1WFCA 4XMOA 3UO4A 2J5FA 5LMKA 4RGJA 5AR7A 3UIUA 3ULIA 4NL0A 1G5SA 5E9EA 3MYGA 5DR9A 3DKCA 5AP7A 4AOIA 3Q2MA 4Q5HA 5DLSA 4D55A 5LXMA 5JKGA 3GC8A 5KO1A 2GMXA 4IX3A 1YXXA 2HOGA 4QTAA 5JN2A 2VGOA 4O27B 4EOKA 4PDOA 2CGXA 4BCPA 2QC6A 5TE0A 4ALWA 4WSQA 2V62A 4DFXE 5HX6A 3CTJA 3MJ2A 2I0EA 3O23A 3FUPA 2VTIA 3KEXA 4O7TA 4GEOA 4PTCA 3UDZA 1Q8ZA 4AW2A 4DBNA 4FGRA 5CAUA 4FNXA 2Q83A 4BIDA 5KUPA 2XEZA 3DZQA 3QKMA 5CS6A 4D5KA 2O63A 4O7RA 4CSVA 4BHNA 2YAKA 1KE6A 2V7OA 4JDIA 1W98A 2YCRA 4UZDA 1JKKA 4FTJA 5L8LA 1MQBA 2EXCX 3Q5IA 3NIZA 4GG7A 2IVTA 4PMTA 3R9NA 2QU5A 3RKBA 3PVBA 5EM7A 5IPJA 2C6EA 5JZNA 5ETAA 5LARA 4MXAA 1F0QA 5HTBA 4IVDA 5HBEA 4MBJA 3UO5A 3ZCLA 4QNYA 3AMBA 4BF2A 5KHWA 4NKSA 5K4IA 2HW7A 3KN5A 3AKKA 3MDYA 4ZY4A 4YO4A 4DDGA 3KVWA 3ZDIA 4ERWA 3TXOA 3QTXA 2X9FA 4P7EA 4FV4A 2G2FA 2RG5A 4FV2A 4AFEA 3COIA 2O5KA 5AR5A 5DOSA 3MH0A 2B7AA 4PDSA 3WF6A 2UZBA 4FT0A 2W1CA 3P23A 2WELA 1M2RA 3ACKA 3BELA 2NP8A 2VTAA 4FKQA 4U9AA 4ZJJA 4EH7A 5CANA 1OGYA 5IQCA 1YOMA 1K2PA 3QXOA 4KIKA 3UIXA 4HNIA 3UBDA 4DFYA 2X7FA 3UGCA 4WUNA 5HG5A 1KWPA 4LG4A 4ID7A 3OOMA 5M55A 5LVOA 3MPTA 3DK3A 5A4TA 5IDPA 2HWOA 3FSKA 3A61A 5J5SA 5AFVA 5LWNA 4AA0A 4YTIA 3QUDA 3ZRKA 1BUHA 2ETMA 2ETKA 1U5RA 2W5BA 4F70A 3RK7A 3KC3A 3MVMA 4HYSA 5C8NA 1A06A 3KY2A 2RFDA 2YDKA 4NFMA 5BX0A 2JDSA 3FZOA 1EH4A 4IX5A 5HHWA 4DG0E 2BTSA 3ORZA 3A7JA 4EHEA 4GKHA 1M14A 1WBOA 2IWIA 2YIRA 5L3AA 2W5HA 5C9CA 3E7OA 4HCTA 4V0GA 4D2WA 2XF0A 2W1DA 2XALA 4CG8A 4YSJA 4AXDA 2ACXA 5LMAA 2CGUA 4HGEA 4GKIA 3WZDA 3LZBA 4LRJA 5H8BA 5JRSA 3AKJA 4EUUA 5F1ZA 5FQDC 2YCFA 1UVRA 2O3PA 3MPMA 5IQDA 5CF5A 3ZDUA 2IVVA 1GIHA 3F61A 2YIWA 3DZOA 3PWYA 3RM6A 3SA0A 2YM5A 1ZY5A 3W8LA 3AGMA 4TXCA 3PA3A 3ZLXA 3OXZA 4ARKA 3CE3A 4S32A 2YITA 1UNHA 2GS2A 4DGOA 2CNUA 2Q0NA 4JRVA 4UALA 5IA3A 4XJ0A 4BDFA 1R39A 2RKUA 3F3ZA 4BY9E 4O1PA 3QQHA 2ITXA 2X8DA 3BBTB 1Q8TA 5C03A 3AT4A 4NIFB 2YM4A 4YJUA 3WIGA 4EOQA 4U8ZA 1R0PA 2B9HA 3KXGA 3RNYA 5GINE 3QGYA 2PMLX 2XVDA 3EN7A 4OBPA 5D41A 4GL9A 2C68A 3NNUA 4EBWA 5AV2A 4R78A 4XOYA 2H9VA 2IZRA 3ZTXA 3GGFA 5FWKK 4O6LA 3ETAA 4FUXA 3BCEA 4FT5A 5CEIA 5JGAA 1SNUA 3HKOA 1KOBA 4RIXB 4OTGA 1H26A 4CXAA 4O0XA 5CSXA 4CKRA 4FSTA 4IAZA 2JKMA 2I40A 5DIAA 2CCIA 5HOAA 5BNJA 4GJ2A 1H00A 4BGQA 1JQHA 2UZVA 5B2MA 3W0QA 3F66A 4LRMA 3OCGA 5HE3A 5IMXA 3TDWA 4AXEA 3KXHA 4FOBA 3SDJA 3R0TA 2CKQA 2P3GX 4V04A 5AAGA 4CLJA 3I79A 5EYDA 3TJDA 3I5NA 4R3PA 5E8UA 4LMUA 4AGWA 2BUJA 3HEGA 4JDHA 5AV0A 2EU9A 3SLSA 4G5JA 1ST0A 3VS0A 4I20A 4J99A 3DJ6A 3FLSA 3EQHA 4Z3VA 1ZMVA 3KMMA 4BWXA 4HGLA 4GU6A 2NO3A 4L42A 4BVUA 4L6QA 4PNKA 4F7JA 3ULZA 3QQUA 5CEQA 5HTCA 5L6OA 1U59A 4GIIA 4XG2A 3D5UA 5B0XA 5A54A 2W5AA 4XCUA 4RWIA 4FV3A 3LIJA 4XRJA 4E5BA 3OBGA 3DBDA 4LOQA 4E4NA 2OJGA 3LFQA 4YNOA 4DEGA 4TYJA 4EZ5A 1BYGA 1YDRE 4N6ZA 3QCQA 4EK5A 4EH4A 3ZXZA 4BCIA 4XOZA 4FZFB 2OO8X 2VO0A 4I22A 3E8CA 2VWWA 2CPKE 4R1YA 2YZLA 2I0YA 2XCKA 1QPDA 4RVLA 5BVWA 5L2IA 4XG3A 3WYXA 4YTCA 5CY3A 4DEDA 5HIEA 1SM2A 3U9CA 4Y5QA 4ASEA 5IUIA 2W4KA 3ROYA 1GAGA 1LEWA 5HG9A 3RNIA 1PXPA 3ZUVA 4AXFA 2BRNA 2UZLA 2Z60A 3SRVA 1DAYA 5DBXA 3QKLA 4B99A 4AS0A 2P55A 5IH4A 5A4LA 3ZMMA 2R3QA 4RIWA 3TIZA 4AF3A 1ZZ2A 2R3MA 2FYSA 2VV9A 3Q4TA 1Q99A 2QD9A 3EN5A 3V8WA 4LV8A 1M52A 4M66A 2QQ7A 5H8GA 4TW9A 4BCJA 3PRIA 3UC4A 2BALA 5BV3A 1BI8A 4E93A 1IRKA 3O8PA 5EDPA 2PE2A 4TWOA 2C5XA 3BE9A 5I3RA 2CKPA 4IZAA 4R7HA 3FMKA 3Q53A 4FODA 4BCMA 4Z55A 3QU0A 3FMHA 4KIPA 2AC5A 2OKRA 3S0OA 5LVNA 4TPTA 3MSSA 5KX8A 2X4ZA 2OI4X 5K3YA 4FKSA 4O91A 4YPDA 5H9BA 2ZVAA 3R01A 4CNHA 5JQ8A 3JR1A 3FPMA 2C6MA 1Q8YA 2FSMX 3RPOA 4G6NA 4O0WA 5DR2A 1FVTA 2J0JA 4U3YA 4HJOA 2ZDUA 4J7BA 4L46A 2ITYA 3NIEA 2FA2A 4M69A 5JGDA 5JZJA 2GPHA 1Y8GA 1J7IA 3TEIA 5BYLA 3GCVA 5HO7A 3LXPA 4DH1A 5LMKC 1U54A 2X9EA 3I6WA 4BIEA 3LFEA 2W9ZB 5IUHA 2X39A 1WVXA 3QCYA 3AC8A 4MBLA 4RJ5A 3FC1X 2EXEA 3SV0A 4GT5A 3ODYX 3PJ3A 5DHJA 4RX5A 2JC6A 4O0VA 4CRLA 2UW8A 2B55A 5CEMA 4O6EA 4IC7A 4U97A 5BVNA 3ZXTA 1F5QA 1M2PA 3PVGA 5E8WA 3FL4A 5GNKA 3EQCA 2VO7A 2QKWB 4AAAA 4HCUA 4BGGA 4DEAA 2W06A 4WIHA 3TUDA 3R7IA 3O7LB 3AC3A 3AT2A 3OXIA 3V5QA 2JBPA 4W9XA 5ETIA 3FKOA 3GU4A 4EH6A 1JLUE 3MY5A 4LGHA 4I21A 4ZIMA 3ZYAA 1ND4A 2GSFA 1FVVA 4RWKA 4O0SA 3LXNA 4E6AA 3R28A 5D11A 3P9JA 4NW6A 2IN6A 4ITIA 3QKKA 4YJRA 5AX9A 4OTHA 4RZVA 4D2RA 4MQ2A 2JKKA 4PL5A 3M1SA 3P7BA 4U80A 4ORKA 3KGAA 4UMRA 4QMOA 3ELJA 3MFUA 5E8ZA 2UW3A 2PE1A 4NTTA 2FVDA 4FKPA 2QHNA 1S9JA 4DA5A 2R7BA 3LFBA 1CM8A 2DYLA 5A9UA 3OT8A 3QLFA 4C4EA 4LV5A 5ACBC 3U4WA 4U6RA 3VC4A 4PUZA 2WMSA 5F95A 4O82A 3NAXA 3QQLA 4U42A 3JXWA 3DQWA 3I4BA 3VUHA 3O2MA 2YIYA 4RIYB 3V01A 4X6RA 5CX9A 3TL8A 4EWHA 2UW0A 4CT1A 4MXOA 4YJOA 5EKOA 3ALOA 2I6LA 2VU3A 3V5JA 1O6KA 3VBTA 2HY0A 1W2DA 3VWAA 5BUIA 4J1RA 3R6XA 2X0OA 3MB6A 5CQUA 4FX3A 4RJ4A 2XJ1A 4N70A 4U7ZA 3HMMA 4L52A 4UWBA 5EOBA 5GJFA 5BMMA 3I60A 4DEEA 3U6JA 4MWHA 1FINA 5JH6A 4DGGA 2BDFA 4FBXA 4HZRA 5E1EA 4GT4A 3KIOC 4NU1A 3TV4A 1JNKA 4F7NA 1XH8A 2JGZA 2JIVA 2X6DA 3SQQA 4EQCA 5M51A 1WZYA 3EQBA 5BYYA 3F5GA 3HMOA 1ZAOA 4GFGA 3HP2A 3RVGA 1ZOEA 2OICA 3MPAA 5A3XA 2CNVA 4H05A 5I9XA 4UBAA 2V22A 3I7BA 3IDPA 4FSWA 2VWVA 5KMIA 1NT2A 5CVHA 2AYPA 3NS9A 2B9JA 2R64A 4AAYA 4LGDA 3ODZX 3DY7A 4JXFA 5AIRA 1G8SA 3DKFA 1IG1A 4C57A 1QPCA 4GMYA 4BDJA 2VTTA 2ZYBA 4FEUA 5L2WA 2B52A 5C8KA 3DA6A 2R3GA 3MTLA 3THBA 4BBEA 3L9NA 4H3PA 2ZV8A 2VNYA 3OT3A 4BWKA 5HICA 4DCEA 4BJJA 4QMZA 3QC4A 4R5SA 2ITUA 3TWJA 2VTSA 2WOUA 3FZ1A 5HCZA 4AT3A 4C4IA 3F3TA 2YIQA 5HGIA 4FE2A 3P78A 1URWA 5F94A 3G15A 4FL3A 2HY81 3UQCA 1AGWA 2YM3A 3COHA 2XNOA 2UZDA 3LOKA 2NRUA 2WQEA 4Y85A 5A6OA 4IM2A 3EQDA 3OF0A 4DTKA 4YLLA 3VIDA 4DEHA 1J1CA 4FT9A 2BZJA 3ZS5A 4O7VA 2JFMA 4FVPA 3E88A 3O17A 3KK9A 4DEBA 4ANQA 4D1SA 3PP0A 2O8YA 5FXRA 3TTJA 3UZRA 5JGBA 1CTPE 2IW6A 4OR5A 2R3KA 1UU3A 5AEPA 4E5AX 4CZUA 3ANQA 3EYHA 5M08A 4GYGA 4IAKA 3LM5A 3BYOA 5C27A 2XEYA 3NUAA 4JNWA 3HAMA 3R7OA 4Y73A 4D2PA 5BMSA 5AX3A 3SHEA 2GQGA 2XYNA 1LEZA 5I9YA 4EK4A 1M7NA 3T3UA 4QMYA 4A9YA 1XHAA 4AW1A 3ZU7A 4O7LA 3H30A 3VUIA 3KMWA 3L9PA 3HV5A 2AEGA 3L8VA 3V6RA 3NCGA 3EZRA 5I3OA 5CAOA 4EH9A 3PA4A 4EH5A 3VF8A 3COKA 2WU7A 2YHVA 4Y95A 4XG7A 1KE5A 3AD4A 3FY2A 1LR4A 1UKHA 3PA5A 2FUMA 4C8BA 4C02A 4EBVA 3LJ0A 4YSMA 1OL2A 3ORKA 4BBFA 3R83A 3NYVA 4GSBA 2WPAA 3Q6WA 3TIYA 4RVTA 2HZ4A 5AAEA 3UG1A 3PYYA 2ZV9A 3O71A 1IAHA 5E1SA 1PKGA 3AGLA 4U3ZA 4D58A 5F9EA 1GZ8A 2ITQA 3OP5A 2BRMA 5CWZA 5EH0A 2I0VA 2ZOQA 1SYKA 4ZSEA 1H1SA 3PZEA 2CN8A 5AV3A 5TT7A 4UMUA 5FTGA 2GNJA 3KREA 5I9VA 4IFGA 2F7XE 4XH6A 5HEZA 4CQGA 4O84A 3U4UA 3HMNA 3OWLA 3BBWA 4M15A 2X7OA 5J8IA 4XBRA 4X2FA 3WI6A 4UN0C 3KKVA 5DT0A 5EHOA 3DLSA 3CY3A 3PIYA 4RLKA 1ZARA 4RX9A 4QPSA 1P4OA 2C6DA 3R22A 3ZSGA 3NRMA 2UVXA 3PP1A 4KWPA 5J1VA 5AP5A 2WMBA 5EI8A 3QTWA 5K0KA 3Q4ZA 4DH3A 4F7SA 2XKFA 2GNGA 3BL9A 4PMSA 3RZBA 3I6UA 5CF4A 2BR1A 3K3IA 4FKUA 4ITHA 4Q2AA 4YU2A 2QR8A 3HRBA 4MXZA 5IDNA 4UMPA 1UNLA 4C37A 1H01A 2WMTA 1OKWA 2ERKA 4OGRA 4PRJA 4UYNA 3F3WA 1PKDA 2R3LA 3DKOA 2Z7LA 3GFEA 3OVVA 1PMEA 1RW8A 4EONA 3IOPA 1STCE 2UZTA 3LFDA 4HPTE 4FIHA 2Q0BA 4BDCA 3GFWA 4JIKA 2J0KA 5K9IA 4ZMFA 1XMMA 2O2UA 1YXSA 5FRIA 2QO7A 3BHVA 4R77A 5E92A 3S95A 5DPVA 2C0OA 5DYJA 3HV4A 4L00A 2Y9QA 4HPUE 3CSVA 2P33A 1XMLA 2FSLX 5AR3A 3DNEA 4NTSA 3RPSA 1MRUA 4BCNA 2IVSA 4YTFA 3H0ZA 3MW1A 4AW5A 2AUHA 2J4ZA 2JIUA 3KL8A 3QFVA 4JBPA 4RVKA 3RAIA 2X8EA 3FXWA 4LL5A 4USFA 4X2KA 3I81A 3F82A 5IZFA 3FWQA 1WBNA 3IW8A 5HVJA 5J95A 3R8PA 1YOLA 4FYOA 5DN3A 5T68A 4XLVA 3U87A 3DT1A 4ZY6A 4APCA 4NJ3A 2DS1A 2XM9A 3W0NA 3R71A 2GTMA 3QQFA 3P7AA 3TNQB 4DBXA 2YLEA 5IF1A 1ZYSA 5TF9A 1UNGA 2XIXA 5EW3A 3P0MA 4JBQA 3BHHA 4AE9A 4KIOA 3TZ8A 3D7ZA 4QP8A 2GQRA 2PUIA 3H9RA 1XH5A 3TM0A 2IG7A 4M12A 4K1BA 3IS5A 3WBLA 2C6LA 4CCBA 3KRWA 3QHWA 3O5AA 2BHEA 2XIYA 3DDPA 4IQ6A 4FT7A 4XYFA 2PMOX 2YJRA 3OCSA 4L7SA 5FD2A 4E4XA 5M57A 1DM2A 3CD3A 3R7EA 2F57A 4GW8A 2OIDA 4E1ZA 1MRYA 4USDA 2FSOX 1T46A 2VUWA 3CC6A 4O7WA 3VHKA 3FLNC 4WO5A 4QP1A 3WF5A 3E5AA 5A4QA 4BTFA 2XKCA 4N0SA 1AD5A 3FHRA 4QMWA 4M84A 3DKGA 4J52A 4FT3A 5B7VA 3HMPA 1Q3WA 3PXKA 3OWJA 4FTIA 4PP7A 4FGBA 4ALVA 1W2CA 2IZUA 2OW3A 4HYIA 1H1RA 4NM7A 4IM0A 5ANIA 4D9TA 2WB8A 3R8LA 4O22A 4TNBA 1PJKA 3LLTA 3NEWA 4UYAA 1G8JA 4AXAA 3HUBA 3PSBA 4R8QA 1E1XA 4RQVA 5M09A 1NXKA 4FTNA 1Q62A 2RGPA 2ZFYA 4J53A 4LDTA 4J8NA 2J90A 1JOWB 1H4LA 2RFNA 3TNIA 2OH4A 3QLGA 3F2AA 3SXRA 4C4HA 4JL9A 3QD2B 5AV1A 4FSUA 4ZLOA 5BVFA 4E26A 4RG0A 3NSZA 5JFVA 4GUEA 5JEBA 4O0RA 3V51A 1XH9A 3WF8A 5CVFA 1UU8A 4D4VA 4QMTA 3FQSA 3HYHA 3ZO2A 3ZC5A 4BI1A 1XH7A 2Z7SA 1G3NA 4C3PA 3SX9A 4EOPA 5KKRC 5KNJA 5IQAA 3A7GA 2OGVA 4QP7A 3ZM4A 3OW4A 3AMAA 4FF8A 4FKGA 1LP4A 3MVJA 2C47A 2F49A 4IMYA 3PWDA 3R7GA 1W84A 5EI6A 1CMKE 1E9HA 3UIBA 4Y5HA 4UXQA 4V0GB 4UB7A 3JUHA 2OG8A 3PXQA 5DR6A 5L8KA 4DT9A 2IZTA 2F7EE 3W2CA 3NFGB 2WKMA 2UVYA 3RMFA 3ZEWA 2GQSA 1Q61A 1IASA 3G2FA 4C34A 3MJ1A 2WQMA 4G17A 2ITVA 4L01A 3OCBA 4PV0A 2HENA 3IPHA 3LAUA 4C7TA 4HVHA 1PMUA 3ORTA 2VTLA 3Q9XA 4QYGA 3LMGA 3R63A 4O1OA 5FM3A 5I4NA 5KMOA 4NKAA 3OWKA 3HDMA 3K5UA 4YBJA 4EJ7A 1H0VA 4TT7A 4L3LA 1K9AA 1X8BA 4C61A 3F3UA 4G9CA 3DAKA 3QCSA 2WGJA 5BVEA 3VUMA 4A9UA 2QURA 3UNJA 2BKZA 3ZO1A 3UNZA 3TUCA 3FL5A 4FJVA 3ET7A 4I1ZA 4ANNA 4TWCA 3GC7A 4RA4A 4DFUA 1R78A 4HOKA 3PE1A 4LUEA 4Q9ZA 2XNMA 4FIIA 3F3VA 3FI8A 2VTMA 4CT2A 3G9NA 2PVMA 5AV4A 2WTKB 4A4LA 4BCKA 4G34A 4ZSAA 4FTMA 4G5PA 2YAAA 2ZJWA 4FICA 3PPKA 3NUNA 3UC3A 3PJCA 2WTWA 3VRZA 1GIJA 4B8LA 2FGIA 3PPZA 1UU9A 2XIRA 3CTQA 5J5TA 3PY3A 1YWVA 3EN4A 2XK7A 4E73A 4ZTSA 1JPAA 3BHTA 1REKA 2GHGA 3DAEA 3OXTA 4PTGA 2WNTA 2RL5A 1TQIA 3RPVA 5FP5A 4HW7A 4L7FA 4YJQA 5DT3A 4W8DA 3R9OA 4AQKA 4FIJA 4WNOA 3UOJA 4CKIA 3VUDA 4FIEA 1XBCA 2OU7A 3C4XA 4QYEA 4Z9LA 3NYOA 4QP9A 4KIQA 3BHUA 5HU3A 2UUEA 5EM6A 2ERZE 3BIZA 2XS0A 5K4JA 1W8CA 1V0BA 2X81A 3BEAA 3HRFA 4NK9A 3U55A 2C3KA 3ZSHA 4K6ZA 5HKMA 4EH8A 2J50A 2P0CA 4FV7A 3R8UA 4DYMA 3DQXA 5HNBA 2QOBA 1YQJA 4YZMA 4J95A 3GOPA 3N51A 4IAIA 3E3BX 1ZYCA 3F7WA 4M0YA 2C3JA 4W8EA 4S31A 1OL5A 1H07A 3BGQA 3E92A 4ITJA 2YM7A 3VJNA 5BUEA 3F9NA 3MN3A 5EOLA 2JD5A 2PVNA 2XIKA 3S1HA 4KUJA 1RE8A 1H8FA 4JVGA 3NWWA 4C4FA 1CKIA 1DI8A 3TMOA 4K0YA 2QOHA 5A4EA 3GB2A 2CKEA 2VTQA 4BHZA 4PPCA 4QQJA 1W7HA 2E2BA 1Y6AA 4IB3A 2KULA 3NLBA 3QX4A 5HD4A 3H3CA 1V0OA 3QC9A 3QTSA 3O51A 3FMLA 5FBNC 3VQUA 2PYWA 1WBSA 3VUTA 5K5NA 5DT4A 2OZAA 4X2NA 2XCHA 2X2KA 3RCDA 3WOWA 3ZOSA 3AXWA 3R7VA 2CGWA 1E1VA 4FZDB 4QP3A 2OXYA 4YR8A 4DF3A 1H24A 3UQGA 3PJ2A 5M4UA 4FSYA 4TYHB 3F88A 3PSDA 4YPSA 3VS1A 3DFCB 3IW4A 4YHJA 2WIPA 5EYMA 1H1PA 4AOJA 4E5WA 5CSPA 2QOCA 3QBNA 5J9ZA 3BZ3A 3MV5A 3M11A 5AADA 4ANMA 1OM1A 4F1MA 2QOKA 3AC2A 3ZH8A 4ZZNA 3BE2A 1PW2A 2IW9A 3BV3A 2XK6A 3PY1A 4FKTA 3D14A 3NW5A 3A7HA 5LVLA 3OWPA 5CF6A 5AM7A 3SW7A 3K3JA 4FZ6A 3KULB 2W1IA 3GEQA 4A06A 1PMVA 3ZC6A 4ZSJA 5GJGA 2PVKA 2GFSA 3I0QA 4Q5EA 4H3QA 4BKJA 4QQTA 3K54A 3PPJA 4D4SA 2XIZA 2QVSE 2UW5A 3C0GA 2YACA 4OAVB 5HE1A 5BYZA 2XNPA 3FLZA 3NUSA 4XEYA 5L8JA 1V1KA 2X0PA 3F6XA 4KSPA 4XUFA 5HQ0A 1H08A 3IKAA 3B8QA 4PF4A 1NY3A 3P7CA 4WBOA 5HTIA 2G15A 3EFWA 2ITPA 5E8YA 3ATTA 3UIMA 4YURA 2Y4IC 2WMAA 2WEIA 2V55A 4TTHB 4A9SA 2E9PA 4BYIA 3UYSA 3LFSA 3LKMA 3SC1A 1HCKA 3QA8A 4CYIA 5F4NA 3ZLYA 4XP0A 4MNEB 3POZA 4MVFA 4B6LA 2Y7JA 3U6IA 2BFYA 2W1FA 2R3PA 4RQKA 5EW8A 2VTNA 1H28A 1Q5KA 3ZHPC 1OIUA 3WZKA 4I93A 1WBPA 1KOAA 3R2YA 1U4DA 4GYIA 3JPVA 5F20A 4IIRA 1ZMUA 2PY3A 4WNMA 1JAMA 3KQ7A 1ERKA 2J0MB 4KAOA 4FTUA 3GQLA 3W18A 2X8IA 1GY3A 2EXMA 4GK2A 4K11A 3TUBA 4A07A 2QODA 4JQEA 4ZEGA 2VRXA 4D0XA 4CLIA 2WMXA 3IDBA 4GVJA 4L44A 3VBVA 2OXDA 4K33A 5HO8A 2C4GA 3AC5A 4NZWB 1VR2A 4BRXA 4QTEA 2PUUA 3UVQA 5HX8A 2H8HA 4II5A 4B0GA 3SKCA 2BFXA 5IA2A 4ZMEA 3CPBA 2WTJA 4UX9A 4RFMA 4QEBA 2ZMDA 3DBFA 4LM5A 4YLKA 3BLRA 4O0TA 5FLFA 4M13A 2JKOA 4RMZA 5KMNA 5D12A 2WIHA 4EOLA 4IZ5A 3VS5A 4PNIA 4I0TA 4I6QA