2JFLA

Crystal structure of human ste20-like kinase (diphosphorylated form) bound to 5- amino-3-((4-(aminosulfonyl)phenyl)amino)-n-(2,6- difluorophenyl)-1h-1,2,4-triazole-1-carbothioamide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
288
structure length
286
Chain Sequence
YEHVTRDLNPEDFWEIIGELGDGAFGKVYKAQNKETSVLAAAKVIDTKSEEELEDYMVEIDILASCDHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTLDALNYLHDNKIIHRDLKAGNILFTLDGDIKLADFGVSAKNTRIQRRDFIGTPYWMAPEVVMCETSKDRPYDYKADVWSLGITLIEMAEIEPPHHELNPMRVLLKIAKSEPPTLAQPSRWSSNFKDFLKKCLEKNVDARWTTSQLLQHPFVTVDSNKPIRELIAEAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords STE20-LIKE SERINE/THREONINE-PROTEIN KINASE
publication title Activation Segment Dimerization: A Mechanism for Kinase Autophosphorylation of Non-Consensus Sites.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 286
sequence length 288
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jflA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jflA01
3MGYA 1H26A 3O50A 4AWIA 3RPOA 2OXDA 3D4QA 4W9WA 5GIOE 2W1IA 5LQFA 1CKPA 3ACJA 5IQEA 5HLPA 4YJVA 3QZGA 3FHIA 4R3CA 1J7LA 5AM7A 4BCKA 5BVOA 5KKRB 4O0TA 1ZLTA 3TN8A 2NRUA 2JC6A 3LOKA 3MB6A 3R1YA 4BVUA 2PL0A 2ONLA 3RTPA 3LCDA 1M7NA 2A27A 3EQCA 2VTRA 1Q8ZA 2CCIA 2XBJA 3NUNA 2OJFE 4QTBA 5TT7A 3IKAA 4APPA 3PJ3A 4MF1A 2Y9QA 4FG8A 2RF9A 3O17A 4AA5A 2QO2A 4BBMA 2J5EA 5D1JA 4EWHA 3WZJA 1ATPE 2PE2A 4FSUA 4F65A 2IWIA 2WEIA 5FDXA 1OPKA 2PWLA 4OTFA 4Z7HA 5A4CA 4R3RA 3LXLA 1E9HA 3NIEA 2QR7A 4WUAA 3F3TA 3AD5A 4NM5A 4RVKA 4FG7A 5F1ZA 3W2OA 1OBGA 3P4KA 3VF8A 1DM2A 2Z02A 2XK4A 3TJDA 3F2RA 4D1SA 3CQEA 4M7IA 4A4OA 3EQFA 4B7TA 3OC1A 1X8BA 1W98A 5CXZA 4K8AA 5HE3A 5AUVA 3RK7A 3MPMA 2RFNA 4FL3A 4JS8A 2QVSE 5KMLA 4Y85A 1CKIA 4IX3A 2BAKA 4GVJA 3H0ZA 3D5WA 2WOUA 4WG5A 1Q97A 1M14A 5ACKA 3C4FA 5K4JA 4HCUA 5IQHA 4UXQA 4G34A 3S0OA 4QMQA 5JQ8A 4OAUC 5BVEA 4QMYA 3IOKA 5LWMA 3VS3A 5KMKA 3TT0A 5IUIA 3SQQA 3TXOA 2CN8A 4TYHA 4OT5A 1BUHA 2R3GA 4MBLA 4UWYA 1FVVA 1UKIA 2XRUA 1XH7A 3R9HA 4IZ7A 4CKJA 2XM8A 4Z3VA 3PP0A 1Q41A 4EK3A 4U43A 5GJDA 2B53A 2C6KA 4MXXA 5EKNA 3HL7A 4YGAA 5J8IA 4L67A 3F6XA 3V5WA 3WF8A 3CIKA 5L2WA 4I0RA 3ORXA 3DBCA 3EHAA 2XKDA 3NGAA 2EWAA 4I41A 3EWHA 4TWNA 2UZNA 3DDPA 2YM7A 5DT3A 3F3ZA 1FMKA 3FMMA 3QKKA 3ZLXA 3EJ1A 1APME 3NR9A 2RL5A 4GV1A 4P5ZA 3TL8A 4MX9A 2C47A 1K3AA 2OF4A 4OGRA 4B4LA 1JKSA 5KMIA 3ZEPA 4GK2A 5LVPA 4C4GA 3E63A 1UA2A 3UVPA 4K9YA 5E1EA 3ZFYA 4S32A 4NCTC 4R7BA 3ULZA 1RW8A 3EH9A 4FTOA 4E8AA 4U45A 3NNVA 4C37A 3ZRKA 2XIZA 2YIRA 1OZ1A 3COKA 4ENXA 1ZZLA 4F6UA 4E7WA 3K2LA 2V62A 3A7GA 1WVWA 4G6LA 1Q5KA 3COMA 3KKVA 4FT7A 3ZZWA 4FE2A 3GQLA 3HV5A 3D5VA 5HLWA 3VUHA 5HORA 2V0DA 4I22A 1RE8A 3PYYA 4X3FC 5C8NA 2W99B 4OBPA 5FP5A 4D4YA 2PVMA 4CCBA 5LVLA 5EM7A 4UZHA 3A7IA 3FLSA 3N4UA 3KULA 3OVVA 3F82A 1SYKA 1GIJA 3BHHA 3ZDIA 3VJNA 3UC4A 4YBJA 3FZTA 4FEWA 5E8VA 3V51A 4EEVA 4MQ2A 4ZY6A 3FXXA 5GHVA 3L8XA 3QKMA 3TACA 3BE2A 1O6KA 1GNGA 4XYFA 5HBEA 2C6LA 1OGUA 4DH5A 4AN2A 4HVDA 2YJSA 4AGCA 2XK3A 4ZJIA 2WMSA 4EOQA 1PYXA 2C3IB 2I0YA 1Y91A 5TOZA 3D5XA 2HYYA 2X9EA 3DXQA 3BEGA 1HCLA 2R9SA 3L8SA 4J8NA 4WNKA 4QNYA 3HAMA 4NH1A 1URWA 2V22A 5EDRA 4H58A 4PDYA 2OO8X 5CANA 4AX8A 3CY2A 3IECA 4YLJA 3KRRA 5A46A 2BRBA 5I9VA 3HGKA 5F4NA 2JDVA 3G0FA 3BX5A 3R8ZA 5IDPA 5AA8A 1NVRA 4O0SA 4RC3A 2Z7SA 3ORKA 4YZNA 3REPA 4ZEGA 2WQOA 3RCJA 3GP0A 5AP4A 3I60A 4Z16A 4EH2A 4YJPA 3QLGA 3E93A 1ZAOA 4QMOA 4X6RA 3P08A 3FUPA 5AAFA 1YOJA 1GZKA 2FO0A 2JFMA 4PRJA 4BZDA 2WPAA 3ZM9A 5JK3A 2WD1A 4TYJA 3K5UA 4CLJA 2BUJA 3W16A 5H9BA 3SRVA 4E6AA 3NW5A 2X6DA 3KGAA 4IB3A 4ZTRA 4FSRA 1Q8UA 1ZY4A 2YACA 3FQEA 3PXYA 2PZPA 4QP7A 2ZYBA 4ZJJA 5CF8A 4FTAA 4C7TA 4R7IA 3OW3A 3NDMA 5HCZA 5BUEA 1H1SA 2QI8A 1PKGA 1KOBA 5AP5A 3QX4A 3NNXA 4I4FA 2RG6A 3EOCA 5A4LA 3AMBA 5EH0A 4PPAA 2H9VA 2Y4IC 4USDA 4X6QC 3ZUUA 1T45A 4TTHB 3V3VA 4JRVA 3U9CA 3OCTA 4YO6A 3ZO2A 4EOOA 5AADA 4FEVA 2NP8A 3ZH8A 3O51A 2QHNA 4HGEA 2XJ2A 2P0CA 3GEQA 2I0HA 4MNFA 4WA9A 2GFCA 3PVGA 1Z9XA 1JNKA 2Y8OA 2WQBA 2OJJA 1IAHA 3NYNA 4ID7A 1J1BA 5ETIA 5BVWA 3G15A 3PJ8A 4GT4A 4I5PA 2GHGA 4IC8A 4K0YA 4YZBA 5D9HA 5CVHA 3LCOA 3LM0A 1GOLA 2C3JA 2WTKC 3AMYA 3Q4ZA 3MFUA 5GZAA 5HCYA 2YJRA 3PWDA 3GUBA 4DA5A 1OUKA 4GIIA 4JLCA 3NX8A 5IKWA 3FMLA 4DFUA 4E5AX 3MFTA 4JG8A 2OGVA 4D2VA 1NT2A 1PXMA 2QG5A 4P4CA 4Q5EA 4QMSA 4ERWA 4ZTMA 4O82A 2OZAB 2J4ZA 5JSMA 4FI1A 4GMYA 3BHVA 4BC6A 4FX3A 4RJ6A 2W05A 3R02A 2YWVA 3SW7A 2YDJA 2W0JA 1AQ1A 1IR3A 2QONA 4LI5A 5E1SA 4GU6A 4RIOA 3PXQA 4OUCA 3VBQA 3CBLA 4O0VA 4Z55A 2ZV9A 1IG1A 5I3OA 4AZTA 2X4FA 3JVRA 2VV9A 5AUUA 5CAQA 3DBFA 4FSQA 3LCSA 1OITA 2O2UA 4NIFA 3WZEA 3VAPA 5BPYA 4CEGA 5HO7A 5BX0A 3WZKA 5EYDA 4RX5A 4CYIA 3FBVA 3RJCA 5HO8A 4ASZA 4MQ1A 3BWJA 3QD2B 3P9JA 5HTCA 1G8AA 4E4MA 3KMMA 3ALNA 4DN5A 2WU7A 3UG2A 2PUPA 4QQCA 5JEBA 4FIIA 1ZYCA 4IDTA 1Q99A 2EVAA 5IQBA 4MWHA 4M13A 4O22A 3S1HA 4RWJA 3IPHA 2PZRA 3DZOA 3HECA 5FP6A 1M52A 4CNHA 5HKMA 3MN3A 2CLQA 5ETFA 4CMOA 4ZLYA 3FHRA 3GC8A 2BZIB 4MNEA 4N0SA 3IGGA 5IPJA 4O91A 4QP2A 2C3KA 4KUJA 4O81A 2XNGA 3AC1A 3AT2A 3OTVA 4BB4A 4EHVA 3OCGA 3PUPA 4TW9A 4RGJA 3GC7A 2XKEA 3CC6A 4IDVA 2X8EA 4EL9A 1FQ1B 1MUOA 3BQRA 4U42A 3RPSA 1XBAA 2VO3A 3E8DA 1MP8A 3QTRA 4KIKB 4S30A 3ZO4A 4D1ZA 4F7NA 2I0EA 3CKXA 1RQQA 3RPVA 4EOKA 2WHBA 1PW2A 5IH6A 2C6DA 5CT7A 5KHWA 3C0GA 5I0BA 3RMFA 4DLJA 1OPLA 2VU3A 5EHLA 4BL1A 3DXPA 4EI4A 3CXWA 4QP6A 4PQNA 5IA0A 3FL5A 5CX9A 4PNKA 4E1ZA 3LJ1A 3KF4A 2QOLA 1K9AA 5I9ZA 3OW4A 3DAKA 2WXVA 2YIYA 4FNYA 2QC6A 4GG5A 2GFSA 4WG3A 3BWFA 3ZHPC 2G01A 3HLLA 4GCJA 5TKDA 4DGNA 1PXLA 4HVSA 5L2TA 5M51A 4I6QA 4YSMA 1R3CA 1H24A 4FA2A 3UIBA 5AX9A 4M15A 1UNGA 2X8DA 4UWBA 3CD8A 3SOAA 5J5TA 3SKCA 4DT9A 3A99A 2YABA 3PA4A 3KRLA 3A4OX 3NLBA 4G6OA 4Q5HA 3VNTA 1ZZ2A 3QTXA 4FTJA 4GG7A 4OAVB 3QCSA 4XG2A 3BELA 3ORZA 3Q4UA 3BCEA 3IDCA 4JG6A 4KIQA 4PTGA 4XP3A 2DWBA 3KXNA 2UZDA 2YDIA 4IE9A 4KBCA 3U4UA 3GT8A 4U3ZA 4F0IA 3C5IA 4GFGA 3BYOA 3OUKA 4X7QA 4F70A 2HCKA 4MWIA 4FTMA 3FE3A 4BI1A 3OXZA 4FVQA 1JSVA 2CJMA 1DAYA 3PP1A 4GU9A 3Q04A 1ZOEA 2HZ4A 4I1ZA 2O0UA 4OTGA 2QO9A 3JY0A 2C69A 4R1YA 5CU3A 4FKWA 3DBEA 3QQKA 4I93A 2VTQA 4M69B 1JKKA 3RALA 4C34A 4FKJA 3TUCA 2A0CX 3F3UA 4FNXA 4IFCA 4DAWA 4K6ZA 2PZ5A 2OIDA 4G17A 3FSFA 1UKHA 4FNZA 4KIOA 5CVFA 4EH7A 5F9EA 3PWYA 4BWXA 5G6VA 3EYGA 5CT0A 5F95A 1WBWA 3OXIA 4F0GA 4YJTA 2OSCA 4MD9E 4YU2A 2BROA 1CMKE 3TZ9A 4F1MA 3MVMA 2X7FA 1IAJA 3KXZA 4Y46A 5E8XA 3D15A 2YFXA 4QMUA 4TY1A 4G5JA 5DVRA 2P2HA 3M42A 4W8DA 2J2IB 1XR1A 5CSPA 4NUSA 3SGCA 2XVDA 4B8MA 5DLSA 2BTRA 4I6FA 4J95A 2CDZA 4G5PA 4J7BA 2Y7JA 4P7EA 2OZOA 3RAIA 3QC9A 3UBDA 2IW9A 1JQHA 3MFRA 4NM3A 5LMKC 4QNAA 3DS6A 2YM8A 2F9GA 3AQVA 1JAMA 3K54A 4YC3A 5AP0A 5AP6A 4BTKA 2ITUA 5HVJA 3C4XA 4L7FA 4IAFA 1QPJA 4KS7A 1J91A 3DLZA 4E6QA 3KCFA 3ORNA 3C4EA 2YHVA 3QQGA 3C5UA 4PV0A 1ZY5A 5L8JA 4GK3A 4RBLA 4BCJA 3MTFA 5CZIA 4BR3A 4FSZA 3UE4A 3U9NA 4CD0A 3IW6A 4RT7A 4FYOA 3ZC5A 4C33A 4E4XA 1Q61A 2GTMA 4ZTNA 3DJ7A 4G3FA 3O96A 4I6HA 4RC4A 2O5KA 2R2PA 4UN0C 1I44A 3DKOA 4U41A 4TZRA 4ACDA 2R3MA 1PXJA 4TYEA 4QP3A 4YMJA 2ZJWA 4L7SA 3WE8A 2VGOA 5CAOA 2IW8A 3KK8A 5EFQA 3F5XA 5EOBA 5B0XA 4JQ8A 4X2KA 3ZCLA 5JRQA 1TKIA 2J90A 2OJ9A 2UZEA 4O21A 2ZM4A 4XLIA 4CTCA 2ZDTA 2VO0A 4IJPA 1PF8A 3DFAA 3LQ8A 1W7HA 2ITTA 2C1BA 4JX3A 3V6RA 2QKWB 3CS9A 3EIDA 2BPMA 5M4UA 2VWZA 2ZB0A 5AUWA 4YPSA 5AV3A 5FM2A 3R9OA 2X39A 3QU0A 5D41A 4ZXTA 3DBQA 2OF2A 2OU7A 3NSZA 5CU2A 4JX7A 2XJ0A 2XK8A 4FODA 3MESA 3PTGA 4GJ2A 3R71A 1RJBA 5I9WA 4XJ0A 3BHYA 3POZA 3BIZA 5T3QA 3DBDA 4BDHA 1REJA 4BWKA 2Y0AA 3OY1A 4QTAA 4WG4A 2P4IA 2HWOA 3S4QA 3BV3A 5AR8A 3GCSA 4GH2A 4C4HA 3FXWA 4MXYA 4YP8A 4NSTA 4R78A 4MD8E 3PSCA 1YDSE 3MFSA 4N70A 5AA9A 5DA3A 3DOGA 4FZAB 4W4WA 1DI8A 5AV1A 5EI2A 4DFXE 4HW7A 3RVGA 5KNJA 1PXIA 3G90X 4QQTA 3KREA 1W83A 1GZOA 4JOAA 3FPMA 5K5NA 3OOGA 4PTEA 2WMAA 5FTGA 5TF9A 3W2PA 3LCKA 4I3ZA 2FH9A 4GW8A 1S9IA 4F1TA 1I09A 3ZO1A 3M2WA 3QZFA 2XJ1A 2C6IA 3PPZA 2VNYA 4N6ZA 3W33A 3MA3A 3KFAA 5ICPA 5HU3A 4NCTA 4JBQA 1XWSA 2YWPA 3VBVA 5KKRC 3IO7A 3WE4A 3NAXA 3UTOA 5KCVA 2F57A 3R7GA 5CU4A 3OXTA 3BU3A 3U4WA 2XP2A 4YURA 4UBAA 4WT6A 3BU6A 4Y73A 4AT3A 3CY3A 4UMRA 4WOVA 3KXXA 5IF1A 4X2JA 2B9HA 2OJGA 3U6IA 3A62A 2E9OA 4HZRA 1QMZA 4CFXA 4X3FA 3C50A 3QRJA 4LGGA 4D2RA 2P33A 5I9YA 3O7LB 2C30A 2J0LA 4L46A 4AN3A 2JBPA 3QTIA 3W10A 5ANKA 3QLFA 3MH3A 3CE3A 5CEKA 2J0IA 4B6LA 2YA9A 3OMVA 1YHSA 4KD1A 5M4IA 2VX1A 4I5HA 2E9NA 4IHPA 4FGRA 2ITYA 1KE9A 4ZZMA 4C62A 4FTUA 1JWHA 4HYIA 4IQ6A 3T8OA 2YCRA 3F66A 2ITZA 5EQYA 3GCQA 3D9VA 3KMWA 3NS9A 5HX8A 1XH4A 3KULB 2H8HA 1QL6A 3ZM4A 1IRKA 2C0TA 3RP9A 3ZSIA 2ITPA 4DG2E 2ITQA 3R6XA 3IOPA 2IVUA 3B8RA 3PG1A 1JKTA 5FG8A 5ACBC 5IQIA 4U44A 5AR2A 2PU8A 3KQ7A 1B6CB 3PY0A 4EJNA 1STCE 4ZSLA 3NEWA 4EQMA 3QALE 5A9UA 2V5QA 4WKQA 2PVFA 4AZWA 5AUTA 4CT1A 3C0HA 4WNOA 3OCBA 3EL8A 4O27B 1G5SA 1BLXA 3PSDA 5LCKA 5BMSA 5EW9A 4EHEA 1KWPA 5LOHA 4FV2A 4I23A 2VNWA 4QQ5A 5DPVA 4JDIA 4XP2A 3TNQB 5M08A 2VTTA 2BFXA 5K9IA 1ZYLA 2UZWE 4ZLOA 2W5BA 2NO3A 3WIGA 3ZBXA 1W0XC 2B55A 4BGHA 5JGAA 4QP8A 5IUGA 4LMNA 3IDBA 2QOKA 3S3IA 5IG1A 4RX9A 5J7HA 1M17A 4V05A 3ROYA 2YEXA 5BQ0A 2JDTA 1PMNA 3F3VA 3FMHA 3LHJA 1URCA 4CZTA 1B39A 4CLIA 2OH4A 5DT4A 3QTZA 5HVYA 4K77A 3ACKA 2UZTA 2FUMA 4BBEA 2BRMA 4F09A 4NWMA 1OIUA 2CGUA 3PZEA 4ITIA 4YHTA 3EB0A 5HD4A 3QYWA 2X0GA 3SRVB 4IM2A 4MVFA 4AZSA 3UMWA 3VS0A 1H1PA 1U54A 2VTHA 3DDQA 3JYAA 3PZHA 4AA0A 5GIPE 3DXNA 5C1QB 3MPTA 3W55A 2UW5A 5FXQA 5C8KA 4HPTE 3ZSHA 3QZIA 1B38A 4QTCA 2YAKA 3OWLA 2QLUA 4WSYA 5GZ9A 3IQ7A 3ATTA 4YNEA 5EM5A 5DR2A 4BYIA 2HZ0A 2V7OA 3AGLA 4DEGA 2HW7A 3W2QA 4FV9A 4OTIA 3R7EA 4IWQA 5AR4A 2R3PA 2PMNX 1JVPP 3QQJA 3H4JA 4UZDA 2O63A 4D9TA 2XKCA 5A6NA 2HY0A 2B0QA 2JIUA 2W1ZA 3R7YA 2A1AB 1Q8YA 4XOYA 1YOLA 4IEBA 3W8LA 3O23A 3NCGA 2IVVA 4JDJA 3ZRLA 3GOKA 4IBMA 5D7AA 4O0XA 2WTDA 4AACA 4C58A 4D2WA 3OS3A 2GNIA 4RVLA 2XB7A 4QMVA 3UVRA 4F9CA 4ZZOA 4B99A 3QGYA 3V8TA 4AOJA 3UZRA 1LEWA 1IEPA 5CNNA 3FLNC 4V04A 4FTRA 4JDHA 4IMYA 5AUYA 3ORIA 3H3CA 3PE2A 4USFA 2I6LA 3LLTA 4KB8A 4RQVA 4JRNA 5DRBA 3VULA 3R2YA 2XS0A 1BMKA 1A48A 1RDQE 3HMMA 4BN1A 2HIWA 3CPBA 3BV2A 4F7LA 3SX9A 5HLNA 2VWBA 4FTTA 3LM5A 4OLIA 5JMSA 3ZFXA 2XNOA 4XP0A 4MKCA 1YQJA 4X2FA 5BUIA 3R8MA 4O7WA 2YCSA 4A9SA 4M3QA 1H08A 4NIFB 4BDJA 3Q53A 4L6QA 2X4ZA 4ALUA 1GZNA 4DCEA 4BTJA 3GVUA 4MBJA 3QCYA 4ZY4A 2YAAA 4H3QA 3UG1A 4OT6A 4NZWB 3ZMMA 5I4NA 3QQLA 5EHYA 2PPQA 4FSNA 1U4DA 5AFVA 2YM4A 4U81A 4EOSA 2XRWA 2WIHA 3KB7A 3CCNA 3AGMA 3IGOA 3IW7A 4JT3A 4BCFA 3ALOA 3KC3A 3SVVA 2HZIA 2PVNA 1HCKA 3MV5A 3GU7A 3UNJA 4ZP5A 3L9LA 3QX2A 1DS5A 4D4VA 2BMCA 3R28A 5J9ZA 4MNEB 5IQFA 2P55A 3QQHA 3BHTA 4FKQA 4LGHA 5CSHA 5B2KA 3FDNA 5JFXA 3BYVA 5AP3A 3ANQA 3H30A 2WELA 4JQEA 5CNOA 4FTCA 4L52A 2XNPA 1Q8TA 5CSVA 3PIXA 3ENMA 2REIA 2ZV8A 3DNDA 1F5QA 2BR1A 2GNFA 5AMNA 3TV7A 4C8BA 3BEAA 3NW6A 4A4LA 4RWIA 4DINA 5E91A 3MJ2A 4NTTA 4KINA 1O6YA 3IW8A 4Q2AA 1ERKA 4CTBA 3NRMA 4LRJA 2VWVA 3ZC6A 3SA0A 2E9PA 5CENA 3IS5A 2JKMA 5EW3A 4OTDA 4G1WA 4BCOA 1F3MC 5FD2A 4P90A 2VAGA 4O2PA 4ZS0A 4D0WA 4L42A 5H3QA 2WTCA 3NCZA 4PL4A 5AV2A 3C4WA 4ACMA 2IZTA 4BDFA 1W82A 3VRYA 3PVBA 4QYHA 3R04A 5M56A 3C13A 4G9CA 4XMOA 2CNQA 2EXMA 2UW4A 4QMXA 5B7VA 2QLQA 2WTIA 4FUYA 2BKZA 5L8KA 4DTBA 2WMBA 4O38A 4TL0A 1YWRA 3TNPC 4FNWA 2NNWB 2F7XE 4C3PA 4OTWA 3HV4A 3Q4CA 2WTWA 2IZUA 4RJ7A 4TN6A 4ANSA 3DTWA 2W06A 3D2KA 3EN5A 1OL1A 2ETKA 3BKBA 5L3AA 3RWQA 2IW6A 4GYGA 4H39A 3UJGA 4JAIA 4O86A 4FSWA 2JAVA 4FTLA 1Q24A 3Q32A 4ANBA 3PXZA 3UIMA 3HEGA 5EDPA 5GZ8A 2GPHA 5CLPA 3DA6A 4BBFA 3TUBA 3ZUVA 2BTSA 4IVCA 4RWLA 5JRSA 5E4HA 5ANEA 4A9RA 3VVHA 2BCJA 3DGKA 3CQUA 4B0GA 3R0TA 4TRLA 4MEDA 4QTEA 4EK6A 1OI9A 3ID6C 1YVJA 2XEZA 3PLSA 4FF8A 2WMTA 4J98A 5JN2A 3V5JA 3ZLWA 5CALA 5HZNA 4FKOA 2X2MA 3MA6A 4MBIA 4EUTA 3EKKA 4U9AA 2BDFA 2GQRA 5KUPA 4QYFA 2XYNA 3VJOA 1E1XA 3I5ZA 4L01A 5A14A 5L2SA 3EN9A 3CQWA 4GRBA 5KMOA 1PJKA 5LMKA 4U97A 5M44A 2OW3A 1MQ4A 3VS4A 4PMTA 3SHEA 3PFQA 4IWOA 4EK4A 3F88A 2YZLA 2CNUA 4DBNA 1H8FA 4NFNA 4IX5A 4G3DA 3QHWA 2J0MB 2PSQA 4GVAA 4PX6A 4ZSAA 3UQGA 3IW4A 4LFIA 4EHZA 1K2PA 4TWCA 4XG9A 1YXSA 3OP5A 4FTNA 4DTAA 2WQMA 5IQCA 4TT7A 2VRXA 3R2BA 4C0TA 4AFEA 4QMNA 2AC5A 2XEYA 3HRBA 4QPSA 2PYWA 5AJQA 5IH5A 2X1NA 4RIXB 4GJ3A 4EBWA 3B2TA 4GS6A 1OKVA 5DNRA 5KMNA 3F7WA 3ZYAA 5I3RA 2PE0A 4BFMA 3FC2A 2OWBA 5HQ0A 1YDTE 3R9NA 3RAHA 5IQAA 3RM7A 4OTPA 4NKAA 3FZ1A 3GCPA 5C26A 5JT2A 3DQWA 5TO8A 4E6DA 3AC3A 4AA4A 3ZO3A 2PVYA 4S33A 1V0BA 5HD7A 4XBRA 1FMOE 5T68A 4PTCA 5JZNA 4ANLA 4F7JA 1H1WA 4U8ZA 3U87A 4KBKA 2WMUA 4PY1A 3OROA 5E8ZA 4BWPA 5AAGA 4NM0A 4ACCA 4AZVA 1UU3A 4ALVA 3S2PA 3V5QA 3HMPA 4AS0A 5CAUA 3FZSA 1AD5A 4KRCA 5HHWA 4O6LA 4UV0A 3HX4A 3MDYA 3ZOSA 3R22A 2G2FA 3H9FA 2PUIA 4IAIA 3TV6A 3AC4A 2BFYA 3MTLA 3W1FA 2VTIA 2OKRA 2YCFA 5E90A 2FSTX 5FTQA 4AZFA 4QTDA 2BDWA 5K0XA 2WZJA 4WO5A 5AAEA 4FT5A 4EZ3A 4LV8A 1FVRA 1R78A 3W32A 5KO1A 3N4TA 3L9NA 4O7YA 3LXNA 4RRVA 4O7SA 2E9VA 3AD4A 3COIA 5IMEA 2W7XA 1G8SA 4C61A 1BYGA 4IZYA 3QRUA 4NJDA 4V01A 4FKPA 4BTFA 2KTYA 4GK4A 2I0VA 2P2IA 2Z2WA 3VBXA 2BIKB 5KZ0A 2PVJA 1R1WA 4CFMA 4GL9A 4BIDA 3MS9A 5FEEA 3OEFX 2OBJA 4J1RA 3KVXA 2UW6A 4UEUA 4EZ7A 2HOGA 1FGIA 5DWRA 3TNHA 1PMVA 3Q4TA 3N51A 4FG9A 5FEQA 4K11A 1M2RA 3UQCA 3DV3A 1U59A 4F6SA 1CSNA 2W4OA 4KS8A 2RKUA 4NJ3A 3PPJA 2VWIA 4FZ6A 4QD6A 4Z9LA 2E2BA 4IAKA 5EHOA 3PA3A 5A54A 2WB8A 1OMWA 4IX6A 4IM3A 4FICA 3TNIA 4F08A 5DT0A 3QCQA 4ZMFA 4YSJA 4C2WA 5J7BA 1YXVA 5F20A 4FKGA 4TNDA 3T9IA 3ULIA 3FZRA 4JXFA 4HZSA 4A06A 1YXXA 4O83A 1XH6A 1Y6BA 4JDKA 4C35A 4ZSEA 4FV0A 1WVYA 4DT8A 4UALA 4FTQA 4BI2A 3HNGA 4FBXA 1VYWA 3DNEA 2Z7QA 4DTKA 2BAQA 5EDQA 1GJOA 2X6EA 1XQZA 4AOTA 3CJFA 2G2IA 2ITOA 3LE6A 3NIZA 4LYNA 4CG9A 1PRYA 1SMHA 4UMQA 4MXZA 5BNJA 1YOMA 1CKJA 2DYLA 2A2AA 4M84A 4I92A 2PUUA 3P5KA 3I0OA 3L1SA 4X3FB 4XRLA 1WAKA 2CLXA 4XV3A 1P4OA 4Y72A 3F7ZA 3U54A 2WNTA 4MYGA 3LXPA 3P86A 4NKSA 5EYCA 4AAAA 4UMUA 2O3PA 5DEWA 3SDJA 4CV8A 2JITA 3PVWA 4AF3A 1FBNA 2EUFB 3E8CA 3TZ8A 4R6VA 2OK1A 3VRZA 4IZ5A 3B2WA 4BTMA 2CKOA 3II5A 3QD0A 3W8QA 1XH8A 4YJRA 4O7NA 4AGDA 3UNZA 4C4EA 3QC4A 4AE6A 2QNJA 5BUJA 4XG3A 2QOHA 2RFDA 4PUZA 3V04A 3UO4A 1V1KA 2NPQA 2Z7LA 5DBXA 3FXZA 5IU2A 3PPKA 3VBWA 2X2LA 4H3BA 4TWOA 3GI3A 3L8PA 3NYXA 4H1MA 4YR8A 3FZOA 2IN6A 2ETRA 2XNEA 4FKTA 4QP1A 2J6MA 4YZDA 2UVZA 4KNBA 4ZZNA 5GNKA 3BGPA 4FIFA 2ZOQA 2VZ6A 3DKCA 5HE1A 5IZFA 2JDOA 3SG8A 4O84A 3FMNA 2X8IA 3QTSA 2YLEA 5E8WA 5F94A 4QYGA 4YJSA 3C51A 3DK6A 3VUKA 5LVNA 3F69A 3MIAA 2W4JA 1FVTA 1ZYSA 3BYSA 2C5YA 4Q9ZA 3PXFA 3W2CA 2W5HA 3LKMA 2CGXA 2WTJA 4EQCA 5HESA 3WF7A 4FTKA 3NUXA 2R3OA 4NEUA 4PPBA 4RSSA 3HV3A 4MTAA 4EC8A 1H01A 1QPCA 5H8EA 2UZOA 5FDPA 5LMBA 3QL8A 3ORTA 2WKMA 4BKZA 5KHXA 4CMUA 3F2NA 2XH5A 3Q52A 4RG0A 3ELJA 4AOIA 2PZYA 3BPRA 4M8TA 5EM8A 3OWPA 4IVAA 5EW8A 3QTWA 2R0UA 4EK5A 2C3LA 2UW3A 3GXLA 5ANJA 3R01A 4L43A 4ZIMA 5HCXA 3AMAA 4BCHA 2VTAA 4BCMA 4CQEA 4ZY5A 5C01A 4H1JA 4CGAA 4YZMA 3H10A 5HG9A 3OTUA 2QO7A 4BCQA 3ROCA 4A9TA 3LW0A 3IW5A 5HU9A 3KMUA 3RK9A 4LMUA 4FV5A 4W4YA 4MHAA 4MF0A 4HYHA 2Y4IB 3E62A 4Y5QA 2UVXA 4RJ5A 3LMGA 4ASEA 2H6DA 1U54B 3OZ6A 5A6OA 4O7VA 1WBVA 4L44A 1OVEA 1PKDA 4M12A 2YZAA 5FXRA 2BALA 4M0YA 3VUDA 5J5SA 3P79A 1Z57A 4OTRA 3OBJA 4B8LA 3MSSA 1BKXA 4APCA 3RM6A 3NYOA 3TTJA 4TPTA 1SM2A 3VS7A 3EFWA 1SNUA 3TI1A 1VEBA 3RWPA 2WTKB 4CVAA 2Z7RA 3OHTA 2JBOA 2WAJA 3NZ0A 3V8WA 3MI9A 3FQHA 2YM3A 1GZ8A 3FL4A 4HNFA 2B4SB 3AT3A 1WZYA 1J7UA 4RJ4A 5CF6A 3F2AA 5E9EA 4FVRA 5HG8A 2C4GA 2HAKA 3FLYA 4IAYA 4RC2A 1OM1A 2IO6A 4IADA 3FC1X 3W2SA 2J51A 4DF3A 3M11A 5HO6A 3HAVA 1H0VA 1YRPA 4ACHA 1YWVA 2RFEA 4GT3A 2OG8A 2QOCA 2YITA 5FGKA 2WFYA 2BIYA 2EB3A 5DGZA 2HK5A 3UIUA 3F5UA 4FC0A 5L2IA 3VC4A 4JNWA 4RZVA 2XIKA 2B9FA 3ZRMA 4A4XA 3ORMA 3A60A 2NRYA 4S34A 2R3QA 4R8QA 2WIPA 1XBCA 2J0KA 4W8EA 4DEHA 5EQEA 1DAWA 3AC5A 3QUPA 3LJ0A 4D2TA 1UU7A 2VUWA 3PIZA 1TVOA 5G1XA 4C3FA 2XA4A 2LGCA 2RGPA 3QHRA 4PMSA 3FV8A 3WI6A 5HICA 3R63A 2R3RA 1H0WA 3UMXA 4EQUA 3UOLA 2XNMA 3C0IA 2BHHA 5J9YA 1QCFA 4TNBA 3HMOA 1OL5A 5IEVA 2JIIA 1T46A 1MQBA 2R5TA 3MPAA 4WSQA 5M53A 2V55A 3POOA 3KY2A 3E64A 1NXKA 3HUCA 3UC3A 3O0GA 3VS2A 3W18A 1MRUA 4LQMA 5D7VA 2B9JA 5FXSA 1CM8A 3O8TA 5HNGA 2EU9A 3DB6A 2DQ7X 4I6BA 2RSVA 1OIQA 2HELA 3MWUA 4JIAA 5C4LA 3R21A 2QOOA 2OICA 3P7AA 1V0PA 2RFSA 4RVMA 4IFGA 4UX9A 2PMOX 4EH8A 4RJ3A 5BYZA 3DCVA 2YN8A 2XK9A 2XIXA 4IVDA 5DRDA 3DK3A 3VBTA 4LV5A 3FPQA 2ERKA 2GHLA 3BLRA 4FZFB 3UYSA 2OLCA 4HVHA 1LP4A 4FZDB 1KE7A 3QKLA 2Q0BA 4PMPA 2PULA 1A06A 3GQIA 4UWCA 5HEZA 3TG1A 3MY0A 3DJ5A 5D12A 4TYHB 1SVGA 4O0WA 5JGBA 4LOQA 2PMIA 4EH4A 4C38A 4U6RA 1GY3A 3DT1A 2WOTA 3T3UA 3QXPA 3SXFA 4IH8A 2Q0NA 4EUUA 4ZAUA 5C27A 3WOWA 4FOBA 4ERKA 3IDPA 2UW8A 1Q62A 3OF0A 4U79A 2X9FA 5CI7A 4BDGA 4YJOA 3ODZX 4BGGA 5HVKA 3CTHA 1NW1A 3SC1A 2R3FA 1HOWA 4TYGA 3G9NA 2FSMX 4WBBB 5EYKA 4E4LA 4TKSA 1YI6A 4FMQA 4WNMA 4JL9A 4O96A 3EL7A 5JH6A 2FGIA 5FBNC 3BI6A 2R3KA 3TZ7A 3MY5A 3WYYA 4RFYA 4ACGA 3BYMA 3UPXA 4LL0A 2QCSA 4KKHA 5K3YA 3NW7A 1O6LA 4FSMA 2C68A 2JDRA 3FI4A 3WYXA 2XF0A 2W96B 5AV0A 1W8CA 1ZMWA 4QMLA 3RBWA 2UW0A 2YM6A 4NFMA 3RPRA 4EZ5A 4KA3A 5LJJA 3NVMB 1UVRA 3OY3A 4ARKA 3E7VA 3EFLA 3KRWA 3PRIA 2W9ZB 4BHZA 3QCXA 5HBHA 1M7QA 2ZM3A 4PF4A 2JD5A 4H3PA 5J87A 1WBNA 2CNVA 3TKIA 1YKRA 3OT8A 3R7IA 5I5ZA 1YXUA 4EHGA 3DAJA 3GCVA 3QTUA 5BVKA 3SAYA 4BF2A 2UVYA 2QOIA 5IA1A 2R3HA 3PXKA 3EQBA 3JXWA 3Q3BA 4MXOA 2ZM1A 2VTSA 1FPUA 3NVKI 3LFEA 3LLAA 3PJCA 3ZU7A 3QWKA 2VX0A 2WMWA 4MXCA 3LMIA 2C6MA 1M2PA 4RA5A 4X0MA 4ZTQA 1L3RE 3WZDA 5D10A 4P5QA 4A7CA 4NW5A 4YTHA 1MRVA 4ANQA 4XX9A 4BCNA 3DFCB 4IB5A 4II5A 3KN6A 1Y6AA 4BIEA 3ERKA 3NWWA 5A3XA 4R1VA 4CV9A 2HW6A 2R0IA 2VTLA 4I5CA 4FV8A 5A4QA 3ZXZA 4YBKA 4KKGA 3GU5A 3U55A 2QKRA 4HCVA 4KRDA 3OCSA 4TXCA 1Z5MA 4Y95A 1PMUA 3E5AA 3LFNA 3CD3A 3HMIA 3DB8A 4QYYA 3FAAA 3TNWA 1Q4LA 2PMLX 2UZUE 1WBPA 1VYZA 3HVCA 3PA5A 3NUSA 3R8PA 3R00A 4BCIA 1J7IA 4BDIA 2PVLA 2XNBA 3SD0A 3A61A 4LG4A 3QUDA 4NL0A 1Y57A 3FYJX 1XH9A 3RAKA 3L9MA 4FKSA 4L9IA 3E8EA 3KRXA 4BHNA 4DITA 5IMXA 3U6JA 2J7TA 4O1PA 4YJNA 3JPVA 5EOLA 3IG7A 3UODA 3D0EA 5E8TA 2C0OA 3Q6UA 5EI8A 5JFSA 4EH3A 5CEPA 3Q2MA 3F5GA 3ZDUA 4CRLA 5BVDA 1JPAA 4LRMA 5C03A 3GBZA 4YNOA 3OUNB 4CYJA 3Q9ZA 2UW9A 4DH1A 3PLAE 2KULA 4KAOA 4BZOA 4O7LA 4IZAA 3Q6WA 4RLLA 4AQCA 4ZS4A 3VN9A 1ZWSA 1ND4A 3FJQE 2QURA 3HYHA 3FEGA 1ZMUA 4FVPA 4IXPA 2PVKA 2XNNA 4YTIA 4HVIA 4G16A 1JBPE 3BU5A 5AP1A 5C9CA 4NU1A 4LOOA 4J53A 3Q9XA 2X2KA 3E3BX 3PIYA 5HNIX 2I40A 3TKHA 4E5WA 3O71A 2WEVA 4O1OA 5IA4A 1KE8A 4QP9A 4I24A 4FL2A 1UV5A 4IX4A 4DEDA 3KN5A 5H8GA 4FK6A 3N9XA 5M07A 3Q9YA 4QPMA 3MVLA 5HIEA 2Z60A 4FIGA 3VUMA 2BKKA 1EH4A 2W1FA 4RMZA 5HI2A 3D83A 1TQIA 3DJ6A 4FKVA 3JVSA 1OL6A 4M68A 5HOAA 3FKNA 5CI6A 3GCUA 4QT1A 5CU6A 3LQ3A 3E7OA 4RIYA 3CKWA 3EFKA 4MAOA 3KK9A 2FYSA 1H07A 4FEQA 4OR5A 5FWKK 2XK6A 4JIKA 3VS1A 5BYYA 4O0RA 2R64A 4RIWA 4EOIA 4OBQA 4QPAA 2XM9A 2VTMA 3ORLA 4XH6A 1OBDA 2ERZE 4K1BA 1Y8GA 3G5DA 4L8MA 3ODYX 3UYTA 3RZFA 2JKKA 3P1AA 3FWQA 4FSTA 2YDKA 2BILB 2ZB1A 5CEOA 5JQ5A 4W4XA 3R7VA 4C57A 3KCKA 4ALWA 2C5VA 4EWQA 4AT5A 2PK9A 1KE5A 2HZNA 4F9BA 2X7OA 1TQPA 3O8UA 3D7TA 2JKOA 3FSKA 4V0GA 3VQHA 1ZYDA 2WU6A 3DY7A 4AW5A 4EOMA 3AC2A 2X81A 4JAJA 4U7ZA 3VIDA 4C2VA 4EJ7A 3R8LA 1IA8A 1VZOA 3KF7A 4XHKB 2CSNA 4E73A 4PWNA 4YHFA 4RWKA 4I5MA 1Q3WA 4D1XA 4PL5A 3QFVA 4MH7A 4IACA 5DYJA 4KWPA 3EYHA 4IAZA 3KVWA 4UYNA 4G2FA 1JSTA 3B8QA 5M09A 3GGFA 3BQCA 3D5UA 2XMYA 4IC7A 2F2UA 3V5PA 3QZHA 1WBOA 3TCPA 4BICA 4DH8A 2I7QA 3O2MA 3UO5A 3FMEA 2JLDA 1UU8A 2WQEA 3VHKA 5CASA 4FEUA 1ZRZA 2W1DA 3I7BA 3A7FA 5AUXA 1LPUA 3UZTA 4X2GA 3KEXA 4O7TA 2PVRA 2W1GA 4TYIA 3ET7A 2UZLA 5KZIA 3PRFA 4WIHA 3FY2A 4MXAA 5DIAA 2LAVA 5ETAA 2HWPA 2QR8A 2OH0E 3K3IA 4O0UA 2Y6MA 2H34A 5B2LA 2X7GA 3PSBA 3I4BA 3BZ3A 4O7ZA 4FIEA 3FMDA 3EQHA 4AE9A 1KV1A 2EXCX 4M67A 3DK7A 5FTOA 5TE0A 4AN9A 3A7HA 4XS2A 4Y83A 1LUFA 3HUBA 1IASA 4C4IA 2AUHA 4ANMA 2R7BA 3PJ2A 2VO6A 2VWXA 4W4VA 4FKIA 1PMEA 1QPEA 2VWUA 3SXSA 5IISA 5EI6A 3PDTA 2JKQA 4BI0A 3JUHA 2EB2A 4HYUA 3TKUA 2QHMA 3BHUA 4G6NA 5KBRA 4AW0A 4QO9A 3UOKA 5GINE 3EZRA 3H0YA 4DH7A 4EORA 3HRCA 4C4JA 3MVJA 3TIZA 3MW1A 4RVTA 5LXMA 3BYUA 3CR0A 3NUUA 5DI1A 4IB1A 2C5OA 4WRSA 3NMUF 4CFVA 4YHJA 1LR4A 1GIIA 2OIBA 5B2MA 5LMAA 5IA2A 4ZMEA 4WBOA 3VS6A 2ETMA 2VGPA 4AUAA 3BLHA 3SOCA 3G6HA 3HDMA 1UNHA 4HYSA 4UXLA 5IQGA 3Q5ZA 2BDJA 1FOTA 4FEXA 5HG7A 4ZJVA 3OD6X 5A4EA 1VJYA 5JFVA 2Z8CA 4I0SA 4K33A 4M66A 4D58A 3KL8A 4HVGA 4CCUA 5HNBA 2YIWA 2JDSA 2QOBA 2V7AA 4L45A 4DEBA 4ORKA 2C0IA 3ZUTA 1JOWB 1XH5A 2J9MA 4EH9A 4QMPA 2O65A 4BDBA 2CMWA 5L6OA 3CJGA 3WBLA 3QD4A 2C5XA 3LFDA 4N4SA 4C4FA 1KV2A 1OL7A 3GC0A 5M55A 3VHEA 2F4JA 2G15A 4GKIA 3A8WA 4HCTA 4YTFA 4RFMA 4AG8A 3FY0A 4S2ZA 3FLQA 3TTIA 5EG3A 4E4NA 3D2IA 3I7CA 4CQGA 4EONA 4KSPA 3MH1A 5CQWA 3AC8A 2VTNA 1OECA 4WHZA 3S95A 5CYIA 4EOLA 4XNEA 4YZCA 3V5TA 2HENA 5KMJA 3L8VA 3UQFA 1XHAA 2BRHA 4PNIA 2QU5A 4QMZA 5EKOA 4G3GA 2A4LA 1PXOA 2BVAA 2FA2A 1WCCA 5FRIA 2PZIA 2GQSA 1YDRE 3C4CA 4E20A 5ITAA 4FUXA 3TUDA 3ZZEA 2BZKB 4ZTHA 1NVSA 3VO3A 1S9JA 1R39A 2YCQA 3MBLA 5CWZA 4BY9E 3UGCA 4AGUA 3GNIB 3HP2A 2YLFA 3OWKA 2IZRA 4PL3A 4XV1A 5DFPA 3RINA 4C36A 4E93A 4ANNA 3TDVA 2OI4X 2JIVA 3G2FA 3P78A 5E92A 5FLFA 5IA5A 3NPCA 2B54A 4ZK5A 4D55A 4E26A 3BGZA 4EBVA 5CS6A 3LFQA 3UOJA 4IB0A 3TM0A 4GFOA 4IIRA 5DEYA 4J8MA 3FMJA 1P2AA 2IVTA 4FV1A 3AXWA 4G9RA 2QU6A 3CSVA 2IPXA 3QBNA 2DS1A 4F99A 2FB8A 2HXQA 4LUDA 4QOXA 5K0KA 4C02A 3QQFA 4EOJA 4K2RA 3COHA 3OOMA 2QD9A 4I0TA 4AT4A 4Q9SA 2R4BA 3JS2A 4CKIA 4G3EA 2CGWA 4F9AA 1O9UA 3HP5A 5LVMA 1WMKA 4C59A 4GEOA 4AW2A 4A9YA 3EKNA 5CEQA 4DLIA 3G0EA 4DHFA 2WMRA 3EZVA 1ZOGA 4RFZA 4IM0A 3ZXTA 3KXMA 3ANRA 4O7RA 3KXGA 4H05A 4XRJA 3WIKA 4FOCA 4J52A 2FSOX 2OFUA 3KXHA 3LFCA 2OFVA 3NNWA 4EOPA 3LFSA 3KU2A 1U5RA 5LARA 2GNHA 2R3JA 3VBYA 4JBOA 4RZWA 2XZSA 2PUNA 2PHKA 2PTKA 4OBOA 4BZNA 3EMGA 2ITVA 3FYKX 3LZBA 1YW2A 4O2ZA 3T9TA 5IH4A 1OKWA 2PE1A 4XUFA 3QQUA 2IZSA 3G6GA 4FL1A 5HTBA 4CFNA 4HJOA 4QMMA 3NUPA 4MD7E 4PMMA 4X2NA 1W84A 2VWWA 2WTVA 4AW1A 5JFWA 5EK7A 4WNPA 4DG3E 5CTPA 5E8YA 2WMQA 3TDWA 1NA7A 4GT5A 2VTOA 5CEIA 4CFWA 4Y8DA 3DU8A 3F61A 4HOKA 3G51A 5HE2A 2BRNA 2PVHA 3CGFA 5JGDA 5HBJA 4IWDA 3E88A 5E8UA 5IQDA 3AT4A 3LFBA 3RK5A 2XK7A 4PDSA 3WARA 3DAEA 1QPDA 3FI8A 4ITHA 4DGGA 4GYIA 1YXTA 4WD5A 5CAVA 1P14A 1YWNA 2QOQA 5L8LA 3BLQA 4WRGA 4IANA 5AP2A 3R8VA 4DC2A 5I9XA 4J96A 5AM6A 1OB3A 4D5KA 4L3JA 2QQ7A 5DR9A 3T3VA 4DCAA 3RAWA 2VTPA 4L00A 4R5YA 4BIBA 4BGQA 5HX6A 4OTQA 3MB7A 4FTIA 5HTIA 2W1EA 5HG5A 2R3NA 4UYAA 4I20A 3TV4A 1P5EA 4BDKA 4LGDA 1U5QA 2WGJA 3I81A 4OW8A 4X3JA 5FM3A 4BKYA 4F4PA 4F7SA 3R30A 1Q8WA 3LFAA 2VN9A 4DEAA 5ANIA 5J79A 1PY5A 2GTNA 3L9PA 2ZVAA 2EXEA 4JVGA 2HXLA 3LAUA 3BE9A 4M0ZA 3SLSA 2ONLC 4EYJA 3C1XA 3MY1A 2ZV7A 3AG9A 1Q3DA 2OJIA 4U40A 3LVPA 2G2HA 3A2CA 1PYEA 3C7QA 3EN6A 4KSQA 4D2PA 3WF9A 5L6PA 2AYPA 2WO6A 3QUEA 5M4CA 4M97A 4CFUA 2BZHB 5K5XA 3QRIA 4XOZA 3W2RA 2R3LA 4XG7A 2ZDUA 1H1QA 3QD3A 4EC9A 4PP7A 3JR1A 4QMWA 4WUNA 4F9YA 4HGLA 2W5AA 1H28A 2GDOA 3P0MA 1NY3A 4YJQA 3ETAA 2IVSA 3LIJA 1A9UA 3GENA 3QF9A 2WQNA 4ITJA 4NT4A 1WBTA 3M1SA 2CHLA 2ZMDA 3A7JA 3RGFA 4O6EA 3TEIA 3ZEWA 4J97A 5M06A 2ZV2A 3QGWA 3U6HA 4UB7A 3UOHA 5DE2A 5BVNA 4I94A 4BDEA 2YM5A 1XKKA 3RI1A 1KE6A 3D7ZA 2F49A 4FT3A 4RLKA 3DQXA 4ZSJA 3WILA 4CZUA 1GIHA 3UP7A 5AR5A 1SVHA 1WFCA 5H2UA 4ASDA 4CRSA 3OEZA 3RCDA 2CKQA 3GFEA 3EN7A 2B52A 4E6CA 4A07A 2RIOA 1OKZA 2UZBA 2CN5A 3V8SA 5AR7A 5CEMA 3IONA 2ZAZA 4GKHA 4R77A 2GQGA 2JGZA 4R5SA 4F0FA 4NK9A 3Q5IA 4RX7A 5E7RA 2BZJA 2B1PA 3MJ1A 3UPZA 4HGSA 3R73A 5AIKA 4NTSA 4C3RA 4F1OA 2YISA 3EN4A 3UIXA 1XBBA 3BBWA 2H96A 5CAPA 4HPUE 3OG7A 5CF4A 3A8XA 2QG7A 3H9OA 2XUUA 3GOPA 2Y4PA 4YTCA 3VQUA 4IVBA 4QMTA 2XKFA 5CSXA 3GU8A 3E8NA 2ITXA 2W1HA 4HGTA 3GU4A 5KBQA 2PY3A 1R0PA 2J50A 5LWNA 1YI4A 3HDNA 2G1TA 4BCPA 5CF5A 2CKEA 3MH2A 2HY81 3DKGA 5JZJA 1JKLA 2UZVA 3C4ZA 2C6OA 1YI3A 3PVUA 4GSBA 2YIQA 2GS7A 4RX8A 4IW0A 4UMPA 1KOAA 3FI2A 1YHVA 5ANGA 3VUGA 5AR3A 4DGMA 4Z7GA 1UNLA 5LCJA 3DTCA 3PG3A 4GIHA 2A19B 5C8MA 3G33A 2R7IA 4D0XA 4DEIA 3Q2JA 4ZOGA 2VTJA 4W9XA 1AGWA 2GS2A 3FZPA 3OT3A 1REKA 5L4QA 3ZTXA 1PXPA 2UV2A 1UWHA 3F5PA 4ONAA 1PXNA 5CZHA 3I5NA 2F2CB 4LRKA 3I79A 1PXKA 3RNIA 3UVQA 4F6WA 3QTQA 2IJMA 4N57A 3BBTB 3HA8A 1FINA 4D4SA 2GNJA 2JEDA 4U5JA 5CQUA 1J3HA 5AEPA 4NYEA 1ZYJA 1IA9A 4XLVA 4YLKA 1H00A 3ENHA 3MVHA 4EKKA 4YLLA 4XG6A 4USEA 1CDKA 2CGVA 1H4LA 2C6EA 3RKBA 3PY1A 4RIYB 5CY3A 1FGKA 1ZXEA 5IUHA 3QAME 5BMMA 4D2SA 2BRGA 4FT0A 4RIWB 3QRTA 1BL7A 3EQGA 3HRFA 3QWJA 4YZ9A 4BDDA 5DG5A 1BX6A 3SG9A 4RQKA 4LL5A 2GU8A 3FMKA 3O7LD 1TQMA 4DGOA 2J0JA 4PDOA 3EQDA 3LPBA 4IWPA 3VW6A 3DKFA 4LOPA 4FIJA 4L3LA 4MCVA 5BYLA 4JQ7A 4RA4A 1G3NA 4Y5HA 4JR7A 4AU8A 3G9LX 1DI9A 4RIXA 4GUEA 2OIQA 4J99A 3VUTA 3NUAA 1XJDA 3D7TB 3U8WA 4V0GB 2GCDA 2QODA 2BHEA 5ETCA 1WBSA 2Y6OA 4YC8A 3GC9A 3U51A 5E8SA 1GAGA 1H1RA 2RG5A 3KA0A 3BRBA 4GFMA 4UMTA 3TJCA 1KUTA 4EYMA 4RPVA 1M2QA 3O8PA 4KKEA 2C1AA 2VWYA 4JR3A 3ZBFA 2GHMA 3N4VA 4BRXA 3WF6A 4R3PA 3K5VA 3Q9WA 3AD6A 1E1VA 2W17A 5T6KA 5IA3A 4DH3A 3MIYA 3R1QA 4I4EA 3UO6A 3A4PA 3OWJA 3NUYA 2ESMA 4FK3A 4QP4A 5HGIA 2UW7A 3FQSA 4NM7A 3V01A 4QQJA 4ZLZA 5AIRA 3KRJA 1OKYA 3E3PA 4GUBA 4JG7A 5CSWA 5DHJA 3LFFA 3ZS5A 4PPCA 2ZMCA 3R7OA 4YPDA 4BKJA 2P3GX 5LVOA 4I21A 4G3CA 3PXRA 2WMVA 5DOSA 3CP9A 4DBXA 3PJ1A 4BDAA 2F7EE 5ANDA 3RNYA 4ASXA 3FLZA 3FI3A 4DGLC 3HV7A 4U0IA 5CXHA 4H36A 5FEDA 4FV6A 1NVQA 3QYZA 3Q60A 3GU6A 2JAMA 3R1NA 1P4FA 5EM6A 3AOXA 4ZTSA 3R1SA 3LXKA 4CSVA 3TIYA 4FGBA 3K3JA 3FKOA 3LJ2A 5L6WL 2OZAA 4N6YA 4EH5A 5HIDA 5L2QA 3QRKA 3WZUA 4F9WA 4KBAA 2I1MA 4CKRA 5ANOA 4X21A 5KMMA 3VUIA 3SXRA 4D5HA 4AFJA 4CMTA 1ZMVA 4FYNA 5BVFA 2GSFA 5KX8A 2YERA 5HIBA 3PE1A 5GJFA 3LCTA 4NW6A 4FT9A 2WMXA 4IAAA 3OBGA 5M57A 4XG4A 5DN3A 4FKLA 4YUQA 4D9UA 4EK8A 4K18A 4EH6A 1BL6A 4CXAA 4FR4A 3HA6A 2F7ZE 4IJ9A 4D4RA 3CPCA 4DEEA 1OUYA 1MRYA 3RHKA 3V6SA 3ZFMA 5JKGA 3VS5A 2O64A 4R7HA 1ZARA 3DLSA 4U3YA 1SNXA 2E9UA 5J9LA 3R8UA 3QA8A 5DMZA 1J1CA 3DPKA 2JFLA 3CEKA 3SV0A 5FQDC 4JBPA 5TR6A 3RHXA 5FBOA 4DE4A 2IG7A 1OIRA 3LQ5A 3FKLA 4P2KA 3F9NA 1OIYA 3GB2A 2J5FA 1SVEA 5AV4A 3EFJA 4L3PA 4FSYA 5J1VA 3ATSA 4OTHA 3SW4A 4CT2A 4AGWA 5DH3A 4CG8A 2CKPA 1PHKA 3CGOA 1U46A 3CLYA 4JBVA 4KIPA 4KIKA 5IDNA 2XIYA 5D11A 3R83A 3I1AA 1LEZA 3E87A 4E3CA 5J95A 3EQRA 4QYEA 3C9WA 4YO4A 5J1WA 3IK3A 4TWPA 3CTQA 2ITNA 2VX3A 4YC6A 3ZLYA 2CCHA 2QOFA 4F63A 5CU0A 3P7BA 3PY3A 4ZSGA 2OXYA 1XO2B 4JI9A 4M14A 1OPJA 3VF9A 2SRCA 4AZEA 1KSWA 2GNGA 2VO7A 4FV7A 5DR6A 3ITZA 4XV2A 3R9RA 3ZSGA 5M4FA 1R0EA 3UZPA 4A9UA 4L68A 4PP9A 1OL2A 1JLUE 2XIRA 5H8BA 5GJGA 2DUVA 3H9RA 3MYGA 2C6TA 5AWMA 3VW8A 3HV6A 3R9DA 3UNKA 3CTJA 2B7AA 3OFMA 2BAJA 4XEYA 5IEYA 3ORPA 4B9DA 3E92A 3R7UA 4RJ8A 5KE0A 2B9IA 4L53A 3HMNA 2VD5A 3MH0A 3NAYA 4XG8A 3NNUA 2W9FB 3TWJA 4EKLA 3D14A 3I6UA 4BYJA 4DFLA 2GS6A 2FSLX 2OXXA 4CFFA 2UUEA 3GFWA 4QRCA 5EYMA 4BCGA 3UP2A 3I0QA 3ZONA 4AXAA 5HE0A 4YJUA 1UWJA 4FKRA 4U80A 4DFBA 3HZTA 4XCUA 5AP7A 3VWAA 4AP7A 4KABA 4JJRA 2Q83A 4XBUA 4ENYA 4HNIA 1F0QA 4BDCA 4M69A 4DG0E 4DFNA 4E5BA 5FUTA 1L8TA 3F3WA 2GNLA 1JSUA 3HKOA 5AX3A 3S00A 3QA0A 2YIXA 3FLWA 3V5LA 5A4TA 3QXOA 3I6WA 3EQIA 2W4KA 1WVXA 2R3IA 4UY9A 4ANOA 1VR2A 4FV4A 3UDBA 1ZOHA 3LMHA 2O8YA 3RPYA 2G9XA 4MK0A 4PDPA 4XV9A 3BGQA 1SZMA 2CPKE 2ITWA 3Q96A 4J71A 4D28A 4G31A 5EQPA 3TZMA 1Y8YA 2GMXA 2W1CA 2FVDA 4CZYB 4DFYA 5IEXA 3EQPA 2AC3A 2XCKA 4FV3A 4O0YA 5CVGA 3NYVA 1CTPE 2XCHA 4FZ7A 4LUEA 1BI7A 4FIHA 3WF5A 4ZTLA 1V0OA 3ZLSA 3D94A 4DYMA 5C4KA 2XYUA 3THBA 2XBAA 4S31A 5AUZA 5K4IA 2C5NA 1H27A 2ACXA 1H25A 1YHWA 5I9UA 3RZBA 4F64A 1UU9A 4FKUA 3JY9A 3P23A 3P7CA 4LM5A 1BI8A 3DZQA 4DFZE
chains in the Genus database with same CATH superfamily
3MGYA 2XARA 1H26A 3O50A 4AWIA 3RPOA 2OXDA 3D4QA 4W9WA 5GIOE 2W1IA 5LQFA 1CKPA 3ACJA 5IQEA 5HLPA 4YJVA 3QZGA 3FHIA 4R3CA 1J7LA 5AM7A 4BCKA 5BVOA 5KKRB 4O0TA 1ZLTA 3TN8A 2NRUA 2JC6A 3LOKA 3MB6A 3R1YA 4BVUA 2PL0A 2ONLA 3RTPA 3LCDA 1M7NA 2A27A 3EQCA 2VTRA 1Q8ZA 2CCIA 2XBJA 3NUNA 2OJFE 4QTBA 5TT7A 3IKAA 4APPA 3PJ3A 4MF1A 2Y9QA 4FG8A 2RF9A 3O17A 4AA5A 2QO2A 4BBMA 2J5EA 5D1JA 4EWHA 3WZJA 1ATPE 2PE2A 4FSUA 4F65A 2IWIA 2WEIA 5FDXA 1OPKA 2PWLA 4OTFA 4Z7HA 5A4CA 4R3RA 3LXLA 1E9HA 3NIEA 2QR7A 4WUAA 3F3TA 3AD5A 4NM5A 4RVKA 4FG7A 5F1ZA 3W2OA 1OBGA 3P4KA 3VF8A 1DM2A 2Z02A 2XK4A 3TJDA 1XMMA 3F2RA 4D1SA 3CQEA 4M7IA 3P5JC 4A4OA 3EQFA 4B7TA 3OC1A 1X8BA 1W98A 5CXZA 4K8AA 5HE3A 5AUVA 3RK7A 3MPMA 2RFNA 4FL3A 4JS8A 2QVSE 5KMLA 4Y85A 1CKIA 4IX3A 2BAKA 4GVJA 3H0ZA 3D5WA 2WOUA 4WG5A 1Q97A 1M14A 5ACKA 3C4FA 5K4JA 4HCUA 5IQHA 4UXQA 4G34A 3S0OA 4QMQA 5JQ8A 4OAUC 5BVEA 4QMYA 3IOKA 5LWMA 3VS3A 5KMKA 3TT0A 5IUIA 3SQQA 3TXOA 2CN8A 4TYHA 4OT5A 1BUHA 2R3GA 4MBLA 4UWYA 3W0PA 1FVVA 1UKIA 2XRUA 1XH7A 3R9HA 4IZ7A 4CKJA 2XM8A 4Z3VA 3PP0A 1Q41A 4EK3A 4U43A 3BL7A 5GJDA 2B53A 2C6KA 4MXXA 5EKNA 3HL7A 4YGAA 5J8IA 4L67A 3F6XA 3V5WA 3WF8A 3CIKA 5L2WA 4I0RA 3ORXA 3DBCA 3EHAA 2XKDA 3NGAA 2EWAA 4I41A 3EWHA 4TWNA 2UZNA 3DDPA 2YM7A 5DT3A 3F3ZA 1FMKA 3FMMA 3QKKA 3ZLXA 3EJ1A 1APME 3NR9A 2RL5A 4GV1A 4P5ZA 3TL8A 4MX9A 2C47A 1K3AA 2OF4A 4OGRA 4B4LA 1JKSA 5KMIA 3ZEPA 4GK2A 5LVPA 4C4GA 3E63A 1UA2A 3UVPA 4K9YA 5E1EA 3ZFYA 4S32A 4NCTC 4R7BA 3ULZA 1RW8A 3EH9A 4FTOA 4E8AA 4U45A 3NNVA 4C37A 3ZRKA 2XIZA 2YIRA 1OZ1A 3COKA 4ENXA 1ZZLA 4F6UA 4E7WA 3K2LA 2V62A 3A7GA 1WVWA 4G6LA 1Q5KA 3COMA 3KKVA 4FT7A 3ZZWA 4FE2A 3GQLA 3HV5A 3D5VA 5HLWA 3VUHA 5HORA 2V0DA 4I22A 1RE8A 3PYYA 4X3FC 5C8NA 2W99B 4OBPA 5FP5A 4D4YA 2PVMA 4CCBA 5LVLA 5EM7A 4UZHA 3A7IA 3FLSA 3N4UA 3KULA 3OVVA 3F82A 1SYKA 1GIJA 3BHHA 3ZDIA 3VJNA 3UC4A 4YBJA 3FZTA 4FEWA 5E8VA 3V51A 4EEVA 4MQ2A 4ZY6A 3FXXA 5GHVA 3L8XA 3QKMA 3TACA 3BE2A 1O6KA 1GNGA 4XYFA 5HBEA 2C6LA 1OGUA 4DH5A 4AN2A 4HVDA 2YJSA 4AGCA 2XK3A 4ZJIA 2WMSA 4EOQA 1PYXA 2C3IB 2I0YA 1Y91A 5TOZA 3D5XA 2HYYA 2X9EA 3DXQA 3BEGA 1HCLA 2R9SA 3L8SA 4J8NA 4WNKA 4QNYA 3HAMA 4NH1A 1URWA 2V22A 5EDRA 4H58A 4PDYA 4DHZA 2OO8X 5CANA 4AX8A 3CY2A 3IECA 4YLJA 3KRRA 5A46A 2BRBA 5I9VA 3HGKA 5F4NA 2JDVA 3G0FA 3BX5A 3R8ZA 5IDPA 5AA8A 1NVRA 4O0SA 4RC3A 2Z7SA 3ORKA 4YZNA 3REPA 4ZEGA 2WQOA 3RCJA 3GP0A 5AP4A 3I60A 4Z16A 4EH2A 4YJPA 3QLGA 3E93A 1ZAOA 4QMOA 4X6RA 3P08A 3FUPA 5AAFA 1YOJA 2XALA 1GZKA 2FO0A 2JFMA 4PRJA 4BZDA 2WPAA 3ZM9A 5JK3A 2WD1A 4TYJA 3K5UA 4CLJA 2BUJA 3W16A 5H9BA 3SRVA 4E6AA 3NW5A 2X6DA 3KGAA 4IB3A 4ZTRA 4FSRA 1Q8UA 1ZY4A 2YACA 3FQEA 3PXYA 2PZPA 4QP7A 2ZYBA 4ZJJA 5CF8A 4FTAA 4C7TA 4R7IA 3OW3A 3NDMA 5HCZA 5BUEA 1H1SA 2QI8A 1PKGA 1KOBA 5AP5A 3QX4A 3NNXA 4I4FA 2RG6A 3EOCA 5A4LA 3AMBA 5EH0A 4PPAA 2H9VA 2Y4IC 4USDA 4X6QC 3ZUUA 1T45A 4TTHB 3V3VA 4JRVA 3U9CA 3OCTA 4YO6A 3ZO2A 4EOOA 5AADA 4FEVA 2NP8A 3ZH8A 3O51A 2QHNA 4HGEA 2XJ2A 2P0CA 3GEQA 2I0HA 4MNFA 4WA9A 2GFCA 3PVGA 1Z9XA 1JNKA 2Y8OA 2WQBA 2OJJA 1IAHA 3NYNA 4ID7A 1J1BA 5ETIA 5BVWA 3G15A 3PJ8A 4GT4A 4I5PA 2GHGA 4IC8A 4K0YA 4YZBA 5D9HA 5CVHA 2PPQA 3LCOA 3LM0A 1GOLA 2C3JA 2WTKC 3AMYA 3Q4ZA 3MFUA 5GZAA 5HCYA 2YJRA 3PWDA 3GUBA 4DA5A 1OUKA 4GIIA 4JLCA 3NX8A 5IKWA 3FMLA 4DFUA 4E5AX 3MFTA 4JG8A 2OGVA 4D2VA 1NT2A 1PXMA 2QG5A 4P4CA 4Q5EA 4QMSA 4ERWA 4ZTMA 4O82A 2OZAB 2J4ZA 5JSMA 4FI1A 4GMYA 3BHVA 4BC6A 4FX3A 4RJ6A 2W05A 3R02A 2YWVA 3SW7A 2YDJA 2W0JA 1AQ1A 1IR3A 2QONA 4LI5A 5E1SA 4GU6A 4RIOA 3PXQA 4OUCA 3VBQA 3CBLA 4O0VA 4Z55A 2ZV9A 1IG1A 5I3OA 4AZTA 4F78A 2X4FA 3JVRA 2VV9A 5AUUA 5CAQA 3DBFA 4AAYA 4FSQA 3LCSA 1OITA 2O2UA 2X0QA 4NIFA 3WZEA 3VAPA 5BPYA 4CEGA 5HO7A 5BX0A 3WZKA 5EYDA 4RX5A 4CYIA 3FBVA 3RJCA 5HO8A 4ASZA 4MQ1A 3BWJA 3QD2B 3P9JA 5HTCA 1G8AA 4E4MA 3KMMA 3ALNA 4DN5A 2WU7A 3UG2A 2PUPA 4QQCA 5JEBA 4FIIA 1ZYCA 4IDTA 1Q99A 2EVAA 5IQBA 4MWHA 4M13A 4O22A 3S1HA 4RWJA 3IPHA 2PZRA 3DZOA 3HECA 5FP6A 1M52A 4CNHA 5HKMA 3MN3A 4BJJB 2CLQA 5ETFA 4CMOA 4ZLYA 3FHRA 3GC8A 2BZIB 4MNEA 4N0SA 3IGGA 5IPJA 4O91A 4QP2A 2C3KA 4KUJA 4O81A 2XNGA 3AC1A 3AT2A 3OTVA 4BB4A 4EHVA 3KIOC 3OCGA 3PUPA 4TW9A 4RGJA 3GC7A 2XKEA 3CC6A 4IDVA 2X8EA 4EL9A 1FQ1B 1MUOA 3BQRA 4U42A 3RPSA 1XBAA 2VO3A 3E8DA 1MP8A 3QTRA 4KIKB 4S30A 3ZO4A 4D1ZA 4F7NA 2I0EA 3CKXA 1RQQA 3RPVA 4EOKA 2WHBA 1PW2A 5IH6A 2C6DA 5CT7A 5KHWA 3C0GA 5I0BA 3RMFA 4DLJA 1OPLA 2VU3A 5EHLA 4BL1A 3DXPA 4EI4A 3CXWA 1G8KA 4QP6A 4PQNA 5IA0A 3FL5A 5CX9A 4PNKA 4E1ZA 3LJ1A 3KF4A 2QOLA 1K9AA 5I9ZA 3OW4A 3DAKA 2WXVA 2YIYA 4FNYA 2QC6A 4GG5A 2GFSA 4WG3A 3BWFA 3ZHPC 2G01A 3HLLA 4GCJA 5TKDA 4DGNA 1PXLA 4HVSA 5L2TA 5M51A 4I6QA 4YSMA 1R3CA 1H24A 4FA2A 3UIBA 5AX9A 4M15A 1UNGA 2X8DA 4UWBA 3CD8A 3SOAA 5J5TA 3SKCA 4DT9A 3A99A 2YABA 3PA4A 3KRLA 3A4OX 2AEGA 3NLBA 4G6OA 4Q5HA 3VNTA 1ZZ2A 3QTXA 4FTJA 4GG7A 4OAVB 3QCSA 4XG2A 3BELA 3ORZA 3Q4UA 3BCEA 3IDCA 4JG6A 4KIQA 4PTGA 4XP3A 2DWBA 3KXNA 2UZDA 2YDIA 4IE9A 4KBCA 3U4UA 3GT8A 4U3ZA 4F0IA 3C5IA 4GFGA 3BYOA 3OUKA 4X7QA 4F70A 2HCKA 4MWIA 4FTMA 3FE3A 4BI1A 3OXZA 1W2FA 4FVQA 1JSVA 2CJMA 1DAYA 3PP1A 4GU9A 3Q04A 1ZOEA 2HZ4A 4I1ZA 2O0UA 4OTGA 2QO9A 3JY0A 2C69A 4R1YA 5CU3A 4FKWA 3DBEA 3QQKA 4I93A 2VTQA 4M69B 1JKKA 3RALA 4C34A 4FKJA 3TUCA 2A0CX 3F3UA 4FNXA 4IFCA 4DAWA 4K6ZA 4AXDA 2PZ5A 2OIDA 4G17A 3FSFA 1UKHA 4FNZA 4KIOA 5CVFA 4EH7A 5F9EA 3PWYA 4BWXA 5G6VA 3EYGA 5CT0A 5F95A 1WBWA 3OXIA 4F0GA 2IF8A 4YJTA 2OSCA 4MD9E 4YU2A 2BROA 1CMKE 3TZ9A 4F1MA 3MVMA 2X7FA 1IAJA 3KXZA 4Y46A 5E8XA 3D15A 2YFXA 4QMUA 4TY1A 4G5JA 5DVRA 2P2HA 3M42A 4W8DA 2J2IB 1XR1A 5CSPA 4NUSA 3SGCA 2XVDA 4B8MA 5DLSA 2BTRA 4I6FA 4J95A 2CDZA 4G5PA 4J7BA 2Y7JA 4P7EA 2OZOA 3RAIA 3QC9A 3UBDA 2IW9A 1JQHA 3MFRA 4NM3A 5LMKC 4QNAA 3DS6A 2YM8A 2F9GA 3AQVA 1JAMA 3K54A 4YC3A 5AP0A 5AP6A 4BTKA 2ITUA 5HVJA 3C4XA 4L7FA 4IAFA 1QPJA 4KS7A 1J91A 3DLZA 4E6QA 3KCFA 3ORNA 3C4EA 2YHVA 3QQGA 3C5UA 4PV0A 1ZY5A 5L8JA 4GK3A 4RBLA 4BCJA 3MTFA 5CZIA 4BR3A 4FSZA 3UE4A 3U9NA 4CD0A 3IW6A 4RT7A 4FYOA 3ZC5A 4C33A 4E4XA 1Q61A 2GTMA 4ZTNA 3DJ7A 4G3FA 3O96A 4I6HA 4RC4A 2O5KA 2R2PA 4UN0C 1I44A 3DKOA 4U41A 4TZRA 4ACDA 2R3MA 1PXJA 4TYEA 4QP3A 4YMJA 2ZJWA 4L7SA 3WE8A 2VGOA 5CAOA 2IW8A 3KK8A 5EFQA 3F5XA 5EOBA 5B0XA 4JQ8A 4X2KA 3ZCLA 5JRQA 1TKIA 2J90A 2OJ9A 2UZEA 4O21A 2ZM4A 4XLIA 4CTCA 2ZDTA 2VO0A 4IJPA 1PF8A 3DFAA 3LQ8A 1W7HA 2ITTA 2C1BA 4JX3A 3V6RA 2QKWB 3CS9A 3EIDA 2BPMA 5M4UA 2VWZA 2ZB0A 5AUWA 4YPSA 5AV3A 5FM2A 3R9OA 2X39A 3QU0A 5D41A 4ZXTA 3DBQA 2OF2A 2OU7A 3NSZA 5CU2A 4JX7A 2XJ0A 2XK8A 4FODA 3MESA 3PTGA 4GJ2A 3R71A 1RJBA 3UDTA 5I9WA 4XJ0A 3BHYA 3POZA 3BIZA 5T3QA 3DBDA 4BDHA 1REJA 4BWKA 2Y0AA 3OY1A 4QTAA 4WG4A 2P4IA 2HWOA 3S4QA 3BV3A 5AR8A 3GCSA 4GH2A 4C4HA 3FXWA 4MXYA 4YP8A 4NSTA 4R78A 4MD8E 3PSCA 1YDSE 3MFSA 4N70A 5AA9A 5DA3A 3DOGA 4FZAB 4W4WA 3PUFC 1DI8A 5AV1A 5EI2A 4DFXE 4HW7A 3RVGA 5KNJA 1PXIA 3G90X 4QQTA 4O4EA 3KREA 1W83A 1GZOA 4JOAA 3FPMA 5K5NA 3OOGA 4PTEA 2WMAA 5FTGA 5TF9A 3W2PA 3LCKA 4I3ZA 2FH9A 4GW8A 2AQXA 1S9IA 4F1TA 1I09A 3ZO1A 3M2WA 3QZFA 2XJ1A 2C6IA 3PPZA 2VNYA 4N6ZA 3W33A 3MA3A 3KFAA 5ICPA 5HU3A 4NCTA 4JBQA 1XWSA 2YWPA 3VBVA 5KKRC 3IO7A 3WE4A 3NAXA 3UTOA 5KCVA 2F57A 3R7GA 5CU4A 3OXTA 3BU3A 3U4WA 2XP2A 4YURA 4UBAA 4WT6A 3BU6A 4Y73A 4AT3A 3CY3A 4UMRA 4WOVA 3KXXA 5IF1A 4X2JA 2B9HA 2OJGA 3U6IA 3A62A 2E9OA 4HZRA 1QMZA 4CFXA 4X3FA 3C50A 3QRJA 4LGGA 4D2RA 2P33A 5I9YA 3O7LB 2C30A 2J0LA 4L46A 4AN3A 2JBPA 3QTIA 3W10A 5ANKA 3QLFA 3MH3A 3CE3A 5CEKA 2J0IA 4B6LA 2YA9A 3OMVA 1YHSA 4KD1A 5M4IA 2VX1A 4I5HA 2E9NA 1XMLA 4IHPA 4FGRA 2ITYA 1KE9A 4ZZMA 4C62A 4FTUA 1JWHA 4HYIA 4IQ6A 3T8OA 2YCRA 3F66A 2ITZA 5EQYA 3GCQA 3D9VA 3KMWA 3NS9A 5HX8A 1XH4A 3KULB 2H8HA 1QL6A 3ZM4A 1IRKA 2C0TA 3RP9A 3ZSIA 2ITPA 4DG2E 2ITQA 3R6XA 3IOPA 2IVUA 3B8RA 3PG1A 1JKTA 5FG8A 5ACBC 5IQIA 4U44A 5AR2A 2PU8A 3KQ7A 1B6CB 3PY0A 4EJNA 1STCE 4ZSLA 3NEWA 4EQMA 3QALE 5A9UA 2V5QA 4WKQA 2PVFA 4AZWA 5AUTA 4CT1A 3C0HA 4WNOA 3OCBA 3EL8A 4O27B 1G5SA 1BLXA 3PSDA 5LCKA 5BMSA 5EW9A 4EHEA 1KWPA 5LOHA 4FV2A 4I23A 2VNWA 4QQ5A 5DPVA 4JDIA 4XP2A 3TNQB 5M08A 2VTTA 2BFXA 5K9IA 1ZYLA 2UZWE 4ZLOA 2W5BA 2NO3A 3WIGA 3ZBXA 1W0XC 2B55A 4BGHA 5JGAA 4QP8A 5IUGA 4LMNA 3IDBA 2QOKA 3S3IA 5IG1A 4RX9A 5J7HA 1M17A 4V05A 3ROYA 2YEXA 5BQ0A 4LV7A 2JDTA 1PMNA 3F3VA 3FMHA 3LHJA 1URCA 4CZTA 1B39A 3UDZA 4CLIA 2OH4A 5DT4A 3QTZA 5HVYA 4K77A 3ACKA 2UZTA 2FUMA 4BBEA 2BRMA 4F09A 4NWMA 1OIUA 2CGUA 3PZEA 4ITIA 4YHTA 3EB0A 5HD4A 3QYWA 2X0GA 3SRVB 4IM2A 4MVFA 4AZSA 3UMWA 3VS0A 1H1PA 1U54A 2VTHA 3DDQA 3JYAA 3PZHA 4AA0A 5GIPE 3DXNA 5C1QB 3MPTA 3W55A 2UW5A 5FXQA 5C8KA 4HPTE 2A98A 3ZSHA 3QZIA 1B38A 4QTCA 2YAKA 3OWLA 2QLUA 4WSYA 5GZ9A 3IQ7A 3ATTA 4YNEA 5EM5A 5DR2A 4BYIA 2HZ0A 2V7OA 3AGLA 4DEGA 2HW7A 3W2QA 4FV9A 4OTIA 3R7EA 4IWQA 5AR4A 2R3PA 2PMNX 1JVPP 3QQJA 3H4JA 4UZDA 2O63A 4D9TA 2XKCA 5A6NA 2HY0A 2B0QA 2JIUA 2W1ZA 3R7YA 2A1AB 1Q8YA 4XOYA 1YOLA 4IEBA 3W8LA 3O23A 3NCGA 2IVVA 4JDJA 3ZRLA 3GOKA 4IBMA 5D7AA 4O0XA 2WTDA 4AACA 4C58A 4D2WA 3OS3A 2GNIA 4RVLA 2XB7A 4QMVA 3UVRA 4F9CA 4ZZOA 4B99A 3QGYA 3V8TA 1VLRA 4AOJA 3UZRA 1LEWA 1IEPA 5CNNA 3FLNC 4V04A 4FTRA 4JDHA 4IMYA 5AUYA 3ORIA 3H3CA 3PE2A 4USFA 2I6LA 3LLTA 4KB8A 4RQVA 4JRNA 5DRBA 3VULA 3R2YA 2XS0A 1BMKA 1A48A 1RDQE 3HMMA 4BN1A 2HIWA 3CPBA 3BV2A 4F7LA 3SX9A 5HLNA 2VWBA 4FTTA 3LM5A 4OLIA 5JMSA 3ZFXA 2XNOA 4XP0A 4MKCA 1YQJA 4X2FA 5BUIA 4AQKA 3R8MA 4O7WA 2YCSA 4A9SA 4M3QA 1H08A 4NIFB 4BDJA 3Q53A 4L6QA 2X4ZA 4ALUA 1GZNA 4DCEA 4BTJA 3GVUA 4MBJA 3QCYA 4ZY4A 2YAAA 1W2DA 4H3QA 4OT6A 4NZWB 3UG1A 3ZMMA 3QQLA 5EHYA 5I4NA 4FSNA 1U4DA 5AFVA 2YM4A 4U81A 4EOSA 2XRWA 2WIHA 3KB7A 4QEBA 3CCNA 3AGMA 3IGOA 3IW7A 4JT3A 4BCFA 1OGYA 3ALOA 3KC3A 3SVVA 2HZIA 2PVNA 1HCKA 3MV5A 3GU7A 3UNJA 4ZP5A 3L9LA 3QX2A 1DS5A 4O4CA 4D4VA 2BMCA 3R28A 5J9ZA 4MNEB 5IQFA 2P55A 3QQHA 3BHTA 4FKQA 4LGHA 5CSHA 5B2KA 3FDNA 5JFXA 3BYVA 3TYKA 5AP3A 3ANQA 3H30A 2WELA 4JQEA 5CNOA 4FTCA 4L52A 2XNPA 1Q8TA 5CSVA 3PIXA 3ENMA 2REIA 2ZV8A 3DNDA 1F5QA 2BR1A 2GNFA 5AMNA 3TV7A 4C8BA 3BEAA 3NW6A 4A4LA 4RWIA 4DINA 5E91A 3BLAA 3MJ2A 4NTTA 4KINA 1O6YA 3IW8A 4Q2AA 1ERKA 4CTBA 3NRMA 4LRJA 2VWVA 3ZC6A 3SA0A 2E9PA 5CENA 3IS5A 2JKMA 5EW3A 4OTDA 4G1WA 4BCOA 1F3MC 5FD2A 4P90A 2VAGA 4O2PA 4ZS0A 4D0WA 4L42A 5H3QA 2WTCA 3NCZA 4PL4A 5AV2A 3C4WA 4ACMA 2IZTA 4BDFA 1W82A 3VRYA 3PVBA 4QYHA 3R04A 5M56A 3C13A 4G9CA 4XMOA 2CNQA 2EXMA 2UW4A 4QMXA 5B7VA 2QLQA 2WTIA 4FUYA 2BKZA 5L8KA 4DTBA 2WMBA 4O38A 4TL0A 1YWRA 3TNPC 4FNWA 2NNWB 2F7XE 4C3PA 4OTWA 3HV4A 3Q4CA 2WTWA 2IZUA 4RJ7A 4TN6A 4ANSA 3DTWA 2W06A 3D2KA 3EN5A 1OL1A 2ETKA 3BKBA 5L3AA 3RWQA 2IW6A 4GYGA 4H39A 3UJGA 4JAIA 4O86A 4FSWA 2JAVA 4FTLA 1Q24A 3Q32A 4ANBA 3PXZA 3UIMA 4AXFA 3HEGA 5EDPA 5GZ8A 4FRFA 2GPHA 5CLPA 3DA6A 4BBFA 3TUBA 3ZUVA 2BTSA 4IVCA 4RWLA 5JRSA 5E4HA 5ANEA 4A9RA 3VVHA 2BCJA 3DGKA 3CQUA 4B0GA 3R0TA 4TRLA 4MEDA 4QTEA 4EK6A 1OI9A 3ID6C 1YVJA 2XEZA 3PLSA 4FF8A 4DDGA 2WMTA 4J98A 5JN2A 3V5JA 3ZLWA 5CALA 5HZNA 4FKOA 2X2MA 3MA6A 4MBIA 4EUTA 3EKKA 4U9AA 2BDFA 2GQRA 5KUPA 4QYFA 2XYNA 3VJOA 1ST0A 1E1XA 2ZFYA 3I5ZA 4L01A 5A14A 5L2SA 3EN9A 3CQWA 4GRBA 5KMOA 1PJKA 5LMKA 4U97A 5M44A 2OW3A 1MQ4A 3VS4A 4PMTA 3SHEA 3PFQA 4IWOA 4EK4A 3F88A 2YZLA 2CNUA 4DBNA 1H8FA 4NFNA 4IX5A 4G3DA 3QHWA 2J0MB 2PSQA 4GVAA 4PX6A 4ZSAA 3UQGA 3IW4A 4LFIA 4EHZA 1K2PA 4TWCA 4XG9A 1YXSA 3OP5A 4FTNA 4DTAA 2WQMA 5IQCA 4TT7A 2VRXA 3R2BA 4C0TA 4AFEA 4QMNA 2AC5A 2XEYA 3HRBA 4QPSA 2PYWA 5AJQA 5IH5A 2X1NA 4RIXB 4GJ3A 4EBWA 3B2TA 4GS6A 1OKVA 5DNRA 5KMNA 3F7WA 3ZYAA 5I3RA 2PE0A 4BFMA 3FC2A 2OWBA 5HQ0A 1YDTE 3R9NA 3RAHA 5IQAA 3RM7A 4OTPA 4NKAA 3FZ1A 3GCPA 5C26A 5JT2A 3DQWA 5TO8A 4E6DA 3AC3A 4AA4A 3ZO3A 2PVYA 4S33A 1V0BA 5HD7A 4XBRA 1FMOE 5T68A 4PTCA 5JZNA 4ANLA 4F7JA 1H1WA 4U8ZA 3U87A 4KBKA 2WMUA 4PY1A 3OROA 5E8ZA 4BWPA 5AAGA 4NM0A 4ACCA 4AZVA 1UU3A 4ALVA 3S2PA 3V5QA 3HMPA 4AS0A 5CAUA 3FZSA 1AD5A 4KRCA 5HHWA 4O6LA 4UV0A 3HX4A 3MDYA 3ZOSA 3R22A 2G2FA 3H9FA 2PUIA 4IAIA 3TV6A 3AC4A 2BFYA 3MTLA 3W1FA 2VTIA 2OKRA 2YCFA 5E90A 2FSTX 5FTQA 4AZFA 4QTDA 2BDWA 5K0XA 2WZJA 4WO5A 5AAEA 4FT5A 4EZ3A 4LV8A 1FVRA 1R78A 3W32A 5KO1A 3N4TA 3L9NA 4O7YA 3LXNA 4RRVA 4O7SA 2E9VA 3AD4A 3COIA 5IMEA 2W7XA 1G8SA 4C61A 1BYGA 4IZYA 3QRUA 4NJDA 4V01A 4FKPA 4BTFA 2KTYA 4GK4A 2I0VA 2P2IA 2Z2WA 3VBXA 2BIKB 5KZ0A 2PVJA 1R1WA 4CFMA 4GL9A 4BIDA 3MS9A 5FEEA 3OEFX 2OBJA 4J1RA 3KVXA 2UW6A 4UEUA 4EZ7A 2HOGA 1FGIA 5DWRA 3TNHA 3AKLA 1PMVA 3Q4TA 3N51A 4FG9A 5FEQA 4K11A 1M2RA 3UQCA 3DV3A 1U59A 4F6SA 1CSNA 2W4OA 4KS8A 2RKUA 1W2CA 3PPJA 2VWIA 4FZ6A 4NJ3A 4QD6A 4Z9LA 2E2BA 4IAKA 5EHOA 3PA3A 5A54A 2WB8A 1OMWA 4IX6A 4IM3A 4FICA 3TNIA 4F08A 5DT0A 3QCQA 4ZMFA 4YSJA 4C2WA 4MUQA 5J7BA 1YXVA 5F20A 4FKGA 4TNDA 3T9IA 3ULIA 3FZRA 4JXFA 4HZSA 4A06A 1YXXA 4O83A 1XH6A 1Y6BA 4JDKA 4C35A 4ZSEA 4FV0A 1WVYA 4DT8A 4UALA 4FTQA 4BI2A 3HNGA 4FBXA 1VYWA 3DNEA 2Z7QA 4DTKA 2BAQA 5EDQA 1GJOA 2X6EA 1XQZA 4AOTA 3CJFA 2G2IA 2ITOA 3LE6A 3NIZA 4LYNA 4CG9A 1PRYA 1SMHA 4UMQA 4MXZA 5BNJA 1YOMA 1CKJA 2DYLA 2A2AA 4M84A 4I92A 2PUUA 3P5KA 3I0OA 3L1SA 4X3FB 4XRLA 1WAKA 2CLXA 4XV3A 1P4OA 4Y72A 3F7ZA 3U54A 2WNTA 4MYGA 3LXPA 3P86A 4NKSA 5EYCA 4AAAA 4UMUA 2O3PA 5DEWA 3SDJA 4CV8A 2JITA 3PVWA 4AF3A 1FBNA 2EUFB 3E8CA 3TZ8A 4R6VA 2OK1A 3VRZA 4IZ5A 3B2WA 4BTMA 2CKOA 3II5A 3QD0A 3W8QA 1XH8A 4YJRA 4O7NA 4AGDA 3UNZA 4C4EA 3QC4A 4AE6A 2QNJA 5BUJA 4I6LA 4XG3A 2QOHA 2RFDA 4PUZA 3V04A 3UO4A 1V1KA 2NPQA 2Z7LA 5DBXA 3FXZA 5IU2A 3PPKA 3VBWA 2X2LA 4H3BA 4TWOA 3GI3A 3L8PA 3NYXA 4H1MA 4YR8A 3FZOA 2IN6A 3AKKA 2ETRA 2XNEA 4FKTA 4QP1A 2J6MA 4YZDA 2UVZA 4KNBA 4ZZNA 5GNKA 3BGPA 4FIFA 2ZOQA 2VZ6A 3DKCA 5HE1A 5IZFA 2JDOA 3SG8A 4O84A 3FMNA 2X8IA 3QTSA 2YLEA 5E8WA 5F94A 4QYGA 4YJSA 3C51A 3DK6A 3VUKA 5LVNA 3F69A 3MIAA 4FJVA 2W4JA 1FVTA 1ZYSA 3BYSA 2C5YA 4Q9ZA 3PXFA 3W2CA 2W5HA 3LKMA 2CGXA