3F5PA

Complex structure of insulin-like growth factor receptor and 3-cyanoquinoline inhibitor
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
307
structure length
299
Chain Sequence
SFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIETDRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Insulin-like growth factor 1 receptor
publication title Lead identification to generate 3-cyanoquinoline inhibitors of insulin-like growth factor receptor (IGF-1R) for potential use in cancer treatment
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 299
sequence length 307
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, R, S, T
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3f5pA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3f5pA01
3ACKA 3OBJA 4H3QA 2QU5A 4FKPA 2Z7RA 3IECA 4IAZA 4ALUA 2C6TA 5M4CA 4F9YA 4AN9A 3DY7A 1PXNA 1YXTA 4KRCA 4TYHB 3VJOA 3L8SA 4CVAA 5A3XA 2QVSE 1P2AA 3PDTA 3BX5A 3ERKA 4DH8A 1ZMUA 3H0ZA 2XKEA 3QYWA 5IUGA 4KNBA 4Z55A 5HG8A 3DBDA 3HUBA 1UU7A 3VF9A 4E1ZA 2BRMA 1OL1A 2YLEA 3OHTA 4PTGA 1S9IA 2AC5A 2WMUA 3QKMA 4D1ZA 4A4OA 5I5ZA 2F57A 4CGAA 2XF0A 3W2OA 1SMHA 2C0OA 2EB2A 3I7BA 3JPVA 3L9MA 1W83A 2J0LA 2J9MA 3PG3A 4KIOA 1I44A 2X2LA 3IW8A 3RPSA 2ETKA 4EOLA 3R83A 2B0QA 1JOWB 5E8YA 3WI6A 1JLUE 5H9BA 4GFMA 2FUMA 2WMQA 3AD4A 4QP8A 4WBOA 3RWPA 2QKRA 5EW3A 4U42A 4HVHA 4BWKA 4F99A 4IMYA 5CI6A 4QPMA 3W1FA 2J51A 4KKHA 3OCGA 4AAAA 3AC3A 4I20A 3QCXA 4IVAA 4NTSA 4BTKA 2WZJA 2E9NA 3DQXA 1Q8ZA 4MK0A 4U97A 2B9JA 4XX9A 3NRMA 5FEDA 3O7LB 3UPZA 4QQCA 5HVKA 4JOAA 3NNWA 1OECA 3D0EA 3LMGA 4F7SA 4E5BA 2J0MB 3KN5A 4RVLA 5FTOA 2OXYA 2BRHA 4IM0A 3FQSA 4LM5A 4MHAA 3VBYA 4CFNA 4OTQA 3VUHA 4OBQA 3VUDA 4F6SA 4BCKA 2HZ4A 4BZDA 4B8LA 2XK7A 5A46A 3CD3A 3ORLA 5AJQA 4AZVA 5IDPA 3DDQA 2J0IA 4JXFA 5CNOA 1YHVA 3L8XA 2VX1A 3EMGA 1OMWA 2OK1A 2BVAA 3ET7A 1YWRA 4FTMA 4Z9LA 2OFVA 1FMKA 3KA0A 3FC1X 4GEOA 4TWNA 4YNEA 3VVHA 5KMIA 2IVUA 4IZ7A 4XV1A 1SVEA 3LE6A 1HCLA 2DWBA 2ITUA 4ANLA 3TXOA 4IHPA 3T8OA 4OTIA 4YZ9A 4QD6A 4JR3A 5ANEA 3H9FA 1WVXA 2B9IA 4KKEA 3RI1A 1J7LA 1G5SA 3FWQA 3PIZA 4PPBA 2GCDA 3ZONA 1GZ8A 2C4GA 4MTAA 3IGGA 4LL5A 4PRJA 5CVHA 5EOBA 3ORPA 4ZEGA 3NR9A 4BCHA 3O8PA 4GKIA 4GL9A 3NX8A 1BI8A 2QOOA 3HV6A 5EOLA 2BIKB 3DK7A 1OPKA 3AQVA 3FSKA 3CJFA 4RJ8A 4UWBA 3CQEA 4IZ5A 3PFQA 5HE1A 3KXMA 2BHEA 2VWXA 3I1AA 3Q4UA 5JFXA 1ZYDA 1FVVA 2OJ9A 3MPTA 4FVRA 5AUVA 2QOCA 2QURA 3A61A 2EU9A 2P2IA 2R3RA 4J8MA 4EHVA 5I3RA 3GT8A 4HZRA 2PHKA 2WTJA 3DBQA 3KXXA 2OFUA 4NW5A 4C4IA 2R3PA 4YURA 5CLPA 4O7VA 3DBFA 4E26A 3VUKA 3MVHA 1M52A 3P9JA 4TYHA 1K3AA 4AF3A 5A4TA 2W4OA 2WAJA 4YJNA 4L43A 3W2QA 2ITOA 2C3IB 2OKRA 2UZEA 1PMNA 3CEKA 3U6IA 2ERKA 4EEVA 5DEWA 5C1QB 3IW6A 3R63A 4XV3A 1K9AA 2WTIA 4PDSA 1XH7A 3AMYA 1FMOE 4EKLA 4YHJA 1H08A 4XS2A 5AR7A 3VBXA 3PJ3A 3UVPA 4CFFA 4GJ2A 5C26A 1VYWA 5GZ9A 4EYJA 4BN1A 5AUWA 4AU8A 1KUTA 3LFFA 3HRCA 5JN2A 5G6VA 4O0TA 2BDFA 5TF9A 3A4OX 5HG5A 3C51A 3FMDA 2ZV8A 4QO9A 1XH4A 3AGLA 4YO4A 4ACGA 3MH3A 3P08A 4J1RA 2VNWA 3OP5A 4FI1A 4FT0A 3H10A 4FIEA 3G9LX 5H8GA 5DWRA 3H30A 4XG4A 3C0GA 3UJGA 4B7TA 4BIDA 1XH5A 1WZYA 4A4LA 2W0JA 4P5QA 2IN6A 5HNGA 4RJ3A 4EH4A 3MBLA 3IW4A 2HAKA 5DVRA 4R7BA 3PY3A 1JSVA 5HICA 4I1ZA 3GU8A 4GFOA 1MRYA 4HVDA 2PZIA 4Y85A 2ONLC 4A7CA 3DDPA 3UIUA 4EOQA 5GINE 4QTDA 3HMOA 3LQ8A 1OZ1A 1YXSA 3HMPA 4D1SA 4E4MA 5HX6A 3EKKA 4O22A 3HAMA 2PVRA 2PZYA 2WOUA 3OOGA 2UZTA 4D4RA 4JDJA 3MPAA 1XH8A 3R02A 4BZNA 2J7TA 3KCKA 4O6LA 4X6RA 5FEQA 5JK3A 3F9NA 3QC4A 5AR3A 3QCYA 3SD0A 5CAUA 3GFWA 4RX9A 1GZOA 5L2QA 5IQIA 2Y8OA 5CT7A 3ZHPC 4IANA 3FPQA 3KQ7A 5AM6A 2A0CX 4CTCA 3OW3A 2XUUA 4RIWB 4G6NA 2YM5A 3GOKA 4D5KA 3BQCA 4I0RA 4X2JA 4A9YA 1MUOA 3GU4A 4BCJA 1Z9XA 4F08A 4EZ7A 4ZS0A 4UB7A 3PY0A 2BAKA 3EKNA 4IB5A 2YZAA 3BELA 4YZNA 3RMFA 5K5NA 1XH9A 5BNJA 2YWPA 5FM3A 2W7XA 5CVFA 2F9GA 1OL2A 2XP2A 2VGOA 1W84A 3PUPA 4G16A 1W7HA 3CS9A 4QPAA 2FH9A 4CLJA 4GKHA 1OGUA 3WZEA 2R3MA 3TG1A 3A2CA 2JBPA 5L8LA 3EL7A 3MH1A 4BDCA 5H2UA 2BZHB 2UW9A 2QLUA 5M53A 3FQEA 3HLLA 4K8AA 3PPZA 4DCEA 1QPEA 1YI4A 2BRNA 2OZOA 4I5CA 4C38A 4DN5A 2XB7A 4ITIA 4Q5EA 4C7TA 2A2AA 4FV8A 3CTJA 4FG9A 4MXAA 3SKCA 4CCUA 4EUUA 4R78A 2HENA 4RWKA 4DGOA 4N6YA 1ZWSA 2YDIA 3RK7A 4HNIA 4E5WA 3JR1A 3Q32A 5L2WA 1APME 3TUDA 2WQOA 5K9IA 4GVAA 3SRVA 5JGBA 3JYAA 2FSLX 5FBOA 3ZYAA 5C4KA 4IZAA 4R1YA 4RIXB 5HOAA 3FE3A 4JS8A 4C36A 3UO5A 5HCZA 3JUHA 2JDVA 3G90X 3QHWA 4W9XA 4BB4A 3V01A 1YKRA 4WSQA 2YWVA 4D1XA 3VIDA 4J52A 2XS0A 4C62A 3UZRA 2CNUA 1XKKA 4Y5QA 1VR2A 4QMWA 3ZSGA 3DAEA 2W99B 3V5LA 2OI4X 5BYLA 4FK6A 3V5WA 2W05A 3MTLA 1I09A 4IQ6A 4AN2A 3VS6A 2CKPA 4RWLA 3MI9A 4YSMA 4EK6A 3QLGA 2XCKA 2JD5A 3IGOA 4OUCA 2VWZA 4FV9A 2CNQA 4TYIA 5CSWA 3LIJA 4FEXA 4LL0A 3FZ1A 4M69A 4YBJA 2JEDA 1OITA 2F4JA 4XH6A 3NSZA 4NU1A 4QMPA 4YPSA 3LFBA 3KXZA 5CWZA 5I0BA 3OEFX 5CF5A 3O0GA 3FKLA 1J1BA 4IB0A 3RAIA 3UMWA 4C34A 5M07A 4RSSA 3QZGA 1XO2B 3VAPA 2QOHA 3ZRLA 4CT1A 4LRMA 2W4KA 4E20A 5CF4A 2JDSA 2W9ZB 4FNYA 4E5AX 3QGWA 1PYXA 5FXRA 2IZSA 1H1PA 4WHZA 2B9FA 4TT7A 3W8LA 4BTJA 2O2UA 3TKUA 4FYNA 4FL2A 3FMNA 4EOPA 4QTAA 2XK4A 2VZ6A 5FRIA 4A9RA 3MB6A 3V8SA 1JKKA 4J95A 5HIEA 3NUXA 3UQGA 4O7SA 2ITQA 5HHWA 2Y0AA 3PIYA 2H96A 2WPAA 3DOGA 4O1PA 2BDWA 4GU6A 5I9YA 5KCVA 1PRYA 4KIKB 3E63A 4EOKA 3UDBA 1IR3A 3FMKA 3VS2A 4FV1A 4C4FA 4IAKA 4RIWA 1GIIA 3S1HA 3NUYA 4AT4A 4TWOA 5HI2A 1JSTA 4WOVA 4BWPA 3OT8A 4MCVA 4LGDA 2JAMA 4GFGA 3COHA 5CT0A 1U46A 2F7ZE 4U44A 3BPRA 4IC8A 1XBCA 4EH6A 1XWSA 3BBTB 1PKGA 4M68A 4XOZA 3QTSA 4FSWA 3QLFA 5A54A 5KBQA 3D5VA 4FTKA 4QYGA 4IB1A 3V8TA 4AZFA 5C8KA 3VRZA 3Q6WA 2NP8A 3AGMA 3RBWA 5A4EA 3EL8A 4N4SA 5D12A 3D2KA 2VTRA 3ATSA 3TUBA 5HTIA 4IAAA 5AAFA 3KMWA 1B39A 1IA8A 5E1SA 4MQ2A 1O6LA 4DFXE 3FBVA 2FSTX 3VHEA 3ULIA 2JDRA 3KVWA 2BRGA 1YI3A 1OKZA 2XIXA 5EQPA 2VO0A 3AD6A 2WMTA 3FMEA 4BY9E 1RQQA 2BUJA 3RHKA 4QMMA 1FVTA 2GS7A 1IEPA 3UG2A 4AZTA 2PULA 3SQQA 1WFCA 5GZ8A 3BHHA 1HOWA 4D2WA 2OJJA 4U7ZA 4RT7A 3DPKA 4BF2A 3TNHA 3EFJA 1YDRE 1KE8A 3NNXA 3KK9A 3EQBA 2C1BA 3LW0A 2R0UA 3D83A 4NJ3A 3ZC5A 4AA0A 5D1JA 4C57A 4FTQA 5IF1A 5HLPA 2CNVA 2P2HA 4JAJA 3PVUA 3LCTA 4O1OA 4RIYA 4G17A 3KF4A 3ZXTA 3GCUA 2ITNA 4X0MA 4AW5A 3EFLA 3GP0A 4ANSA 4BCOA 4DH3A 1QL6A 3ATTA 2WQNA 2PVHA 2X2KA 1NVRA 5FWKK 1UU3A 4I4EA 2JKQA 2YCRA 3CGOA 4APPA 1WBNA 5LJJA 3TIYA 4O7RA 5BMSA 3FZPA 5LQFA 4DG0E 5IQEA 4N57A 1GNGA 1PYEA 2C0IA 5C01A 3PPJA 4KBCA 4BGGA 4D4YA 4D9TA 4DLIA 2IVTA 4AGUA 1U54B 2FA2A 4AOJA 5A9UA 3AXWA 4FKVA 3GXLA 4BWXA 1FINA 3K2LA 1TQIA 2V22A 1KE9A 1YXUA 2C68A 3OF0A 2ITTA 2ZB0A 4L6QA 4F0GA 5I9WA 3LHJA 3D2IA 3WIGA 4F9CA 3HMNA 2O0UA 3LM0A 2IZTA 2O8YA 2EB3A 4AG8A 1P5EA 3KF7A 4C3PA 3BRBA 1BL6A 2ZDTA 2I0YA 5AR8A 4EUTA 2EUFB 2BMCA 4NKAA 3T9IA 1YOLA 3FXXA 4R3RA 3OY3A 4PTEA 3ZUUA 4MNFA 4RZWA 4TXCA 5E8TA 3R2BA 1UU9A 1H28A 1OL5A 3G51A 4UMQA 1CKIA 4RVKA 3CY3A 4ERWA 3N4TA 2VWYA 5CAQA 3VUIA 4KIKA 4NM0A 3NNUA 2NO3A 1NA7A 4QYEA 2O64A 3F82A 3W2RA 3O51A 2IJMA 2G2IA 1OPLA 2I1MA 4OTGA 5CU2A 2ITWA 3GU6A 4USDA 5CALA 4EH5A 1LPUA 2CKOA 2GS2A 5AV1A 4WRGA 5CEMA 4E7WA 4FF8A 3TDWA 3ELJA 4FUXA 4HYHA 4O0UA 5FUTA 3FMLA 2Z7QA 4EC8A 4JG8A 4JR7A 3BEGA 4K18A 3QFVA 4R8QA 3TKIA 2E2BA 4WNPA 4B99A 4C3FA 3D5UA 3UOKA 1KOBA 2CMWA 3Q2JA 4S34A 4X3FC 1STCE 4MXOA 4O7NA 4ZJJA 2FO0A 4LFIA 2ACXA 3DCVA 4X7QA 3UNKA 4S2ZA 1KOAA 2RF9A 4IFCA 2F2UA 5JZNA 3QD0A 4MVFA 3GVUA 1SVHA 3PPKA 3FL5A 4ZXTA 3I5ZA 3VBQA 3CSVA 4XLIA 5AUXA 1RE8A 1CMKE 3ANQA 2VO7A 3GQLA 3GU5A 5FBNC 2XNBA 5GHVA 2LAVA 4B6LA 4P7EA 2H8HA 4FC0A 4U79A 2CGWA 3JXWA 2C30A 4C37A 4QMNA 3ZEPA 2X8DA 3KEXA 5AV4A 1ZOGA 1Z57A 2HZ0A 3BV3A 3FZTA 4BDAA 5HE2A 1H01A 1J3HA 4JQ7A 3QF9A 1ZAOA 2VTMA 3CQWA 4PL4A 2WMRA 5JEBA 5F4NA 2ZMDA 3NAXA 5A6OA 4L8MA 2OIQA 4FZFB 4PNIA 4Q2AA 3CGFA 4NTTA 1ZY4A 1PF8A 3VULA 4UMRA 3FKNA 3MH2A 2VWVA 5BVDA 4H05A 4CT2A 4FE2A 3RJCA 4U43A 2VTIA 1OVEA 2R3OA 4RJ5A 4QQTA 3TKHA 4HVSA 5EI6A 4CKIA 4E8AA 3FHRA 3Q6UA 3DLZA 3PSCA 1H1WA 3W2CA 3THBA 3BGPA 2UZNA 4F1TA 2X6DA 2W06A 4WD5A 4II5A 4FUYA 4GVJA 3VS5A 1U54A 2UZBA 1FQ1B 3ORKA 4QMYA 2VTAA 4AOTA 2R5TA 1CSNA 4E73A 1ZZ2A 4GUEA 1TQMA 1BI7A 3MVJA 2OIDA 3IKAA 3CY2A 5JZJA 5KZ0A 3MVLA 5KBRA 3EN6A 4F7JA 3G9NA 5L8JA 3R71A 4ENXA 5B7VA 4RG0A 2JLDA 2Q0BA 3H0YA 4HVGA 2BZKB 3R7IA 3NUPA 1ZOEA 3TZ7A 4F4PA 5CQUA 5KMMA 5EYDA 2JKOA 4DH5A 4O27B 4E6CA 2ZYBA 4EH7A 3NCGA 4ZAUA 2J4ZA 5CANA 1IG1A 3BE2A 4HCUA 2RG6A 3DV3A 4RX8A 2CJMA 3UBDA 3U54A 1FOTA 3IW5A 5LMAA 4JDKA 4YJQA 3PJCA 4GK3A 3BV2A 4O7WA 4DTKA 5AADA 4FKUA 1JNKA 2CKEA 4KBAA 5BVKA 5IH5A 3G15A 4FKIA 4ACHA 4IXPA 4J99A 5AV0A 3L8VA 3LOKA 3OY1A 5BVNA 2XMYA 3QQLA 5JGAA 3B8RA 4WNKA 3OT3A 4LYNA 4I0SA 5JQ5A 3MA6A 2OO8X 4ANMA 5E92A 5DBXA 3LFEA 5HBJA 4BZOA 4QMXA 4E3CA 3FYKX 4PY1A 1F0QA 5CEQA 4BDIA 2GTNA 4HCVA 4J53A 2QOBA 3EWHA 5HVJA 3BWJA 5CY3A 4AZSA 5ETFA 4HYUA 3A8WA 3TTIA 2X7OA 4BC6A 4BCFA 1ND4A 3KRRA 4IVDA 3LLAA 3LXKA 4UYAA 3A99A 3JS2A 3REPA 3DZQA 3BWFA 3K5UA 3KN6A 3FXWA 5FD2A 4WA9A 3A62A 3TCPA 2DUVA 3OTVA 4F0IA 4RFMA 5EW9A 3LFSA 5FM2A 4QMLA 4YC8A 5FDXA 3VQUA 4CFWA 2PZ5A 4BYJA 1M2RA 1NVQA 4YJVA 5IA4A 5CSHA 4M7IA 5J9YA 4YHFA 2HZIA 4NEUA 4GT4A 4TRLA 3RM6A 3TWJA 2X8EA 2PZPA 4AUAA 3F69A 4JDIA 3F5UA 3DU8A 3PXZA 1H26A 3VWAA 4J98A 2ETMA 5AR5A 1URWA 5FP5A 1TVOA 3COIA 3G6GA 4RVMA 3S2PA 4PNKA 2XRWA 4ZY4A 2R7IA 3W16A 4OTWA 1WVWA 4PL5A 4H58A 2HYYA 4XJ0A 3EH9A 4AFJA 3QD4A 4R7IA 2X0GA 4ZSEA 5CTPA 4MWHA 4ZTHA 3V5QA 1ZYSA 1WAKA 2QI8A 3UPXA 2PTKA 3QBNA 4QP9A 3FSFA 4M14A 3F88A 4JL9A 4FSYA 2OXDA 4HCTA 4FT3A 4NM3A 3OWLA 3IPHA 4MWIA 5BMMA 4DINA 5GIPE 3BE9A 4DTAA 2C5OA 4FX3A 4UMUA 2UW8A 4LOPA 4H36A 4DEEA 1M7NA 2E9OA 1NXKA 3CPBA 3FMMA 3KRJA 3ORNA 4XBUA 5CVGA 4O7TA 4R77A 2ONLA 3BBWA 3U4WA 2XK3A 4EHEA 2UV2A 3E8DA 3JY9A 3KMMA 3P0MA 4DH7A 2UUEA 3IDPA 4CEGA 2C1AA 4F1MA 4FNXA 2EWAA 4NCTC 4PPAA 2W1GA 4NL0A 2R4BA 3D4QA 4Y72A 3E7OA 4R5SA 3QL8A 4MKCA 3ZLWA 4OT6A 4ZZMA 4E6QA 2WEIA 3NDMA 2JDOA 3DBEA 3FPMA 3EFWA 2JIVA 5HIBA 3C9WA 4ALVA 4NIFA 3FKOA 1SNXA 5TO8A 3O50A 5D9HA 3F2RA 5E4HA 2QNJA 4BL1A 3PIXA 3EQHA 4L3LA 3UNJA 3KY2A 5CXZA 2RL5A 2VU3A 4EJNA 5E8WA 3RP9A 3ZU7A 3RK9A 3NVKI 2A27A 4BDBA 5M44A 2WHBA 1XR1A 2OWBA 2UW6A 3AC4A 4O38A 5DRBA 4EOIA 4FTLA 2XK8A 5EKNA 3DLSA 3C5IA 3GEQA 1OL6A 2OF2A 3DFCB 4FTTA 2C3JA 3SA0A 1M7QA 2SRCA 4LUEA 1DAYA 3R6XA 3TNQB 1WBPA 4DFLA 4UALA 5CEIA 1R78A 4FTUA 3RWQA 5DR6A 2A1AB 1UNHA 4ZTNA 5AR2A 3QKLA 4I41A 3HKOA 4DT8A 2VGPA 3QTRA 4NM5A 4BFMA 2R3FA 3OXTA 3R7EA 5AAGA 3CLYA 3TDVA 1JQHA 1KSWA 1SZMA 1QMZA 3Q9WA 3HMMA 4AS0A 2UZOA 2X9FA 3QD3A 2WB8A 2GNLA 2YJSA 2HXQA 3D7TA 3FI4A 3MV5A 3QC9A 4OGRA 4L42A 4OTDA 4PP9A 2ZAZA 4HYSA 4LMUA 4MXYA 2F7EE 5DT4A 3S3IA 2UW4A 3B8QA 5HE0A 3VC4A 1W82A 5L3AA 2NNWB 3QTZA 5E8SA 4HW7A 4KS8A 4UMTA 5EDPA 2GMXA 3ORZA 2YDKA 3QWJA 4G34A 4A07A 5CF6A 2Q83A 5J87A 2C6DA 4HGTA 5EW8A 3EOCA 3PP1A 3DBCA 3DTCA 3VW6A 4L01A 2JITA 4UZDA 2YM7A 3TZ8A 4H1MA 3QRUA 2XM8A 3F3VA 3RKBA 2P3GX 4ZS4A 4IE9A 5JFVA 4IADA 5HE3A 2CGVA 3P7AA 1OIRA 4KUJA 3FLNC 1A06A 5FTGA 4BDFA 4CZYB 2PU8A 3NUUA 4GSBA 5GZAA 2OJGA 2BDJA 1LEZA 3A60A 3IONA 5JQ8A 2HW6A 4MD8E 3AD5A 3HV7A 4K33A 3RNYA 4YGAA 4GYGA 4AWIA 1DM2A 3R22A 5F20A 4GIHA 3U8WA 4C0TA 4IDTA 3R8MA 4YMJA 3VS3A 1DI9A 4FSNA 2R3JA 3IG7A 1J1CA 4KB8A 3PWDA 2RFEA 1W8CA 3C4ZA 4IIRA 4NT4A 2VV9A 5GIOE 3E92A 4JRNA 3TNIA 3BQRA 2ZM3A 4KBKA 4U45A 3R8LA 3TTJA 4ZK5A 4RJ6A 5CSXA 3VF8A 5EI2A 1XH6A 2Z7LA 3R8UA 3BKBA 5AP3A 1ZYCA 2FSMX 3MYGA 4U3ZA 4AW0A 3HV3A 1JPAA 4N0SA 4E4XA 3WBLA 1P14A 5LVMA 4WT6A 1Q61A 1H4LA 3HECA 4FVPA 4EOMA 1NW1A 3OROA 5AFVA 3MVMA 4NUSA 2Z02A 3EJ1A 1JBPE 4LI5A 3FLSA 1WBOA 2EXCX 4UN0C 4OR5A 4S32A 5ANKA 3M11A 3SRVB 3F61A 5BPYA 5AEPA 2C6MA 3HGKA 5E8VA 1UA2A 2QC6A 3OWPA 5BVFA 5K4IA 2HWOA 4ANOA 2XBAA 4X3FB 2C3LA 2IG7A 5IH4A 2Y6OA 4BIBA 3Q9ZA 4AN3A 4CYIA 4YLJA 2W5BA 3MW1A 4QMVA 3ZS5A 4C3RA 3R04A 3COMA 4CD0A 3EN7A 2XM9A 5CEPA 2WXVA 2ZM4A 4FNWA 4IX5A 4JT3A 3LMIA 3F66A 4I3ZA 5LARA 1UKHA 3RM7A 2PVKA 2ITYA 3HP5A 3MFUA 4M69B 3VN9A 4K2RA 4XG8A 4JG7A 4HGSA 4C4JA 2H9VA 4QQ5A 3BYUA 3QA8A 4EQMA 2R7BA 1YVJA 3LVPA 4U9AA 3PXQA 3IK3A 2X9EA 4YTCA 4C4GA 5DH3A 3KL8A 3FLQA 1Y57A 4IB3A 1ZRZA 5T68A 2Z60A 4C59A 4D2TA 1LP4A 3AMBA 3ZCLA 2PYWA 5ETCA 4I6BA 3A4PA 2RG5A 3JY0A 3O71A 2XJ2A 5EYKA 5HG9A 4USFA 2XA4A 1NY3A 5HKMA 1Q3DA 3BGZA 2G2HA 3MY0A 5IQCA 3ZRMA 2WMWA 3OC1A 5EH0A 4EZ3A 3WF8A 3F5XA 2WMBA 3IDCA 3WZUA 2XZSA 3G5DA 3KRXA 4RBLA 3NS9A 4FV0A 4V04A 4ACDA 2P0CA 3PXRA 5IQHA 2JFMA 3OUNB 2XIKA 4I5MA 3LCDA 4QP7A 5AUZA 4NWMA 3SXSA 4TW9A 3U9CA 4JX7A 4DGLC 1YDTE 1T45A 4QMQA 3NNVA 1U59A 3FY0A 4XV9A 3OW4A 4ASZA 3FI8A 3WZJA 1Q3WA 2OGVA 4DBXA 5AP6A 3DTWA 5KMLA 4IW0A 3TNWA 3HDMA 5A4QA 3QTWA 2QD9A 3SLSA 4CG9A 4YR8A 1Q24A 1R0PA 5IA3A 5L8KA 1ZY5A 5CAOA 3IS5A 3QZIA 3ZM9A 4M66A 5IMEA 4YJPA 2YN8A 3F2AA 3R9DA 1OBDA 1QPCA 4XG6A 4FMQA 3UO6A 2XIZA 2HIWA 2IVSA 1J91A 2CHLA 5F1ZA 2OICA 1Q5KA 1SM2A 2PK9A 3EN4A 4M84A 4YJOA 2BRBA 4B8MA 4D0WA 3OCTA 4ZY5A 2R3NA 3SVVA 1PXOA 2BZJA 2C0TA 2JKMA 4D9UA 1Q8YA 4EOJA 2BFXA 2I7QA 5AP2A 4MNEA 3B2TA 3AT3A 1ERKA 3FXZA 5CX9A 3QQGA 4X3FA 2WU7A 2YM3A 3GC9A 3U87A 1CM8A 4FR4A 5IU2A 2CKQA 2ESMA 2WTKC 3QZHA 4ZLYA 3VS0A 5LWNA 3NGAA 3NUNA 5HGIA 3BCEA 5K3YA 3UP7A 4FZ6A 4C61A 3HRFA 5A6NA 4RIYB 4JBVA 4QYHA 4XG9A 5M51A 4XP3A 2HY0A 2X7FA 3ZH8A 3II5A 4RVTA 3ORMA 4JRVA 2C6KA 3D5WA 3E8EA 3QKKA 2B54A 4FIIA 3HMIA 4GT3A 4JQEA 5C4LA 2IW9A 3PE1A 4MH7A 2Z8CA 3C50A 3DAKA 5BUIA 2GNHA 4PPCA 4O7YA 2BKKA 2UW3A 4RFZA 5KE0A 2DQ7X 2PMIA 4FIHA 3QXOA 4XG7A 2CCHA 5ICPA 3MIYA 3GUBA 5CYIA 2PVLA 2WD1A 5K0KA 4ZSAA 4CQEA 1WBSA 3GOPA 5J79A 1EH4A 4W4WA 3PA3A 3CQUA 4G31A 4MBLA 4GJ3A 5KHWA 2R3LA 1Q97A 1GZKA 3Q4TA 4XG3A 2VTHA 4TWCA 2WEVA 4IEBA 5C8NA 4FGRA 1VZOA 4FV3A 3KRLA 2YJRA 2V5QA 3I7CA 3KKVA 4V0GA 3N4VA 1RW8A 1FPUA 3RNIA 4BDHA 3MPMA 4WUNA 2JC6A 3E87A 4FL1A 2R3HA 4PMTA 5ANJA 3ZOSA 3ZLSA 1MP8A 1Y6AA 5AA8A 5CAVA 4M0ZA 5IQDA 3EZRA 3HV4A 5CU3A 4DLJA 3QCQA 1PKDA 1OIUA 5AIKA 3E8NA 3AC5A 3H4JA 4L3PA 3G0FA 2QLQA 3SOCA 2GS6A 5KZIA 2YZLA 2ZMCA 1ZMWA 4HZSA 2V0DA 4IX4A 4JBQA 3BYSA 1BLXA 1X8BA 2GFCA 2VWUA 3GB2A 3HYHA 4ACCA 4QP3A 3O2MA 2YM4A 4QP2A 3ZEWA 5EHYA 4BCNA 3Q5IA 4BHNA 3DA6A 2FB8A 1UWJA 1SVGA 4WG4A 4RC3A 2VTJA 2X4ZA 5D7AA 3PTGA 3PP0A 1OL7A 4GYIA 2UZDA 4IVBA 4ZSLA 1DI8A 2C5NA 4A9UA 3G0EA 1WCCA 1IASA 4NSTA 2PUNA 3Q3BA 4HOKA 4I5PA 4QTCA 3MFRA 4QNAA 5E8ZA 3RCJA 4HGLA 3IQ7A 4DE4A 3TM0A 1PXMA 1Y8YA 1YW2A 3L8PA 4ARKA 3V51A 2HZNA 3EHAA 2YCSA 4MEDA 3RINA 3C0HA 4N70A 4DFUA 1UNGA 3ZSIA 5HCYA 3NAYA 2J6MA 4UV0A 1NVSA 4P5ZA 3FMHA 4DFNA 4ZMFA 5BUEA 2VNYA 2G9XA 3CP9A 4BYIA 2W17A 2X39A 4FT7A 4O86A 3EQRA 2W96B 4QYFA 1S9JA 5AP0A 4FV7A 5HD7A 4FSQA 2W1DA 2YITA 4FT5A 3TV7A 3VS4A 4DITA 2JBOA 4LUDA 2E9VA 5TE0A 1IAHA 2A4LA 3E8CA 4GK2A 4XV2A 2XNPA 1VJYA 3L9LA 3QHRA 4PL3A 3A7JA 4RA5A 4JIKA 4CTBA 4ZSJA 4G6LA 4NFMA 2R0IA 5CZIA 2PUPA 2XKCA 4USEA 5T3QA 2C5VA 3SGCA 3C4CA 4JDHA 1ZMVA 2C3KA 4DEAA 2R9SA 4FK3A 3DB6A 1H24A 1LR4A 3FQHA 3VUTA 3ZZEA 2YHVA 1RDQE 2BR1A 2IVVA 2ZV7A 4WNOA 4XNEA 4DTBA 4FV2A 1WBTA 4BKZA 3R7GA 2IW6A 4U5JA 4CFUA 4FKOA 5DR9A 5DPVA 2GNJA 3SXFA 3Q5ZA 4CZUA 2YDJA 3LLTA 1YXXA 2XKFA 4FZAB 3DK6A 4JIAA 4DAWA 4BIEA 4EZ5A 3R73A 5I3OA 4ALWA 4FKGA 3R21A 2PVNA 3LJ0A 1JVPP 4X2FA 2QG7A 3FDNA 3KB7A 3CIKA 4HYIA 4WO5A 1AGWA 2NRYA 2QONA 3ODYX 4KIPA 3KGAA 4QMOA 2WIHA 1YRPA 4DEBA 4N6ZA 4KSPA 3BYOA 3VJNA 4DFBA 5DIAA 3QUDA 4TL0A 3UGCA 3FHIA 1G8AA 4RQVA 3U6HA 2PZRA 4QPSA 2PE0A 2WTWA 4UZHA 4AE9A 4DEGA 1J7IA 5IUHA 1PY5A 3FY2A 4QYYA 4G3EA 2H6DA 2R3GA 4G1WA 2RFNA 4X2GA 3RPYA 5AP1A 3NWWA 4OT5A 4YLKA 5BYZA 3VW8A 2UW5A 3UIBA 5E90A 3EIDA 1UKIA 4RMZA 3DFAA 3WF6A 4LG4A 5HNBA 2GQRA 2XYNA 3RAHA 4FL3A 1MRUA 2OG8A 2PWLA 2O3PA 1FGIA 3ODZX 5AIRA 5EM6A 5JGDA 2ZM1A 1YWNA 2RIOA 2ZV2A 4IAIA 4NCTA 3VBVA 4ZZOA 3BU6A 4X2KA 4AE6A 3UQFA 3C4EA 4QP1A 3T3UA 2CGXA 3KK8A 2WELA 3ZRKA 3AG9A 5BVOA 3MSSA 4FKQA 3E3BX 3UNZA 4AOIA 4GH2A 5HORA 4O84A 4BDKA 3F3WA 3HX4A 3V3VA 3OD6X 2BPMA 3FLYA 1JKTA 4O0RA 2X8IA 2W5AA 5KKRC 2I0HA 5EYMA 5T6KA 3RAKA 4IWDA 3R8VA 3GCQA 1GIHA 4ZY6A 4MXXA 1P4OA 4FODA 1PXPA 4TN6A 1YHSA 5AA9A 3QQHA 5HX8A 3C7QA 5AX3A 3PVGA 3DJ6A 1VYZA 2OZAA 2YA9A 4S31A 4BI1A 5I9VA 3NEWA 3TL8A 4RIOA 3R2YA 3ZXZA 2WOTA 4EH9A 1WVYA 2XNMA 3UZTA 3GI3A 5IA1A 2EXMA 3ORTA 2YEXA 4EYMA 4PV0A 4U8ZA 3H9OA 4YHTA 3TUCA 3PA4A 5CXHA 4TZRA 3BU3A 1BYGA 3DKGA 5M09A 4U80A 1UV5A 1M2QA 4L00A 1H00A 3L1SA 2PMLX 4FTOA 4TNBA 3RALA 2I6LA 4C8BA 3OXIA 3R28A 1GAGA 3I5NA 4G3CA 4OTFA 3FJQE 2J5EA 3FYJX 1F5QA 3VBTA 2GSFA 4UX9A 2CN5A 5IQFA 4BBFA 4I24A 2AYPA 4I5HA 4QMSA 2Y7JA 5EG3A 2V62A 4M67A 4X6QC 5L6WL 2REIA 5HCXA 5C9CA 3DAJA 3QTQA 3LM5A 3VS1A 4L44A 3R9RA 2QO2A 3G2FA 4FTJA 3V8WA 1P4FA 5J7HA 4FBXA 4IWQA 5AUUA 3Q53A 5JRSA 3ZO3A 2W1IA 4FG8A 5LCKA 4JBPA 5DYJA 4XRJA 4RWIA 5IA5A 5KX8A 1MRVA 1VEBA 3NZ0A 1U5RA 3BYVA 3FZOA 3OWJA 4FV6A 4V05A 1E1XA 4EBVA 2G15A 2GU8A 4GCJA 2UW7A 3PXKA 5AV3A 5D41A 4KRDA 3ANRA 3O17A 4NIFB 3V5PA 1W0XC 1K2PA 3BU5A 2PVJA 2VO3A 5IEYA 3LCOA 4I6FA 1YDSE 3EQFA 2Q0NA 3EQPA 3KXGA 4D5HA 3POOA 2YCQA 1Q62A 4K6ZA 1PXJA 4FTIA 2QU6A 3LFAA 4G9CA 4M13A 2VTTA 5KUPA 3EQGA 4IVCA 4KIQA 3F6XA 4FOBA 5AM7A 1TKIA 1H07A 4RFYA 5JMSA 4FEQA 1H0WA 3EN9A 4O83A 4R5YA 3CBLA 5KMJA 2WQEA 4O0VA 3UOHA 5B2LA 2OJFE 5JSMA 2R2PA 5M4FA 3DXQA 4D2PA 2CN8A 3D94A 2XEYA 3RHXA 4PMMA 3WF9A 1Q4LA 2F7XE 2YERA 3P79A 4PMSA 3LJ2A 2GNGA 5D11A 4AACA 2YAKA 3PWYA 4CG8A 4CV8A 3W2PA 4PTCA 4YTFA 3OWKA 4FTAA 3ZO4A 3F7ZA 3HAVA 5FTQA 4FIFA 4IWPA 3E64A 4DEHA 3W10A 3R8ZA 4YJSA 1R1WA 3NW5A 4G5JA 4JQ8A 3V6RA 4AX8A 3EQIA 4L7SA 4Y83A 2VTQA 4OBPA 3ITZA 2WTVA 3AT2A 3UIXA 4O81A 1MQ4A 3PXYA 5D10A 5IZFA 2VTLA 4XP2A 5LWMA 3D7TB 4QQJA 4QMUA 2FVDA 4XP0A 4ID7A 4KINA 3TACA 4Y5HA 4DEDA 5H3QA 5KMNA 4MXZA 4HNFA 4YJTA 4A06A 3MTFA 4ZLZA 4EONA 1NT2A 4QOXA 2BZIB 3GFEA 3KC3A 3FL4A 4J8NA 5TOZA 2UZVA 4XMOA 3VBWA 3ETAA 2WTKB 3HL7A 4GG5A 4LGGA 5E7RA 4BBMA 3R00A 4H39A 3R8PA 3MJ1A 1KE7A 4G3GA 4W4YA 4RPVA 1Q41A 2IZUA 4W8DA 5ANDA 3I6UA 5ANIA 3T9TA 4BCMA 4BDJA 5LVNA 4ZSGA 3DT1A 5LCJA 1ZZLA 1PHKA 2UW0A 4FSTA 3E3PA 4TKSA 4UWYA 2YAAA 2BAJA 5F95A 4CFXA 4MF1A 4JBOA 5J8IA 3CC6A 4FNZA 4X2NA 3W55A 4DGNA 4WG3A 1ZARA 4KD1A 4ZTMA 3R9HA 1A9UA 4R6VA 3SG9A 3VO3A 1PW2A 4FSMA 3R0TA 5B2KA 4QMZA 2J0KA 5ANOA 3QRJA 5L2TA 2B7AA 4FKTA 4MD7E 4LOQA 4I6QA 3NYOA 4W4XA 4HPUE 2BROA 2BIYA 1Y8GA 2C47A 2P4IA 5L6PA 4QNYA 3SW4A 2J0JA 3HV5A 4EK8A 4BKYA 1DS5A 4M3QA 5HIDA 1QPDA 3AC8A 4NKSA 3C4XA 2V7AA 4ASEA 1AQ1A 3BGQA 4KABA 3ALNA 3OEZA 1J7UA 3KU2A 1O6YA 3MESA 3SOAA 3A7GA 3CPCA 2C5XA 1L8TA 4R3PA 3MS9A 1JWHA 4L7FA 4L67A 3ZZWA 2ITVA 2W4JA 3ZLYA 3PSBA 2OSCA 4CNHA 3CKWA 4W4VA 4HPTE 4CFVA 4TY1A 4KAOA 5GJFA 4RWJA 4YJUA 4ERKA 4CV9A 3U6JA 1Y91A 4EC9A 1OKYA 2JKKA 5HO8A 2ZJWA 4FIJA 4CLIA 4IAFA 3O7LD 4I6HA 4I94A 4IJPA 2X81A 2VX0A 4G3DA 3MGYA 1ZYLA 3CCNA 2PY3A 4EK5A 3IO7A 4FEWA 4AW1A 2G01A 2R3KA 2IZRA 4AZEA 2Z2WA 5DEYA 1RJBA 1XHAA 3WE4A 3LPBA 1PMEA 4Q9SA 2PMNX 4OTRA 4CKRA 4JAIA 3DJ7A 2PVYA 3P78A 2B1PA 3WF7A 4EJ7A 3BLQA 1IRKA 2VO6A 1YXVA 5HESA 1LUFA 4ASXA 4WRSA 4YU2A 4TTHB 3K5VA 2W1EA 5HLWA 5HU3A 3LFCA 4MAOA 5DGZA 3Q52A 3TZMA 2V7OA 5TT7A 4FA2A 2F49A 4JX3A 4W9WA 3KMUA 2ZVAA 3RZBA 3SAYA 3MJ2A 4GUBA 3PXFA 2B55A 5ETIA 4AA5A 4AQCA 4L3JA 3AT4A 4WBBB 3RZFA 5HZNA 3FZSA 1CTPE 4FIGA 1CKJA 3UTOA 4Z7GA 3QRTA 3OBGA 5HTBA 3TJDA 4I22A 3DKOA 4UWCA 5J95A 1YHWA 3S95A 4E4LA 2WMAA 3QX2A 3FC2A 4AXAA 4UYNA 1BKXA 3FI2A 2VTNA 1CKPA 5EI8A 4X3JA 1IAJA 1Q8TA 4U3YA 1V1KA 2J2IB 3P7CA 3NPCA 2VX3A 3V5TA 4S30A 2BTRA 5HO7A 2UZWE 1OIQA 3ENHA 1KV2A 4OAVB 3MFSA 2NPQA 2I0EA 4D2RA 2BHHA 4TYJA 1OPJA 3SW7A 2FSOX 1GIJA 2KTYA 3FUPA 3DKFA 3F5GA 3R7UA 4BTMA 3PE2A 2BFYA 5CEKA 1PXLA 4K9YA 2IWIA 2C5YA 4NM7A 4RC4A 4P2KA 3QYZA 4F7LA 5A14A 1Q8WA 2VWIA 5FXQA 4CRSA 4BR3A 3DB8A 2J50A 3P1AA 4XUFA 4FEUA 2AUHA 3DKCA 3R9NA 2J90A 3QAME 4ONAA 3D14A 2OXXA 3K3JA 4QP4A 1KWPA 3I0QA 5EQYA 5HG7A 3FAAA 4XYFA 3OZ6A 3UC4A 4H1JA 4EWQA 2ZV9A 2BTSA 3CTQA 3H9RA 3CKXA 3CXWA 3R1NA 3G6HA 4R1VA 3N9XA 4D4VA 1Y6BA 4GU9A 3I81A 3U9NA 2NRUA 2QR8A 2YLFA 3BI6A 1BUHA 3Q4CA 5BQ0A 4DH1A 4FZDB 5FEEA 3U51A 3E7VA 2XJ1A 4XG2A 4DCAA 3K3IA 3NCZA 3ZM4A 4F6UA 3UVQA 5I9XA 4PP7A 2XNNA 5JRQA 1V0OA 2DS1A 3W8QA 2XBJA 1H8FA 3MDYA 4F64A 3NUSA 4LMNA 3EB0A 4DG3E 3RAWA 3VRYA 2UZLA 4G3FA 4O6EA 5FDPA 3WF5A 4Z16A 4MNEB 3QZFA 5FQDC 1FBNA 2JGZA 4D2SA 3GGFA 4LGHA 1XBAA 5LVPA 1PXIA 2J5FA 2HY81 2Y4IC 3OG7A 4FV5A 1ZYJA 3KULB 3FV8A 3HRBA 1LEWA 4IAYA 3BHUA 3BHTA 3O23A 2ZOQA 3RCDA 3UO4A 2X7GA 4J7BA 5CSVA 3KXHA 4FKLA 5TKDA 4F6WA 4C2WA 2RFDA 2I40A 4AGWA 5KKRB 2YCFA 3VUGA 3DNDA 3M2WA 3BYMA 4KWPA 4NK9A 4TYEA 5EDRA 5E8XA 4FOCA 3QUEA 5IA2A 4F0FA 2C6IA 2BKZA 4ZTLA 1WBWA 4EK3A 2E9UA 4JVGA 3TI1A 4CXAA 2R64A 4R3CA 5L4QA 4I21A 4QTEA 4Y8DA 5KNJA 5DHJA 3LJ1A 1SNUA 2YACA 3LXNA 3M1SA 4E93A 4BVUA 1GZNA 4CFMA 4MQ1A 1H1SA 4CZTA 4NZWB 5GJGA 2XJ0A 1WMKA 4BTFA 4B4LA 4BDEA 5HBHA 4ZTQA 4OBOA 4WUAA 5CASA 3WE8A 2OH4A 2GNIA 4NYEA 3ZC6A 2ITPA 3ZTXA 4M0YA 3OUKA 5LMKC 2X1NA 2YIRA 1KE6A 2O63A 1JKLA 3SHEA 3QRKA 3W18A 3Q04A 2WNTA 4IZYA 4V0GB 3HA6A 3S0OA 5AMNA 3LFDA 5EM8A 3PG1A 5ACBC 3MY1A 3LCSA 4K77A 4XCUA 3WILA 2GHLA 2B9HA 4RLLA 4C02A 3WYYA 2JFLA 3ID6C 4O0XA 1Q8UA 4ACMA 3SX9A 2X6EA 5FP6A 2VWBA 3QXPA 3R1YA 4Y95A 5DI1A 1B6CB 5DR2A 3RGFA 1KE5A 3ENMA 3O96A 4CQGA 4FYOA 5AR4A 2QO9A 5KMKA 2OBJA 5H8EA 5M08A 3CE3A 5IISA 4C33A 4G2FA 2PMOX 4ENYA 1U5QA 5IKWA 4L45A 1R39A 2P55A 5M06A 2UZUE 5JT2A 1H25A 1V0BA 3OMVA 3ZO1A 2XK9A 3TIZA 3R01A 1ZLTA 2YIYA 3CR0A 5IQGA 3L9PA 3PA5A 4OAUC 3FLZA 5FGKA 2WIPA 4YTIA 3WIKA 2O65A 1KV1A 4CMOA 4K0YA 4DGMA 5ANGA 4Z7HA 4AFEA 1XJDA 3UOLA 4IH8A 4E4NA 3LCKA 5CENA 3AC1A 3JVSA 3R7VA 2GFSA 3ORIA 4H3PA 4CMTA 2WTCA 1QCFA 4LV5A 5AWMA 5IG1A 4YZMA 3WOWA 5DMZA 1YOJA 2Z7SA 4P90A 4ZJVA 4F9AA 2Y6MA 3QUPA 4GS6A 5K0XA 3KFAA 3JVRA 3GC7A 3N51A 4IM3A 4W8EA 2GDOA 4HGEA 3FEGA 3Q2MA 3ZUTA 3N4UA 4IX6A 5F94A 3TJCA 5J9LA 3ZBFA 3D5XA 3S4QA 1O6KA 4I93A 2XIRA 2XCHA 3NYVA 2VTOA 4RX7A 2I0VA 5I9ZA 4CKJA 1YOMA 3G33A 4YJRA 4O7LA 4KSQA 3M42A 3KULA 4IWOA 3OTUA 4BICA 1FVRA 2BALA 2XNOA 3OCSA 3EQDA 2QKWB 3F3ZA 5DNRA 3ACJA 3KXNA 4FKWA 4BKJA 1JSUA 5HLNA 5BVEA 3ZO2A 5JFSA 4JNWA 4UBAA 1PJKA 3W32A 3R1SA 2XVDA 5KHXA 4RRVA 4E6DA 4BGQA 5ITAA 3P5KA 3HEGA 2W5HA 4YC3A 1ZXEA 2YM8A 2E9PA 1Z5MA 2CGUA 5AUYA 4I0TA 5AV2A 4FZ7A 3U4UA 3ZMMA 4EQUA 4NFNA 5EKOA 2IPXA 4FTCA 4F09A 3FZRA 5KO1A 2OW3A 3LKMA 4XEYA 1HCKA 3NUAA 2QHMA 3I79A 3ZFXA 4F7NA 4I4FA 5J9ZA 5AP4A 1GOLA 2OIBA 5FG8A 5GNKA 3BLRA 1OUYA 4U81A 4DA5A 3LFQA 4PF4A 4IFGA 3QTIA 3B2WA 3C4WA 4HJOA 2W1ZA 3C13A 2W1CA 4EWHA 5HBEA 5JKGA 3Q4ZA 3BIZA 4GW8A 2HK5A 2QQ7A 4FKSA 5EYCA 3P7BA 1REJA 4YNOA 5L6OA 3H3CA 1T46A 2GTMA 3QALE 4OW8A 3UG1A 3BLHA 3OS3A 4UEUA 4YC6A 4AT3A 2X2MA 3IDBA 3ROYA 3UZPA 4EL9A 4D4SA 1R0EA 4DT9A 4WIHA 5E1EA 2C6OA 2LGCA 4IX3A 4O91A 1WBVA 5EHLA 5ETAA 3AMAA 3LQ3A 3VHKA 3PYYA 4L46A 4EHZA 4TNDA 1B38A 4NW6A 2PSQA 3LZBA 5A4LA 1H27A 4O7ZA 3U55A 3RTPA 4YLLA 3EYGA 4WKQA 1R3CA 3PRIA 5A4CA 4J97A 3NW7A 1E1VA 4RQKA 4BI2A 5CSPA 3PZEA 2VTPA 1OI9A 2C69A 2VWWA 3EYHA 3P23A 5IEXA 4ZJIA 2BCJA 3PRFA 2YIXA 4GMYA 2BAQA 4BCGA 5HU9A 3AOXA 2KULA 2PVFA 4YZCA 3MIAA 4MD9E 2QHNA 4QP6A 4YUQA 4AP7A 3OFMA 3HUCA 2C6EA 4FVQA 5DOSA 5K5XA 4IDVA 4ZIMA 5E9EA 2YFXA 5IEVA 3HVCA 5F9EA 2CLQA 4YPDA 3VS7A 4CRLA 1OBGA 2DYLA 2GNFA 2VRXA 3MY5A 4IJ9A 2OZAB 5I9UA 5EQEA 2UVZA 3GC8A 4RGJA 4TPTA 4L53A 4FICA 4Q9ZA 4R7HA 4BBEA 4FKJA 3RPRA 4EHGA 5HTCA 5LVOA 2UVXA 3T3VA 3F3UA 3QCSA 1CDKA 3OCBA 3IOKA 3TT0A 4ZTSA 5JFWA 5D7VA 4FSUA 1BX6A 3R9OA 5AUTA 5KMOA 4RIXA 5CI7A 4D58A 2VAGA 3KCFA 3MA3A 4FSZA 3V5JA 3DK3A 3IOPA 5E8UA 4FEVA 1F3MC 2JDTA 2RFSA 5BVWA 3VUMA 4EH2A 4EH8A 1ATPE 4ZP5A 4LV8A 2QOKA 3Q96A 4OLIA 2CLXA 2PVMA 4K1BA 4GRBA 3I0OA 1OB3A 5LXMA 2CPKE 5DT3A 1UNLA 2GQGA 3I60A 3QRIA 4X21A 1M14A 3RVGA 4EBWA 4F70A 4U0IA 2QG5A 1OUKA 2OJIA 4JG6A 5DT0A 1JAMA 2ERZE 5EFQA 3LQ5A 3O8TA 4QRCA 3EN5A 3NIEA 2RGPA 3S00A 4F9BA 4CYJA 4NH1A 4M15A 4ITJA 2WFYA 1G3NA 3R7OA 3DNEA 3WYXA 3UIMA 5LOHA 3F3TA 2B52A 4BHZA 5HEZA 5HVYA 4DBNA 4H3BA 3NIZA 3Q9XA 4MBIA 4A9TA 5HQ0A 2WO6A 4GIIA 4BCIA 3R1QA 2WMXA 3C4FA 3FI3A 1L3RE 3Q60A 5HNIX 3GCVA 4OTHA 3PLSA 4S33A 4O96A 4OTPA 3Q9YA 4MXCA 4ZOGA 4MF0A 3I6WA 3ZFYA 4Q5HA 4RJ4A 3MN3A 4O21A 1REKA 3OOMA 4M8TA 3TNPC 3KREA 4I23A 2PUUA 2RKUA 4BCPA 2QOQA 2QO7A 2QOFA 2ZB1A 2XNEA 2WU6A 2CCIA 2QCSA 3TV4A 3WZDA 2JIUA 3AC2A 4KS7A 4UY9A 5CAPA 4XOYA 3GCPA 4LQMA 5AAEA 5CF8A 5CEOA 4IACA 1SYKA 3A7IA 4FG7A 5GJDA 4RLKA 2QOIA 2JAVA 4IBMA 1PMUA 4A9SA 2WQBA 5EM5A 1OKWA 4G6OA 2IW8A 3BHVA 4YZBA 5DFPA 4O0YA 3NMUF 3BHYA 4DFZE 2HELA 2ITZA 3MFTA 4NJDA 5CU4A 5IQAA 4GT5A 4EOOA 5IA0A 4O2ZA 3PY1A 4FSRA 5EHOA 5M57A 5C8MA 3UYSA 5G1XA 1GY3A 2VN9A 3GCSA 5J1WA 5J5SA 3NW6A 2XH5A 4ZZNA 2FGIA 4PQNA 3RK5A 3ZUVA 5IQBA 3F5PA 3A7FA 4AGDA 1O9UA 2XK6A 3ZDUA 4CSVA 4JI9A 1FGKA 3LMHA 4AW2A 5J5TA 4D2VA 3QTUA 2YIWA 2R3IA 2UVYA 3QQFA 5ACKA 4YBKA 1YWVA 2RSVA 5DG5A 1V0PA 2B4SB 4ITHA 4K11A 4P4CA 5AX9A 3VNTA 4EOSA 3MB7A 5M55A 2EXEA 3GC0A 2PPQA 4AGCA 3UVRA 4QTBA 4DHFA 4KKGA 5EK7A 3UYTA 4PDOA 3UQCA 3E93A 3PJ1A 3KVXA 4J71A 5DLSA 3SV0A 3UOJA 1M2PA 5E91A 4BI0A 4WSYA 4YZDA 4DGGA 4XHKB 1OIYA 3NVMB 3PVWA 2Y4IB 1OKVA 2YM6A 3P86A 4DFYA 1YQJA 2VD5A 3QTXA 3ZDIA 4PDPA 4L52A 5HO6A 3ROCA 3MWUA 3CD8A 3D9VA 4V01A 2EVAA 2W1HA 2OU7A 4FKRA 2Y4PA 3SXRA 1QPJA 3DXPA 1MQBA 4AA4A 5LMBA 2XEZA 2HOGA 3CTHA 3PLAE 4PWNA 4Y73A 4DYMA 3QGYA 5J7BA 4YSJA 3BZ3A 3RPOA 2B53A 5BUJA 5BX0A 2PUIA 3HA8A 4IM2A 3OXZA 5TR6A 3HZTA 4A4XA 4FGBA 4QT1A 4DEIA 5K4JA 3HNGA 2R3QA 3QU0A 5B2MA 5IUIA 5AP5A 4D55A 4RX5A 5IPJA 4PDYA 3GNIB 2XIYA 4G9RA 5CQWA 1ZOHA 3TN8A 4CMUA 1TQPA 4PUZA 5EM7A 4AT5A 2OLCA 3TEIA 3DJ5A 5H8BA 2OF4A 3FLWA 3PJ8A 2C6LA 3NLBA 2XRUA 3QQUA 4U6RA 3TV6A 4HVIA 3EQCA 3QQKA 2QOLA 3DZOA 4PMPA 1G8SA 3KRWA 4BGHA 5FXSA 2OH0E 5L2SA 2QODA 2WMSA 4L9IA 2PE1A 2PE2A 5IMXA 2W1FA 4UXLA 2PL0A 4KA3A 4JLCA 3A8XA 1AD5A 3C1XA 5LVLA 1W98A 1BL7A 4LRKA 4O82A 4MYGA 4LRJA 3IW7A 2ZDUA 2GPHA 4WG5A 4YP8A 4GG7A 3SC1A 4MBJA 3NYNA 5M56A 3EZVA 5FLFA 3HDNA 4ANQA 3UC3A 2G1TA 4F65A 3A7HA 4M97A 2GQSA 4FT9A 4D0XA 3LFNA 4FTRA 3UE4A 4F1OA 2BILB 4B9DA 3BEAA 2GHGA 1U4DA 3DQWA 4BDDA 2VUWA 2AC3A 2ETRA 3LAUA 2HCKA 3L9NA 4RJ7A 3MH0A 2FYSA 5DE2A 3ORXA 5J1VA 1H1RA 5DRDA 4D28A 2HW7A 3QX4A 1IA9A 3E5AA 3QD2B 3CJGA 4ASDA 2WTDA 3F2NA 3K54A 4XBRA 4F63A 4F9WA 5L2IA 3HP2A 5AP7A 3OVVA 3ZFMA 2HXLA 2W9FB 4RA4A 2XNGA 3LXLA 4WNMA 4Z3VA 1OM1A 1UU8A 3PVBA 4IC7A 3ULZA 5M4IA 1GJOA 3GBZA 2A19B 4I92A 5JH6A 5IH6A 3V04A 4ANBA 4C4EA 2WQMA 4GV1A 3D7ZA 3GU7A 2P33A 4XLVA 5CU6A 4EQCA 3DS6A 3POZA 4PX6A 5C03A 1H1QA 4DG2E 3DXNA 4O2PA 5DA3A 3UP2A 1BMKA 4ORKA 4C4HA 3WZKA 5M4UA 4U40A 3W33A 1URCA 4MX9A 4C58A 4JJRA 4U41A 5DN3A 5IDNA 2GHMA 5EDQA 1M17A 4ZLOA 2XKDA 3SDJA 5I4NA 4J96A 3GQIA 3ZLXA 3DGKA 1YI6A 2HWPA 3R30A 4O0WA 2IO6A 4ZTRA 4APCA 4RZVA 3QQJA 4Y46A 3WARA 4TYGA 3PSDA 5BYYA 4E6AA 4G5PA 4RC2A 4EI4A 4EK4A 3EFKA 3PZHA 4EKKA 3UMXA 2CDZA 2WMVA 5B0XA 1PMVA 3RPVA 3O8UA 3UODA 3LXPA 5C27A 4QMTA 4BDGA 5CNNA 4GK4A 4FTNA 3F7WA 4DC2A 4ZMEA 1XBBA 3C5UA 2CSNA 2QR7A 2WKMA 4CCBA 2XYUA 3C0IA 4EORA 4C2VA 2JIIA 5LMKA 4YTHA 3I4BA 4TWPA 4B0GA 5CS6A 3W2SA 2G2FA 2H34A 2V55A 3FMJA 4YO6A 2Y9QA 3PJ2A 4L68A 4XRLA 3V6SA 1A48A 4LOOA 4UXQA 4AZWA 3SG8A 4ANNA 2X4FA 1JKSA 4BCQA 3ALOA 4BRXA 2YIQA 3D15A 3COKA 2WGJA 3QWKA 3TZ9A 3ZSHA 4C35A 2YISA 4O0SA 3R7YA 2O5KA 1E9HA 2ITXA 2VTSA 3GENA 1H0VA 2F2CB 3E62A 3ZBXA 5CZHA 4FV4A 4DF3A 5CU0A 1UVRA 1Q99A 4M12A 1XQZA 4UMPA 1PXKA 1UWHA 3VQHA 4EH3A 3QA0A 5HD4A 3P4KA 3E88A 1DAWA 3NYXA 2YABA
chains in the Genus database with same CATH superfamily
3ACKA 3OBJA 4H3QA 2QU5A 4FKPA 2Z7RA 3IECA 4IAZA 4ALUA 2C6TA 5M4CA 4F9YA 4AN9A 3DY7A 1PXNA 1YXTA 4KRCA 4TYHB 3VJOA 3L8SA 4CVAA 5A3XA 2QVSE 1P2AA 3PDTA 3BX5A 3ERKA 4DH8A 1ZMUA 3H0ZA 5J7BA 2XKEA 3QYWA 5IUGA 4KNBA 4Z55A 5HG8A 3DBDA 3HUBA 1UU7A 3VF9A 4E1ZA 2BRMA 1OL1A 2X0OA 2YLEA 3OHTA 1S9IA 2AC5A 2WMUA 3QKMA 4PTGA 4D1ZA 4A4OA 5I5ZA 2F57A 4CGAA 2XF0A 3W2OA 1SMHA 2C0OA 2EB2A 3I7BA 3JPVA 3L9MA 1W83A 2J0LA 2J9MA 3PG3A 4KIOA 1I44A 2X2LA 3IW8A 3RPSA 2ETKA 4EOLA 3R83A 2B0QA 1JOWB 5E8YA 3WI6A 1JLUE 5H9BA 4GFMA 2FUMA 2WMQA 3AD4A 4QP8A 4WBOA 3RWPA 2QKRA 5EW3A 4U42A 4HVHA 4BWKA 4F99A 4IMYA 5CI6A 4QPMA 3W1FA 2J51A 4KKHA 3OCGA 4AAAA 3AC3A 4I20A 3QCXA 4IVAA 4NTSA 4BTKA 2WZJA 2E9NA 3DQXA 1Q8ZA 4MK0A 4U97A 2B9JA 4XX9A 3NRMA 5FEDA 3O7LB 3UPZA 4QQCA 5HVKA 4JOAA 3NNWA 1OECA 3D0EA 3LMGA 4F7SA 4E5BA 2J0MB 3KN5A 4RVLA 5FTOA 2OXYA 2BRHA 4IM0A 3FQSA 4LV7A 4LM5A 4MHAA 3VBYA 4CFNA 4OTQA 3VUHA 4OBQA 3VUDA 4F6SA 4BCKA 2HZ4A 4BZDA 4B8LA 2XK7A 5A46A 3CD3A 3ORLA 5AJQA 4AZVA 5IDPA 3DDQA 2J0IA 4JXFA 5CNOA 1YHVA 3L8XA 2VX1A 3EMGA 1OMWA 2OK1A 2BVAA 3ET7A 1YWRA 4FTMA 4Z9LA 2OFVA 1FMKA 3KA0A 3FC1X 4GEOA 4TWNA 4YNEA 3VVHA 5KMIA 2IVUA 4IZ7A 4XV1A 1SVEA 3LE6A 1HCLA 2DWBA 2ITUA 4ANLA 3TXOA 4IHPA 3T8OA 4OTIA 4LDTA 4YZ9A 4QD6A 4JR3A 5ANEA 3H9FA 1WVXA 2B9IA 4KKEA 3RI1A 1J7LA 1G5SA 3FWQA 3PIZA 4PPBA 2GCDA 3ZONA 1GZ8A 2C4GA 4MTAA 3IGGA 4LL5A 4PRJA 5CVHA 5EOBA 3ORPA 4ZEGA 3NR9A 4BCHA 3O8PA 4GKIA 4GL9A 3NX8A 1BI8A 2QOOA 3HV6A 5EOLA 2BIKB 3DK7A 1OPKA 3AQVA 3FSKA 3CJFA 4RJ8A 4UWBA 3CQEA 4IZ5A 3PFQA 5HE1A 3KXMA 2BHEA 2VWXA 3I1AA 3Q4UA 5JFXA 1ZYDA 1FVVA 2OJ9A 3MPTA 4FVRA 5AUVA 2QOCA 2QURA 3A61A 2EU9A 2P2IA 2R3RA 4J8MA 4EHVA 5I3RA 3GT8A 4HZRA 2PHKA 2WTJA 3DBQA 3KXXA 2OFUA 4NW5A 4C4IA 2R3PA 4YURA 5CLPA 4O7VA 3DBFA 4E26A 3VUKA 3MVHA 1M52A 3P9JA 4TYHA 1K3AA 4AF3A 5A4TA 2W4OA 2WAJA 4YJNA 4L43A 3W2QA 2ITOA 2C3IB 2OKRA 2UZEA 1PMNA 3CEKA 3U6IA 2ERKA 4EEVA 5DEWA 5C1QB 3IW6A 3R63A 4XV3A 1K9AA 2WTIA 4PDSA 1XH7A 3AMYA 1FMOE 4EKLA 4YHJA 1H08A 4XS2A 5AR7A 3VBXA 3PJ3A 3UVPA 4CFFA 4GJ2A 5C26A 3UDZA 1VYWA 5GZ9A 4EYJA 4BN1A 5AUWA 4AU8A 1KUTA 3LFFA 3HRCA 5JN2A 5G6VA 4O0TA 2BDFA 5TF9A 3A4OX 5HG5A 3C51A 3FMDA 2ZV8A 4QO9A 1XH4A 3AGLA 4YO4A 4ACGA 3MH3A 3P08A 4J1RA 2VNWA 3OP5A 4FI1A 4FT0A 3H10A 4FIEA 3G9LX 5H8GA 5DWRA 3H30A 4XG4A 3C0GA 3UJGA 4B7TA 4BIDA 1XH5A 1WZYA 4A4LA 2W0JA 4P5QA 2IN6A 5HNGA 4RJ3A 4EH4A 3MBLA 3IW4A 2HAKA 5DVRA 4R7BA 3PY3A 1JSVA 5HICA 4I1ZA 3GU8A 4GFOA 1MRYA 4HVDA 2PZIA 4Y85A 2ONLC 4A7CA 3DDPA 3UIUA 4EOQA 5GINE 4QTDA 3HMOA 3LQ8A 1OZ1A 1YXSA 3HMPA 4D1SA 4E4MA 5HX6A 3EKKA 4O22A 3HAMA 2PVRA 2PZYA 2WOUA 3OOGA 2UZTA 4D4RA 4JDJA 3MPAA 1XH8A 3R02A 4BZNA 2J7TA 3KCKA 4O6LA 4X6RA 5FEQA 5JK3A 3F9NA 3QC4A 5AR3A 3QCYA 3SD0A 5CAUA 3GFWA 4RX9A 1GZOA 5L2QA 5IQIA 2Y8OA 5CT7A 3ZHPC 4IANA 3FPQA 4DHZA 3KQ7A 5AM6A 2A0CX 4CTCA 3OW3A 2XUUA 4RIWB 4G6NA 2YM5A 3GOKA 4D5KA 3BQCA 4I0RA 4X2JA 4A9YA 1MUOA 3GU4A 4BCJA 1Z9XA 4F08A 4EZ7A 4ZS0A 4UB7A 3PY0A 2BAKA 3EKNA 4IB5A 2YZAA 3BELA 4YZNA 3RMFA 5K5NA 1XH9A 5BNJA 2YWPA 5FM3A 2W7XA 5CVFA 2F9GA 1OL2A 2XP2A 2VGOA 1W84A 3PUPA 4G16A 1W7HA 3CS9A 4QPAA 2FH9A 4CLJA 4GKHA 1OGUA 3WZEA 2R3MA 3TG1A 3A2CA 2JBPA 5L8LA 3EL7A 3MH1A 4BDCA 5H2UA 2BZHB 2UW9A 2QLUA 5M53A 3FQEA 3HLLA 4K8AA 3PPZA 4DCEA 1QPEA 1YI4A 2BRNA 2OZOA 4I5CA 4C38A 4DN5A 2XB7A 4ITIA 4Q5EA 4C7TA 2A2AA 4FV8A 3CTJA 4FG9A 4MXAA 3SKCA 4CCUA 4EUUA 4R78A 2HENA 4RWKA 4DGOA 4N6YA 1ZWSA 2YDIA 3RK7A 4HNIA 4E5WA 3JR1A 3Q32A 1W2CA 1APME 5L2WA 3TUDA 2WQOA 5K9IA 4GVAA 3SRVA 5JGBA 3JYAA 2FSLX 5FBOA 3ZYAA 5C4KA 4IZAA 4R1YA 4RIXB 5HOAA 3FE3A 4JS8A 4C36A 3UO5A 5HCZA 3JUHA 2JDVA 3G90X 3QHWA 4W9XA 4BB4A 3V01A 1YKRA 4WSQA 2YWVA 4D1XA 3VIDA 4J52A 2XS0A 4C62A 3UZRA 2CNUA 1XKKA 4Y5QA 1VR2A 4QMWA 3ZSGA 3DAEA 2W99B 3V5LA 2OI4X 5BYLA 4FK6A 3V5WA 2W05A 3MTLA 1I09A 4IQ6A 4AN2A 3VS6A 2CKPA 4RWLA 3MI9A 4YSMA 4EK6A 3QLGA 2XCKA 2JD5A 3IGOA 4OUCA 2VWZA 4FV9A 2CNQA 4TYIA 5CSWA 3LIJA 4FEXA 4LL0A 3FZ1A 4M69A 4YBJA 2JEDA 1OITA 2F4JA 4XH6A 3NSZA 4NU1A 4QMPA 4YPSA 3LFBA 3KXZA 5CWZA 5I0BA 3OEFX 5CF5A 3O0GA 3FKLA 1J1BA 4IB0A 3RAIA 3UMWA 4C34A 5M07A 4RSSA 3QZGA 1XO2B 3VAPA 2QOHA 3ZRLA 4CT1A 4LRMA 4AAYA 2W4KA 4E20A 5CF4A 2JDSA 2W9ZB 4FNYA 4E5AX 3QGWA 1PYXA 5FXRA 2IZSA 1H1PA 4WHZA 2B9FA 4TT7A 3W8LA 4BTJA 2O2UA 3TKUA 3PFYA 4FYNA 4FL2A 3FMNA 4EOPA 4QTAA 2XK4A 3TMOA 2VZ6A 5FRIA 4A9RA 3MB6A 3V8SA 1JKKA 4J95A 5HIEA 3NUXA 3UQGA 4O7SA 2ITQA 5HHWA 2Y0AA 3PIYA 2H96A 2WPAA 3DOGA 4O1PA 2BDWA 4GU6A 5I9YA 5KCVA 1PRYA 4KIKB 3E63A 4EOKA 3UDBA 1IR3A 3FMKA 3VS2A 4FV1A 4C4FA 4IAKA 4RIWA 1GIIA 3S1HA 3NUYA 4AT4A 4TWOA 5HI2A 1JSTA 4WOVA 4BWPA 3OT8A 4MCVA 4LGDA 2JAMA 4GFGA 3COHA 5CT0A 1U46A 2F7ZE 4U44A 3BPRA 4IC8A 1XBCA 4EH6A 1XWSA 3BBTB 1PKGA 4M68A 4XOZA 3QTSA 4FSWA 3QLFA 5A54A 5KBQA 3D5VA 4FTKA 4QYGA 4IB1A 3V8TA 4AZFA 5C8KA 3VRZA 3Q6WA 2NP8A 3AGMA 3W0QA 3RBWA 5A4EA 3EL8A 4N4SA 5D12A 3D2KA 4QDEA 2VTRA 3ATSA 3TUBA 5HTIA 4IAAA 5AAFA 3KMWA 1B39A 1IA8A 5E1SA 4MQ2A 1O6LA 4DFXE 3FBVA 2FSTX 3VHEA 3ULIA 2JDRA 3KVWA 2BRGA 1YI3A 1OKZA 2XIXA 5EQPA 2VO0A 3AD6A 2WMTA 3FMEA 4O4CA 1XMMA 4BY9E 1RQQA 2BUJA 3RHKA 4QMMA 1FVTA 2GS7A 1IEPA 3UG2A 4AZTA 2PULA 3SQQA 1WFCA 5GZ8A 3BHHA 1HOWA 4D2WA 2OJJA 4U7ZA 4RT7A 3DPKA 4BF2A 3TNHA 3EFJA 1YDRE 1KE8A 3NNXA 3KK9A 3EQBA 2C1BA 3LW0A 2R0UA 3D83A 4NJ3A 3ZC5A 4AA0A 5D1JA 4C57A 4FTQA 5IF1A 5HLPA 2CNVA 2P2HA 4JAJA 3PVUA 3LCTA 4O1OA 4RIYA 4G17A 3KF4A 3ZXTA 3GCUA 2ITNA 4X0MA 4AW5A 3EFLA 3GP0A 4ANSA 4BCOA 4DH3A 1QL6A 3ATTA 2WQNA 2PVHA 2X2KA 1NVRA 5FWKK 1UU3A 4I4EA 2JKQA 2YCRA 3CGOA 4APPA 1WBNA 5LJJA 3TIYA 4O7RA 5BMSA 3FZPA 5LQFA 4DG0E 5IQEA 4N57A 1GNGA 1PYEA 2C0IA 5C01A 3PPJA 4KBCA 4BGGA 4D4YA 4D9TA 4DLIA 2IVTA 4AGUA 1U54B 2FA2A 4AOJA 5A9UA 3AXWA 4FKVA 3GXLA 4BWXA 1FINA 3K2LA 1TQIA 2V22A 1KE9A 1YXUA 2C68A 3OF0A 2ITTA 2ZB0A 4L6QA 4F0GA 5I9WA 3LHJA 3D2IA 3WIGA 4F9CA 3HMNA 2O0UA 3LM0A 2IZTA 2O8YA 2EB3A 4AG8A 1P5EA 3KF7A 4C3PA 3BRBA 1BL6A 4F78A 2ZDTA 2I0YA 5AR8A 4EUTA 2EUFB 2BMCA 4NKAA 3T9IA 1YOLA 3FXXA 4R3RA 3OY3A 4PTEA 3ZUUA 4MNFA 4RZWA 4TXCA 5E8TA 3R2BA 1UU9A 1H28A 1OL5A 3G51A 4UMQA 1CKIA 4RVKA 3CY3A 4ERWA 3UOJA 3N4TA 2VWYA 5CAQA 3VUIA 4KIKA 4NM0A 3NNUA 2NO3A 1NA7A 4QYEA 2O64A 3F82A 3W2RA 3O51A 2IJMA 2G2IA 1OPLA 2I1MA 4OTGA 5CU2A 2ITWA 3GU6A 4USDA 5CALA 4EH5A 1LPUA 2CKOA 2GS2A 5AV1A 4WRGA 5CEMA 4E7WA 4FF8A 3PUFC 3TDWA 3ELJA 4FUXA 4HYHA 4O0UA 5FUTA 3FMLA 2Z7QA 4EC8A 4JG8A 4JR7A 3BEGA 4K18A 3QFVA 4R8QA 3TKIA 2E2BA 4WNPA 4B99A 4C3FA 3D5UA 3UOKA 1KOBA 2CMWA 3Q2JA 4S34A 4X3FC 1STCE 4MXOA 4O7NA 4ZJJA 2FO0A 4LFIA 2ACXA 3DCVA 4X7QA 3UNKA 4S2ZA 1KOAA 2RF9A 4IFCA 2F2UA 5JZNA 4JMQA 3QD0A 4MVFA 3GVUA 1SVHA 3PPKA 3FL5A 4ZXTA 3I5ZA 3VBQA 3CSVA 4XLIA 5AUXA 1RE8A 1CMKE 3VONA 3ANQA 2VO7A 3GQLA 3GU5A 5FBNC 2XNBA 5GHVA 2LAVA 4B6LA 4P7EA 2H8HA 4FC0A 4U79A 2CGWA 3JXWA 2C30A 4C37A 4QMNA 3ZEPA 2X8DA 3KEXA 5AV4A 1ZOGA 1Z57A 2HZ0A 3BV3A 3FZTA 4BDAA 5HE2A 2AEGA 1H01A 1J3HA 4JQ7A 3QF9A 1ZAOA 2VTMA 3CQWA 4PL4A 1G8JA 2WMRA 5JEBA 5F4NA 2ZMDA 3NAXA 5A6OA 4L8MA 2OIQA 4FZFB 4PNIA 4Q2AA 3CGFA 4NTTA 1ZY4A 1PF8A 3VULA 4UMRA 3FKNA 3MH2A 2VWVA 5BVDA 4H05A 4CT2A 2XAOA 4FE2A 3RJCA 4U43A 2VTIA 1OVEA 2R3OA 4RJ5A 4QQTA 3TKHA 4HVSA 5EI6A 4CKIA 4E8AA 3FHRA 3Q6UA 4AQKA 3DLZA 3PSCA 1H1WA 3W2CA 3THBA 3BGPA 2UZNA 4F1TA 2X6DA 2W06A 4WD5A 4II5A 4FUYA 4GVJA 3VS5A 1U54A 2UZBA 1FQ1B 3ORKA 4QMYA 2VTAA 4AOTA 2R5TA 1CSNA 4E73A 1ZZ2A 4GUEA 1TQMA 1BI7A 3MVJA 2OIDA 3IKAA 3CY2A 5JZJA 5KZ0A 3MVLA 5KBRA 3EN6A 4F7JA 3G9NA 5L8JA 3R71A 4ENXA 5B7VA 4RG0A 2JLDA 2Q0BA 3H0YA 4HVGA 2BZKB 3R7IA 3NUPA 1ZOEA 3TZ7A 4F4PA 5CQUA 5KMMA 5EYDA 2JKOA 4DH5A 4O27B 4E6CA 2ZYBA 4EH7A 3NCGA 4ZAUA 2J4ZA 5CANA 1IG1A 3BE2A 4HCUA 2RG6A 3DV3A 4RX8A 2CJMA 3UBDA 3U54A 1FOTA 3IW5A 5LMAA 3W0OA 4JDKA 4YJQA 3PJCA 4GK3A 3BV2A 4O7WA 4DTKA 5AADA 4FKUA 1JNKA 2CKEA 4KBAA 5BVKA 5IH5A 3G15A 4FKIA 4ACHA 4IXPA 4J99A 5AV0A 3L8VA 3LOKA 3OY1A 5BVNA 2XMYA 3QQLA 5JGAA 3B8RA 4WNKA 3OT3A 4LYNA 4I0SA 5JQ5A 3MA6A 2OO8X 4ANMA 5E92A 5DBXA 3LFEA 5HBJA 4BZOA 4QMXA 4E3CA 3FYKX 4PY1A 1F0QA 5CEQA 4BDIA 2GTNA 4HCVA 4J53A 2QOBA 3EWHA 5HVJA 3BWJA 5CY3A 4AZSA 5ETFA 4HYUA 3A8WA 3TTIA 2X7OA 4BC6A 4BCFA 1ND4A 3KRRA 4IVDA 3LLAA 3LXKA 4UYAA 3A99A 3JS2A 3REPA 3DZQA 3BWFA 3K5UA 3KN6A 3FXWA 5FD2A 4WA9A 3A62A 3TCPA 2DUVA 3OTVA 4F0IA 4RFMA 5EW9A 3LFSA 5FM2A 4QMLA 4YC8A 5FDXA 3VQUA 4CFWA 2PZ5A 4BYJA 1M2RA 1NVQA 4YJVA 5IA4A 5CSHA 4M7IA 5J9YA 4YHFA 2HZIA 4NEUA 4GT4A 4TRLA 3RM6A 3TWJA 2X8EA 2PZPA 4AUAA 3F69A 4JDIA 3F5UA 3DU8A 3PXZA 1H26A 3VWAA 4J98A 2ETMA 5AR5A 1URWA 5FP5A 1TVOA 3COIA 3G6GA 4RVMA 3S2PA 4PNKA 2XRWA 4ZY4A 2R7IA 3W16A 4OTWA 1WVWA 4PL5A 4H58A 2HYYA 4XJ0A 3EH9A 4AFJA 3QD4A 4R7IA 2X0GA 4ZSEA 5CTPA 4MWHA 4ZTHA 3V5QA 1ZYSA 1WAKA 2QI8A 3UPXA 2PTKA 3QBNA 4QP9A 3FSFA 4M14A 3F88A 4JL9A 4FSYA 2OXDA 4HCTA 4FT3A 4NM3A 3OWLA 3IPHA 4MWIA 5BMMA 4DINA 5GIPE 3BE9A 4DTAA 2C5OA 4FX3A 4UMUA 2UW8A 4LOPA 4H36A 4DEEA 1M7NA 2E9OA 1NXKA 3CPBA 3FMMA 3KRJA 3ORNA 4XBUA 5CVGA 4O7TA 4R77A 2ONLA 3BBWA 3U4WA 2XK3A 4EHEA 2UV2A 3E8DA 3JY9A 3KMMA 3P0MA 4DH7A 2UUEA 3IDPA 4CEGA 2C1AA 4F1MA 4FNXA 2EWAA 4NCTC 4PPAA 2W1GA 4NL0A 2R4BA 3D4QA 4Y72A 4QEBA 3E7OA 4R5SA 3QL8A 4MKCA 3ZLWA 4OT6A 4ZZMA 3NFFB 4E6QA 2WEIA 3NDMA 2JDOA 3DBEA 3FPMA 3EFWA 2JIVA 5HIBA 3C9WA 4ALVA 4NIFA 3FKOA 1SNXA 5TO8A 3O50A 5D9HA 3F2RA 5E4HA 2QNJA 4BL1A 3PIXA 3EQHA 4L3LA 3UNJA 3KY2A 5CXZA 2RL5A 2VU3A 4EJNA 5E8WA 3RP9A 3ZU7A 3RK9A 3NVKI 2A27A 4BDBA 5M44A 2WHBA 1XR1A 2A98A 2OWBA 2UW6A 3AC4A 4O38A 5DRBA 4EOIA 4FTLA 2XK8A 5EKNA 3DLSA 3C5IA 3GEQA 1OL6A 2OF2A 3DFCB 4FTTA 2C3JA 3SA0A 1M7QA 2SRCA 4LUEA 1DAYA 3R6XA 3TNQB 1WBPA 4DFLA 4UALA 5CEIA 1R78A 4FTUA 3RWQA 5DR6A 2A1AB 1UNHA 4ZTNA 5AR2A 3QKLA 4I41A 3HKOA 4DT8A 2VGPA 3QTRA 4NM5A 4BFMA 2R3FA 3OXTA 3R7EA 5AAGA 3CLYA 3TDVA 3KIOC 1JQHA 1KSWA 1SZMA 3W0NA 1QMZA 3Q9WA 3HMMA 4AS0A 2UZOA 2X9FA 3QD3A 2WB8A 2GNLA 2YJSA 2HXQA 3D7TA 3FI4A 3MV5A 3QC9A 4OGRA 4L42A 4OTDA 4PP9A 2ZAZA 4HYSA 4LMUA 4MXYA 2F7EE 5DT4A 3S3IA 2UW4A 3B8QA 5HE0A 3VC4A 1W82A 5L3AA 2NNWB 3QTZA 5E8SA 4HW7A 4KS8A 4UMTA 5EDPA 2GMXA 3ORZA 2YDKA 3QWJA 4G34A 4A07A 5CF6A 2Q83A 5J87A 2C6DA 4HGTA 5EW8A 3EOCA 3PP1A 3DBCA 3DTCA 3VW6A 4L01A 2JITA 4UZDA 2YM7A 3TZ8A 4H1MA 3QRUA 2XM8A 3F3VA 3RKBA 2P3GX 4ZS4A 4IE9A 5JFVA 4IADA 5HE3A 2CGVA 3P7AA 1OIRA 4KUJA 3FLNC 1A06A 5FTGA 4BDFA 4CZYB 2PU8A 3NUUA 4GSBA 5GZAA 2OJGA 2BDJA 1LEZA 3A60A 3IONA 5JQ8A 2HW6A 4MD8E 3AD5A 3HV7A 4K33A 3RNYA 4YGAA 4GYGA 4AWIA 1DM2A 3R22A 5F20A 4GIHA 3U8WA 4C0TA 4IDTA 3R8MA 4YMJA 3VS3A 1DI9A 4FSNA 3BL9A 2R3JA 3IG7A 1J1CA 4KB8A 3PWDA 2RFEA 1W8CA 3C4ZA 4IIRA 4NT4A 2VV9A 5GIOE 3E92A 4JRNA 3TNIA 3BQRA 2ZM3A 4KBKA 4U45A 3R8LA 3TTJA 4ZK5A 4RJ6A 5CSXA 3VF8A 5EI2A 1XH6A 2Z7LA 3R8UA 3BKBA 5AP3A 1ZYCA 2FSMX 3MYGA 4U3ZA 4AW0A 3HV3A 1JPAA 4N0SA 4E4XA 3WBLA 1P14A 5LVMA 4WT6A 1Q61A 1H4LA 3HECA 4FVPA 4EOMA 1NW1A 3OROA 5AFVA 3MVMA 4NUSA 2Z02A 3EJ1A 1JBPE 4LI5A 3FLSA 1WBOA 2EXCX 4UN0C 4OR5A 4S32A 5ANKA 3M11A 3SRVB 3F61A 5BPYA 5AEPA 4FJVA 2C6MA 3HGKA 5E8VA 4DDIA 1UA2A 2QC6A 3OWPA 5BVFA 5K4IA 2HWOA 4ANOA 2XBAA 4X3FB 2C3LA 2IG7A 4O4BB 5IH4A 2Y6OA 4BIBA 3Q9ZA 4AN3A 4CYIA 4YLJA 2W5BA 3MW1A 4QMVA 3ZS5A 4C3RA 3R04A 3COMA 4CD0A 3EN7A 5BV3A 2XM9A 5CEPA 2WXVA 2ZM4A 4FNWA 4IX5A 4JT3A 4DHJA 3LMIA 3F66A 4I3ZA 5LARA 1UKHA 3RM7A 2PVKA 2ITYA 3HP5A 3MFUA 4M69B 3VN9A 4K2RA 4XG8A 4JG7A 4HGSA 4C4JA 2H9VA 4QQ5A 3BYUA 3QA8A 4EQMA 2R7BA 1YVJA 3LVPA 4U9AA 3PXQA 3IK3A 2X9EA 4YTCA 4C4GA 5DH3A 3KL8A 3FLQA 1Y57A 4IB3A 1ZRZA 5T68A 2Z60A 4C59A 4D2TA 1LP4A 3AMBA 3ZCLA 2PYWA 5ETCA 4I6BA 3A4PA 2RG5A 3JY0A 3O71A 2XJ2A 5EYKA 5HG9A 4USFA 2XA4A 1NY3A 5HKMA 1Q3DA 3BGZA 2G2HA 3MY0A 5IQCA 3ZRMA 2WMWA 3OC1A 5EH0A 4EZ3A 3WF8A 3F5XA 2WMBA 3IDCA 3WZUA 2XZSA 3G5DA 3KRXA 4RBLA 3NS9A 4FV0A 4V04A 4ACDA 2P0CA 3PXRA 5IQHA 2JFMA 3OUNB 2XIKA 4I5MA 3LCDA 4QP7A 5AUZA 4NWMA 3SXSA 4TW9A 3U9CA 4JX7A 4DGLC 1YDTE 1T45A 4QMQA 3NNVA 1U59A 3FY0A 4XV9A 3OW4A 4ASZA 3FI8A 3WZJA 1Q3WA 2OGVA 4DBXA 5AP6A 3DTWA 5KMLA 4IW0A 3TNWA 3HDMA 5A4QA 3QTWA 2QD9A 3SLSA 4CG9A 4YR8A 1Q24A 1R0PA 5IA3A 5L8KA 1ZY5A 5CAOA 3IS5A 3QZIA 3ZM9A 4M66A 5IMEA 4YJPA 3BLAA 2YN8A 3F2AA 3R9DA 1OBDA 1QPCA 4XG6A 4FMQA 3UO6A 2XIZA 2HIWA 2IVSA 1J91A 2CHLA 5F1ZA 2OICA 1Q5KA 1SM2A 2PK9A 3EN4A 4M84A 4YJOA 2BRBA 4B8MA 4D0WA 3OCTA 4ZY5A 2R3NA 3SVVA 1PXOA 2BZJA 2C0TA 3W0PA 2JKMA 4D9UA 1Q8YA 4EOJA 2BFXA 2I7QA 5AP2A 4MNEA 3B2TA 3AT3A 1ERKA 3FXZA 5CX9A 3QQGA 4X3FA 2WU7A 2YM3A 3GC9A 3U87A 1CM8A 4FR4A 5IU2A 2CKQA 2ESMA 2WTKC 3QZHA 4ZLYA 3VS0A 5LWNA 3NGAA 3NUNA 1ST0A 5HGIA 3BCEA 5K3YA 3UP7A 4FZ6A 4C61A 3HRFA 5A6NA 4RIYB 4JBVA 4QYHA 4XG9A 5M51A 4XP3A 2HY0A 2X7FA 3ZH8A 3II5A 4RVTA 3ORMA 4JRVA 2C6KA 3D5WA 3E8EA 3QKKA 2B54A 4FIIA 3HMIA 4GT3A 4JQEA 5C4LA 2IW9A 4AXCA 3PE1A 4MH7A 2Z8CA 3C50A 3DAKA 5BUIA 2GNHA 4PPCA 4O7YA 2BKKA 2UW3A 4RFZA 5KE0A 2DQ7X 2PMIA 4FIHA 3QXOA 4XG7A 2CCHA 5ICPA 3MIYA 3GUBA 5CYIA 2PVLA 2WD1A 5K0KA 4ZSAA 4CQEA 1WBSA 3GOPA 5J79A 1EH4A 4W4WA 3PA3A 3CQUA 4G31A 4MBLA 4GJ3A 5KHWA 2R3LA 1Q97A 1GZKA 3Q4TA 4XG3A 2VTHA 4TWCA 2WEVA 4IEBA 5C8NA 4FGRA 1VZOA 4FV3A 3KRLA 2YJRA 2V5QA 3I7CA 3KKVA 4V0GA 3N4VA 1RW8A 1FPUA 3RNIA 4BDHA 3MPMA 4WUNA 2JC6A 3E87A 4FL1A 2R3HA 4PMTA 2ZFYA 5ANJA 3ZOSA 3ZLSA 1MP8A 1Y6AA 5AA8A 4O4EA 5CAVA 4M0ZA 5IQDA 3EZRA 3HV4A 5CU3A 4DLJA 3QCQA 1PKDA 1OIUA 5AIKA 3E8NA 3AC5A 3H4JA 4L3PA 3G0FA 2QLQA 3SOCA 2GS6A 5KZIA 2YZLA 2ZMCA 1ZMWA 4HZSA 2V0DA 4IX4A 4JBQA 3BYSA 1BLXA 1X8BA 2GFCA 2VWUA 3GB2A 3HYHA 4ACCA 4QP3A 3O2MA 2YM4A 4QP2A 3ZEWA 5EHYA 4BCNA 3Q5IA 4BHNA 3DA6A 2FB8A 1UWJA 1SVGA 4WG4A 4RC3A 2VTJA 2X4ZA 5D7AA 3PTGA 3PP0A 1OL7A 4GYIA 2UZDA 4IVBA 4ZSLA 1DI8A 2C5NA 4A9UA 3G0EA 1WCCA 1IASA 4NSTA 2PUNA 3Q3BA 4HOKA 4I5PA 4QTCA 3MFRA 4QNAA 5E8ZA 3RCJA 4HGLA 3IQ7A 4DE4A 3TM0A 1PXMA 1Y8YA 1YW2A 3L8PA 4ARKA 3V51A 2HZNA 3EHAA 2YCSA 4MEDA 3RINA 3C0HA 4N70A 4DFUA