3F5PA

Complex structure of insulin-like growth factor receptor and 3-cyanoquinoline inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
307
structure length
299
Chain Sequence
SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIETDRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Insulin-like growth factor 1 receptor
publication title Lead identification to generate 3-cyanoquinoline inhibitors of insulin-like growth factor receptor (IGF-1R) for potential use in cancer treatment
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 299
sequence length 307
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, R, S, T
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3f5pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3f5pA01
2YIRA 3HNGA 1H1WA 4OBPA 2OZOA 4ALUA 2WEVA 5BYZA 4EOKA 1U5QA 3IW5A 4QMXA 3C0IA 5AP6A 1OL2A 3F2AA 3RM6A 3E64A 4I0RA 3FI4A 3IOPA 1Q41A 4X3FA 2PVHA 3OD6X 3UO4A 5HQ0A 4BZOA 2RSVA 3QD4A 1YHSA 3JVSA 3EKKA 3NAXA 4IFGA 5L8JA 5I0BA 4CTCA 2B9HA 4IWQA 4N6ZA 4A9UA 2V5QA 5BX0A 3GOPA 2IPXA 4FTTA 5LWMA 4JVGA 4ZTRA 3SD0A 1OBGA 4GIHA 4HYSA 4I4EA 5DHJA 3TDVA 4BICA 5FTGA 3A61A 3MPMA 3PZEA 3PVWA 4GK4A 4QP3A 5L6WL 2I1MA 3CQUA 4WKQA 3OXIA 4D2SA 4QD6A 4C34A 5K5NA 2W1IA 4G31A 2LGCA 4NEUA 5CI7A 4PMTA 2YDJA 3DZQA 5KCVA 3N9XA 3COIA 4F1MA 5HNIX 5JRQA 4OW8A 4R1YA 1OPJA 4FF8A 3AC5A 4GT5A 4AGCA 4CFUA 4W9XA 4FTIA 1YXTA 4M0ZA 5AUZA 3C4ZA 3F7ZA 4QP9A 4BIBA 2GHLA 2XRWA 4FTNA 3TTIA 4D9UA 3FZPA 3CEKA 4IVCA 3EL8A 4EK3A 4HYIA 4UY9A 4JAIA 3HGKA 3ZUUA 3R28A 4NW6A 5EW9A 2JBPA 4GV1A 1Q97A 4BKYA 4EJ7A 3BI6A 4MYGA 5LVLA 5CXHA 4FKOA 2YEXA 3HRBA 4R3CA 4TYGA 4KKEA 2XK4A 3RK9A 4C62A 4GKHA 1WBOA 1O6LA 4RIXA 3IW8A 2ZV2A 1YWNA 3NX8A 3TJCA 3R73A 2J90A 2IZTA 4TYHB 5DMZA 3G51A 4RT7A 4O0WA 4FGBA 2XCHA 5I5ZA 3HV7A 4MXOA 2QG7A 2VTSA 1WBWA 4B99A 4WIHA 4XV1A 2YDIA 4UMTA 3H0ZA 3KVXA 3ORZA 4MXXA 2EB2A 2Q0NA 3FYJX 2GHMA 2BIKB 3BV2A 3COMA 3L1SA 5CVFA 5L8KA 3QA8A 3QTIA 3FXXA 4B8MA 3UMWA 2XUUA 3DBQA 4QMWA 4TYIA 2OFUA 3EN5A 3EOCA 4FG9A 3VQHA 2J0IA 3KK8A 3IGGA 3KF7A 4EQCA 5KBRA 1H0WA 2UUEA 3NIEA 4IX5A 4I3ZA 4BDCA 2PYWA 2QODA 4X3FC 5CAPA 3LAUA 2PVRA 2QOBA 5E7RA 3N4VA 5A46A 4EK8A 3G0EA 4IWPA 4GU9A 3U9CA 3QXOA 1U5RA 2C30A 4D2PA 2YCFA 4IB0A 3RAWA 4DN5A 4F7LA 3BELA 2OH0E 5F95A 3BHYA 4L3JA 5DGZA 4EH5A 1B6CB 2CKEA 2RF9A 1KE6A 3OVVA 5I4NA 5A14A 4UZDA 3QCXA 3R7EA 3CBLA 3BLRA 2PVNA 4RIWA 5EFQA 1W84A 1ZYLA 4IE9A 2C3JA 5EQYA 3TKHA 3LW0A 3HDNA 3BQRA 2YHVA 2CCHA 3OOMA 4L7SA 4F0FA 2ZM4A 1CDKA 4FTKA 4UEUA 4F0IA 2YWPA 2X7FA 5EKNA 1QCFA 4FKVA 4F99A 5KMIA 3FLZA 3BKBA 4JBOA 2F7ZE 3HV5A 4BCJA 3MB6A 3F5PA 4J95A 3MB7A 3REPA 2VNYA 3GENA 3S4QA 3DXNA 4NK9A 2IO6A 1JKLA 1KWPA 1LEWA 1SZMA 3DA6A 3K3JA 4XEYA 3UG1A 4BDIA 1GNGA 3DOGA 3KRLA 3UZRA 4OTGA 4WNOA 3HMIA 3VHEA 4LUDA 4FNWA 4AE9A 2OO8X 4AXAA 4M7IA 5FWKK 5HEZA 3C1XA 3UP7A 3VC4A 1OMWA 4L8MA 3ZSIA 3SXRA 4BCOA 4CFNA 3WILA 2W4OA 4IVBA 4R8QA 3EH9A 4GJ2A 2JDSA 4HGLA 4E4LA 1ZMUA 3PXKA 4YZNA 4RVMA 3R1NA 4TT7A 3ORNA 5KMJA 4XP3A 4AZSA 2I7QA 1FMKA 5GZ9A 1M2RA 4EBWA 3UBDA 1ERKA 4RFYA 4MKCA 5BUEA 5GINE 1NXKA 2BRMA 2AC3A 1YI3A 2P33A 2Y4IB 3CJGA 4AT3A 4O2ZA 3NYVA 2GS6A 4KINA 2BZIB 4AZEA 4C4HA 2QLUA 3PDTA 5BPYA 4F09A 1BL7A 4EH9A 4CLIA 2W4KA 1MQ4A 3A7FA 3NW5A 5IQEA 4TY1A 2XCKA 3EYGA 3FQEA 3BE2A 3P86A 3EQIA 2GNJA 3BE9A 2HELA 4CYIA 4FKTA 3QU0A 4WHZA 3QLGA 3WOWA 2YDKA 3LFCA 4ZSGA 5IQBA 1R78A 2X2MA 4QPSA 2B0QA 2WGJA 4UMRA 4U8ZA 5IUHA 1J91A 1V0OA 4UXLA 2QU6A 1B38A 4FSMA 1KE8A 1R0EA 2B55A 3FMDA 5LXMA 1O9UA 3Q52A 2H9VA 5JSMA 3UNKA 4OUCA 3VBYA 4BGGA 2F2CB 4Y46A 3NEWA 4I6HA 4I94A 4OT5A 1B39A 3C4FA 3SOCA 1LUFA 2YABA 1YI4A 2V7OA 1M7QA 3ATTA 5JN2A 3NCZA 4DCAA 5E8SA 3BIZA 4M14A 2IZUA 4XRLA 3DBDA 4QTBA 4QMZA 4DCEA 4IXPA 5IA0A 3VNTA 3DDQA 5LJJA 3LMHA 3QKMA 4BDHA 3W10A 4AE6A 5E91A 2ZDTA 4RJ4A 3OS3A 3EQPA 1JNKA 1JSTA 2VWIA 3LFEA 4MNEA 4FEUA 2HXQA 3OWLA 4A7CA 4ZZNA 2VTAA 1HOWA 3DV3A 1IASA 3LQ8A 3MVLA 3H3CA 3PPZA 4FVPA 2LAVA 2I0VA 1Q4LA 3R9NA 4WNKA 2YCRA 4KIKB 3UNJA 2BDFA 4P5QA 3KREA 3OY1A 3FKOA 1V0BA 3RNIA 4YURA 3EFWA 4AW0A 1YQJA 5JZJA 2W1DA 3U4WA 4U0IA 1LP4A 5EHOA 3ZFMA 3C5IA 2GS7A 2UZLA 5B2KA 5JZNA 4YHTA 4U42A 4KB8A 3B8QA 5HG8A 4ASEA 3E88A 3GBZA 3HP2A 4QQ5A 5E1SA 2XRUA 2FSOX 3F66A 2X2LA 3ZLYA 5LVOA 3PA5A 4DH7A 2BTRA 3AD4A 1KE5A 4PMSA 1XH4A 1R1WA 2ITPA 2XNMA 3HMMA 5DA3A 4DEHA 3F88A 2GSFA 4C4FA 3BHHA 3TCPA 4D9TA 3HUCA 1W7HA 3AC8A 4Y5HA 4CCUA 2EWAA 3IDCA 4JG7A 4CKIA 1IEPA 3I81A 4O38A 4FIEA 5GNKA 4C57A 4WNMA 4BF2A 1U46A 4O0RA 3LM5A 3UO6A 3O17A 5CZHA 3R1QA 4HYHA 3VUHA 5CF6A 3QF9A 5DR6A 3B8RA 3G0FA 3E3PA 2QLQA 3ZONA 1UVRA 2HW6A 4F63A 4NU1A 4AU8A 5IG1A 1UKIA 1PF8A 2C5OA 5HZNA 2WIPA 2YIWA 4PP7A 3U6IA 1FQ1B 4C4EA 3UG2A 4DGMA 3GC9A 1PXLA 4KSQA 2W9FB 2ITVA 3F3WA 4MX9A 3TV6A 5BUJA 1PMEA 2AUHA 3RZBA 5BMMA 5KHXA 4DGLC 3UOLA 2YM8A 3PY3A 4RA4A 2VTIA 4QMTA 3F5UA 3NS9A 4FSTA 4G6NA 4ZZMA 3ZFYA 4HPUE 1H25A 4YZCA 3FLNC 4AW5A 3CTQA 1YOLA 5IH4A 2VTMA 3SVVA 3SV0A 4FEVA 3P1AA 4J52A 2FGIA 2YAKA 3DQXA 2OJIA 5HD7A 2WMVA 3R83A 1OIRA 5IEYA 4X2FA 3PLAE 4FKWA 3KMMA 3WI6A 1XQZA 2CGUA 4BYIA 2UW7A 2JKQA 3DJ5A 3MVMA 3H9OA 3K5VA 3ZM4A 5L6OA 2WQOA 3NSZA 2QOFA 2FB8A 2BTSA 4NCTC 4YUQA 2PUIA 3UYTA 4G3EA 4W4YA 5FDXA 4J1RA 4EZ5A 2XK6A 4AW1A 2HCKA 2W9ZB 3AT2A 3OTVA 2Y6MA 1XBAA 1GIHA 3LJ0A 4UN0C 3NVMB 3ZHPC 4QP7A 5HNGA 4AGUA 4PL3A 2GQSA 2RFDA 5CWZA 5DNRA 5A4EA 5KUPA 4V0GB 1KV2A 4YC3A 3FDNA 2YM4A 4APCA 5KKRC 4F9WA 4Y73A 1JPAA 1GIIA 4DAWA 1OKWA 4ZSEA 3GU7A 2EUFB 3PVBA 2JKOA 3TIYA 4EK4A 2VWZA 2WTCA 5IEVA 3G15A 2JDVA 4AOJA 4ZY5A 1YW2A 2C5YA 3DGKA 1Q8UA 3KXHA 3H30A 3F6XA 2W1GA 1YHWA 3UC4A 4N70A 4IB1A 3WIGA 4EYJA 4HVDA 3E8NA 5CEKA 4ANQA 1JLUE 3QZHA 4DBNA 4YR8A 3Q04A 4G6LA 1TQIA 3LIJA 4ZS4A 4TPTA 3DCVA 5DRBA 2CGXA 4HGSA 1OITA 3PJ2A 4GFOA 1ZAOA 4XG6A 3MH1A 5J9LA 4FSZA 3RP9A 5JEBA 3FSKA 5J7HA 4R5SA 1ATPE 4TWPA 3PSCA 2JLDA 2W99B 3KC3A 1IG1A 4LI5A 3TV4A 5CSVA 1Y8YA 3IG7A 5HCXA 2ITUA 2PULA 1PYXA 3PYYA 2XIXA 3DKGA 4RWJA 4XV3A 4H05A 3CJFA 1Z9XA 3MTFA 5TF9A 4ZY4A 4HVIA 3DBEA 3QD2B 1CMKE 4G3GA 4GSBA 4FSNA 2J0LA 4ACHA 3TKIA 5L2IA 2J5EA 2O65A 3DAJA 2XEZA 4BTJA 3FC1X 2B53A 3P7BA 4QYFA 5F4NA 4HVGA 3RPYA 3QRKA 4IWOA 3RAIA 2YN8A 3EQHA 4NM3A 4PV0A 3Q6UA 4D5HA 3R01A 1KE7A 4EOIA 4YBJA 2EXMA 4Q2AA 3LFBA 4FKJA 5HVJA 2OLCA 2X8EA 2XK3A 3BGPA 4QMYA 4DH8A 4WD5A 5AUXA 5HU3A 2PUNA 4IDTA 1X8BA 3BGQA 5ETCA 4C3RA 3FZOA 5HO7A 4PTEA 3Q53A 5T6KA 4B7TA 5E1EA 3VO3A 2YZLA 4EKKA 5A6OA 3RCJA 3JUHA 3BPRA 3OCGA 4W8DA 4BVUA 3KMUA 4J99A 4U45A 3U51A 3W2OA 3ZBXA 4AFJA 4AZWA 1IAJA 4O82A 2R3LA 1CKPA 3L8VA 2R3PA 5AAEA 3OT3A 2VTRA 3WBLA 5EYKA 3COKA 3PY0A 3NNVA 5A9UA 4FI1A 1U4DA 3TZMA 5AV2A 5IU2A 2E9UA 2XJ1A 1JSUA 2JITA 4NM0A 3RPSA 3QQGA 3U9NA 5AX9A 4UMPA 2ETKA 2OZAA 4MCVA 5CEMA 1REJA 3FPQA 5AWMA 1OL7A 2VD5A 2W17A 4ZJIA 3ZSGA 4XMOA 2FH9A 1BI8A 3GU5A 3BV3A 1XH5A 3R7YA 3VVHA 2VTOA 4XG7A 4UX9A 2C6OA 3BHTA 3FY0A 4ZY6A 4ASDA 5BYLA 4FIIA 2OJFE 2VU3A 4GFGA 3E7OA 2YCQA 1UV5A 3KN6A 2Y8OA 2R7BA 3OWPA 2A4LA 2GNLA 2YACA 3MPTA 4EYMA 4MBLA 1BLXA 2GMXA 4F4PA 3GCPA 2W4JA 3F9NA 4BWPA 1O6KA 1URWA 3FLSA 4NJDA 4BKZA 5C8NA 4P2KA 1XBCA 3HZTA 2A1AB 2BRGA 3D15A 1UKHA 5CTPA 5IISA 1ZWSA 4JLCA 3CR0A 1H24A 3QC9A 2BDWA 4XG9A 5HO6A 4O7VA 2R4BA 3OEZA 4OTQA 3ZLWA 3EFKA 5G1XA 2YM5A 3Q5IA 3WF9A 2BFYA 4PTCA 2VTNA 4PUZA 4RIYA 1RW8A 5EQPA 3D2KA 4MBJA 3L9PA 2W06A 4BTMA 5C4KA 3VS2A 3OCBA 3IW7A 4NFNA 4YJTA 4FT3A 2PMNX 3QQFA 5HLWA 4YJRA 2R3OA 4Z55A 1FGKA 5AM6A 1FMOE 4O0TA 2XKFA 5AP1A 3E3BX 1J7UA 2XBJA 2XNBA 3PPKA 3PP1A 2XIZA 2VAGA 3PG3A 4EOQA 3MGYA 1ZY4A 5HE3A 2XNOA 2XIRA 3D7TA 4RVLA 4Z7GA 1F5QA 2REIA 1RJBA 4CEGA 4Y72A 4O27B 4GH2A 4W9WA 5AIRA 5J5SA 3O71A 1MUOA 2ITZA 2XF0A 3DDPA 3FMKA 3U6HA 2IG7A 3SG8A 3KB7A 5FG8A 4L43A 4D2TA 3CLYA 3MA3A 4G17A 5CZIA 4A9SA 5LVMA 3UC3A 2B7AA 3F3UA 2P2IA 4F70A 5CEQA 2GNGA 3LJ1A 4CG8A 3K2LA 4OTFA 5HNBA 4GG5A 3R71A 4ZOGA 5GIPE 2OXYA 5M07A 2PZYA 3SX9A 3RHKA 3GEQA 4ZTMA 1PXNA 4TWOA 4C38A 4TW9A 4IM3A 4MD9E 3LOKA 1DAYA 3S95A 2F9GA 3UTOA 2Q83A 4J8NA 4S30A 4ANOA 4R78A 1MRYA 4IH8A 2C5NA 3D14A 3PRFA 4WRSA 4I5CA 4FL3A 4ITJA 5E8VA 4PQNA 4C3FA 1GOLA 4CT2A 2E2BA 4C36A 5ITAA 2UVXA 3SRVB 3C50A 4M67A 4D4VA 1R0PA 1QPCA 3ERKA 3FBVA 4ITIA 2R3MA 3TV7A 2J6MA 1VEBA 3R30A 4XBUA 3QUDA 1JQHA 4QMOA 3UVPA 1OUYA 4BWKA 4E5BA 2VRXA 4UYNA 2HWOA 3KULB 5KX8A 3RK7A 3V01A 1WCCA 5CAUA 5AP7A 3VJNA 2BMCA 1A48A 3FMLA 2YWVA 3MW1A 4U3YA 2VO3A 5LWNA 3PLSA 2EB3A 4RIWB 3ZS5A 3QALE 4L44A 3V5WA 4KIOA 4OTWA 4CMUA 4II5A 2V0DA 4ENYA 4F64A 5IF1A 2OF4A 4FA2A 5D12A 4M97A 4OLIA 4QMSA 3C7QA 3ZRMA 4QMMA 5HTCA 3A4OX 4YNOA 3E93A 3RAKA 4RBLA 1W98A 4U3ZA 4RVTA 3W16A 3JXWA 4EHEA 4EZ3A 5HTIA 4CZYB 5ICPA 4YZBA 3A7IA 3QTQA 1NT2A 4XV2A 5LCJA 3TDWA 4JDHA 4JDJA 4RWIA 4DFLA 2QR7A 3OCSA 5BVWA 1M17A 3TZ8A 5KMMA 1Z5MA 3ROCA 4AFEA 2GQRA 3SW4A 4K33A 2WOUA 2WPAA 4Q9SA 4H3PA 1ZZ2A 4RC2A 1WBVA 2R7IA 4XJ0A 3R8UA 1G3NA 3II5A 1T45A 4FUYA 2CKQA 3GU6A 5F20A 3SAYA 3HEGA 4ARKA 5JK3A 1Q99A 3VN9A 4FKIA 1VR2A 3A7JA 4EQMA 4Z9LA 1W0XC 1ZYSA 4LOOA 4EOLA 4V04A 3TNHA 1MP8A 2R64A 3NUUA 3RPRA 3ANQA 4JX7A 1PYEA 3H10A 4QPAA 4QP8A 5J8IA 5DIAA 4DG3E 4DITA 5F1ZA 5E4HA 1J3HA 2WMSA 3IS5A 3QBNA 2WMWA 4O0XA 4I93A 3FXWA 3Q9ZA 4RPVA 4G6OA 4QMLA 3W2CA 4XS2A 5DT0A 3MWUA 4AGWA 2J5FA 2JDTA 4EC8A 3LHJA 4FKPA 3FAAA 3W2RA 4O6EA 5KZIA 2R3IA 4QMUA 5KMLA 4M84A 5M44A 3GCUA 3UODA 3V5TA 3KXXA 4ACMA 1P4OA 4C59A 5IQHA 5D11A 1PXMA 3LXLA 1BL6A 3OW3A 2PZIA 3UDBA 4DH5A 4EEVA 4P5ZA 2WXVA 3MSSA 3MA6A 5JKGA 3CC6A 3S00A 3G6HA 4EBVA 5CF5A 3FKNA 4K9YA 5I3RA 3HMPA 2XK9A 2O63A 4HCTA 5EM8A 3F3VA 3M1SA 3AGMA 3GB2A 3DU8A 2BHEA 2VNWA 2YZAA 4FSRA 4FEWA 3WF7A 1SNUA 4O7ZA 3RKBA 4R7IA 2WTDA 3I5ZA 3QUEA 2C6IA 4LGDA 5LCKA 5K4JA 2WMBA 2FSTX 2QVSE 1OBDA 4AAAA 3DBCA 4FTUA 1ZYDA 2C5XA 3MFRA 2R3RA 3I6UA 4TYEA 4HOKA 4FK6A 3QD3A 2PPQA 4BZDA 3CE3A 2WU7A 2J9MA 2DWBA 3L8SA 4FTRA 2BROA 4QTDA 4RWLA 5CI6A 3WYYA 4A9YA 4CFXA 1Q3DA 3EWHA 4IFCA 5EKOA 4E26A 3T8OA 3H9RA 2YLFA 4YTHA 3IW4A 3QFVA 5T68A 4GJ3A 4M69B 3SA0A 2RKUA 3CPBA 2WQBA 1CSNA 2CN5A 3FZTA 4L3PA 4ALWA 3R63A 3KVWA 4IAKA 3IOKA 4JAJA 4A9RA 2GQGA 2XKDA 1H08A 4K11A 3R7OA 4DTKA 4HVSA 2Q0BA 1AGWA 2VX0A 3MS9A 1CM8A 4FV3A 2X9EA 4GK2A 2R0UA 4MXAA 4YP8A 5M53A 3KQ7A 5AUTA 1GZKA 2VWUA 1YXSA 2IVVA 3QRIA 1FOTA 5FQDC 5HOAA 4E1ZA 5CAOA 3E87A 3RI1A 1YWVA 1TQPA 2QO9A 3PJ8A 5FP5A 4DHFA 3QL8A 3DXPA 2JFLA 1P4FA 4FKRA 2E9VA 4DA5A 2ZM3A 4BY9E 2HZ4A 5AM7A 2C5VA 4DGGA 4TYJA 4AOTA 4E4NA 3KFAA 3TJDA 2VX1A 3POZA 3QHRA 1WBPA 3QGWA 4RC3A 2ETRA 5HCYA 5HO8A 2DUVA 2XZSA 3PIYA 2HY81 3PXFA 4FZDB 2JIIA 5AUVA 3PWYA 5G6VA 4K0YA 3V8SA 3B2TA 3W8QA 1PXJA 3BYMA 3AD5A 2UZEA 4KKGA 1ZMWA 3TNWA 3HRCA 4EI4A 3Q2JA 3HV6A 4XUFA 5CX9A 3V5LA 2C6DA 5AUYA 5M09A 3FKLA 2B54A 4O91A 3JR1A 4FV0A 5HLPA 3TXOA 3W2QA 5GZAA 2NO3A 3T3VA 3D9VA 3EFLA 3GC0A 4IWDA 4CGAA 3DAKA 5AAFA 5TOZA 1H4LA 2Y7JA 5FM2A 2GNIA 2ZMCA 4L67A 3R9HA 3LJ2A 2SRCA 4DEDA 5CT0A 1V1KA 2WMXA 3ZLXA 4JBQA 1ZOGA 2CLQA 3BWFA 4Z3VA 3KXNA 3QTZA 3FYKX 5GIOE 4YJQA 5FM3A 1JVPP 2JIVA 3CGFA 5ANJA 4L9IA 5BMSA 3LCDA 4F7NA 1XHAA 1J1BA 1NA7A 3V3VA 4I21A 4FSWA 2QKRA 2JKKA 2UW3A 3DFAA 3KRRA 4YU2A 1H07A 4TNDA 2RG5A 4YSJA 4G34A 3MFTA 5LARA 5L8LA 2X4FA 4AW2A 3C5UA 4MF1A 4EJNA 5FUTA 3M11A 5AAGA 5FBOA 4DE4A 4ALVA 1M7NA 2WTJA 4G3DA 3LQ5A 4DEEA 4DFUA 2R5TA 2UZOA 3Q4CA 1FGIA 5IH5A 3OW4A 3O2MA 3Q3BA 2XP2A 2XKEA 2XK7A 3BU3A 3DK6A 3PZHA 4IBMA 2VGOA 3UVRA 4JRNA 3FZSA 2XVDA 4YTFA 5IMEA 5AX3A 4PPCA 5LVPA 4NIFB 3HAMA 4ANBA 4QT1A 3NYXA 5ACBC 3DK7A 4NKSA 2IN6A 1NVSA 5C01A 4F1TA 4ZJVA 1K9AA 4FT5A 5J9ZA 4EOSA 2ZDUA 5LMKC 4BI0A 5GJFA 5IUIA 1YOJA 4IB3A 4QQCA 4GYIA 1BI7A 3BYSA 3F82A 5CY3A 2J4ZA 4HGTA 4RQKA 3OT8A 1GAGA 3UO5A 4IC8A 2QOLA 5HIDA 4CQEA 2B9IA 2UW4A 5B0XA 3D7ZA 4G9CA 1M2QA 1XR1A 1NY3A 3DKFA 4EH4A 4PX6A 1W83A 3C51A 2G15A 3I79A 4JRVA 5ANGA 3LCKA 3MH2A 5HHWA 4D2WA 4FK3A 4O21A 3BRBA 3WF8A 2JIUA 3PWDA 4I20A 1ZYJA 1JSVA 3LMIA 4B9DA 4PDYA 3W1FA 2UV2A 1UU8A 3JY0A 4IW0A 3G5DA 3RTPA 3WE8A 4BI2A 1KOAA 3A8XA 1SVEA 5E8WA 4MXYA 4CCBA 5HVYA 4GW8A 2C6MA 1S9IA 3OY3A 1I44A 2C69A 4L68A 4WBBB 3U87A 3TUCA 3R2BA 5M4CA 4RJ5A 4NM5A 2FA2A 4BDFA 4JIKA 1M52A 5EI2A 4BTFA 2R3FA 3AMYA 3Q4UA 3LFQA 1OI9A 3R02A 4BGQA 2W5HA 5CSPA 4PF4A 2XIKA 3L8PA 2JGZA 4WA9A 4BFMA 4ANMA 3CD3A 3OC1A 2BFXA 3GCVA 3W32A 3FLQA 2ONLA 4KSPA 1DI8A 2GFCA 3QC4A 5CNOA 4YMJA 4U79A 5L2WA 1UWJA 4O0VA 2OGVA 4IC7A 3UIMA 4GU6A 5DI1A 2VWBA 4BGHA 2X2KA 2B52A 3K3IA 3PXRA 5HIEA 5CAQA 2O3PA 1IA8A 3CD8A 2I0YA 4BDEA 3RZFA 5B7VA 1I09A 2PZRA 4O2PA 3DJ7A 2X8DA 4M8TA 3ODYX 2VTLA 5ETFA 2W5AA 1RQQA 3ZO4A 4NFMA 3FUPA 4NCTA 3C4WA 4U41A 4YNEA 2CHLA 5K3YA 3BYOA 2XYUA 4S32A 4R6VA 3MH0A 3B2WA 2IVUA 4S31A 4Z16A 3ZOSA 1FVVA 4F6UA 3R0TA 3PE1A 4YLLA 4KRCA 3EFJA 4IHPA 3IW6A 4O0YA 3TN8A 3KN5A 4E8AA 5IA4A 3NNWA 1OL6A 4U7ZA 2WD1A 5ANEA 2VWXA 2VO6A 4EC9A 3GU8A 3EB0A 3VAPA 2ZVAA 3ORIA 2WTKC 3T3UA 2E9OA 2VO7A 1WZYA 5K4IA 4DYMA 2B9FA 2UZBA 3I7CA 5CU6A 2BIYA 4RX8A 4FV5A 2OXDA 4DFBA 3ORPA 4BCMA 3EQBA 3GXLA 5D7VA 1YXVA 2Z02A 5CSHA 4FBXA 3HKOA 3E63A 2BR1A 4RC4A 4G5PA 1CKJA 2X8IA 2O5KA 4USDA 5C8KA 4HPTE 3UOJA 2HY0A 3LVPA 3VRZA 1Q8ZA 5DYJA 4E4MA 4C2VA 2XEYA 4F65A 1WBTA 3HRFA 4RVKA 2VTHA 4RMZA 3QXPA 4U6RA 4FTMA 5JFVA 1R39A 4I4FA 4L45A 3R8PA 4IZ7A 2BZHB 2X7OA 3QCYA 3E7VA 4GK3A 2BZJA 3K5UA 4F6SA 3GC8A 5FXSA 3SXSA 4TWNA 4WO5A 2QR8A 4A4OA 1GIJA 1VYZA 3TT0A 4IAZA 1KE9A 2H6DA 4XV9A 1YKRA 3PTGA 4K77A 4LUEA 4TYHA 3HAVA 5M4IA 3PXYA 4UYAA 1F3MC 2PE0A 4PP9A 3TUBA 1OVEA 4NH1A 2ZV9A 2OF2A 2ONLC 5AP5A 1BUHA 2WOTA 3KCKA 2C68A 4DFZE 3VQUA 4AWIA 2CN8A 4TNBA 4I6QA 2ZYBA 4YLJA 2QOCA 4CRSA 3BYVA 4O7RA 3LPBA 4O83A 3NCGA 3NDMA 5DR9A 3NUYA 5DWRA 2YA9A 3PFQA 3F2RA 4RG0A 4KNBA 5FRIA 1JWHA 2C47A 2C6KA 4NT4A 5E8TA 5DPVA 4E93A 1PHKA 3PP0A 3ZO1A 2ZB1A 3GI3A 2XNEA 3C4XA 3BEGA 4FC0A 3CPCA 4IACA 4NWMA 4NM7A 4BCNA 3N4TA 1EH4A 2Y0AA 4KIPA 3ZZWA 5IZFA 2UZUE 3AQVA 4RFMA 4ACCA 2P0CA 4CV8A 2NRUA 2RG6A 4IX3A 3GQIA 2IJMA 3NAYA 4YJNA 3AD6A 3VUGA 3CTHA 4FVQA 3UPZA 4I5PA 5CLPA 4ZSLA 3BGZA 1R3CA 1URCA 3DLZA 1BMKA 5AR4A 4LGGA 4JOAA 5HX8A 4AZFA 3PSBA 4H58A 5KO1A 1JKTA 3U55A 3HVCA 4Q5HA 3QWKA 5DOSA 5HBEA 4AQCA 4CNHA 3RMFA 2F7EE 3OHTA 4A4LA 4U80A 3I1AA 2QURA 4F6WA 4YSMA 4ASZA 4BDDA 5IQCA 1J1CA 4UV0A 5HVKA 3QX2A 5EM5A 2ACXA 2QHMA 3FE3A 4N57A 1E1VA 4IAIA 4KIQA 4MF0A 3W55A 2JD5A 4OAUC 2IVTA 4NSTA 5M55A 3ZC6A 5FEEA 4BCFA 3ZMMA 4AX8A 3ULZA 2VWVA 3KEXA 4LFIA 4JI9A 2CNUA 2PVKA 3ZXZA 4DEGA 3ALOA 1Y91A 1UWHA 5EDPA 1OB3A 4GVJA 4LOPA 2QO2A 2I0HA 2ITWA 5ANKA 4JQ7A 3RM7A 1T46A 1YWRA 4RIOA 3JVRA 4LMNA 2C3LA 3BQCA 2HZNA 1VZOA 3T9TA 3L9MA 3NW7A 3R00A 4XYFA 2CKOA 3TG1A 4L3LA 2BRHA 3IKAA 4IAFA 4KKHA 4UWCA 4JXFA 2G01A 4FTAA 4I41A 4K8AA 1XH8A 2PTKA 2ZM1A 3D4QA 1G8AA 2R3KA 2BUJA 4Y95A 4YO4A 3UQFA 2I0EA 5JGBA 3ZO2A 4YTCA 4OGRA 2OFVA 1ZOEA 4D1SA 3JPVA 2RFNA 2OH4A 3NNUA 4MK0A 4R7HA 3M42A 2A0CX 5AEPA 3R21A 2R9SA 5AV3A 5L2SA 2IW6A 5KE0A 2ESMA 2Z2WA 3R1SA 3R6XA 2GNHA 4MNFA 2ITYA 4D2VA 4QO9A 4CG9A 4JS8A 3Q4TA 3R8MA 3GNIB 1W82A 4DFYA 5EI6A 5BVDA 4BCKA 3DB6A 1UNHA 4H39A 5A4QA 2OICA 1XH9A 1PJKA 2P2HA 3BWJA 3C0GA 3FMEA 3ODZX 2OKRA 4GMYA 2IZRA 4MWHA 2WZJA 3V5JA 5CU2A 1CKIA 2RGPA 3TNPC 4USEA 5T3QA 3NZ0A 3Q6WA 1HCKA 2OU7A 4I22A 4UXQA 4FKLA 5AP2A 1OKZA 4TWCA 4FKSA 3LCSA 4CZUA 5ANDA 1SVGA 4S34A 5EM6A 4DT8A 2C0TA 3AT4A 2VWYA 3DXQA 4JBVA 3WZUA 2Y6OA 4IJ9A 5EYDA 3HA6A 3QCSA 5CF8A 2V22A 4F7SA 5LMAA 4RGJA 3WZEA 2UVZA 4U81A 4C35A 5FXQA 2ZMDA 3FEGA 5DH3A 3FXZA 3CTJA 1E9HA 2ERKA 4GT4A 3UZPA 4FIFA 4X2NA 3KRWA 3GOKA 4FG7A 4C4GA 3KGAA 4CZTA 5J79A 2YCSA 4KBAA 2E9NA 3KKVA 4N6YA 4AA4A 2R3QA 2H8HA 5CU4A 5A3XA 3AC3A 3W33A 1H27A 4ZTHA 4DEIA 1U54A 3S1HA 3F3ZA 2RL5A 4AUAA 3KCFA 3P5KA 2F49A 3PIZA 1RE8A 5C8MA 4EWHA 3O0GA 4O7YA 5C03A 3V8TA 2C3KA 4CKJA 4F0GA 4XCUA 5LOHA 3OROA 5HE0A 2X39A 2XBAA 2NPQA 3D5VA 3AXWA 4GL9A 4C02A 4R77A 2AC5A 3IDPA 4YHJA 4ZP5A 5A6NA 2ZJWA 4X3FB 3L9LA 2YERA 1WBNA 5AADA 5D9HA 3R04A 3BZ3A 3PE2A 4PL4A 1DI9A 3R8LA 4DTAA 1QPJA 4ZXTA 2I6LA 3IQ7A 5IA2A 4EWQA 1OPLA 4J71A 2V7AA 2WAJA 3ZRKA 2R3JA 2Y4IC 4LM5A 5CQWA 2JAVA 4LOQA 3VS1A 2UW6A 3NWWA 3TACA 2ZV7A 2H34A 3FI3A 3MIYA 4X2GA 4DF3A 3QX4A 4J53A 3BBTB 2QKWB 4X3JA 1YOMA 4EUTA 4I0SA 3PG1A 4GT3A 3C13A 5FTOA 3DTCA 1ZXEA 3JY9A 3D2IA 3FZRA 4ONAA 5JMSA 2J0KA 3MI9A 4XP2A 2WMRA 3CKXA 3VBWA 3PSDA 3EN4A 3EN6A 3ZUTA 2WKMA 3C9WA 4EKLA 3OWKA 2ITQA 3NUXA 4QP2A 4E6AA 4C3PA 5DEYA 3LM0A 3VWAA 3LE6A 2BALA 3HDMA 5K5XA 4QOXA 4O22A 2IW8A 4DEBA 4U5JA 3LXKA 4BCQA 3F7WA 3UNZA 1OIUA 4EOOA 3OBJA 3HUBA 3LFAA 3BU6A 3P7CA 5JQ5A 4F9AA 1DAWA 3R9OA 1SMHA 1XJDA 4RX5A 4O7TA 5CVHA 3R9RA 4YJVA 5J95A 2VTPA 5KZ0A 3EQGA 2O0UA 4FT0A 2XYNA 4RJ8A 1PW2A 2W05A 4JIAA 3ULIA 4I5HA 3Q9WA 4IIRA 4I5MA 4M0YA 2JAMA 4RIXB 3FHRA 4CSVA 5J9YA 4NYEA 4N4SA 3PIXA 2XMYA 4GUEA 5EW3A 4FKQA 2VN9A 1KUTA 3CCNA 4FTOA 4IQ6A 2BPMA 2C0OA 3ORLA 4LRMA 5D1JA 4BBMA 3SLSA 2C6LA 3POOA 2F2UA 3KXGA 4W8EA 4D1ZA 1H00A 5EDQA 3UZTA 3H0YA 3R2YA 5HLNA 1STCE 3HLLA 3MFUA 5EYMA 3V8WA 4IM0A 4C61A 2QCSA 5IA5A 2Z7QA 1MRUA 5FEQA 1A9UA 1Q8WA 3WZKA 4FV8A 1SYKA 4WBOA 2OXXA 3ANRA 5CENA 3VF9A 4B0GA 3ELJA 4FT9A 4IB5A 4KS7A 4FTJA 4CLJA 5IKWA 4FEXA 1AD5A 4R1VA 4ID7A 2XNNA 3UJGA 3PVGA 2CGWA 3SC1A 4ORKA 5BVOA 5ETIA 4OTRA 4RJ7A 4V0GA 5A4LA 4H1JA 1V0PA 3P08A 1Y6BA 3E8EA 5E8XA 4CFMA 3ZXTA 5ANIA 3ORMA 4Y83A 5AFVA 4DGNA 5I9WA 2PWLA 2NP8A 5ETAA 4FL2A 4UWBA 3D0EA 4BDAA 4C33A 1J7LA 2VGPA 4FZ7A 4XBRA 3H9FA 4U97A 5M4FA 2DS1A 2C6TA 3ZBFA 4DLIA 5HG9A 3O23A 1UU3A 2JC6A 3DPKA 4PPAA 5LVNA 3PXQA 1REKA 5EQEA 4MD8E 3IECA 4O0SA 3KL8A 4EOMA 1JOWB 1Y8GA 2Z7SA 3W8LA 3DY7A 2WU6A 5DRDA 5JGAA 2PZ5A 2PK9A 4QYYA 5E8ZA 5TE0A 3CQEA 5I9XA 3N4UA 2W1EA 1KSWA 4Y8DA 3ZCLA 3CKWA 4ZIMA 4NUSA 3NGAA 3SW7A 2EVAA 5BVEA 2C1BA 2WMQA 4PRJA 4GKIA 5L2QA 3Q4ZA 4PDOA 4D4RA 3EN9A 3NIZA 3F69A 5HG5A 1YRPA 4DFXE 4QPMA 1H01A 5C9CA 4CQGA 4FUXA 2IW9A 5AP4A 3G6GA 3RJCA 4FGRA 3FC2A 3HL7A 5J87A 4BDJA 4PTGA 3BEAA 5JT2A 4MD7E 3DTWA 3E92A 2WQNA 2XM8A 2Z8CA 2HZ0A 3LFSA 4DC2A 4ANLA 4HNFA 3ENHA 1BKXA 4D0XA 5L2TA 5DT4A 3SDJA 5DN3A 2XK8A 4KWPA 4RQVA 1KOBA 4X21A 4X6QC 4OR5A 1M2PA 5IQAA 2GTMA 4BHNA 3FL4A 2UZDA 4PY1A 3HYHA 2HWPA 2A2AA 4LMUA 5I9ZA 1PXPA 2PUUA 4M12A 5FGKA 3FPMA 3WIKA 3QQLA 4QTEA 4BR3A 3O50A 3DNDA 2W96B 4ZMFA 5AR2A 4CXAA 4ZMEA 3FLYA 3G2FA 5I9UA 1GZ8A 3QQUA 4LRKA 3CSVA 3R1YA 2EU9A 4G3CA 5IMXA 2UZNA 3OF0A 5EYCA 3F2NA 2RFEA 5BUIA 3NLBA 5HTBA 5L6PA 3JYAA 3UP2A 3TNIA 3UQCA 4O0UA 3SG9A 3TI1A 3HMNA 4UZHA 4WG5A 5JQ8A 5AP3A 2OI4X 2FVDA 4EH8A 3MY5A 2PMIA 3VS3A 4HZRA 2R3GA 4TKSA 3OUKA 1Q62A 2P4IA 3OP5A 4D1XA 1OUKA 2QD9A 5L3AA 3DBFA 3ZTXA 3ZZEA 2FYSA 4MQ1A 4B6LA 4CYJA 2YM3A 2PU8A 5J1WA 3ZC5A 2PHKA 3DJ6A 1JKSA 3OXZA 4J96A 2XJ2A 5CYIA 5AA8A 3N51A 4EK5A 3FL5A 1BX6A 4FKUA 1XO2B 3AC2A 2QOQA 5GJGA 3LQ3A 4EHZA 4XG2A 4G9RA 4YZ9A 4FV9A 5EHYA 4M3QA 3E62A 1XWSA 4BYJA 4IX4A 2QOHA 4IVDA 2XIYA 3CXWA 1PY5A 2A27A 4QP4A 2W1FA 2HW7A 4JNWA 4MNEB 5TT7A 2XM9A 2X0GA 4L53A 3CIKA 3G33A 3QTXA 3QAME 4BDBA 1YXXA 4XG4A 4FYNA 3P4KA 5CT7A 4MQ2A 3AC4A 3VIDA 3A99A 3G90X 4L52A 5AR3A 2VZ6A 3SXFA 3UE4A 2ITTA 3KXMA 4CRLA 3DK3A 4FEQA 3MFSA 4U9AA 2R3HA 4C7TA 5F9EA 5KKRB 4CTBA 3UQGA 4CKRA 1J7IA 3QZGA 1OECA 1KV1A 4MH7A 4S2ZA 4FSQA 5LMKA 4QYHA 2XNGA 4QTAA 3HX4A 1P14A 5HGIA 3AT3A 3W2SA 4RSSA 3FMNA 5H9BA 3HA8A 5AR7A 3DB8A 3G9LX 5H8GA 3LFFA 5JFXA 4C2WA 3EYHA 3LKMA 1GJOA 2O2UA 3IPHA 3NR9A 3LFDA 4HZSA 3W2PA 4EOJA 4EZ7A 3LCTA 4HVHA 3R22A 4QMNA 5JRSA 3U54A 3HV4A 5EOLA 5K0KA 4JX3A 3ZRLA 3UGCA 2RFSA 4GVAA 5AMNA 2CSNA 2X1NA 3O96A 3D5XA 2P3GX 3EQDA 4K2RA 4Q5EA 3VS6A 5EH0A 3WZJA 3QTUA 4BBEA 2OIBA 4BCPA 4YJSA 3Q32A 4AS0A 5TKDA 4L7FA 4YPDA 4RA5A 4TRLA 3KA0A 3IONA 4KS8A 4X7QA 3QCQA 1SVHA 2YJSA 3A7HA 3AMBA 4RX9A 5B2MA 1OGUA 3PPJA 3Q9XA 1H28A 4GYGA 4JJRA 4PDSA 4P90A 5DE2A 4EK6A 4ANSA 4MAOA 3TZ7A 3VUIA 3VS5A 4AF3A 5IH6A 2R3NA 4FR4A 1NVQA 2XH5A 1UU9A 2JDOA 4J8MA 3MPAA 3RWPA 2KULA 3F5GA 2W7XA 3C4CA 3DKOA 4W4WA 2YIYA 2GDOA 3VW6A 1NVRA 1Q5KA 2XKCA 3TM0A 3ZM9A 3DLSA 3I5NA 3MYGA 1ZZLA 4MBIA 4WUAA 3U6JA 3SRVA 4DFNA 3QRUA 1L8TA 4O84A 5EM7A 2BRNA 2C1AA 1O6YA 3IGOA 3RPVA 3A8WA 4YBKA 5AA9A 3P78A 2BKKA 2UZTA 2J50A 5IQGA 5AJQA 3TIZA 5A4CA 4YGAA 5CNNA 4FV4A 3ZDUA 3GC7A 3KULA 1SNXA 2OWBA 3O8TA 4YC8A 4D4YA 3C0HA 3VHKA 3FMJA 3QGYA 4GG7A 4X6RA 5B2LA 1ZOHA 3VS4A 5KMOA 4A07A 2IVSA 4QNYA 4V05A 2OG8A 1IA9A 3NMUF 3TZ9A 3MIAA 3DAEA 3IK3A 2HIWA 4QQTA 2H96A 4HCUA 4XP0A 5M51A 1S9JA 3GFEA 2Z7LA 4I23A 4UMQA 3MY1A 4F08A 3BHVA 5JGDA 5FTQA 3TKUA 1YHVA 4I0TA 4IEBA 2V55A 4FNYA 4MEDA 1OZ1A 5AV1A 3OBGA 4EH2A 5CVGA 5K0XA 4X2KA 4XRJA 5CU0A 4UMUA 3MN3A 3EMGA 2HAKA 3OG7A 3ET7A 3VUTA 3VBXA 4D55A 3AGLA 3ZH8A 5CU3A 4UB7A 4UBAA 2XS0A 4PMPA 4HCVA 2G2IA 3RINA 4HNIA 5CAVA 3TUDA 1NW1A 4K6ZA 4QMQA 1K3AA 3PVUA 4AGDA 2CJMA 4KBCA 2J7TA 3THBA 4FNZA 4YJPA 1DS5A 1UU7A 4X2JA 5M06A 4FTQA 5HESA 4IDVA 3CS9A 1FVTA 4FIGA 4YLKA 2BDJA 5C26A 3F61A 2WTWA 3DT1A 2JDRA 3DQWA 2F57A 2ITNA 1ZY5A 4KUJA 4BBFA 2VWWA 4IM2A 5DLSA 2BAJA 1WVWA 4BWXA 5CF4A 4FV2A 2QONA 4H1MA 2PL0A 4GCJA 4L00A 4FG8A 1FVRA 3I0QA 4QP6A 3F5XA 1P2AA 3R7GA 3D94A 2CNVA 1WMKA 1WVYA 1LPUA 3FSFA 4M66A 2W0JA 2PVLA 2WMAA 5A4TA 2AYPA 5LQFA 4Y5QA 4R7BA 4YO6A 5ANOA 3AMAA 3C4EA 4MTAA 3K54A 4A06A 3BLHA 2PY3A 3EKNA 3KRJA 4ZLYA 1OL1A 3QYWA 4JT3A 5BVFA 4I24A 3FHIA 4AZTA 4DINA 3MESA 3QRJA 2PMLX 3MVJA 5HD4A 3MDYA 1ZYCA 3LZBA 2UZWE 4AN9A 4BIDA 4XOZA 2R2PA 3NPCA 1YXUA 4K18A 2PVFA 3ZUVA 4IAAA 5JFSA 5EG3A 2YISA 3ROYA 3ZEWA 2CNQA 1Z57A 2UW8A 2ZV8A 1G8SA 3KU2A 4AP7A 3QWJA 4LQMA 2B4SB 2CDZA 4S33A 2G9XA 2PE2A 4O6LA 4PNKA 3IO7A 4XG8A 4EH6A 4Z7HA 4ERKA 2ZOQA 1IAHA 4RJ3A 1L3RE 4TZRA 3WARA 3PA3A 1QPDA 2ITXA 5EOBA 2OZAB 2XNPA 1OM1A 4MXZA 4WOVA 3OTUA 1W8CA 3Q60A 3GQLA 4FOBA 4M69A 2WQMA 3HP5A 5CSXA 3VULA 1FBNA 3NYOA 2WELA 4ZAUA 3E8CA 5JH6A 2V62A 3KXZA 4D58A 4QYEA 1U54B 3AG9A 3V6SA 3A60A 3VBQA 3UOKA 1BYGA 3EIDA 2X4ZA 4U43A 3MJ2A 3ORXA 4JL9A 4M13A 3U4UA 4CFWA 3A7GA 4DG0E 4E6QA 2PUPA 4NKAA 3MV5A 2WMTA 4PDPA 3DNEA 5H8EA 3I0OA 3E5AA 4BCGA 5L4QA 2PE1A 4FYOA 1TKIA 1PXIA 2OJJA 1ZLTA 4OTPA 3R8ZA 4KA3A 1VYWA 5CALA 2UW5A 4YC6A 2F4JA 2WIHA 3DKCA 5KBQA 4C58A 1VJYA 4EHGA 5DT3A 1PKGA 2IWIA 4G5JA 4AA5A 1QL6A 3EL7A 3LCOA 3E8DA 4I6BA 4L46A 5DVRA 4AT5A 4QRCA 5DEWA 1PXKA 2E9PA 4L42A 2NNWB 4F9BA 1PRYA 4G2FA 1YDRE 4RIYB 2OIDA 5A54A 5DBXA 3UPXA 3BYUA 5K9IA 5BVNA 2WMUA 3VUDA 4EH7A 2WFYA 2HOGA 4FIHA 3MTLA 3EN7A 3OXTA 4DT9A 4U40A 4XLIA 4FE2A 4USFA 1H1RA 4ZTLA 3QYZA 4ACDA 3KF4A 2O64A 3TEIA 4OT6A 4W4VA 4O1OA 1P5EA 2WEIA 1WAKA 4NW5A 3RPOA 4AACA 4ANNA 2WB8A 4QMVA 2J2IB 3V04A 2Z60A 4BKJA 4CD0A 4CT1A 4PPBA 5HX6A 3D7TB 4KD1A 4IVAA 2YFXA 4ACGA 4FTLA 5J5TA 2G2FA 4FZAB 1UNGA 3QZIA 4FZ6A 2GCDA 3P7AA 4WSYA 5HI2A 5BVKA 3UOHA 3FLWA 3NW6A 4N0SA 3QKKA 4WUNA 2WTVA 4ZLZA 4FV6A 5AP0A 3QHWA 4QNAA 3COHA 5HG7A 5HE2A 3SOAA 2Y9QA 3D83A 4FIJA 4FL1A 5HIBA 2OIQA 2X6EA 1JBPE 4KAOA 4WSQA 3LXNA 2W1HA 4FV7A 3DZOA 4YZDA 3EQFA 3BBWA 4FOCA 4JDKA 3Q9YA 4XG3A 5C1QB 1YI6A 5D10A 2BCJA 2EXCX 3V5PA 4FNXA 2QHNA 2DQ7X 1GZNA 4WG4A 1AQ1A 1QPEA 5DFPA 3UYSA 4HYUA 1QMZA 3O7LD 4I6FA 4NZWB 2ZAZA 3CQWA 2FSMX 5EW8A 4DEAA 4B8LA 1IRKA 2JFMA 2UVYA 4U44A 1PXOA 1PMVA 4FSUA 1IR3A 2BILB 5GHVA 1OKVA 4EORA 2FUMA 2OK1A 4EHVA 4DBXA 2UW0A 4KABA 5LMBA 1PMUA 5FBNC 4OBOA 4XOYA 4XX9A 3OEFX 2G1TA 3NRMA 3QTWA 3RGFA 3ZFXA 4WG3A 4E4XA 3ENMA 3R7UA 3VBTA 2VTTA 3ORKA 4EQUA 2UW9A 5CQUA 2C4GA 4OAVB 4NIFA 5AR5A 2Y4PA 2DYLA 1Y6AA 1JKKA 3JS2A 4R5YA 3ETAA 4PNIA 2HENA 2WO6A 2W5BA 3OUNB 4ENXA 2BVAA 3L9NA 4LYNA 5CXZA 2OSCA 5M08A 2CCIA 4C37A 2BRBA 2QOIA 1APME 5M56A 1OKYA 4G1WA 4TXCA 3Q2MA 4RLLA 3U8WA 2B1PA 5I3OA 5H8BA 4UWYA 3VS0A 4E6DA 3P79A 2PVMA 2QG5A 1PMNA 2ZB0A 4JG6A 5IUGA 3EJ1A 4O7NA 4DH1A 3VF8A 4AN3A 3S3IA 5IPJA 3R9DA 3SGCA 4XLVA 3FI2A 2X9FA 4LL5A 1RDQE 5KNJA 3ZEPA 3TNQB 1M14A 2CLXA 3GGFA 3BLQA 3CY3A 3O8PA 4WRGA 2BAQA 5HU9A 2QO7A 2X7GA 5M4UA 4RWKA 3I6WA 3NYNA 3PJ3A 4K1BA 3WF6A 3O7LB 4KRDA 2W1CA 3UIBA 5BYYA 4DH3A 3QQJA 4E5WA 3S2PA 3ZDIA 2Z7RA 4IZ5A 4ASXA 1YDTE 4IZAA 3FJQE 5FDPA 2YM6A 5AIKA 1OL5A 5EHLA 4RX7A 5GJDA 2BZKB 4R3PA 4ZTNA 3RCDA 5IDPA 4JQ8A 3VUMA 3D5UA 1ND4A 3FMMA 2VUWA 5FEDA 4ZTSA 4IAYA 2GFSA 3EZRA 1CTPE 1Q61A 4GFMA 2GPHA 3ZSHA 1TQMA 4DLJA 4CVAA 1PKDA 5DG5A 4AOIA 4PL5A 5HBHA 4D0WA 4BL1A 2ITOA 2GU8A 4WT6A 5FLFA 4BN1A 3WYXA 2BAKA 2A19B 2YAAA 2IZSA 4QYGA 2GS2A 4LGHA 3ID6C 2C0IA 2KTYA 4XHKB 4O7LA 4GEOA 1ZRZA 4FVRA 3R8VA 3V51A 5IEXA 3OFMA 5E90A 2YLEA 4CFFA 3CY2A 3UMXA 3SHEA 3MH3A 5FXRA 2C6EA 4PWNA 3HV3A 3BCEA 4H3QA 4R3RA 1XH7A 3FQHA 3PA4A 4OBQA 4FX3A 4J7BA 3FMHA 3ITZA 4BCHA 5H3QA 3L8XA 2OBJA 2HK5A 3RK5A 5CEOA 1OIQA 3QQKA 5CEPA 3ZU7A 3RBWA 1Q8YA 4ZS0A 4APPA 3WE4A 4TTHB 5FD2A 1GZOA 1GY3A 2G2HA 1Q8TA 4OTHA 4L01A 4DG2E 3FQSA 1H8FA 3PY1A 4JR3A 4MHAA 1U59A 4JG8A 3PXZA 4KIKA 3D5WA 3WF5A 2J51A 2WTIA 4D2RA 5IQIA 4E7WA 3VW8A 3BX5A 3WZDA 4AZVA 2OJGA 1FINA 2PVYA 5H2UA 3T9IA 3MBLA 4E6CA 5BQ0A 2PMOX 2GHGA 4C8BA 4FTCA 4WNPA 5J1VA 4IANA 3KMWA 1WBSA 4QMPA 4E20A 3QZFA 2PVJA 4AG8A 2P55A 2JBOA 1ZARA 3EZVA 4F7JA 1G5SA 2OW3A 2QOOA 3RVGA 4XNEA 4F9CA 3ZYAA 4CMOA 1YDSE 4MXCA 3R7VA 4O7WA 4GS6A 5TO8A 3I60A 3CP9A 3FV8A 2WQEA 2CGVA 2QNJA 1H26A 3LXPA 3NNXA 3GU4A 3UVQA 5E9EA 5KMKA 5EDRA 1UNLA 2FO0A 5J7BA 1WVXA 2YM7A 4MWIA 5E8YA 2BKZA 2I40A 3LFNA 4YJOA 2YITA 4E73A 5AUWA 4BRXA 3P0MA 2HXLA 3EQCA 5DR2A 4FV1A 4QQJA 3FZ1A 4LG4A 3Q96A 4BC6A 4BHZA 1SM2A 2CMWA 2ERZE 5ACKA 1A06A 2ETMA 4NTTA 5IA3A 4PMMA 4TL0A 1Q24A 3EQRA 1WFCA 4FICA 4EONA 3OWJA 2CPKE 3GCQA 3VRYA 3R7IA 3F3TA 2VV9A 5JFWA 4G16A 3HMOA 4O1PA 4EUUA 3GCSA 4G3FA 3RAHA 5IA1A 3A2CA 4NL0A 4ZSJA 2B9JA 4ZK5A 1Q3WA 4IADA 3ACJA 5HCZA 2BHHA 5IQFA 3DFCB 1UA2A 4JR7A 4BB4A 5HE1A 3KK9A 5M57A 1XBBA 4D28A 3MVHA 4A4XA 3GT8A 3P23A 4GIIA 2VTQA 2YJRA 3FWQA 5CSWA 5AV0A 4RZWA 3NVKI 3O51A 4CFVA 4P4CA 3QRTA 3MY0A 4FKGA 5EI8A 4FMQA 4DGOA 3VBVA 2X81A 4YJUA 3RALA 3W18A 2GNFA 3LLTA 1H0VA 3UIUA 3NUAA 1HCLA 5KHWA 1FPUA 4NJ3A 2RIOA 1LEZA 4EH3A 1K2PA 3OZ6A 1JAMA 2X6DA 3AC1A 3RWQA 3CGOA 2WNTA 3SKCA 4FSYA 4ZLOA 3NUSA 3P9JA 1H1SA 3V5QA 5CASA 3KY2A 4JQEA 5HBJA 4IX6A 5AUUA 2VTJA 2YIQA 3H4JA 3QA0A 5AV4A 4GUBA 3ZLSA 3PJCA 5E8UA 4H3BA 4AT4A 4A9TA 3DS6A 4TN6A 4ERWA 5F94A 4EOPA 4C4IA 3QTSA 4LV5A 3A4PA 2J0MB 4AA0A 2WHBA 4HW7A 4I1ZA 3ALNA 4Y85A 2HYYA 3G9NA 4IZYA 4MVFA 4V01A 4YTIA 3QTRA 4UALA 3ATSA 4FZFB 4BDKA 4CMTA 5BNJA 5I9VA 4LRJA 3M2WA 1OPKA 5D41A 1MQBA 2R0IA 5KMNA 3KRXA 4ZTQA 2XA4A 5C27A 2EXEA 3I7BA 4P7EA 2YIXA 5HORA 3TL8A 4RZVA 1OIYA 2HZIA 1H1QA 5HICA 4OTIA 2JKMA 4O86A 3BHUA 3I4BA 3NUPA 3QQHA 3OMVA 1Y57A 4BI1A 3UIXA 1DM2A 3PJ1A 4RJ6A 5CANA 2W1ZA 1ZMVA 4QTCA 4XH6A 1MRVA 4F9YA 3QKLA 4BTKA 4OTDA 3PUPA 4ZSAA 5IQDA 2OJ9A 1LR4A 2VO0A 3GVUA 2WTKB 4M15A 4BCIA 4D5KA 3S0OA 5TR6A 4NTSA 3GFWA 1YVJA 4D4SA 1E1XA 3ORTA 3QLFA 4RFZA 4B4LA 4ZEGA 4KBKA 4C0TA 2JEDA 4RRVA 4E5AX 3AOXA 4QP1A 3EHAA 3A62A 3GUBA 4I92A 4JDIA 3LMGA 3MJ1A 4IJPA 1TVOA 5EK7A 2FSLX 4AN2A 4LL0A 2QI8A 3RHXA 3VJOA 4BIEA 4L6QA 4W4XA 2XJ0A 3FY2A 4J98A 2NRYA 5CS6A 5I9YA 3OOGA 1F0QA 4E3CA 4Q9ZA 5CEIA 2PSQA 3Q5ZA 4FODA 2PZPA 4LV8A 4ZZOA 4DTBA 2QQ7A 4O81A 2F7XE 3VUKA 3BU5A 1XH6A 4FT7A 3V6RA 2GTNA 3ZO3A 4HJOA 4O96A 2O8YA 2UZVA 2CKPA 4YHFA 3LLAA 4EL9A 3FI8A 3HECA 4C4JA 4CV9A 5AR8A 2QU5A 3VS7A 3O8UA 3IDBA 3TWJA 4O7SA 4H36A 3QD0A 4ZJJA 5IDNA 3ACKA 1XKKA 5HKMA 5FP6A 5E92A 4HGEA 4YZMA 4F1OA 3GP0A 3OCTA 4YPSA 4RLKA 2C3IB 3PRIA 2XB7A 5D7AA 4BDGA 5C4LA 4GRBA 3NUNA 2QOKA 4ITHA 4JBPA 3SQQA 4J97A 3TTJA 2QC6A 4BZNA 2VX3A 4IMYA 3RNYA 1H1PA 5GZ8A 2J0JA 3QUPA 4M68A 4X0MA
chains in the Genus database with same CATH superfamily
2YIRA 3HNGA 1H1WA 4OBPA 2OZOA 4ALUA 2WEVA 5BYZA 4EOKA 1U5QA 3IW5A 4QMXA 3C0IA 5AP6A 1TFFA 1OL2A 3F2AA 3RM6A 3E64A 4I0RA 3FI4A 3IOPA 1Q41A 4X3FA 2PVHA 3OD6X 3UO4A 5HQ0A 4BZOA 2RSVA 3QD4A 1YHSA 3JVSA 3EKKA 3NAXA 4IFGA 5L8JA 5I0BA 4CTCA 2B9HA 4IWQA 4N6ZA 4A9UA 2V5QA 5BX0A 3GOPA 2IPXA 4FTTA 5LWMA 4JVGA 4ZTRA 3SD0A 1OBGA 4GIHA 4HYSA 4I4EA 5DHJA 3TDVA 4BICA 5FTGA 3A61A 3MPMA 3PZEA 3PVWA 4GK4A 4QP3A 5L6WL 2I1MA 3CQUA 4WKQA 3OXIA 4D2SA 4QD6A 4C34A 5K5NA 2W1IA 4G31A 2LGCA 4NEUA 5CI7A 4PMTA 2YDJA 3DZQA 5KCVA 3N9XA 3COIA 4DHZA 4F1MA 5HNIX 5JRQA 4OW8A 4R1YA 1OPJA 4FF8A 3AC5A 1XMLA 4GT5A 4AGCA 4CFUA 4W9XA 4FTIA 1YXTA 4M0ZA 5AUZA 3C4ZA 3F7ZA 4QP9A 4BIBA 2GHLA 2XRWA 4FTNA 3TTIA 4D9UA 3FZPA 3CEKA 4IVCA 3EL8A 4EK3A 4HYIA 4UY9A 4JAIA 3HGKA 3ZUUA 3R28A 4NW6A 5EW9A 2JBPA 4GV1A 1Q97A 4BKYA 4EJ7A 3BI6A 4MYGA 5LVLA 5CXHA 4FKOA 2YEXA 3HRBA 4R3CA 4TYGA 4KKEA 2XK4A 3RK9A 4C62A 4GKHA 1WBOA 1O6LA 4RIXA 3IW8A 2ZV2A 1YWNA 3NX8A 4I6LA 3TJCA 3R73A 2J90A 2IZTA 4TYHB 5DMZA 3G51A 4RT7A 4O0WA 4FGBA 2XCHA 5I5ZA 3HV7A 4MXOA 2QG7A 2VTSA 4QDEA 1WBWA 4B99A 4WIHA 4XV1A 2YDIA 4UMTA 3H0ZA 3KVXA 3ORZA 4MXXA 2EB2A 2Q0NA 3FYJX 2GHMA 2BIKB 3BV2A 3COMA 3L1SA 5CVFA 5L8KA 3QA8A 3QTIA 3FXXA 4B8MA 3UMWA 2XUUA 3DBQA 4QMWA 4TYIA 2OFUA 3EN5A 3EOCA 4FG9A 3VQHA 2J0IA 3KK8A 3IGGA 3KF7A 4EQCA 5KBRA 1H0WA 2UUEA 4O4DA 3NIEA 4IX5A 4I3ZA 4BDCA 2PYWA 2QODA 4X3FC 5CAPA 3LAUA 2PVRA 2QOBA 5E7RA 3N4VA 5A46A 4EK8A 3G0EA 4IWPA 4GU9A 3U9CA 3QXOA 1U5RA 2C30A 4D2PA 2YCFA 4IB0A 3RAWA 4DN5A 4F7LA 3BELA 2OH0E 5F95A 3BHYA 4L3JA 5DGZA 4EH5A 1B6CB 2CKEA 2RF9A 1KE6A 3OVVA 5I4NA 5A14A 4UZDA 3QCXA 3R7EA 3CBLA 3BLRA 2PVNA 4RIWA 5EFQA 1W84A 1ZYLA 4IE9A 2C3JA 5EQYA 3TKHA 3LW0A 3HDNA 3BQRA 2YHVA 2CCHA 3OOMA 4L7SA 4F0FA 3W0MA 2ZM4A 1CDKA 4FTKA 4UEUA 4F0IA 2YWPA 2X7FA 5EKNA 1QCFA 4FKVA 4F99A 5KMIA 3FLZA 3BKBA 4JBOA 2F7ZE 3HV5A 4BCJA 3MB6A 3F5PA 4J95A 3MB7A 3REPA 2VNYA 3GENA 3S4QA 3DXNA 4NK9A 2IO6A 1JKLA 1KWPA 1LEWA 1SZMA 3DA6A 3K3JA 4XEYA 3UG1A 4BDIA 1GNGA 3DOGA 3KRLA 3UZRA 4OTGA 4WNOA 3HMIA 3VHEA 4LUDA 4FNWA 4AE9A 2OO8X 4AXAA 4M7IA 5FWKK 5HEZA 3C1XA 3UP7A 3VC4A 1OMWA 4L8MA 3ZSIA 3SXRA 4BCOA 4CFNA 3WILA 2W4OA 4IVBA 4R8QA 3EH9A 4GJ2A 2JDSA 4HGLA 4E4LA 1ZMUA 3PXKA 4YZNA 4RVMA 3R1NA 4TT7A 3ORNA 5KMJA 4XP3A 4AZSA 2I7QA 1FMKA 5GZ9A 1M2RA 4EBWA 3UBDA 1ERKA 4RFYA 4MKCA 5BUEA 5GINE 1NXKA 2BRMA 2AC3A 1YI3A 2P33A 2Y4IB 3CJGA 4AT3A 4O2ZA 3NYVA 2GS6A 4KINA 2BZIB 4AZEA 4C4HA 2QLUA 3PDTA 5BPYA 4F09A 1BL7A 4EH9A 4CLIA 2W4KA 1MQ4A 3A7FA 3NW5A 5IQEA 4TY1A 2XCKA 3EYGA 3FQEA 3BE2A 3P86A 3EQIA 2GNJA 3BE9A 2HELA 4CYIA 4FKTA 3QU0A 4WHZA 3QLGA 3WOWA 2YDKA 3LFCA 4ZSGA 5IQBA 1R78A 2X2MA 4QPSA 2B0QA 2WGJA 4UMRA 4U8ZA 5IUHA 1J91A 1V0OA 4UXLA 2QU6A 1B38A 4FSMA 1KE8A 1R0EA 2B55A 3FMDA 5LXMA 1O9UA 3Q52A 3UDZA 2H9VA 5JSMA 3UNKA 4OUCA 3VBYA 4BGGA 2F2CB 4Y46A 3NEWA 4I6HA 4I94A 4OT5A 1B39A 3C4FA 3SOCA 1LUFA 2YABA 1YI4A 2V7OA 1M7QA 3ATTA 5JN2A 3NCZA 4DCAA 5E8SA 3BIZA 4M14A 2IZUA 4XRLA 3DBDA 4QTBA 4QMZA 4DCEA 4IXPA 5IA0A 3VNTA 3DDQA 5LJJA 3LMHA 3QKMA 4BDHA 3W10A 4AE6A 5E91A 2ZDTA 4RJ4A 3OS3A 3EQPA 1ST4A 1JNKA 1JSTA 2VWIA 3LFEA 4MNEA 4FEUA 2HXQA 3OWLA 4A7CA 4ZZNA 2VTAA 1HOWA 3DV3A 1IASA 3LQ8A 3MVLA 3H3CA 3PPZA 4FVPA 2LAVA 2I0VA 1Q4LA 3R9NA 4WNKA 2YCRA 4KIKB 3UNJA 2BDFA 4P5QA 3KREA 3OY1A 3FKOA 1V0BA 3RNIA 4YURA 3EFWA 4AW0A 1YQJA 5JZJA 2W1DA 3U4WA 4U0IA 1LP4A 5EHOA 3ZFMA 3C5IA 2GS7A 2UZLA 5B2KA 5JZNA 4YHTA 4U42A 4KB8A 3B8QA 5HG8A 4ASEA 3E88A 3GBZA 3HP2A 4QQ5A 5E1SA 2XRUA 2FSOX 3F66A 2X2LA 3ZLYA 5LVOA 3PA5A 4DH7A 2BTRA 3AD4A 1KE5A 4PMSA 1XH4A 1R1WA 2ITPA 2XNMA 3HMMA 5DA3A 4DEHA 3F88A 2GSFA 4C4FA 3BHHA 3TCPA 4D9TA 3HUCA 1W7HA 3AC8A 4Y5HA 4CCUA 2EWAA 3IDCA 4JG7A 4CKIA 1IEPA 3I81A 4O38A 4FIEA 5GNKA 4C57A 4WNMA 4BF2A 1U46A 4O0RA 3LM5A 3UO6A 3O17A 5CZHA 3R1QA 4HYHA 3VUHA 5CF6A 3QF9A 5DR6A 3B8RA 3G0FA 3E3PA 2QLQA 3ZONA 1UVRA 2HW6A 4F63A 4NU1A 4AU8A 5IG1A 1UKIA 1PF8A 2C5OA 5HZNA 1W2CA 2WIPA 2YIWA 4PP7A 3U6IA 1FQ1B 4C4EA 3UG2A 4DGMA 3GC9A 1PXLA 4KSQA 2W9FB 2ITVA 3F3WA 4MX9A 3TV6A 5BUJA 1PMEA 2AUHA 3RZBA 5BMMA 5KHXA 4DGLC 3UOLA 2YM8A 3PY3A 4RA4A 2VTIA 4QMTA 3F5UA 3NS9A 4FSTA 4G6NA 4ZZMA 3ZFYA 4HPUE 1H25A 4YZCA 3FLNC 4AW5A 3CTQA 1YOLA 5IH4A 2VTMA 3SVVA 3SV0A 4FEVA 3P1AA 4J52A 2FGIA 2YAKA 3DQXA 2OJIA 5HD7A 2WMVA 3R83A 1OIRA 5IEYA 4X2FA 3PLAE 4FKWA 3KMMA 3WI6A 1XQZA 2CGUA 4BYIA 2UW7A 2JKQA 3DJ5A 3MVMA 3H9OA 3K5VA 3ZM4A 5L6OA 2WQOA 3TYKA 3NSZA 2QOFA 2FB8A 2BTSA 4NCTC 4YUQA 2PUIA 3UYTA 4G3EA 4W4YA 5FDXA 2X0PA 4J1RA 4EZ5A 2XK6A 4AW1A 2HCKA 2W9ZB 3AT2A 4FRFA 3OTVA 2Y6MA 1XBAA 1GIHA 3LJ0A 4UN0C 3NVMB 3ZHPC 4QP7A 5HNGA 4AGUA 4PL3A 2GQSA 2RFDA 5CWZA 5DNRA 5A4EA 5KUPA 4V0GB 1KV2A 4YC3A 3FDNA 2YM4A 4APCA 5KKRC 4F9WA 4Y73A 1JPAA 1GIIA 4DAWA 1OKWA 4ZSEA 3GU7A 2EUFB 3PVBA 2JKOA 3TIYA 4EK4A 2VWZA 2WTCA 5IEVA 3G15A 2JDVA 4AOJA 4ZY5A 1YW2A 2C5YA 3DGKA 1Q8UA 3KXHA 3H30A 3F6XA 2W1GA 1YHWA 3UC4A 4N70A 4IB1A 3WIGA 4EYJA 4HVDA 3E8NA 5CEKA 4ANQA 1JLUE 3QZHA 4DBNA 4YR8A 3Q04A 4G6LA 1TQIA 3LIJA 4ZS4A 4TPTA 3DCVA 5DRBA 2CGXA 4HGSA 1OITA 3PJ2A 4GFOA 1ZAOA 4XG6A 3MH1A 5J9LA 4FSZA 3RP9A 5JEBA 3FSKA 5J7HA 4R5SA 1ATPE 4TWPA 3PSCA 2JLDA 2W99B 3KC3A 1IG1A 4LI5A 3TV4A 5CSVA 1Y8YA 3IG7A 5HCXA 2ITUA 2PULA 1PYXA 3PYYA 2XIXA 3DKGA 4RWJA 4XV3A 4H05A 3CJFA 1Z9XA 3MTFA 5TF9A 4ZY4A 4HVIA 3DBEA 3QD2B 1CMKE 4G3GA 4GSBA 4FSNA 2J0LA 4ACHA 3TKIA 5L2IA 2J5EA 2O65A 3DAJA 2XEZA 4BTJA 3FC1X 2B53A 3P7BA 4QYFA 5F4NA 4HVGA 3RPYA 3QRKA 4IWOA 3RAIA 2YN8A 3EQHA 4NM3A 4PV0A 3Q6UA 4D5HA 3R01A 1KE7A 4EOIA 4YBJA 2EXMA 4Q2AA 3LFBA 4FKJA 5HVJA 2OLCA 2X8EA 2XK3A 3BGPA 4QMYA 4DH8A 4WD5A 5AUXA 5HU3A 2PUNA 4IDTA 1X8BA 3BGQA 5ETCA 4C3RA 3FZOA 5HO7A 4PTEA 3Q53A 5T6KA 4B7TA 5E1EA 3VO3A 2YZLA 4EKKA 5A6OA 3RCJA 3JUHA 3BPRA 3OCGA 4W8DA 4BVUA 3KMUA 4J99A 4U45A 3U51A 3W2OA 3ZBXA 4AFJA 4AZWA 1IAJA 4O82A 2R3LA 1CKPA 3L8VA 2R3PA 5AAEA 3OT3A 2VTRA 3WBLA 5EYKA 3COKA 3PY0A 3NNVA 5A9UA 4FI1A 1U4DA 3TZMA 5AV2A 5IU2A 2E9UA 2XJ1A 1JSUA 2JITA 4NM0A 3RPSA 3QQGA 3U9NA 5AX9A 4UMPA 2ETKA 2OZAA 4MCVA 5CEMA 3BL7A 1REJA 3FPQA 5AWMA 1OL7A 2VD5A 2W17A 4ZJIA 3ZSGA 4XMOA 2FH9A 1BI8A 3GU5A 3BV3A 1XH5A 3R7YA 3VVHA 2VTOA 4XG7A 4UX9A 2C6OA 3BHTA 3FY0A 4ZY6A 4ASDA 5BYLA 4FIIA 2OJFE 2VU3A 4GFGA 3E7OA 2YCQA 1UV5A 3KN6A 2XAOA 2Y8OA 2R7BA 3OWPA 2A4LA 2GNLA 2YACA 3MPTA 4EYMA 4MBLA 4AXEA 1BLXA 2GMXA 4F4PA 3GCPA 2W4JA 3F9NA 4BWPA 1O6KA 1URWA 3FLSA 4NJDA 4BKZA 5C8NA 4P2KA 1G8JA 1XBCA 3HZTA 2A1AB 2BRGA 3D15A 1UKHA 5CTPA 5IISA 1ZWSA 4JLCA 3CR0A 1H24A 3QC9A 2BDWA 4XG9A 5HO6A 4O7VA 2R4BA 3OEZA 4OTQA 3ZLWA 3EFKA 5G1XA 2YM5A 3Q5IA 3WF9A 2BFYA 3O5AA 4PTCA 2VTNA 4PUZA 4RIYA 1RW8A 5EQPA 3D2KA 4MBJA 3L9PA 2W06A 4BTMA 5C4KA 3VS2A 3OCBA 3IW7A 4NFNA 4YJTA 4FT3A 2PMNX 3QQFA 5HLWA 4YJRA 2R3OA 4Z55A 1FGKA 5AM6A 1FMOE 4O0TA 2XKFA 3NFGB 5AP1A 3E3BX 1J7UA 2XBJA 2XNBA 3PPKA 3PP1A 4AXCA 2XIZA 2VAGA 3PG3A 4EOQA 3MGYA 1ZY4A 5HE3A 2XNOA 2XIRA 3D7TA 4RVLA 4Z7GA 1F5QA 2REIA 1RJBA 4CEGA 4Y72A 4O27B 4GH2A 4W9WA 5AIRA 5J5SA 3O71A 1MUOA 2ITZA 2XF0A 3DDPA 3FMKA 3U6HA 2IG7A 3SG8A 3KB7A 5FG8A 4L43A 4D2TA 3CLYA 3MA3A 4G17A 5CZIA 4A9SA 5LVMA 3UC3A 2B7AA 3F3UA 2P2IA 4F70A 5CEQA 2GNGA 3LJ1A 4CG8A 3K2LA 4OTFA 5HNBA 4GG5A 3R71A 4ZOGA 5GIPE 2OXYA 5M07A 2PZYA 3SX9A 3RHKA 3GEQA 4ZTMA 1PXNA 4TWOA 4C38A 4TW9A 4IM3A 4MD9E 3LOKA 1DAYA 3S95A 2F9GA 3UTOA 2Q83A 4J8NA 4S30A 4ANOA 4R78A 1MRYA 4IH8A 2C5NA 3D14A 3PRFA 4WRSA 4I5CA 2X0OA 4MUQA 4FL3A 4ITJA 5E8VA 4PQNA 4C3FA 1GOLA 4CT2A 2E2BA 4C36A 5ITAA 4QEBA 2UVXA 3SRVB 3C50A 4M67A 4D4VA 1R0PA 1QPCA 3ERKA 3FBVA 4ITIA 2R3MA 3TV7A 2J6MA 1VEBA 3R30A 4XBUA 3QUDA 1JQHA 4QMOA 3UVPA 1OUYA 4BWKA 4E5BA 2VRXA 4UYNA 2HWOA 3KULB 5KX8A 3RK7A 3V01A 1WCCA 5CAUA 5AP7A 3VJNA 2BMCA 1A48A 3FMLA 2YWVA 3MW1A 4U3YA 2VO3A 5LWNA 3PLSA 2EB3A 4RIWB 3ZS5A 3QALE 4L44A 3V5WA 4KIOA 4OTWA 4CMUA 4II5A 2V0DA 4ENYA 4F64A 5IF1A 2OF4A 4FA2A 5D12A 4M97A 4OLIA 4QMSA 3C7QA 3ZRMA 4QMMA 5HTCA 3A4OX 4YNOA 3E93A 3RAKA 4RBLA 1W98A 4U3ZA 4RVTA 3W16A 3JXWA 4EHEA 4EZ3A 5HTIA 4CZYB 5ICPA 4YZBA 3A7IA 3QTQA 1NT2A 4XV2A 5LCJA 3TDWA 4JDHA 4JDJA 4RWIA 4DFLA 2QR7A 3OCSA 5BVWA 1M17A 3TZ8A 5KMMA 1Z5MA 3ROCA 4AFEA 2GQRA 3SW4A 4K33A 2WOUA 2WPAA 4Q9SA 4H3PA 1ZZ2A 4RC2A 1WBVA 2R7IA 4XJ0A 3R8UA 1G3NA 3II5A 1T45A 4FUYA 2CKQA 3GU6A 5F20A 3SAYA 3HEGA 4ARKA 5JK3A 1Q99A 3VN9A 4FKIA 1VR2A 3A7JA 4EQMA 4Z9LA 1W0XC 1ZYSA 4LOOA 4EOLA 4V04A 3TNHA 1MP8A 2R64A 3NUUA 3RPRA 3ANQA 4JX7A 1PYEA 3H10A 4QPAA 4QP8A 5J8IA 5DIAA 4DG3E 4DITA 5F1ZA 4QDVA 1J3HA 2WMSA 5E4HA 3IS5A 3QBNA 2WMWA 4O0XA 4I93A 3FXWA 3Q9ZA 4RPVA 4G6OA 4QMLA 3W2CA 4XS2A 5DT0A 3MWUA 4AGWA 2J5FA 2JDTA 4EC8A 3LHJA 4FKPA 3FAAA 3W2RA 4O6EA 5KZIA 2R3IA 4QMUA 5KMLA 4M84A 5M44A 3GCUA 3UODA 3V5TA 3KXXA 4ACMA 1P4OA 4C59A 5IQHA 5D11A 1PXMA 3LXLA 1BL6A 3OW3A 2PZIA 3UDBA 4DH5A 4EEVA 4P5ZA 2WXVA 3MSSA 3MA6A 5JKGA 3CC6A 3S00A 3G6HA 4EBVA 5CF5A 3FKNA 4K9YA 5I3RA 3HMPA 2XK9A 2O63A 4HCTA 5EM8A 3F3VA 3M1SA 3AGMA 3GB2A 3DU8A 2BHEA 2VNWA 2YZAA 4FSRA 4FEWA 3WF7A 1SNUA 4O7ZA 3RKBA 4R7IA 2WTDA 3I5ZA 3QUEA 2C6IA 4LGDA 5LCKA 5K4JA 2WMBA 2FSTX 2QVSE 1OBDA 4AAAA 3DBCA 4FTUA 1ZYDA 2C5XA 3MFRA 2R3RA 3I6UA 4TYEA 4HOKA 4FK6A 3QD3A 2PPQA 4BZDA 3CE3A 2WU7A 2J9MA 2DWBA 3L8SA 4FTRA 2BROA 4QTDA 4RWLA 5CI6A 3WYYA 4A9YA 4CFXA 1Q3DA 3EWHA 4IFCA 5EKOA 4E26A 3T8OA 3H9RA 2YLFA 4YTHA 3IW4A 3QFVA 5T68A 4GJ3A 4M69B 3SA0A 2RKUA 3KIOC 3CPBA 2WQBA 1CSNA 2CN5A 3FZTA 4L3PA 4ALWA 3R63A 3KVWA 4IAKA 3IOKA 4JAJA 4A9RA 2GQGA 2XKDA 1H08A 4K11A 3R7OA 4DTKA 4HVSA 2Q0BA 1AGWA 2VX0A 3MS9A 1CM8A 4FV3A 2X9EA 4GK2A 2R0UA 4MXAA 4YP8A 5M53A 3KQ7A 5AUTA 1GZKA 2VWUA 1YXSA 2IVVA 3QRIA 1FOTA 5FQDC 5HOAA 4E1ZA 5CAOA 3E87A 3RI1A 4F78A 1YWVA 1TQPA 2QO9A 3PJ8A 5FP5A 4DHFA 3QL8A 3DXPA 2JFLA 1P4FA 4FKRA 2E9VA 4DA5A 2ZM3A 4BY9E 2HZ4A 5AM7A 2C5VA 4DGGA 4TYJA 4AOTA 4E4NA 3KFAA 3TJDA 2VX1A 3POZA 3QHRA 1WBPA 3QGWA 4RC3A 2ETRA 5HCYA 5HO8A 2DUVA 2XZSA 3PIYA 2HY81 3PXFA 4FZDB 3W0RA 2JIIA 5AUVA 3PWYA 5G6VA 4K0YA 4BJJA 3V8SA 2XARA 3B2TA 3W8QA 1PXJA 3BYMA 3AD5A 2UZEA 4KKGA 1ZMWA 3TNWA 3HRCA 4EI4A 3Q2JA 3HV6A 4XUFA 5CX9A 3V5LA 2C6DA 5AUYA 5M09A 3FKLA 2B54A 4O91A 3JR1A 4FV0A 5HLPA 3TXOA 3W2QA 5GZAA 2NO3A 3T3VA 3D9VA 3EFLA 3GC0A 4IWDA 4CGAA 3DAKA 5AAFA 5TOZA 1H4LA 2Y7JA 5FM2A 2GNIA 2ZMCA 4L67A 3R9HA 3LJ2A 2SRCA 4DEDA 5CT0A 1V1KA 2WMXA 3ZLXA 4JBQA 1ZOGA 2CLQA 3BWFA 4Z3VA 3KXNA 3QTZA 3FYKX 5GIOE 4YJQA 5FM3A 1JVPP 2JIVA 3CGFA 5ANJA 4L9IA 5BMSA 3LCDA 4F7NA 1XHAA 1J1BA 1NA7A 3V3VA 4I21A 4FSWA 2QKRA 2JKKA 2UW3A 3DFAA 3KRRA 4YU2A 1H07A 4TNDA 2RG5A 4YSJA 4G34A 3MFTA 5LARA 5L8LA 2X4FA 4AW2A 3C5UA 4MF1A 4EJNA 5FUTA 3M11A 5AAGA 5FBOA 4DE4A 4ALVA 1M7NA 2WTJA 4G3DA 3LQ5A 4DEEA 3W0PA 4DFUA 2R5TA 2UZOA 3Q4CA 1FGIA 5IH5A 3OW4A 3O2MA 3Q3BA 2XP2A 2XKEA 2XK7A 3BU3A 3DK6A 3PZHA 4IBMA 2VGOA 3UVRA 4JRNA 3FZSA 2XVDA 4YTFA 5IMEA 5AX3A 4PPCA 5LVPA 4NIFB 3HAMA 4ANBA 4QT1A 3NYXA 5ACBC 3DK7A 4NKSA 2IN6A 1NVSA 5C01A 4F1TA 4ZJVA 1K9AA 4FT5A 5J9ZA 4EOSA 2ZDUA 5LMKC 4BI0A 5GJFA 5IUIA 1YOJA 4IB3A 4QQCA 4GYIA 1BI7A 3BYSA 3F82A 5CY3A 2J4ZA 4HGTA 4RQKA 3OT8A 1GAGA 3UO5A 4IC8A 2QOLA 5HIDA 4CQEA 2B9IA 2UW4A 5B0XA 3D7ZA 4G9CA 1M2QA 1XR1A 1NY3A 3DKFA 4EH4A 4PX6A 1W83A 3C51A 2G15A 3I79A 4JRVA 5ANGA 3LCKA 3MH2A 5HHWA 4D2WA 4FK3A 4O21A 3BRBA 3WF8A 2JIUA 3PWDA 4I20A 1ZYJA 1JSVA 3LMIA 4B9DA 4PDYA 3W1FA 2UV2A 1UU8A 3JY0A 4IW0A 3G5DA 3RTPA 3WE8A 4BI2A 1KOAA 3A8XA 1SVEA 5E8WA 4MXYA 4CCBA 5HVYA 4GW8A 2C6MA 1S9IA 3OY3A 1I44A 2C69A 4L68A 4WBBB 3U87A 3TUCA 2XALA 3R2BA 5M4CA 4RJ5A 4NM5A 2FA2A 4BDFA 4JIKA 1M52A 5EI2A 4BTFA 2R3FA 3AMYA 3Q4UA 3LFQA 1OI9A 3R02A 4BGQA 2W5HA 5CSPA 4PF4A 2XIKA 3L8PA 2JGZA 4WA9A 4BFMA 4ANMA 3CD3A 2IEWA 3OC1A 2BFXA 3GCVA 3W32A 3FLQA 2ONLA 4KSPA 1DI8A 2GFCA 3QC4A 5CNOA 4YMJA 4U79A 5L2WA 1UWJA 4O0VA 2OGVA 4IC7A 3UIMA 4GU6A 5DI1A 2VWBA 4BGHA 2X2KA 2B52A 3K3IA 3PXRA 5HIEA 5CAQA 2O3PA 1IA8A 3CD8A 3W0SA 2I0YA 4BDEA 3RZFA 5B7VA 1I09A 2PZRA 4O2PA 3DJ7A 2X8DA 4M8TA 3ODYX 2VTLA 5ETFA 2W5AA 1RQQA 3ZO4A 4NFMA 3FUPA 4NCTA 3C4WA 4U41A 4YNEA 2CHLA 5K3YA 3BYOA 2XYUA 4S32A 4R6VA 3MH0A 3B2WA 2IVUA 4S31A 4Z16A 3ZOSA 1FVVA 4F6UA 3R0TA 3PE1A 4YLLA 4KRCA 3EFJA 4IHPA 3IW6A 4O0YA 3TN8A 3KN5A 4E8AA 5IA4A 3NNWA 1OL6A 4U7ZA 2WD1A 5ANEA 2VWXA 2VO6A 4EC9A 3GU8A 3EB0A 3VAPA 2ZVAA 3ORIA 2WTKC 3T3UA 2E9OA 2VO7A 1WZYA 5K4IA 4DYMA 2B9FA 2UZBA 3I7CA 5CU6A 2BIYA 4RX8A 4FV5A 2OXDA 4DFBA 3ORPA 4BCMA 3EQBA 3GXLA 5D7VA 1YXVA 2Z02A 5CSHA 4FBXA 3HKOA 3E63A 2BR1A 4RC4A 4G5PA 1CKJA 2X8IA 2O5KA 4USDA 5C8KA 4HPTE 3UOJA 2HY0A 3LVPA 3VRZA 1Q8ZA 5DYJA 4E4MA 4C2VA 2XEYA 4F65A 1WBTA 3HRFA 2IF8A 4RVKA 2VTHA 4RMZA 3QXPA 4U6RA 4FTMA 5JFVA 1R39A 4I4FA 4L45A 3R8PA 4IZ7A 2BZHB 2X7OA 3QCYA 3E7VA 4GK3A 2BZJA 3K5UA 4F6SA 3GC8A 5FXSA 3SXSA 4TWNA 4WO5A 2QR8A 4A4OA 1GIJA 1VYZA 3TT0A 4IAZA 1KE9A 2H6DA 4XV9A 1YKRA 3PTGA 4K77A 4LUEA 3AKLA 4TYHA 3HAVA 5M4IA 3PXYA 4UYAA 1F3MC 2PE0A 4PP9A 3TUBA 1OVEA 4NH1A 2ZV9A 2OF2A 2ONLC 5AP5A 1BUHA 2WOTA 3KCKA 2C68A 4DFZE 3VQUA 4AWIA 2CN8A 4TNBA 4I6QA 2ZYBA 4YLJA 2QOCA 4CRSA 3BYVA 4O7RA 3LPBA 4O83A 3NCGA 3NDMA 5DR9A 3NUYA 5DWRA 2YA9A 3PFQA 3F2RA 4RG0A 4KNBA 5FRIA 1JWHA 2C47A 2C6KA 4NT4A 5E8TA 5DPVA 4E93A 1PHKA 3PP0A 3ZO1A 2ZB1A 3GI3A 2XNEA 3C4XA 3BEGA 4FC0A 3CPCA 4IACA 4NWMA 4NM7A 4BCNA 3N4TA 1EH4A 2Y0AA 4KIPA 3ZZWA 5IZFA 2UZUE 3AQVA 4RFMA 4ACCA 2P0CA 4CV8A 2NRUA 2RG6A 4IX3A 3GQIA 2IJMA 3NAYA 4YJNA 3AD6A 3VUGA 3CTHA 4FVQA 4AXFA 1TZDA 3UPZA 4I5PA 5CLPA 4ZSLA 3BGZA 1R3CA 1URCA 3DLZA 1BMKA 5AR4A 4LGGA 4JOAA 5HX8A 4AZFA 3PSBA 4H58A 5KO1A 1JKTA 3U55A 3HVCA 4Q5HA 3QWKA 5DOSA 5HBEA 4AQCA 4CNHA 3RMFA 2F7EE 3OHTA 4A4LA 4U80A 3I1AA 2QURA 4F6WA 4YSMA 4ASZA 4BDDA 5IQCA 1J1CA 4UV0A 5HVKA 3QX2A 5EM5A 2ACXA 2QHMA 3FE3A 4N57A 3W0NA 1E1VA 4IAIA 4KIQA 4MF0A 3W55A 2JD5A 4OAUC 2IVTA 4NSTA 5M55A 3ZC6A 5FEEA 4BCFA 3ZMMA 4AX8A 3ULZA 2VWVA 3KEXA 4LFIA 4JI9A 2CNUA 2PVKA 3ZXZA 4DEGA 3ALOA 1Y91A