2JFLA

Crystal structure of human ste20-like kinase (diphosphorylated form) bound to 5- amino-3-((4-(aminosulfonyl)phenyl)amino)-n-(2,6- difluorophenyl)-1h-1,2,4-triazole-1-carbothioamide
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
288
structure length
286
Chain Sequence
YEHVTRDLNPEDFWEIIGELGDGAFGKVYKAQNKETSVLAAAKVIDTKSEEELEDYMVEIDILASCDHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVMLELERPLTESQIQVVCKQTLDALNYLHDNKIIHRDLKAGNILFTLDGDIKLADFGVSAKNTRIQRRDFIGTPYWMAPEVVMCETSKDRPYDYKADVWSLGITLIEMAEIEPPHHELNPMRVLLKIAKSEPPTLAQPSRWSSNFKDFLKKCLEKNVDARWTTSQLLQHPFVTVDSNKPIRELIAEAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STE20-LIKE SERINE/THREONINE-PROTEIN KINASE
publication title Activation Segment Dimerization: A Mechanism for Kinase Autophosphorylation of Non-Consensus Sites.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 286
sequence length 288
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jflA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jflA01
1BLXA 4BTKA 5BVDA 2CGUA 2XIXA 4FTJA 1SVEA 5EHLA 1ZOHA 3UGCA 4APCA 5DMZA 3IKAA 1XR1A 5M08A 4LRMA 2XIKA 4GH2A 4C02A 4NCTA 5M4CA 1I44A 3CS9A 4BTFA 5AEPA 4IM3A 3KN5A 4FYOA 3TM0A 3PE1A 2O3PA 2QURA 4JR3A 1JKSA 5KMMA 1JKKA 3Q52A 4FSMA 4M69B 3ERKA 2VWUA 3KN6A 2A2AA 2GU8A 3NW5A 4L43A 3C0HA 3H4JA 4DHFA 5K0XA 4JIKA 4F9YA 5KBQA 5CX9A 3R7YA 2ZV2A 4CKRA 2WQEA 3A7JA 4XG7A 1QL6A 3OY3A 5DGZA 4X6QC 4YJVA 5I3RA 3WI6A 5J9ZA 1K3AA 3MPMA 2YM5A 3ZOSA 4EK6A 4OUCA 2C5VA 5LMKC 3MFTA 3IPHA 4FTRA 4QP8A 1Q41A 2RKUA 4R1VA 4BCNA 5ETFA 5JKGA 4GRBA 4HYUA 2VTHA 3RI1A 3EL7A 3AT2A 2C0IA 4GYIA 3IDPA 4MBIA 4D5HA 5L4QA 4CFMA 3QZIA 5EQEA 1OKVA 3FMMA 5AR4A 3KL8A 1AQ1A 5JSMA 5A4LA 5AP0A 4TTHB 1YXTA 5HQ0A 2J0JA 5IQHA 4CQEA 4DFBA 4WHZA 4E93A 2BCJA 5J7BA 2UW4A 4M15A 3PPKA 1GZNA 2G1TA 3BLRA 4NM3A 2YM3A 1XJDA 1YXUA 4BN1A 4G6LA 5J87A 4KD1A 4O0SA 5HO7A 4BY9E 3VC4A 4IZ7A 4U7ZA 4JR7A 1L3RE 4IFCA 4MK0A 1Q5KA 3UMXA 2X7OA 3FAAA 5FP5A 3QQLA 4RIWB 3KXMA 4YJQA 5HZNA 3K54A 2CGXA 2H9VA 5D7VA 4AGUA 3FLWA 4OT6A 4M12A 1JVPP 2C3IB 3HV7A 4U9AA 2X6EA 1FBNA 4H1MA 3R1NA 1GAGA 3EOCA 4RWIA 5AWMA 3FQHA 4ZY6A 5K4IA 5FWKK 4CTBA 4PTEA 3U8WA 4NSTA 5DNRA 3TL8A 3HDNA 1BUHA 4FOBA 3NLBA 4AFJA 3V8TA 2PMLX 3R30A 2ONLA 3GBZA 3OS3A 3SW4A 2W1DA 3CGOA 1AD5A 4GS6A 3O51A 4MYGA 4BHZA 4CCBA 3R9RA 4YR8A 1OIRA 3TXOA 4FG9A 3AXWA 4RVLA 2J90A 2YWPA 4C4FA 4QMWA 3PDTA 3QQJA 4EBWA 4ZEGA 1UWJA 3AGMA 3KVXA 3MV5A 4PDPA 3IG7A 4GFMA 3P7CA 4U8ZA 4YZCA 4CMUA 4EZ5A 3MDYA 3D5XA 1M17A 5AAGA 2OU7A 3LLAA 3OXIA 4ZTSA 1VJYA 2PVNA 3CGFA 3WIKA 5CQWA 4PL3A 3VQUA 3GCUA 4TT7A 3QQFA 2FB8A 2ITYA 4FTMA 1RQQA 5J5TA 4U0IA 4EK4A 2FSLX 4DGGA 2V0DA 2QU6A 4G17A 3JY9A 4G3CA 1BMKA 2UVXA 4BZNA 2W1GA 4A07A 3NW7A 4EH8A 3R83A 2W05A 4AOIA 1YI4A 3AMAA 3DKCA 4ITIA 4RVKA 4O1OA 4Z16A 4EORA 4OGRA 3H0ZA 4C2WA 2QKRA 5IUGA 2ITZA 3ZDIA 3SXRA 2I7QA 3AD6A 2XKEA 3DFCB 3PA5A 5KMLA 5CI7A 5B2LA 4P90A 2OWBA 3R7UA 1ERKA 3QTXA 1CKIA 4WUAA 3MH1A 3FLQA 3OOGA 2GNFA 3Q60A 4RIYA 2E9PA 2R3QA 2ZVAA 4RVTA 4DEDA 4CFXA 4CT2A 3CLYA 2PVFA 2W9FB 1W8CA 2QOBA 2X7FA 3F88A 3MPAA 4IQ6A 4KABA 4O0UA 4WG5A 2XJ1A 3SC1A 3T9IA 3MESA 3I6WA 2JKKA 4N6ZA 2XEZA 1ZZLA 1JSVA 2XNPA 3QLGA 3HP5A 5AV0A 4MTAA 2WB8A 4DFNA 4V01A 2VN9A 2PTKA 3IW6A 4WA9A 3T3VA 4KKHA 3DJ6A 4NT4A 2W4OA 2Y7JA 3BWFA 4YSJA 5EHYA 5HNBA 3EQRA 4UBAA 5AR5A 3DJ5A 2C3JA 3LLTA 4FKPA 3ZZEA 4BDKA 4TYGA 2BIYA 3F2AA 5IA0A 4JL9A 4I5CA 1VYZA 4F63A 5L2SA 3GCVA 3JVRA 5H8BA 4M69A 3UYSA 1CMKE 2QO9A 5KCVA 1G3NA 3E3BX 4EOQA 3QRJA 4FV0A 2G2IA 2QO2A 2R64A 4R3CA 5CSWA 5F1ZA 4EC9A 4L46A 3MH2A 5BUJA 2YIXA 2YM7A 3ELJA 1IRKA 5HNGA 4QMZA 2OXYA 4D4VA 3E5AA 4UB7A 5C9CA 3EH9A 3FMEA 3NS9A 3PJ2A 2J51A 4XRJA 3WF5A 4ONAA 1JAMA 1H27A 4DINA 3NNXA 1PXMA 5I9UA 3CQEA 3WOWA 4QTEA 3U87A 2HYYA 2QD9A 2QOHA 4C4GA 4R78A 4WKQA 5IPJA 2XYNA 3LAUA 4PQNA 4ITHA 2PVRA 3G5DA 5DE2A 3W16A 1OITA 3TNQB 3PTGA 4BZDA 5D12A 5CU4A 2HY0A 3GB2A 5CY3A 3DNDA 3PJ1A 4C57A 2Z8CA 3BGZA 4LGHA 2YDJA 4JIAA 4MH7A 4YZNA 3S00A 3ZZWA 2WMAA 3MVHA 3N4UA 5HOAA 3NUSA 4DC2A 2GS6A 3ATSA 3DQWA 5FEEA 1CSNA 3NR9A 3NMUF 5CASA 4IDVA 2IJMA 2UZWE 3PVWA 2WTDA 4TYHB 2GNLA 2B7AA 4E20A 5BVOA 5AJQA 3ZCLA 4Y72A 3VJOA 4GYGA 4R8QA 2OF2A 3ITZA 4U79A 3ZTXA 4C8BA 1ZYDA 5K4JA 4MF0A 4ACCA 3QD4A 4FL3A 3SAYA 5FXRA 2VWZA 5E8ZA 2BROA 2QC6A 4FKUA 3G9LX 3ORNA 4QPSA 4AXAA 3NDMA 3QD0A 2H96A 2GQRA 4QYEA 2X8DA 4DFLA 4YJRA 4QMNA 5I9YA 3O23A 3O0GA 2HY81 1PJKA 3RZFA 4ERWA 4BDDA 4FKIA 4ZMFA 2P33A 2R3GA 4FNWA 5GJGA 2V7OA 1OM1A 5LVOA 4HYSA 5GJDA 3ZO4A 3P7AA 2AUHA 4GG7A 4F0FA 1PRYA 2P4IA 2OLCA 4WIHA 5HO8A 2WEVA 3QFVA 4F64A 2W06A 3KRJA 3OWPA 1JBPE 2ZB1A 1H28A 4TKSA 3VN9A 3ZYAA 4RJ7A 3BHTA 4UZDA 5LARA 3OF0A 4IJPA 4BCFA 2JAVA 3NUPA 2YIYA 3NWWA 3BQCA 4AACA 5A6NA 5M57A 2OSCA 3BEGA 3DBCA 3Q9XA 3R28A 2F7XE 3KFAA 1GNGA 3NCZA 3WF9A 5J95A 4I0TA 5HIEA 5GIOE 3H9RA 5TE0A 5JFSA 4JLCA 4UZHA 4JNWA 1PMVA 2A27A 2VV9A 3UPXA 1A48A 2UZLA 1KV2A 3SXFA 3S0OA 3DKOA 3FJQE 4FF8A 4ENXA 4FSWA 3HLLA 3SGCA 4IZYA 3WARA 4FT7A 2HOGA 3TZ8A 3UP2A 2A4LA 2OXDA 2QR7A 3PRFA 3A61A 2BTSA 5FEDA 4FV6A 4RSSA 5KKRC 4EOKA 2PWLA 3AC3A 3ENHA 4KIKA 3EYHA 2CKEA 3C1XA 3NSZA 4Q9SA 2ZMCA 2NPQA 4RWLA 2Y8OA 4J8MA 2WEIA 4EKLA 2BRHA 3SXSA 3MI9A 3QKKA 3MVJA 4P7EA 4PNKA 5FDPA 5KO1A 3MH3A 4M3QA 5AX9A 3QRIA 2NO3A 3ZONA 3IGGA 2H8HA 2XJ0A 5IQGA 4G6NA 4FEXA 4RA5A 3BU6A 3DCVA 3T8OA 4KWPA 1XH7A 4QNYA 5CYIA 4YLJA 1ZYLA 5HG8A 4C62A 3SV0A 3OTUA 4QPMA 2X81A 5EKOA 3PVUA 5E8WA 5AR2A 3VUIA 4KS7A 4Q5HA 4E4MA 4BICA 3EN5A 3VRYA 5E8UA 1NA7A 2G2FA 2J50A 3F3UA 4IANA 2AC5A 4FICA 3V5QA 2C5NA 2J0LA 5C8NA 2XMYA 2WZJA 1TQIA 3QUEA 5BX0A 5DG5A 5CZIA 3W10A 5KKRB 4O6LA 1Q97A 4IAYA 3R8MA 1FVVA 3D5WA 3MY1A 4M67A 3TZ7A 2UW9A 2C6DA 2RG6A 4M97A 3RPSA 4UWCA 3VUTA 3WE4A 3T3UA 1WBOA 5DH3A 2X7GA 4O0WA 3OROA 4G9CA 5GINE 4V04A 4ZMEA 3AG9A 3HV6A 4O22A 5L6OA 3ZFMA 4QO9A 2BFYA 3G0EA 3GC9A 4UV0A 4BCPA 2CNVA 3UZPA 5CAOA 5AR7A 2WD1A 4ZZMA 1ZZ2A 3ORIA 4HYHA 3HAMA 2XK9A 4ZSGA 4DG0E 1UA2A 3V5JA 4ZTLA 4HVIA 4EOMA 4GW8A 4LV8A 4O2PA 3H9OA 3VHKA 3UQCA 3R8PA 2VWVA 4MNEB 3POOA 4MQ2A 3OXZA 4D28A 2ZM1A 4E1ZA 4X2JA 3UOHA 5CF5A 4YZBA 4XG8A 4USFA 3C4ZA 4FTOA 5IG1A 3FUPA 3LHJA 1GZ8A 3N4VA 3F66A 3F3TA 1UWHA 1DS5A 3KF7A 1UV5A 3PIZA 4IH8A 3R7EA 2P2HA 3M11A 3A7IA 3OOMA 3UMWA 3OC1A 2JFLA 5C4KA 4APPA 1GIHA 5KZIA 4O7WA 4OTIA 2YERA 5CAVA 5I5ZA 4MVFA 4BI1A 3OFMA 5EDQA 5HLPA 5EYDA 4DH8A 3DBFA 5JN2A 2HWOA 3PA3A 3F6XA 2G9XA 1RJBA 2GQGA 4FGBA 4Y5QA 5GZ9A 3ALNA 3FSKA 3LJ1A 4WUNA 3QA8A 1U4DA 5JFVA 2XNOA 4XG2A 4IX5A 3AQVA 1APME 2I40A 2B4SB 4UALA 1IASA 2YJSA 3QHRA 3W8QA 2Y4IC 3C0IA 4RX7A 1Z9XA 3ZBFA 2F2CB 1XBCA 3EFKA 3TT0A 4CVAA 3KRRA 5BYLA 3PY1A 3COIA 5E7RA 2WMQA 4OTQA 4FKSA 2YM4A 5D9HA 1U59A 2OJJA 4TYIA 4GUBA 4ENYA 3MYGA 3ZSIA 5JEBA 2QHNA 4XV1A 3LFCA 3DXQA 5BVNA 3ROYA 1FOTA 4Y85A 3OCSA 1WZYA 4NUSA 3SLSA 4KAOA 4O38A 3HA6A 2PVJA 3L8XA 2W1HA 4GMYA 5J8IA 4U80A 1OBGA 1OBDA 1H1PA 4RLLA 1V0BA 5HE3A 3FHIA 4EH9A 4YGAA 3D94A 3PJCA 4PUZA 3L8VA 4UMTA 4DLIA 4MD7E 3RPYA 2WOUA 3RJCA 4BYJA 3UQFA 3ZUVA 3F3WA 3IW8A 3QCSA 5HE2A 3R8UA 3QKMA 4JJRA 4Q5EA 2W1CA 5KMIA 2X2MA 2VX1A 2HXLA 3GFEA 1IA8A 3DV3A 4M8TA 4NCTC 4X2FA 5HICA 1BI7A 2ITUA 3I5NA 3G33A 4G3FA 2ZAZA 3SA0A 3L9MA 4C35A 1MUOA 4IWQA 5JK3A 1WFCA 2BZIB 4BIBA 1JNKA 2Y4IB 3BPRA 4GU6A 3SKCA 4BWPA 1JLUE 5HU3A 2PULA 1NVSA 3BE9A 5E8YA 4LOPA 3FZ1A 4RRVA 5J79A 4TWOA 3QAME 3E7VA 4AW2A 4MBJA 2RSVA 1R39A 4XCUA 4PL4A 4YTFA 2R3IA 1YOMA 4FK3A 4OTHA 5LVLA 4DEGA 4OTRA 4FZFB 3NX8A 4AW1A 2GNHA 5CENA 5EQYA 3PSBA 3FSFA 2VTLA 3OTVA 4RQVA 4A4LA 1ZWSA 2R3LA 4EHEA 1LP4A 3D7TB 4FNXA 4F6UA 4EH4A 3DPKA 4IAIA 4J71A 4FKVA 5ANEA 1FQ1B 4IB5A 4YZMA 2YITA 1OKWA 3Q4TA 4FT0A 4P5QA 3N4TA 5HCYA 3EN4A 4HCVA 1NVRA 5J7HA 2F4JA 4FKGA 1YI6A 3L8PA 4JBVA 2XK3A 3M42A 3CEKA 1WBPA 5JQ5A 1Q8WA 4RZWA 4DA5A 2JD5A 5AUYA 5HO6A 1ZXEA 2BILB 5IQAA 1SM2A 5EI2A 4K77A 4BF2A 4IBMA 4UMQA 3UOJA 2PU8A 1OL1A 5DRBA 4D2WA 4OTWA 4G6OA 4DBNA 5A4CA 3HVCA 4BWKA 4WRSA 1PMUA 3QL8A 4PP9A 2C1AA 5E1EA 3QYZA 4ASZA 4S34A 4RIOA 2JKQA 3MS9A 3PYYA 4JBQA 4XUFA 4J7BA 3LMIA 2C6MA 5EM8A 3VBVA 1O6YA 5TOZA 4IACA 3LCSA 3EQHA 1XBAA 2GNGA 4D1XA 3UO6A 3ZDUA 1DI8A 4JX3A 5AFVA 4BFMA 5AV4A 3SG9A 3ODZX 2QO7A 1Y57A 3HZTA 4LMNA 4R3RA 2R3OA 3P79A 3RNYA 2ONLC 5E9EA 1ZARA 4FV9A 1Y8GA 3UNKA 2C68A 2ZV7A 4H3PA 3EQFA 4QP6A 3IONA 1PXOA 2VD5A 4WT6A 4O86A 4AZVA 4YJOA 3KXXA 1IEPA 5DT4A 2YCSA 4F09A 3KRWA 4IEBA 4MBLA 3MY0A 3EKKA 1YHVA 5F20A 4CT1A 2W17A 3QZFA 2O64A 4MNEA 5EW3A 2R2PA 5EH0A 3FLSA 4O7TA 3ZUTA 5HE0A 4DITA 4N57A 3FQEA 3LFEA 3QTUA 4MWHA 3CTJA 3PG1A 3PXFA 3PLSA 5LMBA 4PRJA 3FXWA 4CTCA 5AUTA 4YC6A 3PFQA 3QC4A 5T68A 5JZJA 4DCEA 3KREA 5EFQA 1YOJA 4LOOA 2QU5A 5JRQA 1JWHA 2I0EA 3MWUA 1XH8A 4GK2A 4NM7A 4R3PA 2PMOX 3R21A 4Z9LA 5L8KA 2OJ9A 4FKTA 3ZC5A 5M07A 3DAJA 3LQ8A 4Z7GA 2IW6A 5A46A 5CXZA 2XB7A 3UIMA 3QCXA 1UU8A 4U97A 4PPBA 5HVKA 4H05A 1QCFA 4GVJA 4OBPA 3BIZA 1ATPE 2VX3A 5FQDC 3QRUA 3R9HA 3UVRA 1H25A 4LL5A 4NH1A 4LUDA 2Q0BA 5HHWA 4U44A 4ASDA 3GU6A 3GUBA 4FT9A 2EU9A 4AUAA 2PZIA 5B0XA 3CJGA 2HWPA 4TN6A 4DG2E 5DBXA 2NRUA 5AA8A 1KOBA 3KK9A 4JI9A 2UZUE 3U51A 3UTOA 2XIYA 4AFEA 4K2RA 2W4JA 2YHVA 4QMXA 4ANOA 4QTAA 4S31A 3O50A 3WBLA 4EOOA 1OZ1A 3DXNA 5M44A 4L53A 3ZS5A 1W84A 3BYSA 3HV5A 3FKNA 2ZV8A 3OD6X 4W4WA 1Q8UA 5D1JA 5T6KA 4HGTA 5E8VA 4WG4A 4FVPA 2Y4PA 2QONA 2YIQA 3E63A 3UO5A 1J7LA 3G6HA 4D9UA 5A14A 3W2RA 3KMMA 1J91A 2J6MA 4DGNA 1JKTA 3PJ8A 4JG6A 4OTFA 3O8UA 3W2OA 5ICPA 4ERKA 5IA4A 2RGPA 3MSSA 4ZLYA 4FL1A 1XH9A 3BYMA 3UQGA 3BBTB 4ZZOA 3QTZA 3MA3A 4QP4A 2UVYA 1IAJA 3O7LB 4F9WA 2W5BA 3BGPA 2ZJWA 3JXWA 4O0RA 1PYXA 3BELA 2O65A 4IB0A 4KIPA 4L00A 1PXLA 3MB6A 4RIYB 4FEQA 5IDNA 2ITTA 3VUDA 2F49A 3F3ZA 3UDBA 4NZWB 1KE6A 4L44A 4ZIMA 3TG1A 1BI8A 3I6UA 1HCKA 2HENA 4MNFA 3ZLYA 5JGDA 4YLKA 5CALA 2PE0A 3CY2A 4YLLA 3UJGA 3O96A 2UZDA 4LQMA 4GJ2A 2J5FA 2IO6A 3S95A 4GFOA 1UNLA 2WU6A 4YJNA 3ZO3A 3OP5A 2VTRA 1CM8A 1BYGA 3P7BA 4FC0A 4MF1A 1ZMWA 2OO8X 5IH4A 4UN0C 2ERKA 2EXEA 4O7SA 2C0TA 1MQBA 2WQOA 4FV3A 5IEVA 3GENA 3BGQA 1TVOA 4MXZA 5FEQA 4AX8A 4BCGA 2E2BA 1P4FA 3BLHA 3FKLA 3KCKA 1XBBA 4BDFA 1OMWA 4GUEA 1YHSA 3HEGA 2VTTA 1CTPE 2XYUA 2B52A 3QRKA 3PSDA 3II5A 4FSTA 4NW5A 4ZTMA 2PK9A 3HKOA 5M51A 4DF3A 5K3YA 4IXPA 3F69A 2P3GX 3ORKA 5D41A 3BYOA 5AR8A 2PSQA 3EN6A 4FV1A 4Y95A 3FLZA 4DLJA 5JH6A 3DDPA 1NW1A 3I1AA 1XWSA 4IADA 1V0PA 4JQEA 3DY7A 3Q6UA 4H1JA 4M66A 4ANSA 2VO6A 4BWXA 2W5AA 1PW2A 4HZSA 3KK8A 3NW6A 4EK3A 4Q2AA 1YRPA 1MP8A 2QI8A 2Z60A 2Z7QA 5DI1A 3C4XA 4P5ZA 1ZOEA 4NKSA 3ZC6A 2W99B 3Q4ZA 3I7CA 4BYIA 5FD2A 4U45A 2XK7A 2OZAB 3EQBA 3DLSA 4X2NA 2CN8A 4NK9A 3JUHA 4IM0A 3R2BA 2QOQA 3QALE 4UMRA 3UZTA 3CKXA 2C3LA 2BRMA 4PV0A 1OPLA 4EH2A 3FMNA 4LFIA 5CT0A 4D2SA 5HTBA 5AUWA 4J97A 2WTJA 4EI4A 3FI3A 2O8YA 2UZVA 4U3ZA 4D0XA 4CZYB 5A9UA 2JAMA 2PYWA 4YHFA 4ZLZA 1CKPA 4DEIA 2WTWA 2C6TA 1PXNA 4G3EA 4U43A 3BHVA 5FGKA 4A9YA 3NVKI 4IWDA 4ZJVA 3FI2A 4KB8A 4LMUA 2W1FA 2ITXA 3L8SA 4BL1A 4AZTA 1OPJA 4AN9A 1GY3A 2XBJA 3QQUA 4NKAA 5C1QB 5D7AA 1H08A 2VTJA 2XJ2A 3IDBA 5L2TA 2SRCA 3DZQA 4FG7A 4HPTE 2VTAA 1XKKA 2ZDUA 3HX4A 3LIJA 4MQ1A 3RAHA 1M2RA 4IJ9A 3W1FA 2R3HA 4J8NA 3CTHA 5IEXA 3NYXA 1Z5MA 3AD4A 2C6IA 2X1NA 1OKYA 4QNAA 4WSQA 2YDIA 5CSPA 3D5UA 3PWYA 3EQCA 3C7QA 2GFSA 3K2LA 2CN5A 4HGSA 5F4NA 1MRUA 2DQ7X 5ANDA 5BVWA 4XH6A 2UW8A 3D4QA 2FUMA 1JOWB 4I6HA 2ZB0A 1WAKA 3ETAA 5FTGA 4WNOA 4IB3A 3RAKA 3A7FA 3BYVA 3E87A 3PXQA 1QPCA 1A06A 4II5A 4UXLA 3VWAA 4MCVA 4JAJA 5HX8A 3BBWA 5CSXA 5CVHA 2GPHA 5C26A 4I5MA 1Z57A 4TL0A 2VGPA 5HORA 4JS8A 4WNKA 4RJ4A 3LXPA 1LEZA 1M7QA 3QZHA 2YAKA 4XYFA 2C5XA 4QP3A 5FLFA 1NVQA 3LCDA 4IW0A 3ZXTA 2C6OA 3CD3A 4FSZA 3QTSA 3GC0A 2WO6A 4TY1A 3PXYA 4LOQA 2OFUA 4FIEA 4F4PA 5M56A 4FEVA 5AM7A 4A4XA 2FO0A 1H8FA 3OMVA 2B55A 3PPJA 5DFPA 2XNBA 2VTMA 3QGYA 3TZ9A 3V8WA 3UIBA 4DH5A 3B2WA 2GDOA 2XEYA 3I4BA 4J96A 3DOGA 4HCUA 1UKIA 4HVDA 5AMNA 3OWKA 1XQZA 3AC8A 4KIKB 4RJ8A 4S33A 2WTIA 4FVQA 3TUCA 3HV4A 4RJ3A 5HVYA 2CJMA 1U54B 3E3PA 2R0IA 4O27B 2X9EA 2G15A 3QUPA 4CQGA 4F7JA 4BDCA 3W33A 5EHOA 4L42A 5C27A 5CZHA 5BPYA 4ZTRA 1XH6A 3NNUA 1HOWA 5CQUA 3JPVA 2PVHA 3HMOA 4E5BA 3LQ3A 3FYKX 2B9HA 4NIFA 3HV3A 2G01A 3KRXA 3PPZA 3VS1A 3RK9A 4D2PA 3NNWA 3C4FA 4XOYA 4QMMA 4IWOA 5H8GA 4FOCA 3U6JA 4FEWA 4C4IA 2OFVA 4YHTA 2OF4A 1NT2A 4TWPA 3UG2A 3SVVA 5JFWA 3LKMA 4NL0A 5TO8A 4W4VA 5CU2A 3TWJA 2QODA 3CR0A 4WOVA 4JG8A 4UYNA 2OJGA 2GHGA 4EH3A 3NZ0A 3QTIA 5F9EA 1OIYA 2J0KA 4L7SA 2JDTA 3MIAA 2X2LA 4P2KA 3VJNA 4CFUA 4IX6A 5I3OA 4PTCA 2CNUA 5AX3A 4KSQA 5CF6A 2CNQA 4FIHA 4HVSA 5HBJA 3R9DA 5A4EA 3QQGA 4UWYA 3BI6A 4EOPA 4BVUA 3QA0A 4E6CA 5LVPA 4IAFA 5DRDA 4AN2A 4EUTA 3IK3A 1P14A 2YISA 5AP4A 1I09A 3CJFA 5JRSA 4RBLA 4DFZE 1H26A 3UE4A 5KZ0A 4FTQA 4DEEA 3PIYA 2VTIA 2PVMA 4W4XA 2XNGA 4UX9A 4E73A 2EXCX 2F7EE 4F9AA 5B2MA 1WBNA 2PHKA 4R5YA 3LXLA 1FVRA 4K0YA 5KX8A 3FKOA 1HCLA 3LFFA 4G3GA 3KEXA 2HZ4A 1IR3A 4N6YA 1H07A 3BHUA 5CF4A 2RFSA 3OVVA 4B4LA 2OK1A 2OZAA 4J53A 3WZKA 1B39A 1WCCA 5M4IA 4ZTQA 1ND4A 4JRVA 1WVXA 4KNBA 3A2CA 4I21A 3P1AA 4QMVA 2JDVA 5L6PA 4O0YA 2C47A 4RLKA 3RP9A 4D58A 4FTCA 3MH0A 3MJ2A 5HBHA 2YM8A 4CKIA 4CLIA 3UP7A 5A54A 3VQHA 2GS7A 2VWIA 3THBA 4YC8A 4AE9A 3BQRA 4IB1A 5HX6A 2BKKA 3UPZA 3G15A 1PYEA 4FKLA 4G5JA 3TTJA 4AU8A 2WTCA 4DEHA 5CAQA 3V5PA 4XG6A 2BIKB 4ZXTA 4UEUA 2QKWB 3V5TA 2QLUA 4UMUA 4AT4A 4J52A 4RWKA 3TTIA 4C37A 4Z7HA 5EKNA 4YBKA 3UIUA 4WD5A 3E8EA 3MFUA 3U4UA 2JIIA 4BDIA 3D0EA 3FE3A 2GHMA 5C8MA 3DU8A 4ANQA 4D4YA 1VEBA 5BMMA 1B38A 3E93A 3G6GA 4A06A 4KIQA 4Y8DA 2REIA 2WFYA 5H3QA 3QD3A 4AZFA 4EJNA 4FNZA 4FUYA 3TIZA 1MRYA 5CEPA 4I22A 4PTGA 5HD7A 3W2SA 5CEKA 3E88A 3VF8A 3UNZA 2J7TA 3R2YA 4MXAA 4LV5A 4MXYA 2E9OA 3RCJA 3COKA 3F2RA 4XHKB 3LFNA 1W98A 2IPXA 3OBGA 2WIPA 4RMZA 4XRLA 5HTCA 4BCJA 5ANOA 2ZMDA 4GT4A 4X21A 3U55A 4PMTA 2RFNA 3ATTA 3FDNA 3M2WA 4G34A 2BKZA 4XEYA 2B9IA 4FX3A 5M53A 4B6LA 3OCGA 5IH6A 3FC1X 3FLYA 1YOLA 2XK6A 1QMZA 5D11A 2Y9QA 4HNIA 1LEWA 2WMXA 2QOOA 4I5HA 5IZFA 3DXPA 5HIBA 4F08A 4GU9A 3DTWA 2FGIA 3DQXA 3C4CA 3LW0A 4ANMA 2ITQA 2VUWA 4JOAA 3TI1A 4O7VA 3ZXZA 3NCGA 3V6SA 2XM9A 2BR1A 1KV1A 3KC3A 3ZSGA 3V01A 3EQPA 3R7VA 3EQDA 4QYGA 3A8XA 4OLIA 5BNJA 3K3IA 5TR6A 2IN6A 1RDQE 4WNMA 5LXMA 1OGUA 2VTPA 4ZK5A 4F1OA 1GJOA 4RT7A 3Q5ZA 4HGLA 4FE2A 5FTOA 4DH1A 1U54A 3FL4A 4XS2A 1XH5A 3OY1A 3Q3BA 3HMMA 4HW7A 2YDKA 5G6VA 4L8MA 3NUYA 1H0WA 4OTGA 4BR3A 5I9XA 4F70A 4HOKA 3E64A 4BGGA 1PXJA 4ZY4A 2V55A 4QQTA 3WF8A 4IVBA 4EBVA 3FY2A 5TT7A 2E9VA 5C4LA 5IU2A 4JDIA 2JC6A 3I0QA 3KF4A 5FUTA 2A19B 4A4OA 2WMSA 1REJA 4K33A 2OJFE 3GU4A 3PVGA 2YA9A 3MN3A 4OBQA 2GHLA 2PE2A 5L2WA 3FPQA 3F3VA 1MQ4A 1TQPA 2Y0AA 3KXNA 4UWBA 3S4QA 4CNHA 5HE1A 4DGOA 5I9ZA 1YW2A 3RK7A 4DEBA 3R01A 5ITAA 3RM7A 2AC3A 3E62A 3NAYA 1Q8ZA 4JXFA 4QMTA 2X8EA 1WVYA 2PZPA 2ZOQA 3AC2A 3PY0A 4GT3A 4YMJA 4V05A 2J9MA 3CKWA 5LWMA 4MEDA 4AGCA 3ZLWA 1OVEA 4J99A 4K1BA 4ZTHA 2X8IA 2GNIA 2YACA 4NM0A 3ORLA 4LL0A 2IVUA 2X4FA 3QF9A 4W9WA 3VNTA 3GCSA 5KE0A 4ZAUA 4YJPA 1W83A 2QNJA 3ACJA 4QP2A 4BTMA 3QGWA 4CZUA 3EN7A 2QVSE 4DE4A 3RAIA 3F9NA 3A7HA 3TKHA 4AOJA 4YUQA 4XG3A 4XJ0A 3OCBA 5BQ0A 4BGQA 3AC5A 1H4LA 2VZ6A 1ZYCA 1KSWA 1ZAOA 4FSRA 4FT3A 5BUIA 4E7WA 3TIYA 4NYEA 3AMYA 4C4JA 4XP3A 4EZ7A 3U9CA 5CU6A 4FKWA 5CEIA 5AUXA 3VS3A 1V0OA 4AGDA 4WBOA 4FV8A 5KUPA 3R63A 4E5AX 2JLDA 4F0IA 2QCSA 5FXSA 3A7GA 3VBTA 2R3MA 1KE8A 3F5PA 3DKFA 5HG5A 1Y91A 1YDRE 1TQMA 2ERZE 2WQMA 3BV2A 2B9JA 3ORPA 5CU3A 3GU5A 5HESA 5IA5A 4FGRA 5G1XA 2C5OA 3FZSA 4FKRA 2IVTA 4D0WA 4C59A 3Q4UA 3VF9A 2VTNA 2VWYA 3BU3A 4I92A 2VGOA 1PKDA 2UZTA 3EZVA 4KBCA 1JSUA 4RPVA 5E91A 2J0MB 4FKQA 2QHMA 1KOAA 4XX9A 5AP3A 4MAOA 3VUMA 2C6KA 3H3CA 2CDZA 5CAPA 4K8AA 5L6WL 3TKUA 4JDKA 4CGAA 4ZTNA 2OJIA 4M84A 4PY1A 3R7GA 2GTNA 3HMNA 3HNGA 5L8JA 2YZLA 4L68A 5EQPA 4U3YA 1OECA 2OIQA 4XV3A 2V5QA 5LCJA 5HNIX 3TUDA 5J1VA 1Y8YA 2O63A 2QOFA 3RHXA 4HCTA 3ET7A 4D5KA 5AAEA 3B8QA 1DAWA 3H0YA 3ENMA 4W8DA 1BKXA 1CDKA 1OIQA 3DDQA 4AT3A 4O0VA 1URCA 3KQ7A 2ZM4A 4AE6A 1AGWA 3BCEA 5E8XA 3VS2A 3Q9ZA 3GU7A 4H36A 3EZRA 4K18A 4QTDA 5HBEA 4QMLA 4UY9A 3Q2MA 3DAEA 4OAVB 1OL2A 2UZNA 3PXKA 4E26A 3W32A 4BCOA 3DTCA 3LOKA 4RFMA 1LUFA 4BCKA 2CCIA 4F9CA 1YXVA 1QPDA 1S9JA 4TYJA 5DPVA 4A9UA 3ORMA 3R1QA 4D2RA 4ZZNA 5K0KA 2XNEA 2Z7SA 2PUPA 4F0GA 4I0RA 4FZ6A 4PMPA 5M4FA 4BCMA 4D4SA 1R0EA 2JDRA 3R7OA 2GSFA 2OZOA 2UVZA 5CEMA 2PUUA 5ETCA 3WIGA 4BIEA 4EOIA 3GI3A 3IO7A 3C9WA 2VNYA 2OH0E 5GZAA 5IQCA 4BDEA 4JBPA 4TWNA 3PE2A 4CXAA 1OKZA 4GL9A 2PY3A 2RIOA 3T9TA 4F7SA 4HJOA 2QR8A 3PA4A 3Q6WA 4YJTA 5EG3A 2IZRA 3HUCA 3IDCA 3WYXA 5JT2A 3S1HA 4IX3A 4PNIA 2BDJA 4AGWA 5CWZA 3OCTA 3AT3A 3ULZA 3UO4A 1FGIA 4MXOA 5KBRA 3LE6A 5M09A 3TKIA 5HI2A 3PUPA 3OHTA 2UW3A 4BDGA 2WMUA 4FSNA 4OBOA 4ANNA 4EYMA 1ZMVA 1UVRA 4NWMA 2UV2A 3A4PA 4EHVA 5CSHA 1KE5A 4PP7A 4BDAA 4C4EA 3AC1A 4QYYA 3P23A 2I6LA 3R7IA 3LMGA 5K5XA 2OH4A 4H3BA 3MGYA 4QMUA 3H10A 4G3DA 5LVMA 5ACKA 3DT1A 3NYVA 3BV3A 3R9OA 4FKJA 4I6BA 3OBJA 1K9AA 4N70A 5JGBA 3HYHA 2HAKA 1FMOE 3SRVA 1SZMA 4R7IA 3MFRA 4FK6A 3PRIA 1FMKA 1U5RA 3NUXA 4OTPA 4DBXA 3BZ3A 3Q04A 2GMXA 5GHVA 3HUBA 5AADA 2Z02A 4I4EA 4Y73A 3KCFA 4X3JA 2IZUA 3VS7A 5DYJA 5IA2A 4YTCA 5IA1A 2CLXA 3ZHPC 4NEUA 4WRGA 2OIBA 1STCE 4W8EA 5DOSA 3FL5A 5CVGA 3REPA 4CSVA 3TZMA 3SQQA 4BKYA 2DYLA 4ZJIA 5K9IA 4R5SA 4RA4A 4YSMA 5BVEA 4C2VA 2YN8A 4RFYA 4USDA 3EFWA 4L7FA 1ZYJA 3WZUA 5HCZA 4KRCA 5BMSA 4RWJA 1WMKA 1KE9A 3NRMA 4KINA 4TW9A 1M14A 3OWLA 3UZRA 2ACXA 3FXXA 3TJCA 3SOAA 4IE9A 4D2TA 3GU8A 3IW4A 3D14A 4XLIA 5FBOA 4B8MA 2ZV9A 1LR4A 2V7AA 4O21A 5BYYA 2BAQA 4H58A 4QP7A 4QOXA 3R6XA 2JFMA 2WU7A 3EFLA 4L3LA 3V6RA 3FYJX 3GC7A 3JS2A 4W4YA 3VS5A 2BMCA 5A4TA 4CLJA 2YM6A 2WNTA 3W18A 5BVKA 4M13A 3ANRA 2C5YA 4G5PA 4IX4A 3K5UA 3I5ZA 2KULA 3C0GA 4IFGA 2PUIA 3V5LA 5FP6A 3BRBA 2R3PA 3O8PA 4XV2A 2W96B 4YNEA 3TN8A 2P0CA 4CMTA 2QQ7A 4OT5A 3FPMA 3RTPA 4E6AA 3UVPA 4RC3A 3B2TA 3LFBA 3PY3A 4EWHA 4P4CA 4L9IA 4RQKA 3HP2A 5ACBC 3ZEWA 4FV4A 5E4HA 3LQ5A 4WSYA 5KNJA 4G1WA 5IQFA 4JT3A 3SD0A 2XKCA 4IVDA 4C36A 3AC4A 4CFWA 3FEGA 1R78A 3HL7A 3OEZA 3FMHA 3UOLA 4F99A 4YJSA 2IZTA 3NUAA 3MTFA 5HD4A 3F7ZA 3HRCA 2W5HA 4GT5A 4X0MA 2BZKB 3MVLA 2WELA 1DM2A 4E5WA 5GNKA 4CCUA 3R9NA 3VS4A 2XF0A 4X6RA 4PMMA 2BUJA 4YHJA 5E8TA 3A99A 4CRLA 4CEGA 4I1ZA 3QTWA 4V0GB 5HLNA 4G16A 3EIDA 4PPAA 4GKIA 4QPAA 2C6LA 3LCKA 2IW9A 3QRTA 2QLQA 4IAZA 4XOZA 4L67A 4IVCA 4K6ZA 2JIUA 4D1SA 3R8ZA 2XVDA 2DWBA 5AV2A 4EOLA 1PY5A 4BBFA 2F9GA 4CG9A 3HGKA 3FV8A 3GQLA 2X6DA 2JBOA 3GQIA 3NIEA 3VVHA 3UNJA 1GZOA 5HCXA 4BDBA 3PZEA 1G8SA 4E4NA 3OT8A 3C4EA 3SX9A 2BTRA 1YVJA 3R73A 4FG8A 3D2KA 2I0YA 4C38A 4F6WA 3KMUA 2R7BA 4RFZA 1FGKA 5DR2A 4EQUA 4NIFB 3LCOA 3E8DA 3Q5IA 4BI0A 3CTQA 4JAIA 2C3KA 3ROCA 4MD9E 5AUZA 2WAJA 5D10A 3VULA 4CFFA 4DGMA 1Q4LA 4ACHA 3LM5A 3GEQA 4A9SA 2JIVA 2YIWA 3PIXA 4TRLA 4U6RA 4B8LA 3WZJA 4DFUA 5E1SA 1SMHA 4FV2A 3DGKA 4LM5A 4BKJA 3A8WA 4BIDA 5JFXA 4L45A 3VBXA 4F65A 3JR1A 2GCDA 4E6QA 4JVGA 3EL8A 4L52A 2VTSA 3ZO2A 5LQFA 3IS5A 4UYAA 2WMWA 2XP2A 4CV9A 3SHEA 2XM8A 1DI9A 1PXIA 4M14A 3P86A 5IEYA 5IQDA 1R0PA 4ZSLA 3PJ3A 3OEFX 4RX9A 5LMAA 3QQKA 2HELA 2B1PA 4FL2A 5ANKA 3RNIA 3KULA 4M7IA 3BE2A 1Q61A 4QT1A 3PP0A 4DH7A 3RALA 5DLSA 2CKOA 3UOKA 2CSNA 1J7UA 2WMBA 4BBMA 3AMBA 4X3FB 3WE8A 5M06A 3KMWA 4RX8A 3FC2A 4GVAA 2CGWA 4A7CA 2XCKA 2JKMA 4KSPA 3VUGA 5IKWA 1YXSA 3KA0A 3DFAA 4L3PA 2YABA 4EHZA 3LFAA 1MRVA 3OXTA 3W2QA 4DG3E 1P4OA 3WF7A 3BLQA 1QPEA 2PMNX 5CLPA 3VW6A 1K2PA 5LVNA 2PVKA 5CNNA 3WILA 4F1MA 4M0ZA 5HU9A 3F2NA 1EH4A 2OIDA 3H9FA 2JDOA 3COHA 3GFWA 4YTHA 4E8AA 2UZEA 4I3ZA 1OUKA 3TV6A 2BRNA 4R6VA 4GEOA 2PUNA 3LFQA 2YLEA 2XNNA 3IGOA 3I7BA 4YPDA 2IWIA 3HAVA 2UZOA 4ALVA 4ZSJA 4TNBA 5J1WA 4IZAA 2B54A 2UUEA 2HZ0A 1LPUA 2XH5A 4U5JA 5AP5A 5FBNC 1W0XC 4MD8E 5EM6A 4F7LA 3OW3A 3RHKA 4DT8A 1P2AA 3C4WA 5J9LA 4GG5A 3R02A 3FMLA 4FIIA 4AN3A 4QYFA 1ZY4A 5DVRA 3LFDA 1CKJA 1JPAA 4ASEA 3KU2A 4HVGA 3FZTA 4GFGA 3DB8A 1U5QA 4PMSA 5DT0A 3ANQA 5TKDA 1PMNA 1ZOGA 2VO3A 4WG3A 1O9UA 3PXZA 4J98A 4IAAA 1SNXA 2W7XA 2O5KA 3WF6A 3NGAA 4AWIA 2VWWA 5DHJA 3HRBA 4JDJA 4G2FA 2BZHB 3CIKA 1L8TA 5LOHA 2CKPA 4W9XA 2E9UA 5HGIA 3IOKA 2HXQA 2WTKC 3P4KA 4ALWA 4YURA 4C58A 3LFSA 4O2ZA 4U40A 1OL7A 4MX9A 3RINA 4Y5HA 3R71A 1OL5A 2WHBA 3CQUA 5HIDA 2E9NA 5AIKA 4CFVA 1E1VA 2R3FA 4ZOGA 4EC8A 4IM2A 1PKGA 2XZSA 3IECA 2LAVA 3OWJA 1REKA 1R1WA 4XBUA 4ASXA 3W2PA 5EW8A 3V8SA 5EK7A 1G8AA 5KMOA 3HRFA 3ORTA 4MHAA 5IA3A 4AZSA 5JQ8A 4DAWA 2OG8A 5E8SA 4C3PA 4FSYA 3FBVA 3ZUUA 4FTKA 4OTDA 4IDTA 2QOCA 2XUUA 4N0SA 4V0GA 4GJ3A 4KKGA 5FTQA 3RPVA 2OGVA 4DEAA 4R7HA 4MXCA 4NTSA 3DNEA 3F5GA 1H1RA 3A4OX 1BX6A 5B7VA 3R1YA 3LVPA 3MW1A 2WTKB 2ZM3A 5JMSA 5BYZA 2R3JA 3E8NA 2YCFA 3LJ0A 4JX7A 2H34A 5DR9A 2YZAA 4FT5A 4QMSA 2Z7RA 1JQHA 3L9PA 4IC8A 4DFXE 1YDSE 1H00A 3AOXA 4AA5A 2PZ5A 3QQHA 2LGCA 1O6KA 3E8CA 3GGFA 4BGHA 2GQSA 4NW6A 1W82A 4I93A 5H2UA 3Q2JA 4EL9A 2BVAA 1A9UA 2CMWA 4FI1A 4FYNA 3QC9A 5JGAA 3C50A 4ZSEA 1BL6A 2J2IB 5CVFA 2Y6MA 3C13A 3RWQA 2CKQA 3OUNB 2RL5A 2WQNA 4ZP5A 4CKJA 4YNOA 5H8EA 1PMEA 1WBVA 4X7QA 3MB7A 4BKZA 3O71A 3MBLA 2XRWA 4EJ7A 4C3FA 3CC6A 4QMPA 4USEA 4IVAA 2UW0A 4FSUA 4S30A 3PWDA 2ZDTA 3R8VA 3DB6A 3EQIA 3DBQA 2XRUA 5IISA 3TCPA 4BTJA 3I0OA 4QMQA 4PPCA 4JDHA 4YC3A 4QP1A 3TV4A 4E4XA 2ITPA 3HDMA 2GFCA 1XHAA 4X3FA 4ANBA 3V3VA 3CPCA 4BDJA 4FV5A 4IWPA 5DIAA 2XIRA 3HMPA 1UU3A 2J5EA 4FTLA 3G51A 5KHXA 1YI3A 4YZDA 2FVDA 3RK5A 4XG4A 1Q8YA 3PZHA 5HKMA 2JBPA 4S32A 1YWRA 4JQ7A 3ZBXA 5T3QA 4KBKA 3GNIB 3WZEA 3UODA 1O6LA 2I0VA 3G0FA 2W1EA 3QWJA 3QXPA 1KE7A 3PG3A 1OIUA 2FA2A 3OUKA 5GZ8A 3MVMA 3QX2A 4GIHA 4R7BA 3DZOA 1FVTA 3EYGA 4HGEA 5FM2A 4C34A 2EB3A 5BUEA 3GOKA 5CF8A 4BZOA 4DYMA 5EI6A 3GOPA 4K9YA 4PWNA 4A9TA 2EXMA 2VWBA 3GXLA 5FDXA 4ZSAA 1IAHA 2W1ZA 3P9JA 3RZBA 4O7LA 3ZU7A 5HTIA 1YXXA 4KS8A 4RC4A 1PXKA 2I0HA 4NM5A 1NXKA 4ARKA 1IA9A 5CEOA 2A0CX 3O2MA 2VAGA 2IG7A 3D7ZA 2HW6A 3R0TA 3MTLA 4LYNA 3ZM4A 4PDYA 4B99A 1Q62A 2JDSA 5L2QA 5J5SA 2GNJA 1H1SA 4AA0A 1J1BA 4NJ3A 3OW4A 3AD5A 3COMA 2P55A 3I79A 3IOPA 2W1IA 1V1KA 4IHPA 4ACGA 4EQMA 5E92A 4CFNA 4RGJA 4XP2A 4XBRA 2WPAA 1ZMUA 3FXZA 4CYJA 1PXPA 1VR2A 4DFYA 2P2IA 5EM7A 4ORKA 2W4KA 3MIYA 2OI4X 3ZLSA 4EQCA 2UW5A 4ZLOA 2XKFA 2AYPA 3MPTA 1TKIA 3JY0A 5JZNA 4EH7A 4FTTA 5AUUA 4RVMA 4FODA 3ODYX 4RIXB 5ANGA 3ZRLA 3ZFYA 2PE1A 2XS0A 2XNMA 3BKBA 4FZDB 4TWCA 5DR6A 5EW9A 3VAPA 4BRXA 4DH3A 5LWNA 5BVFA 2QOKA 1Q3DA 3EJ1A 4RIWA 4LI5A 5J9YA 4DTKA 3K3JA 5LMKA 5A4QA 4R1YA 5AIRA 4AA4A 3ULIA 3CSVA 4C33A 1SYKA 5AUVA 4ACDA 3EB0A 3QBNA 2PZYA 3QKLA 4I94A 1H1QA 3AGLA 4FIJA 1PHKA 5IH5A 2R5TA 4IIRA 3LXNA 5CEQA 4C61A 5H9BA 3FMDA 3POZA 4GCJA 2J0IA 3QU0A 5CI6A 3QLFA 5CXHA 3U54A 2HCKA 3DAKA 3UBDA 1XO2B 1SNUA 3DKGA 3SW7A 3VIDA 3ZEPA 4B9DA 1WVWA 1R3CA 5HG7A 3TDWA 3KY2A 4YPSA 3GVUA 4ID7A 3Q96A 4LRJA 4BCIA 3NAXA 2BRBA 3HA8A 4EKKA 3EKNA 1P5EA 3FMKA 5DN3A 4PF4A 2XA4A 3QTQA 2X4ZA 4CMOA 5DEWA 3D7TA 2ITVA 4XG9A 3R04A 4I20A 2XK8A 1FPUA 4O96A 3ORZA 1Y6AA 4TZRA 2BDWA 2WXVA 2XBAA 4RC2A 5IMXA 4DN5A 2R3KA 4CYIA 5IMEA 2BDFA 2R4BA 4FIFA 3OZ6A 4G9RA 4FTUA 3G90X 4XMOA 3CP9A 3B8RA 4IAKA 5EYCA 2IW8A 3W55A 3RBWA 2BHEA 2H6DA 3O7LD 1SVHA 5EOBA 4EONA 5AAFA 1KWPA 3HMIA 3JYAA 3CY3A 4Z55A 3LMHA 2HK5A 1H01A 1J1CA 2PZRA 4YO4A 4DTAA 3PVBA 4AS0A 1WBSA 2V62A 2B0QA 1GZKA 4KUJA 2X2KA 3M1SA 5FXQA 4EEVA 5M55A 3TEIA 3Q32A 4D4RA 3JVSA 2BALA 4N4SA 3P08A 1F3MC 1ZLTA 3DJ7A 2ESMA 3EWHA 2OKRA 2QG5A 2CHLA 3PXRA 5IDPA 4DGLC 3SRVB 3FZRA 3BYUA 3QYWA 4LG4A 4ZS4A 2RFDA 5AM6A 2UZBA 4QTCA 4UXQA 3ZO1A 2B9FA 3NEWA 4EK8A 4PX6A 3VUHA 3TNPC 4RG0A 3KB7A 3CXWA 3QCYA 1NY3A 4FBXA 2CPKE 4NFNA 2FH9A 3N51A 4QYHA 4Q9ZA 4YU2A 3U6IA 3DK7A 3CE3A 3KXHA 3ZLXA 1X8BA 3EQGA 3NPCA 3RCDA 5IUIA 3VS6A 4D9TA 3UC3A 3NUUA 4E6DA 3I60A 3MA6A 4ZY5A 2R7IA 3F61A 5EM5A 5EI8A 5I9VA 2DS1A 3D2IA 2ITNA 4I0SA 4KIOA 4QQCA 2A1AB 5I0BA 1UKHA 1KUTA 3F5XA 1VYWA 2ETMA 1T45A 2F57A 4AQCA 4RJ6A 4BC6A 4CD0A 4AAAA 3TACA 3VHEA 4FA2A 3QTRA 4FZ7A 2VRXA 3K5VA 4U81A 3EFJA 2VU3A 2ITWA 3KRLA 2GS2A 3QXOA 4O0TA 4O1PA 1J3HA 3E92A 5HG9A 3P78A 3ALOA 4PDOA 5EYMA 3RWPA 3TV7A 2QOLA 3FQSA 4WNPA 2XK4A 3QZGA 3L9NA 3QUDA 4ACMA 4BBEA 3R1SA 2VTQA 4ALUA 4E4LA 2PL0A 5DEYA 4AZWA 4LRKA 3BHYA 5C8KA 2YLFA 4U41A 3LXKA 2JITA 1UU7A 3P5KA 3Q53A 2X39A 3RMFA 5KMKA 2YCRA 1YDTE 3OT3A 4O81A 2VO7A 4B7TA 3FI8A 4O6EA 4FNYA 4PDSA 4I5PA 4FKOA 2R0UA 1DAYA 1BL7A 4HYIA 3IQ7A 1QPJA 4K11A 3ZH8A 4F9BA 3PLAE 1T46A 2PPQA 4R77A 2VTOA 3NIZA 3R8LA 4XLVA 5CSVA 1YWVA 3MJ1A 2JGZA 5AA9A 5GIPE 1WBWA 2I1MA 3PSCA 4I4FA 2G2HA 4FV7A 3DS6A 4MXXA 3I81A 4H3QA 1JSTA 3W2CA 4C7TA 4QQ5A 4EOSA 1OB3A 2YAAA 3S2PA 5HLWA 3NVMB 4Z3VA 5CS6A 4RIXA 4ANLA 4KA3A 3EMGA 3TDVA 3F5UA 2YCQA 2OBJA 3FY0A 4GK4A 4TYHA 4GKHA 2F7ZE 4AW5A 2YEXA 4TNDA 4EK5A 2RF9A 4CV8A 2HW7A 4OAUC 4F6SA 3UVQA 1G5SA 1GOLA 2Q0NA 4GSBA 4AG8A 1OPKA 4HNFA 3U9NA 4LUEA 4EH5A 2ETKA 4RZVA 3GP0A 3BX5A 2R3RA 2WGJA 3NYNA 4GK3A 3C5UA 1B6CB 4FIGA 4BCHA 3LZBA 4L6QA 4CRSA 3V51A 4TYEA 4ZS0A 5B2KA 2O2UA 3RPOA 2BZJA 3SG8A 5E90A 4HZRA 1YQJA 2CGVA 3IW7A 1WBTA 4IZ5A 4FTAA 3A60A 3D5VA 3WZDA 5C01A 1Q99A 1IG1A 2C6EA 2QOIA 3H30A 3TUBA 3O8TA 3R22A 3CBLA 5CAUA 3AT4A 4TPTA 5IQEA 2BAKA 2FSOX 4C0TA 4I23A 4BCQA 4O7NA 1H1WA 2VX0A 2HZNA 4M0YA 3S3IA 5IUHA 3KVWA 4EHGA 1Q24A 2NP8A 3DBEA 4AOTA 4UMPA 5KMNA 4FMQA 2Y6OA 5EYKA 4ITJA 5LCKA 3GCQA 3KKVA 4C4HA 4O83A 3C5IA 2O0UA 4S2ZA 2UW6A 1VZOA 2XCHA 3FZOA 4MWIA 3DK6A 4Y46A 4YO6A 1YHWA 2XIZA 3EHAA 2FSTX 3LM0A 2WTVA 4KBAA 4D2VA 5ETAA 3U4WA 3GCPA 2UW7A 3DK3A 3ZRMA 3CQWA 3KGAA 2GTMA 5AP2A 4JQ8A 2C1BA 4FZAB 3KULB 2F2UA 5EDPA 3VO3A 4BI2A 3QWKA 3ID6C 5DT3A 4AP7A 3MFSA 4HVHA 5DA3A 5AV3A 5CTPA 2NNWB 5DWRA 2IVVA 4AF3A 4KRDA 5IQBA 3RKBA 4CG8A 3CPBA 5A6OA 4X2GA 3MY5A 4RJ5A 4XV9A 5CT7A 5HVJA 3FLNC 2R9SA 2NRYA 5I9WA 5M4UA 4FR4A 3P0MA 4HPUE 4RX5A 1Q8TA 4F7NA 5ANJA 5FG8A 4Y83A 5GJFA 4O91A 2RG5A 4I6QA 4JG7A 2YIRA 3L1SA 1E9HA 2RFEA 1H24A 3ACKA 3C51A 3PP1A 4LGGA 4M68A 2BFXA 3UYTA 2EWAA 3ZSHA 4YJUA 3R00A 3DA6A 5ETIA 4NU1A 5AP6A 3LJ2A 1OL6A 3Q4CA 4LGDA 4YP8A 5KHWA 1F0QA 4I41A 4BDHA 4J1RA 5EOLA 2PVLA 2J4ZA 2C30A 3G2FA 2PMIA 3QX4A 4X2KA 5L8LA 3FMJA 3QHWA 3O17A 3RAWA 4FVRA 2EVAA 3WYYA 2BHHA 5AP1A 2DUVA 2BPMA 2X9FA 4YTIA 4O82A 4L01A 1UU9A 4I6FA 2W9ZB 3SDJA 3V5WA 1Y6BA 3TJDA 3VBYA 4EH6A 3Q9YA 4BB4A 5CANA 2PVYA 2ZYBA 4AT5A 4A9RA 3GC8A 2WMRA 4EYJA 1M2PA 3ZFXA 3D15A 4O84A 4DCAA 2WMVA 3RGFA 4I24A 4QTBA 5AV1A 3VBWA 2VO0A 3BHHA 2V22A 2FSMX 2C69A 5LJJA 3ORXA 3VBQA 2C4GA 4CZTA 5F94A 1GIIA 2WKMA 1URWA 4EUUA 3CD8A 4O7YA 2BRGA 4GIIA 4QMOA 4D1ZA 1F5QA 1H0VA 3EN9A 2CCHA 2OICA 3ZMMA 4EZ3A 5CU0A 5IF1A 2HZIA 4PL5A 3VS0A 3ZRKA 3KXGA 2X0GA 4QRCA 1S9IA 4DT9A 2BAJA 3FI4A 4BHNA 1GIJA 2IZSA 4H39A 3KXZA 2WIHA 4O0XA 4FSQA 5K5NA 3DBDA 2Z7LA 3OG7A 4QMYA 1XH4A 1M52A 5EDRA 4NJDA 1M2QA 2WQBA 4D55A 1ZYSA 4OR5A 1YWNA 3L9LA 2JKOA 4TXCA 3UIXA 3VW8A 4B0GA 3VUKA 1E1XA 3NNVA 3W8LA 4C3RA 1U46A 2YFXA 4XNEA 2WMTA 5C03A 3A62A 4EWQA 2WOTA 3N9XA 4NTTA 3D83A 3CCNA 1Q3WA 1OUYA 3NYOA 3RPRA 5FRIA 3TNHA 3QD2B 3TNIA 4O7ZA 5L3AA 1RE8A 3SOCA 5ANIA 3U6HA 5I4NA 4O7RA 4XP0A 1UNGA 1ZRZA 3IW5A 3QCQA 2QG7A 3LCTA 3UG1A 3V04A 4QD6A 2FYSA 4J95A 4JBOA 4X3FC 4EOJA 3TNWA 2EB2A 1RW8A 1OI9A 4OW8A 1YKRA 2YJRA 1ZY5A 3RM6A 4G31A 3LPBA 3BWJA 3VRZA 1J7IA 2XKDA 2CLQA 3FZPA 4GV1A 4FTIA 2VNWA 5CNOA 4AW0A 1M7NA 2Q83A 3UC4A 3FWQA 4JRNA 3DLZA 4QP9A 4WBBB 4FEUA 1FINA 2OW3A 3FHRA 5AR3A 2KTYA 2B53A 5TF9A 3Q9WA 5AP7A 3NUNA 4DTBA 2W0JA 4FTNA 4E3CA 1UNHA 1JKLA 1PF8A 2C0OA 5HEZA 5L2IA 1SVGA 4KKEA 2IVSA 3F7WA 5FM3A 4ZJJA 4AZEA 4MKCA 3G9NA 4L3JA 2HIWA 4QQJA 4NFMA 4FUXA 2EUFB 5A3XA 2Z2WA 2YWVA 2JEDA 2VWXA 4U42A 4WO5A 3ZM9A 2ETRA 3D9VA 3RVGA 2R3NA 4F1TA 3BEAA 4IC7A 3GT8A 5KMJA 2ITOA 4IMYA 2OXXA 4YBJA 4YZ9A 3BU5A 5IQIA 5F95A 3HECA 3F82A 3E7OA 1W7HA
chains in the Genus database with same CATH superfamily
1BLXA 4BTKA 5BVDA 2CGUA 2XIXA 4FTJA 1SVEA 5EHLA 1ZOHA 3UGCA 4APCA 5DMZA 3IKAA 1XR1A 5M08A 4LRMA 2XIKA 4GH2A 4C02A 4NCTA 5M4CA 1I44A 3CS9A 4BTFA 5AEPA 4IM3A 3KN5A 4FYOA 3TM0A 3PE1A 2O3PA 2QURA 4JR3A 1JKSA 5KMMA 1JKKA 3Q52A 4FSMA 4M69B 3ERKA 2VWUA 3KN6A 2A2AA 2GU8A 3NW5A 4L43A 3C0HA 3H4JA 4DHFA 5K0XA 4JIKA 4F9YA 5KBQA 5CX9A 3R7YA 2ZV2A 4CKRA 2WQEA 3A7JA 4XG7A 1QL6A 3OY3A 5DGZA 4X6QC 4YJVA 5I3RA 3WI6A 5J9ZA 1K3AA 3MPMA 2YM5A 3ZOSA 4EK6A 4OUCA 2C5VA 5LMKC 3MFTA 3IPHA 4FTRA 4QP8A 1Q41A 2RKUA 4R1VA 4BCNA 5ETFA 5JKGA 4GRBA 4HYUA 4LV7A 2VTHA 3RI1A 3EL7A 3AT2A 2C0IA 4GYIA 3IDPA 4MBIA 4D5HA 5L4QA 4CFMA 3QZIA 5EQEA 1OKVA 3FMMA 5AR4A 3KL8A 1AQ1A 5JSMA 5A4LA 5AP0A 4TTHB 1YXTA 5HQ0A 2J0JA 5IQHA 4CQEA 4DFBA 4WHZA 4E93A 2BCJA 5J7BA 2UW4A 4M15A 3PPKA 1GZNA 2G1TA 3BLRA 4NM3A 2YM3A 1XJDA 1YXUA 4BN1A 4G6LA 5J87A 4KD1A 4O0SA 5HO7A 4BY9E 3VC4A 4IZ7A 4U7ZA 4JR7A 1L3RE 4IFCA 2AQXA 4MK0A 1Q5KA 3UMXA 2X7OA 3FAAA 5FP5A 3QQLA 4RIWB 3KXMA 4YJQA 5HZNA 3K54A 2CGXA 2H9VA 5D7VA 4AGUA 3FLWA 4OT6A 4M12A 1JVPP 2C3IB 3HV7A 4U9AA 2X6EA 1FBNA 2IF8A 3R1NA 4H1MA 1GAGA 3EOCA 4RWIA 5AWMA 3FQHA 4ZY6A 5K4IA 5FWKK 4CTBA 4PTEA 3U8WA 4NSTA 5DNRA 4O4CA 3TL8A 3HDNA 1BUHA 4FOBA 3NLBA 4AFJA 3V8TA 2PMLX 3R30A 2ONLA 3GBZA 3OS3A 3SW4A 2W1DA 3CGOA 1AD5A 4GS6A 3O51A 4MYGA 4BHZA 4CCBA 3R9RA 4YR8A 1OIRA 3TXOA 4FG9A 3AXWA 4RVLA 2J90A 2YWPA 4C4FA 4QMWA 3PDTA 3QQJA 4EBWA 4ZEGA 1UWJA 3AGMA 3KVXA 3MV5A 4PDPA 3IG7A 4GFMA 3P7CA 4U8ZA 4YZCA 1W2DA 4CMUA 4EZ5A 3MDYA 3D5XA 1M17A 5AAGA 2OU7A 3LLAA 3OXIA 4ZTSA 1VJYA 2PVNA 3CGFA 3WIKA 5CQWA 4PL3A 3VQUA 3GCUA 4TT7A 3QQFA 2FB8A 2ITYA 4FTMA 1RQQA 5J5TA 4U0IA 4EK4A 2FSLX 4DGGA 2V0DA 2QU6A 4G17A 1XMMA 3JY9A 4G3CA 1BMKA 2UVXA 4BZNA 2W1GA 4A07A 3NW7A 4EH8A 3R83A 2W05A 4AOIA 1YI4A 3AMAA 3DKCA 4ITIA 4RVKA 4O1OA 4Z16A 4EORA 4OGRA 3H0ZA 4C2WA 2QKRA 5IUGA 2ITZA 3ZDIA 3SXRA 2I7QA 3AD6A 2XKEA 3DFCB 3PA5A 5KMLA 5CI7A 5B2LA 4P90A 2OWBA 3R7UA 1ERKA 3QTXA 1CKIA 4WUAA 3MH1A 3FLQA 3OOGA 2GNFA 3Q60A 4MUQA 4RIYA 2E9PA 2R3QA 2ZVAA 4RVTA 4DEDA 4CFXA 4CT2A 3CLYA 2PVFA 2W9FB 1W8CA 2QOBA 2X7FA 3F88A 3MPAA 4IQ6A 4KABA 4O0UA 4WG5A 2XJ1A 3SC1A 3T9IA 3MESA 3I6WA 2JKKA 4N6ZA 2XEZA 1ZZLA 1JSVA 2XNPA 3QLGA 3HP5A 5AV0A 4MTAA 2WB8A 4DFNA 4V01A 2VN9A 2PTKA 3IW6A 4WA9A 3T3VA 4KKHA 3DJ6A 4NT4A 2W4OA 2Y7JA 3BWFA 4YSJA 5EHYA 5HNBA 3EQRA 4UBAA 5AR5A 3DJ5A 2C3JA 3LLTA 4FKPA 3ZZEA 4BDKA 4TYGA 2BIYA 3F2AA 5IA0A 4JL9A 4I5CA 1VYZA 4F63A 5L2SA 3GCVA 3JVRA 5H8BA 4M69A 3UYSA 1CMKE 2QO9A 5KCVA 1G3NA 3E3BX 4EOQA 1ST4A 3QRJA 4FV0A 4LDTA 2G2IA 2QO2A 2R64A 4R3CA 5CSWA 5F1ZA 4EC9A 4L46A 3MH2A 5BUJA 2YIXA 2YM7A 3ELJA 1IRKA 5HNGA 4QMZA 2OXYA 4D4VA 3E5AA 4UB7A 5C9CA 3EH9A 3FMEA 3NS9A 3PJ2A 2J51A 4XRJA 3WF5A 4ONAA 3UDTA 1JAMA 1H27A 4DINA 3NNXA 1PXMA 5I9UA 3CQEA 3WOWA 4QTEA 3U87A 2HYYA 2QD9A 2QOHA 4C4GA 4R78A 4WKQA 5IPJA 2XYNA 3LAUA 4PQNA 4ITHA 2PVRA 3G5DA 5DE2A 3W16A 1OITA 3TNQB 3PTGA 4BZDA 5D12A 5CU4A 2HY0A 3GB2A 5CY3A 3DNDA 3PJ1A 4C57A 2Z8CA 3BGZA 4LGHA 2YDJA 4JIAA 4MH7A 4YZNA 3S00A 3ZZWA 2WMAA 3MVHA 3N4UA 5HOAA 3NUSA 4DC2A 2GS6A 3ATSA 3DQWA 3O5AA 5FEEA 1CSNA 3NR9A 3NMUF 5CASA 4IDVA 2IJMA 2UZWE 3PVWA 2WTDA 4TYHB 2GNLA 2B7AA 4E20A 5BVOA 5AJQA 3ZCLA 4Y72A 3VJOA 4GYGA 4R8QA 2OF2A 3ITZA 4U79A 3ZTXA 4C8BA 1ZYDA 5K4JA 4MF0A 4ACCA 3QD4A 4FL3A 3SAYA 5FXRA 2VWZA 5E8ZA 2BROA 2QC6A 4FKUA 3G9LX 3ORNA 4QPSA 4AXAA 3NDMA 3QD0A 2H96A 2GQRA 4QYEA 2X8DA 4DFLA 4YJRA 4QMNA 5I9YA 3O23A 3O0GA 3TMOA 2HY81 1PJKA 3RZFA 4ERWA 4BDDA 4FKIA 4ZMFA 2P33A 2R3GA 4FNWA 5GJGA 2V7OA 1OM1A 5LVOA 4HYSA 5GJDA 3ZO4A 3P7AA 2AUHA 4GG7A 4F0FA 1PRYA 2P4IA 2OLCA 4WIHA 5HO8A 2WEVA 3QFVA 4F64A 2W06A 3KRJA 3OWPA 1JBPE 2ZB1A 1H28A 4TKSA 3VN9A 3ZYAA 4RJ7A 3BHTA 4UZDA 5LARA 3OF0A 4IJPA 4BCFA 2JAVA 3NUPA 2YIYA 3NWWA 3BQCA 4AACA 5A6NA 5M57A 2OSCA 3BEGA 3DBCA 3Q9XA 3R28A 2F7XE 3KFAA 1GNGA 3NCZA 3WF9A 5J95A 4I0TA 5HIEA 5GIOE 3H9RA 5TE0A 5JFSA 4JLCA 4UZHA 4JNWA 1PMVA 2A27A 2VV9A 3BLAA 3UPXA 1A48A 2UZLA 1KV2A 3SXFA 3S0OA 3DKOA 3FJQE 4FF8A 4ENXA 4FSWA 3HLLA 3SGCA 4IZYA 3WARA 4FT7A 2HOGA 3TZ8A 3UP2A 2A4LA 2OXDA 2QR7A 3PRFA 3A61A 2BTSA 5FEDA 4FV6A 4RSSA 5KKRC 4EOKA 2PWLA 3AC3A 3ENHA 4KIKA 3EYHA 2CKEA 3C1XA 3NSZA 4Q9SA 2ZMCA 2NPQA 4RWLA 2Y8OA 4J8MA 2WEIA 4EKLA 2BRHA 3SXSA 3MI9A 3QKKA 3MVJA 4P7EA 4PNKA 5FDPA 5KO1A 3MH3A 4M3QA 5AX9A 3QRIA 2NO3A 3ZONA 3IGGA 2H8HA 2XJ0A 4I6LA 4G6NA 4FEXA 4AXFA 4RA5A 5IQGA 3BU6A 3DCVA 3T8OA 4KWPA 1XH7A 4QNYA 5CYIA 4YLJA 1ZYLA 5HG8A 4C62A 3SV0A 3OTUA 4QPMA 2X81A 5EKOA 3PVUA 5E8WA 5AR2A 3VUIA 4KS7A 4Q5HA 4E4MA 4BICA 3EN5A 3VRYA 5E8UA 1NA7A 2G2FA 2J50A 3F3UA 4IANA 1G8KA 2AC5A 4FICA 3V5QA 2C5NA 2J0LA 5C8NA 2XMYA 2WZJA 1TQIA 3QUEA 5BX0A 5DG5A 5CZIA 3W10A 5KKRB 4O6LA 1Q97A 4IAYA 3R8MA 1FVVA 3D5WA 3MY1A 4M67A 3TZ7A 2UW9A 2C6DA 2RG6A 4M97A 3RPSA 4UWCA 3VUTA 3WE4A 3T3UA 1WBOA 5DH3A 2X7GA 4O0WA 3OROA 4G9CA 5GINE 4V04A 4ZMEA 3AG9A 3HV6A 4O22A 5L6OA 3ZFMA 4QO9A 2BFYA 3G0EA 3GC9A 4UV0A 4BCPA 2CNVA 3UZPA 5CAOA 5AR7A 2WD1A 4ZZMA 1ZZ2A 3ORIA 4HYHA 3HAMA 2XK9A 4ZSGA 4DG0E 1UA2A 3V5JA 4ZTLA 4HVIA 4EOMA 4GW8A 1TFFA 4LV8A 4O2PA 2A98A 3H9OA 3VHKA 3UQCA 3R8PA 2VWVA 4MNEB 3POOA 4MQ2A 3OXZA 4D28A 2ZM1A 4E1ZA 4X2JA 3UOHA 5CF5A 4YZBA 4XG8A 4USFA 3C4ZA 4FTOA 5IG1A 3FUPA 3LHJA 1GZ8A 3N4VA 3P5JC 3F66A 3F3TA 1UWHA 1DS5A 3KF7A 1UV5A 3PIZA 4IH8A 3R7EA 2P2HA 3M11A 3A7IA 3OOMA 3UMWA 3OC1A 2JFLA 5C4KA 4APPA 1GIHA 5KZIA 4O7WA 4OTIA 2YERA 5CAVA 4DDGA 5I5ZA 4MVFA 4BI1A 3OFMA 5EDQA 5HLPA 5EYDA 4DH8A 3DBFA 5JN2A 2HWOA 3PA3A 3F6XA 2G9XA 1RJBA 2GQGA 4FGBA 4Y5QA 5GZ9A 3ALNA 3FSKA 3LJ1A 4WUNA 3QA8A 1U4DA 5JFVA 2XNOA 4XG2A 4IX5A 3AQVA 1APME 2I40A 2B4SB 4UALA 1IASA 2YJSA 3QHRA 3W8QA 2Y4IC 3C0IA 4RX7A 1Z9XA 3ZBFA 2F2CB 1XBCA 3EFKA 4FRFA 3TT0A 3KRRA 4CVAA 3PY1A 3COIA 5BYLA 5E7RA 2WMQA 4OTQA 4FKSA 2YM4A 5D9HA 1U59A 2OJJA 4TYIA 4GUBA 4ENYA 3MYGA 3ZSIA 5JEBA 2QHNA 4XV1A 3LFCA 3DXQA 5BVNA 3ROYA 1FOTA 4Y85A 3OCSA 1WZYA 4NUSA 3SLSA 4KAOA 4O38A 3HA6A 2PVJA 3L8XA 2W1HA 4GMYA 5J8IA 4U80A 1OBGA 1OBDA 1H1PA 4RLLA 1V0BA 5HE3A 3FHIA 4EH9A 4YGAA 3D94A 3PJCA 4PUZA 3L8VA 4UMTA 4DLIA 4MD7E 3RPYA 2WOUA 3RJCA 4BYJA 3UQFA 3ZUVA 3F3WA 3IW8A 3QCSA 5HE2A 3R8UA 3QKMA 4JJRA 4Q5EA 2W1CA 5KMIA 2X2MA 2VX1A 2HXLA 3GFEA 1IA8A 3DV3A 4M8TA 4NCTC 4X2FA 5HICA 1BI7A 2ITUA 3I5NA 3G33A 4G3FA 2ZAZA 3SA0A 3L9MA 4C35A 1MUOA 4IWQA 5JK3A 1WFCA 2BZIB 4BIBA 1JNKA 2Y4IB 3BPRA 4GU6A 3SKCA 4BWPA 1JLUE 5HU3A 2PULA 1NVSA 3BE9A 5E8YA 4LOPA 3FZ1A 4RRVA 5J79A 4TWOA 3QAME 3E7VA 4AW2A 4MBJA 2RSVA 1R39A 4XCUA 4PL4A 4YTFA 2R3IA 1YOMA 4FK3A 4OTHA 5LVLA 4DEGA 4OTRA 4FZFB 3NX8A 4AW1A 2GNHA 5CENA 5EQYA 4O4DA 3PSBA 3FSFA 2VTLA 3OTVA 4RQVA 4A4LA 1ZWSA 2R3LA 4EHEA 1LP4A 3D7TB 4FNXA 4F6UA 4EH4A 3DPKA 4IAIA 4J71A 4FKVA 5ANEA 1FQ1B 4IB5A 4YZMA 2YITA 1G8JA 1OKWA 3Q4TA 4FT0A 4P5QA 3N4TA 5HCYA 3EN4A 4HCVA 1NVRA 5J7HA 1VLRA 2F4JA 4DHJA 4FKGA 1YI6A 3L8PA 4JBVA 2XK3A 3M42A 3CEKA 1WBPA 5JQ5A 1Q8WA 4RZWA 4DA5A 2JD5A 5AUYA 5HO6A 1ZXEA 2BILB 5IQAA 1SM2A 5EI2A 4K77A 4BF2A 4IBMA 4UMQA 3UOJA 2PU8A 1OL1A 5DRBA 4D2WA 4OTWA 4G6OA 4DBNA 5A4CA 3HVCA 4BWKA 4WRSA 1PMUA 3QL8A 4PP9A 2C1AA 5E1EA 3QYZA 4ASZA 4S34A 4RIOA 2JKQA 3MS9A 3PYYA 4JBQA 4XUFA 4J7BA 3LMIA 2C6MA 5EM8A 3VBVA 1O6YA 5TOZA 4IACA 3LCSA 3EQHA 1XBAA 2GNGA 4D1XA 3UO6A 3ZDUA 1DI8A 4JX3A 5AFVA 4BFMA 5AV4A 3SG9A 3ODZX 2QO7A 1Y57A 3HZTA 4LMNA 4R3RA 2R3OA 3P79A 3RNYA 3ML1A 2ONLC 5E9EA 1ZARA 4FV9A 1Y8GA 3UNKA 2C68A 2XALA 2ZV7A 4H3PA 3EQFA 4QP6A 3IONA 1PXOA 2VD5A 4WT6A 4O86A 4AZVA 4YJOA 3KXXA 1IEPA 5DT4A 2YCSA 4F09A 3KRWA 4IEBA 4MBLA 3MY0A 3EKKA 1YHVA 5F20A 4CT1A 2W17A 3QZFA 2O64A 4MNEA 5EW3A 2R2PA 5EH0A 3FLSA 4O7TA 3ZUTA 5HE0A 4DITA 4N57A 3FQEA 3LFEA 3QTUA 4MWHA 3CTJA 3PG1A 3PXFA 3PLSA 5LMBA 4PRJA 3FXWA 4CTCA 5AUTA 4YC6A 3PFQA 3QC4A 5T68A 5JZJA 4DCEA 3KREA 5EFQA 1YOJA 4LOOA 2QU5A 5JRQA 1JWHA 2I0EA 3MWUA 1XH8A 4GK2A 4NM7A 4R3PA 2PMOX 3R21A 4Z9LA 5L8KA 2OJ9A 4FKTA 3ZC5A 5M07A 3DAJA 3LQ8A 4Z7GA 2IW6A 5A46A 5CXZA 1W2CA 2XB7A 3UIMA 3QCXA 1UU8A 4U97A 4PPBA 5HVKA 4H05A 1QCFA 4GVJA 4OBPA 3BIZA 1ATPE 2VX3A 5FQDC 3QRUA 3R9HA 3UVRA 1H25A 4LL5A 4NH1A 4LUDA 2Q0BA 5HHWA 4U44A 4ASDA 3GU6A 3GUBA 4FT9A 2EU9A 4AUAA 2PZIA 5B0XA 3CJGA 2HWPA 4TN6A 4DG2E 5DBXA 2NRUA 5AA8A 1KOBA 3KK9A 4JI9A 2UZUE 3U51A 3UTOA 2XIYA 4AFEA 4K2RA 2W4JA 2YHVA 4QMXA 4ANOA 4QTAA 4S31A 3O50A 3PUFC 3WBLA 4EOOA 1OZ1A 3DXNA 5M44A 4L53A 3ZS5A 1W84A 3BYSA 3HV5A 3FKNA 2ZV8A 3OD6X 4W4WA 1Q8UA 5D1JA 5T6KA 4HGTA 5E8VA 4WG4A 4FVPA 2Y4PA 2QONA 2YIQA 3E63A 3UO5A 1J7LA 3G6HA 4D9UA 1W2FA 3W2RA 5A14A 3KMMA 1J91A 2J6MA 4DGNA 1JKTA 3PJ8A 4JG6A 4OTFA 3O8UA 3W2OA 5ICPA 4ERKA 5IA4A 2RGPA 3MSSA 4ZLYA 4FL1A 1XH9A 3BYMA 3UQGA 3BBTB 4ZZOA 3QTZA 3MA3A 4QP4A 2UVYA 1IAJA 3O7LB 4F9WA 2W5BA 3BGPA 2ZJWA 3JXWA 4O0RA 1PYXA 3BELA 2O65A 4IB0A 4KIPA 4L00A 1PXLA 3MB6A 4RIYB 4FEQA 5IDNA 2ITTA 3VUDA 2F49A 3F3ZA 3UDBA 4NZWB 1KE6A 4L44A 4ZIMA 3TG1A 1BI8A 3I6UA 1HCKA 2HENA 4MNFA 3ZLYA 5JGDA 4YLKA 5CALA 2PE0A 3CY2A 4YLLA 3UJGA 3O96A 2UZDA 4LQMA 4GJ2A 2J5FA 2IO6A 4DHZA 3S95A 4GFOA 1UNLA 2WU6A 4YJNA 3ZO3A 3OP5A 2VTRA 1CM8A 1BYGA 3P7BA 4FC0A 4MF1A 1ZMWA 2OO8X 5IH4A 4UN0C 2ERKA 2EXEA 4O7SA 2C0TA 1MQBA 2WQOA 4FV3A 5IEVA 3GENA 3BGQA 1TVOA 4MXZA 5FEQA 4AX8A 4BCGA 2E2BA 1P4FA 3BLHA 3FKLA 3KCKA 1XBBA 4BDFA 1OMWA 4GUEA 1YHSA 3HEGA 2VTTA 1CTPE 2XYUA 2B52A 3QRKA 3PSDA 3II5A 4FSTA 4NW5A 4ZTMA 2PK9A 3HKOA 5M51A 4DF3A 4AXDA 5K3YA 4IXPA 3F69A 2P3GX 3ORKA 5D41A 3BYOA 5AR8A 2PSQA 3EN6A 4FV1A 4Y95A 3FLZA 4DLJA 5JH6A 3DDPA 1NW1A 3I1AA 1XWSA 4IADA 1V0PA 4JQEA 3DY7A 3Q6UA 4H1JA 4M66A 4ANSA 2VO6A 4BWXA 2W5AA 1PW2A 4HZSA 3KK8A 3NW6A 4EK3A 4Q2AA 1YRPA 1MP8A 2QI8A 2Z60A 2Z7QA 5DI1A 3C4XA 4P5ZA 1ZOEA 4NKSA 3ZC6A 2W99B 3Q4ZA 3I7CA 4BYIA 5FD2A 4U45A 2XK7A 2OZAB 3EQBA 3DLSA 4X2NA 2CN8A 4NK9A 3JUHA 4IM0A 3R2BA 2QOQA 3QALE 4UMRA 3UZTA 3CKXA 2C3LA 2BRMA 4PV0A 1OPLA 3W0PA 4EH2A 3FMNA 4LFIA 5CT0A 4D2SA 5HTBA 5AUWA 4J97A 2WTJA 4EI4A 3FI3A 2O8YA 2UZVA 4U3ZA 4D0XA 4CZYB 5A9UA 2JAMA 2PYWA 4YHFA 4ZLZA 1CKPA 4DEIA 2WTWA 2C6TA 1PXNA 4G3EA 4U43A 3BHVA 5FGKA 4A9YA 3NVKI 4IWDA 4ZJVA 3FI2A 4KB8A 4LMUA 2W1FA 2ITXA 3L8SA 4BL1A 4AZTA 1OPJA 4AN9A 1GY3A 4DDIA 2XBJA 3QQUA 4NKAA 5C1QB 5D7AA 1H08A 2VTJA 2XJ2A 3IDBA 5L2TA 2SRCA 3DZQA 4FG7A 4HPTE 2VTAA 1XKKA 2ZDUA 3HX4A 3LIJA 4MQ1A 3RAHA 1M2RA 4IJ9A 3W1FA 2R3HA 4J8NA 3CTHA 5IEXA 3NYXA 1Z5MA 3AD4A 2C6IA 2X1NA 1OKYA 4QNAA 4WSQA 2YDIA 5CSPA 3D5UA 3PWYA 3EQCA 3C7QA 2GFSA 3K2LA 2CN5A 4HGSA 5F4NA 1MRUA 2DQ7X 5ANDA 5BVWA 4XH6A 2UW8A 3D4QA 2FUMA 1JOWB 4I6HA 2ZB0A 1WAKA 3ETAA 5FTGA 4WNOA 4IB3A 3RAKA 3A7FA 3BYVA 3E87A 3PXQA 1QPCA 1A06A 4II5A 4UXLA 3VWAA 4MCVA 4JAJA 5HX8A 3BBWA 5CSXA 5CVHA 2GPHA 5C26A 4I5MA 1Z57A 4TL0A 2VGPA 5HORA 4JS8A 4WNKA 4RJ4A 3LXPA 1LEZA 1M7QA 3QZHA 2YAKA 4XYFA 2C5XA 4QP3A 5FLFA 1NVQA 3LCDA 4IW0A 3ZXTA 2C6OA 3CD3A 4FSZA 3QTSA 3GC0A 2WO6A 4TY1A 3PXYA 4LOQA 2OFUA 4FIEA 4F4PA 5M56A 4FEVA 5AM7A 4A4XA 2FO0A 1H8FA 3OMVA 2B55A 3PPJA 5DFPA 2XNBA 2VTMA 3QGYA 3TZ9A 3V8WA 3UIBA 4DH5A 3B2WA 2GDOA 2XEYA 3I4BA 4J96A 3DOGA 4HCUA 1UKIA 4HVDA 5AMNA 3OWKA 1XQZA 3AC8A 4KIKB 4RJ8A 4S33A 2WTIA 4FVQA 3TUCA 3HV4A 4RJ3A 5HVYA 2CJMA 1U54B 3E3PA 2R0IA 4O27B 2X9EA 2G15A 3QUPA 4CQGA 4F7JA 4BDCA 3W33A 5EHOA 4L42A 5C27A 5CZHA 5BPYA 4ZTRA 1XH6A 3NNUA 1HOWA 5CQUA 3JPVA 2PVHA 3HMOA 4E5BA 3LQ3A 3FYKX 2B9HA 4NIFA 3HV3A 2G01A 3KRXA 2XANA 3PPZA 3VS1A 3RK9A 4D2PA 3NNWA 3C4FA 4XOYA 4QMMA 4IWOA 5H8GA 4FOCA 3U6JA 4FEWA 4C4IA 2OFVA 4YHTA 2OF4A 1NT2A 4TWPA 3W0SA 3UG2A 3SVVA 5JFWA 3LKMA 4NL0A 5TO8A 4W4VA 5CU2A 3TWJA 2QODA 3CR0A 4WOVA 4JG8A 4UYNA 2OJGA 2GHGA 4EH3A 3NZ0A 3QTIA 5F9EA 1OIYA 2J0KA 4L7SA 2JDTA 3MIAA 2X2LA 4P2KA 3VJNA 4CFUA 4IX6A 5I3OA 4PTCA 2CNUA 5AX3A 4KSQA 5CF6A 2CNQA 4FIHA 4HVSA 5HBJA 3R9DA 5A4EA 3QQGA 4UWYA 3BI6A 4EOPA 4BVUA 3QA0A 4E6CA 5LVPA 4IAFA 5DRDA 4AN2A 4EUTA 3IK3A 1P14A 2YISA 5AP4A 1I09A 3CJFA 5JRSA 4RBLA 4DFZE 1H26A 3UE4A 5KZ0A 4FTQA 4DEEA 3PIYA 2VTIA 2PVMA 4W4XA 2XNGA 4UX9A 4E73A 2EXCX 2F7EE 4F9AA 5B2MA 1WBNA 2PHKA 4R5YA 3LXLA 1FVRA 4K0YA 5KX8A 3FKOA 1HCLA 3LFFA 4G3GA 3KEXA 3W0QA 2HZ4A 1IR3A 4N6YA 1H07A 3BHUA 5CF4A 2RFSA 3OVVA 4B4LA 2OK1A 2OZAA 4J53A 3WZKA 1B39A 1WCCA 5M4IA 4ZTQA 1ND4A 4JRVA 1WVXA 4KNBA 3A2CA 4I21A 3P1AA 4QMVA 2JDVA 5L6PA 4O0YA 2C47A 4RLKA 3RP9A 4D58A 4FTCA 3MH0A 3MJ2A 5HBHA 2YM8A 4CKIA 4CLIA 3UP7A 5A54A 3VQHA 2GS7A 2VWIA 3THBA 4YC8A 4AE9A 3BQRA 4IB1A 5HX6A 2BKKA 3UPZA 3G15A 1PYEA 4FKLA 4G5JA 3TTJA 4AU8A 2WTCA 4DEHA 5CAQA 3V5PA 4XG6A 2BIKB 4ZXTA 4UEUA 2QKWB 3V5TA 2QLUA 4UMUA 4AT4A 4J52A 4RWKA 3TTIA 4C37A 4Z7HA 5EKNA 4YBKA 3UIUA 4WD5A 3E8EA 3MFUA 3U4UA 2JIIA 4BDIA 3D0EA 3FE3A 2GHMA 5C8MA 3DU8A 4ANQA 4D4YA 1VEBA 5BMMA 1B38A 3E93A 3G6GA 4A06A 4KIQA 4Y8DA 2REIA 2WFYA 5H3QA 3QD3A 4AZFA 4EJNA 4FNZA 4FUYA 3TIZA 1MRYA 5CEPA 4I22A 4PTGA 5HD7A 3W2SA 5CEKA 3E88A 3VF8A 3UNZA 2J7TA 3R2YA 4MXAA 4LV5A 4MXYA 2E9OA 3RCJA 3COKA 3F2RA 4XHKB 3LFNA 1W98A 2IPXA 3OBGA 2WIPA 4RMZA 4XRLA 5HTCA 4BCJA 5ANOA 2ZMDA 4GT4A 4X21A 3U55A 4PMTA 2RFNA 3ATTA 3FDNA 3M2WA 4G34A 2BKZA 4XEYA 2B9IA 4FX3A 5M53A 4B6LA 3OCGA 5IH6A 3FC1X 3FLYA 1YOLA 2XK6A 1QMZA 5D11A 4QEBA 2Y9QA 4HNIA 1LEWA 2WMXA 2QOOA 4I5HA 5IZFA 3DXPA 5HIBA 4F08A 4GU9A 3DTWA 2FGIA 3DQXA 3C4CA 3LW0A 4ANMA 2ITQA 2VUWA 4JOAA 3TI1A 4O7VA 3ZXZA 3NCGA 3V6SA 2XM9A 2BR1A 1KV1A 3KC3A 3ZSGA 3V01A 3EQPA 3R7VA 3EQDA 4QYGA 3A8XA 4OLIA 5BNJA 3K3IA 5TR6A 2IN6A 1RDQE 4WNMA 5LXMA 1OGUA 1XMLA 2VTPA 4ZK5A 4F1OA 1GJOA 4RT7A 3Q5ZA 4HGLA 4FE2A 5FTOA 4DH1A 1U54A 3FL4A 4XS2A 1XH5A 3OY1A 3Q3BA 3HMMA 4HW7A 2YDKA 5G6VA 4L8MA 3NUYA 1H0WA 4OTGA 4BR3A 5I9XA 4F70A 4HOKA 3E64A 4BGGA 1PXJA 4ZY4A 2V55A 3VONA 4QQTA 3WF8A 4IVBA 4EBVA 3FY2A 5TT7A 2E9VA 5C4LA 5IU2A 4JDIA 2JC6A 3I0QA 3KF4A 5FUTA 2A19B 4A4OA 2WMSA 1REJA 4K33A 2OJFE 3GU4A 3PVGA 2YA9A 3MN3A 4OBQA 2GHLA 2PE2A 5L2WA 3FPQA 3F3VA