4FIGA

Catalytic domain of human pak4
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
293
structure length
292
Chain Sequence
RVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PAK 4
publication title Type II p21-activated kinases (PAKs) are regulated by an autoinhibitory pseudosubstrate.
pubmed doi rcsb
source organism Homo sapiens
total genus 91
structure length 292
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4figA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4figA01
3UP7A 4BCJA 4S31A 3R8PA 4F70A 3O17A 3A61A 2G15A 1R39A 3KULA 2C1BA 3MFRA 3QTSA 4J98A 3WOWA 1K2PA 1EH4A 3QQKA 5CI6A 5HKMA 5BNJA 2GHLA 1YWRA 3AC8A 3C9WA 1TQIA 3MY0A 4GL9A 4TT7A 4NWMA 5CF5A 4EK5A 4B8MA 1XBCA 4L9IA 3BEGA 3R83A 3KREA 3RKBA 5CF8A 4A9TA 4FEVA 5FXRA 2A0CX 4QP8A 4IWOA 2QKRA 1Q62A 2IVTA 3FI2A 4BHZA 4EWHA 1PMVA 3BE9A 4FTMA 5DHJA 1OL6A 1GZOA 1UU8A 4KABA 4I4FA 3JY9A 4FZ7A 3U4WA 5HVKA 5CAQA 5EHOA 4C59A 1CTPE 4R1VA 3MIYA 3FMHA 4EOKA 3CKWA 4O83A 2JEDA 3NRMA 3B8QA 5BUEA 2QOHA 3VS4A 3IW5A 5AR8A 3PXFA 3NEWA 2NRYA 2YDKA 5IEXA 5CYIA 4NIFB 4I41A 1RQQA 2J4ZA 4O6EA 5CWZA 1CKPA 3GI3A 4USDA 2AC3A 3K3JA 4E8AA 2W1FA 4I0TA 2BZHB 1BL6A 1H01A 2GHMA 4E20A 1GIJA 3MVLA 4A4XA 2XP2A 3EQDA 5CT0A 3V6SA 3QQFA 4JR3A 5FRIA 2VWXA 4MKCA 4D4VA 4ERKA 3C4ZA 5EQYA 3KULB 1CDKA 1XQZA 4C02A 4QP1A 4DEHA 4JIKA 3PXRA 3RNYA 4UZHA 4HYUA 2GTNA 4F09A 4HVDA 3R63A 1XH7A 2GMXA 4OGRA 3R9OA 3CBLA 4JDHA 4YJTA 3VRZA 3V01A 1F3MC 5CS6A 1Z9XA 4D9TA 4O84A 1M7NA 2XF0A 4O0UA 4RA5A 4GT3A 2QCSA 3COKA 3F7WA 3DJ6A 1UU3A 4DF3A 3ZDIA 3C51A 2ITWA 3HYHA 4W9WA 4XV9A 1WVXA 3QL8A 4MCVA 3V5WA 3W8QA 2PUUA 4YLJA 4YPDA 4OT5A 5IA1A 2PVYA 4BKJA 2ITZA 3UG2A 2UZWE 4JDJA 3F3UA 4M68A 4WSQA 5F20A 2PZ5A 4FTQA 2BZKB 4AN9A 1JKKA 1BL7A 1FVVA 4EYMA 3D94A 1G3NA 3EH9A 1HCLA 3BQCA 3DJ5A 3UC4A 4ASZA 3KC3A 4CYIA 5JEBA 3CJGA 5J5SA 3RZFA 2Y9QA 3E93A 5CVHA 3PJ8A 4AS0A 4NYEA 2B54A 3AC3A 2QO7A 3TDWA 1KSWA 2PVLA 3DAEA 2JKMA 3RBWA 1AD5A 4X3JA 4FIGA 2OI4X 3PPJA 3HP2A 4L46A 4V0GA 4X7QA 5E1SA 4TTHB 5TF9A 2JDSA 4EEVA 3KU2A 2C6OA 3QTWA 5AEPA 3EQRA 1U5QA 4ZK5A 4D2PA 3VULA 4RZWA 3VBTA 3HLLA 4ANMA 4FV9A 4Z7GA 3S1HA 1JSVA 2A2AA 3UTOA 4GYGA 1H1QA 2WXVA 4IWQA 4FKPA 4FT9A 2P0CA 5HG5A 5HNBA 1R78A 3OCTA 4WUNA 5EM6A 4DEEA 3R9NA 3SD0A 3BHUA 5M06A 2Z8CA 4YLLA 5AUVA 3UIBA 3R7UA 3ROCA 3PLSA 3QAME 4JRNA 4PPBA 3TZ7A 3COIA 2GSFA 4E6CA 5BX0A 3VAPA 1UA2A 4XCUA 2V7AA 3P5KA 2XKFA 5AX3A 3K5UA 4M15A 5ITAA 2IJMA 4F08A 2RF9A 3WF5A 4D1SA 4JDIA 3WZUA 3CJFA 3A4PA 3IW7A 3LCOA 5JZNA 4F6WA 3U6IA 4AUAA 2ZJWA 1SVGA 2X7GA 4M14A 3AD6A 3EHAA 3V8WA 4ZEGA 5IG1A 3UNJA 4B4LA 1FVTA 4E4NA 2OW3A 4BCIA 3ANQA 3O8TA 4G3GA 2EXEA 3VHKA 3CSVA 1BX6A 1UU9A 4JDKA 5AV3A 3ZBXA 2R3JA 4I6FA 4V0GB 3EZRA 3BKBA 3WYYA 4QTAA 1FVRA 4RX9A 3NW5A 4W4YA 4AGCA 2WMXA 4X2FA 4CZUA 4WD5A 4AN3A 2CNUA 3LCSA 5KZ0A 4BDCA 3LQ3A 3MY1A 1WBTA 2G2FA 4HW7A 3NPCA 3V5PA 4CZTA 3AD4A 2JLDA 3L9LA 4TYHA 4ZSLA 2E9VA 4L3PA 1KV1A 1JKTA 2O0UA 3FY0A 4FSNA 4RBLA 4XG7A 5DA3A 5BMMA 5HBJA 4DA5A 5A14A 4NTSA 3IW8A 1NVSA 2WQOA 2E9PA 4FTIA 4ZAUA 2CHLA 2DS1A 4K9YA 4CRLA 4AT3A 5I9WA 3PVGA 4W8EA 4DC2A 1H28A 5HLPA 2ITOA 3ET7A 3KN6A 1SM2A 2CGXA 3SHEA 3SX9A 2UW3A 3P0MA 5IQAA 2YACA 3LOKA 4MX9A 3HUCA 4YZMA 4JG7A 4YJUA 3UVQA 4ZZNA 4HJOA 4TY1A 2Z02A 4XG4A 2VWWA 4FIEA 3UO4A 2QOOA 5FP5A 3V04A 3LLTA 2RSVA 2GPHA 3FC1X 1T46A 4F6SA 5TR6A 3ZFYA 3ZO3A 2PZPA 2ZM4A 4BFMA 2PVFA 3IS5A 5EW9A 4QNYA 4B9DA 1J91A 1FPUA 1ZY4A 3UIMA 5HU9A 4C2VA 1QPCA 2W06A 2BZJA 3F3TA 4NH1A 4W4WA 4E3CA 4ZP5A 2H6DA 5E8ZA 3TZ8A 2X81A 5BVWA 2VV9A 2ZM1A 3P79A 4PP7A 5CQWA 3RAIA 4L67A 3FMJA 3DLSA 3ALNA 5IQEA 3QHWA 4H3BA 4JVGA 3GFWA 4DEAA 5F4NA 4NL0A 5GZAA 2R3IA 3UP2A 3FI4A 4TL0A 2UW9A 3B2WA 3F5GA 4C4HA 5JN2A 3I6WA 2W5BA 1YRPA 3RK5A 2WOUA 4BWPA 3R7YA 1WMKA 1NA7A 1J7UA 1ZYCA 3QGWA 3G0EA 3W32A 5EI8A 2XKEA 4KBAA 3FBVA 3R00A 4O7NA 3ULIA 4JQ8A 4C8BA 3B2TA 2A1AB 3DLZA 3DJ7A 3MA6A 2VNYA 4G3EA 4D2VA 1PXIA 4Z55A 5CEMA 5ICPA 5CU4A 4UBAA 4DH1A 2CLQA 1ZRZA 3T9IA 1KOBA 4ZTMA 2CJMA 2HW7A 3IOKA 4LFIA 3UMWA 5HX8A 5L8KA 5IQCA 4LGGA 5AV4A 5AWMA 4ZS0A 3UIUA 4NKAA 2I40A 3HDMA 4IZ7A 4QMOA 2C0IA 2CGUA 3MIAA 5DLSA 4JS8A 4ZXTA 5LOHA 3GQLA 4MF1A 2ZV8A 3RAWA 4J96A 2XNMA 1J7LA 4EKLA 4O0TA 4O0YA 1CKJA 4IM3A 4NCTC 5JGDA 1OKVA 3QRTA 4H58A 4H3PA 3PZEA 4JXFA 4QO9A 4OT6A 4MXYA 5E92A 3R8VA 3ZEPA 3ZUTA 4AZWA 2JDRA 4KIKA 3LMHA 4D0WA 4QP3A 5AP4A 1F0QA 2WMSA 3MS9A 4N0SA 4O96A 3KCKA 3QUEA 5AV0A 3GC7A 3TTIA 4ANNA 4O7VA 3R8UA 5FEEA 3OHTA 2PSQA 1H8FA 4DGNA 3NW6A 1H1RA 2PZYA 4O1OA 3O8UA 4FMQA 3KXNA 4O7YA 3QQUA 2R3FA 4C33A 4JBOA 4OTPA 1R1WA 4FVQA 3ZTXA 4D1XA 5HBHA 2OXYA 3F2NA 5IISA 3FHIA 2BRGA 3DBDA 4X3FB 4YP8A 3QUPA 3R9HA 3RNIA 5HE0A 4BTMA 1MRYA 3OY1A 2W9FB 4KNBA 4YHFA 4PY1A 5HGIA 2X2KA 4MNFA 3ELJA 4FTKA 3SVVA 2UZEA 1FMKA 4QMZA 3DFCB 3R8ZA 3VO3A 2BTRA 5IMEA 3PZHA 4RVLA 4G5PA 4EZ3A 1GOLA 5B2MA 3FMDA 4RX5A 4DT8A 5C4LA 2C5YA 2W05A 3F88A 5JZJA 4DITA 4YMJA 4TYJA 3VF9A 4USFA 4N4SA 4QQ5A 3FZPA 2C4GA 3ALOA 3FLQA 4WBBB 3MV5A 4QT1A 4RIYB 4C7TA 2OZAB 3DT1A 3BIZA 3HMPA 5KKRB 2HK5A 3GP0A 5LWMA 3Q4UA 1IEPA 4RPVA 4KA3A 4PL5A 4BDKA 4J1RA 3LFCA 4EZ5A 3NLBA 4LOPA 1H00A 3H9RA 3T3UA 1S9IA 3A60A 1JKLA 4DINA 2QO2A 4E1ZA 1G8AA 2HAKA 3NZ0A 3HEGA 4FIJA 3DV3A 4AW1A 5IU2A 4ASXA 4NM7A 3KVWA 3ORPA 3PVBA 5AR5A 4TWOA 5IH6A 4EH7A 2X8IA 3ZZEA 1KV2A 1MQBA 2OSCA 2G9XA 4NEUA 5HO6A 4DH8A 1H08A 3MVMA 5ACKA 2R3QA 4GT4A 3QQJA 4RFYA 1FGIA 2UZBA 4W8DA 4O7SA 1YOJA 4UWBA 4H1MA 5DIAA 4OTDA 4CT2A 3KF7A 5JKGA 2QU5A 3A7IA 2CKQA 4E4LA 2DUVA 3A8XA 4FTNA 3T3VA 5BVOA 3QFVA 2R7IA 4GIIA 5AFVA 4GFOA 2OO8X 4HCUA 4XRJA 5CZIA 3NX8A 3ORLA 1IA9A 4QP4A 4ITJA 4DEGA 5AUTA 4DH7A 3PLAE 5E9EA 3F3VA 4QYFA 3ZLSA 2R2PA 3HMNA 3QKLA 3ENMA 4DG2E 5JFWA 1WBSA 3R2YA 4BVUA 4JAIA 3D0EA 3F69A 3FPMA 3C50A 3V3VA 1IAJA 2JDOA 3GCUA 4EH9A 3FMNA 3E92A 3TJCA 3NMUF 1SNXA 2XIKA 4D0XA 4I4EA 1Z57A 3LJ1A 3H10A 4Y85A 3G6GA 4MTAA 2JC6A 3KMUA 3QA8A 4PX6A 2RFNA 4M12A 3GU5A 4RMZA 4WRSA 2R3OA 1JVPP 3TG1A 4HVSA 2QNJA 3MSSA 4L43A 3IGGA 4JIAA 4E4MA 5DH3A 4TYGA 2VAGA 2P55A 2GS7A 2CN8A 3PWDA 2FSMX 4QOXA 5IDPA 3BX5A 3W55A 3I60A 4BI2A 4R8QA 2R5TA 2CPKE 2J0IA 3QA0A 4CLIA 4XOZA 5DRBA 2E9OA 4IZAA 3O96A 5E8TA 2R64A 3EWHA 4QTCA 5FTQA 4DCAA 3FUPA 2JD5A 3OVVA 3VS3A 5IQFA 5M44A 4G6NA 4ALVA 3GU7A 2IZSA 4LUEA 4IANA 1LEZA 4L52A 4CV8A 5HVYA 2HOGA 3O7LD 2C5VA 4HYIA 3R1NA 3NUAA 2CGWA 4EYJA 5K4JA 4JR7A 1XH9A 5AM6A 4C34A 3ZXZA 2I0VA 5DGZA 5FD2A 2W1CA 3G90X 4FSMA 5C8MA 2XKDA 5KBRA 3SA0A 3UVRA 4DTAA 4KRCA 4YJPA 1JAMA 2WAJA 4RJ8A 1JQHA 5J9LA 2Y6MA 2YCSA 2JFMA 3EMGA 3FL4A 1E9HA 4BDHA 3KY2A 5FEDA 2W7XA 2CKOA 3JR1A 3H3CA 5C1QB 3AC5A 3FQEA 4HYSA 4LV5A 2XNNA 1FBNA 2PTKA 2FGIA 2O8YA 2VTRA 3NCZA 3N9XA 4PF4A 1BYGA 1M7QA 2HCKA 3DS6A 3PE1A 2AC5A 3QRIA 3DKGA 5DFPA 2QOKA 5DR9A 4DG3E 3GCVA 4I1ZA 5EW3A 1Q61A 4YSJA 3OC1A 1P4OA 1TVOA 1PXNA 2LGCA 4BDBA 5HG7A 5IMXA 1OPLA 2E2BA 4ANLA 5FXSA 3BPRA 4GEOA 4IB1A 2OU7A 3ZOSA 2Y0AA 4DBXA 3QCYA 2VO6A 2VWVA 3FC2A 3C0HA 1GNGA 4Q2AA 4QMLA 4HVHA 4NU1A 3BV3A 3PXQA 3E88A 1O6KA 1UNGA 4D55A 4FBXA 3KRJA 3FLSA 4JBPA 3Q5ZA 1K9AA 3HV6A 4XG8A 3OEFX 4ONAA 4ZZMA 4QTEA 3QRKA 4EH3A 5A4LA 3ACJA 4F9WA 5IH5A 3D83A 2ZDUA 3WBLA 3PJ1A 5L2TA 2W1GA 5M4IA 1LPUA 4JL9A 5AUYA 1STCE 3UVPA 3U55A 4RZVA 2BFXA 2BAQA 2VX3A 5AMNA 5CEOA 5LMAA 3HZTA 3KXGA 1NY3A 4UYAA 4FTLA 3RZBA 5AP7A 4L7SA 2F49A 4EK3A 2VO0A 3R73A 2J5EA 4I94A 2CCIA 4AZSA 4EK4A 3SG9A 4M66A 4H1JA 4XBRA 5I5ZA 3NVKI 4LRMA 5CVGA 4FTUA 4BZDA 3P7BA 2BFYA 3KMWA 3VUHA 2FSOX 4EOSA 1U54B 2YM8A 2HENA 3UODA 5K0XA 4TYEA 2B0QA 2C0OA 5FEQA 4RJ4A 2GS6A 5FBNC 5TKDA 2XEYA 5CAVA 2J90A 2W1EA 4XMOA 3U4UA 3UGCA 4BIDA 4WNMA 3EL8A 2P4IA 4RC3A 1JWHA 4V04A 4HPTE 2YCRA 5C01A 4G9CA 2EU9A 4YJQA 3NCGA 3PXZA 4O7ZA 2PYWA 3H9FA 3OUKA 5IA3A 4IZYA 1LR4A 4GT5A 3KXMA 2GNLA 4NW5A 5LCKA 3R8MA 3QTUA 3DKFA 3AT4A 1AGWA 4DCEA 4G3DA 3CTHA 3KXZA 4GKIA 3I81A 4M8TA 4BICA 4YJNA 2XK6A 2YIXA 1DI9A 4FNYA 1OL1A 2UW5A 2X6DA 3OWKA 2DWBA 3NWWA 1O6LA 4P5QA 5JH6A 4HVGA 4I5CA 4FTRA 5HLWA 5JRQA 4RC4A 2YITA 4H05A 2UVYA 2QU6A 2C6DA 2Z7SA 3KXXA 5DPVA 1FGKA 3CIKA 2VWYA 4HPUE 4OR5A 5CQUA 5EKOA 2JGZA 3RHXA 5D9HA 4CTBA 5AADA 3V5JA 2BPMA 1V1KA 5FM3A 4ZJJA 1PRYA 4K1BA 4FV5A 1X8BA 3HKOA 5CXHA 4G17A 2YJSA 5BQ0A 3QXPA 2I0YA 1ERKA 4BCHA 3F61A 5D10A 3KRRA 4IWPA 3CGFA 4I20A 3IK3A 4KS8A 4BR3A 3DQWA 3ORIA 5HNGA 4C35A 2YM4A 5DR2A 3FSKA 5A4CA 2JKQA 4M3QA 4K77A 2OJIA 3ZSHA 1QPDA 3FZOA 3OMVA 3EN7A 3MPAA 4FNXA 4CQGA 4UEUA 4HYHA 4IJPA 5M4FA 3CP9A 3C0IA 3VW8A 4A4OA 1JPAA 4OTQA 4C3FA 4DFUA 1XO2B 3FSFA 5ETAA 3BLQA 5BUIA 2BDWA 5IEVA 3ODYX 4FKOA 4MHAA 3ITZA 4BYIA 4EH2A 2W4OA 3KL8A 4F0FA 3JS2A 4FKTA 3D4QA 2W1ZA 3E62A 4MF0A 5LVOA 3SXRA 5DNRA 2BKKA 2B9IA 4DH5A 4WG3A 3O2MA 4BCKA 2CGVA 4NM5A 5I4NA 1LEWA 3F5UA 4I6BA 4MYGA 5HCZA 4EJ7A 5ETFA 1W82A 5AP5A 4OAUC 1I09A 2ZV7A 4X21A 3LXLA 4E6AA 3HA8A 4EHGA 5CNOA 5GJGA 3GOPA 3RTPA 4YUQA 5K9IA 4DEBA 5KMLA 3A7HA 4KIPA 4XP0A 1KE7A 2WQMA 3QWKA 4O0VA 5CZHA 4OUCA 1XKKA 3O7LB 2X8DA 4E73A 4XG3A 4TWPA 5CU2A 5CENA 3GU8A 5IQIA 3N51A 1JSUA 5CU3A 1OL5A 3ZONA 4C61A 5GINE 1OIYA 3E7OA 4XHKB 4D58A 1XWSA 2VWIA 1CSNA 3ID6C 4FG7A 3WE8A 4ZLOA 4CG9A 4AA4A 4I92A 4KBKA 4U6RA 4BDJA 4IAIA 5M4UA 4R78A 2OICA 2BAJA 4HGTA 3KEXA 3PG3A 4L3LA 1XBAA 2X7OA 4LOQA 4F7JA 4OLIA 2VTHA 3C7QA 2WTJA 1OIRA 3QQHA 4FA2A 2WMWA 3JVRA 2YLEA 4BGHA 3BRBA 4EQCA 4UXQA 5G6VA 3FQSA 2Z7LA 4PMMA 5ANIA 3DNDA 3E8DA 3MBLA 3ZYAA 3UQGA 4GG7A 3DDQA 4MXOA 1J7IA 1L3RE 3C4EA 3CS9A 4LI5A 5A4QA 4ZTHA 4UB7A 3MH3A 2HIWA 1JNKA 5CT7A 5TOZA 3U54A 3FKLA 3HA6A 2OF4A 2R3GA 1XH5A 2ONLC 3IG7A 4O27B 1LP4A 3OCBA 4DEIA 3MN3A 4DYMA 4J97A 4MVFA 3DY7A 3EQIA 2QONA 3LPBA 2YM3A 5EG3A 3I1AA 3LMIA 4X6QC 3WIGA 3QZGA 4QPSA 4D5HA 4AGWA 3W10A 3LZBA 2C6MA 3BELA 2AYPA 2GNFA 2PUNA 2C0TA 4V01A 3JVSA 4ZJIA 5HE3A 5HLNA 4FL3A 2R4BA 3FKNA 4G6OA 1BMKA 1JSTA 4ZY5A 3SW4A 1UV5A 1UWJA 4TW9A 2VO7A 4GK2A 4A9YA 4I22A 4RC2A 4YTIA 2C47A 3REPA 4AQCA 4C37A 1OL2A 5AP1A 1FOTA 4QMWA 1W7HA 4YZCA 5JGBA 3PSDA 1OGUA 4LG4A 1P5EA 4MBIA 3FMKA 4OTHA 3MW1A 3ROYA 4EHZA 3QCQA 4FYNA 3GU4A 4Q5HA 3ZRKA 2GFSA 5CTPA 3KRXA 5CF6A 5H3QA 3Q53A 3TNPC 5HEZA 3Q60A 4EJNA 2GNGA 5KZIA 4AGDA 2B1PA 3S4QA 4CFNA 5AP6A 1PMNA 1ZZ2A 2PVKA 1VR2A 2XK3A 3MA3A 1O6YA 1YI6A 4IAAA 4DFXE 2YM5A 3CTJA 4YR8A 4M97A 1F5QA 3HMMA 1QPEA 5CAOA 3UPZA 5EM7A 3AMYA 3NUPA 2BHHA 4TPTA 3Q6WA 4AW5A 1DM2A 1OUYA 2X6EA 3BCEA 4MXXA 4EK6A 4YURA 4CEGA 2X4ZA 5E91A 4ERWA 3FLZA 4LL0A 4XV2A 2JAVA 4XV3A 3SAYA 1AQ1A 3L1SA 4MD9E 3ZC6A 3BGPA 3Q9XA 2IZTA 2W4KA 4F99A 3LCTA 2CKEA 4HGLA 4ASEA 4FTAA 4GW8A 4FI1A 4UV0A 5L2QA 3GQIA 5I9YA 5HNIX 3SRVA 3R30A 3KXHA 2PMIA 3M2WA 4AXAA 1GJOA 3VF8A 3RP9A 3HECA 4C57A 2BUJA 3CTQA 5CSWA 4FV4A 4PV0A 3UE4A 1NVRA 4WNPA 5IPJA 5KMMA 3KK8A 3OWPA 4AZEA 4NCTA 1ND4A 3WF9A 4PMSA 3VN9A 5IA4A 2WKMA 3EL7A 1OKZA 1WAKA 4XBUA 2CDZA 4WIHA 5J87A 4ITHA 4MXCA 3BWJA 4WO5A 2WMBA 2BCJA 2JFLA 4WKQA 4ZTNA 3U9NA 3W2QA 4F7LA 4QMNA 2CN5A 2NPQA 3LAUA 3MYGA 3KA0A 3DU8A 3PWYA 4PL4A 4QQJA 3R04A 3NYXA 3UZPA 3DK6A 3UZTA 3CXWA 4G5JA 5AX9A 4ID7A 4QYEA 4U41A 5FBOA 4NKSA 2Y4IB 1W83A 5M4CA 3EQGA 3Q9WA 4D1ZA 5BVNA 2GNIA 2ZM3A 1PMUA 2BALA 2OJJA 3QD3A 4AE9A 5L6OA 4APCA 5FDXA 2XK9A 3BBWA 5JFXA 4MK0A 5HBEA 4BB4A 3LKMA 4XNEA 3FI3A 4XRLA 2QOBA 4ASDA 3Q4ZA 5I9VA 2XNGA 2PVJA 3CQEA 4DGOA 2BMCA 2JBOA 4JAJA 3TCPA 1M52A 3Q6UA 1ATPE 1JLUE 4O7TA 4L6QA 2O63A 4CKRA 4I0SA 5A9UA 2QODA 3COHA 3E8NA 5FQDC 2ZV2A 1APME 3HNGA 3IGOA 2E9NA 4L8MA 3R7EA 2FB8A 2UW7A 4NSTA 4PRJA 2RFEA 2WIPA 3FXXA 3RCDA 5L6PA 4RQKA 4D2RA 2BAKA 4OTWA 5AR7A 3MB6A 3FMEA 5E8UA 5TE0A 3WF7A 1SNUA 4RT7A 1ZMWA 2VTQA 4ACHA 4CFWA 2PMNX 3DK7A 3QKMA 3VQHA 3BWFA 2CMWA 4EC9A 4WT6A 3WYXA 5T3QA 3VWAA 4Z16A 5LXMA 1FQ1B 2ZYBA 2W5AA 2VTOA 4MBJA 2PL0A 1QCFA 3TUDA 2W99B 4FKVA 3ZSGA 4BTFA 3KMMA 2YERA 3D7TA 3QTQA 2XK8A 4FVRA 3L8PA 2VUWA 4GFGA 3RPVA 4WHZA 4YTCA 2VU3A 3FL5A 4X2GA 4FNWA 5KE0A 3T9TA 3O71A 4IVCA 3FZ1A 3VUIA 1PXJA 3L8VA 3HL7A 3EQCA 4U5JA 2WMVA 3WE4A 4AG8A 5AA9A 4QYHA 3DBCA 1KWPA 5IUGA 2CCHA 1MRUA 4CMTA 2UW6A 2O2UA 2A19B 3QYWA 4ACDA 5HI2A 1XH6A 5JSMA 4O22A 2YDIA 2O3PA 3D2KA 5AR2A 3DQXA 2YLFA 4EWQA 4FKWA 3DB6A 4I93A 2WZJA 5T68A 4I23A 3VUKA 4YO4A 3QYZA 2BIKB 1PF8A 1JOWB 3FMLA 1B6CB 5BYZA 3TWJA 2WTKB 4LRKA 1M17A 1MQ4A 4R7HA 3ZO2A 4FEXA 3UOLA 4FTJA 4ZSEA 4CD0A 2V7OA 1PXKA 4QNAA 2PE1A 2W4JA 2EXCX 4LMUA 1JKSA 1JBPE 2X8EA 2BRHA 3HAVA 5BMSA 3OS3A 4OBPA 4TYHB 3FLNC 5JGAA 4I5MA 4QMYA 4F65A 3OW4A 3RAHA 2A27A 2UZUE 3DNEA 4M69A 4MWIA 4GVAA 3F7ZA 3TTJA 4ALWA 3PSBA 4FOCA 4ANSA 2R9SA 4MD7E 3DK3A 4G1WA 3OW3A 4R7BA 4DGLC 2C3JA 3TEIA 4I5PA 4ZSGA 1VJYA 2R3NA 2EB3A 3QKKA 3FXWA 5E8WA 3FZRA 2VWBA 1J1BA 4QMTA 1UKHA 4QRCA 3GEQA 4L01A 5HE2A 3RPSA 4AZFA 4UXLA 3GBZA 5IA0A 1H25A 1O9UA 3CCNA 4IIRA 4ZTSA 4O2PA 3I7BA 1HOWA 2XIZA 3H0ZA 3ORKA 1H24A 3PP1A 4UWYA 4R6VA 5E7RA 2QG7A 4A07A 1YHSA 3A7JA 5AUWA 5JFVA 2YABA 2GQRA 4BCPA 5C26A 1UNHA 1PYXA 2WEVA 4U81A 2PZRA 4M84A 5JRSA 3EN5A 3OOMA 4ENXA 2QLQA 1ZYDA 2YAKA 4RX7A 5M55A 2PULA 4ACMA 2X2MA 2ITUA 3ZU7A 4A7CA 2ETMA 4BC6A 3LM0A 4LGDA 1YWNA 4YC6A 2R3PA 3NNVA 3IECA 3OXIA 3BEAA 5HG9A 3TV7A 1SVEA 4K2RA 2J9MA 5J79A 4J52A 1RDQE 4ZMFA 3GFEA 4R7IA 2HXQA 3NUSA 4FSZA 1H07A 4RFZA 3FKOA 1R3CA 5BYYA 1ZAOA 2PE0A 4JRVA 3F9NA 5E8YA 3ZCLA 3L8XA 5F1ZA 3K2LA 4G34A 3GT8A 4IDTA 4N6ZA 2C6IA 4FICA 2WTWA 4H36A 4Q9SA 3LFAA 4FYOA 2V55A 2EB2A 2ZVAA 4HZSA 2Q83A 3N4TA 5FG8A 4FV3A 3VJOA 3BLHA 3Q9YA 4FKGA 4CFMA 3QC4A 2XYUA 3CEKA 5EH0A 3OY3A 2Q0BA 1UU7A 4AP7A 4YHJA 3UOHA 2XEZA 4EHVA 2JIIA 3AC1A 4WBOA 4BRXA 1PY5A 4W4VA 2VNWA 3LQ5A 3PY1A 3BLRA 3M11A 4ZY4A 4EOOA 4FUYA 3TNHA 1Q8TA 2QR7A 4P4CA 4XEYA 3PRIA 4F9YA 5KMNA 4BZOA 3RPRA 2PUIA 4O21A 3UG1A 3PJCA 4GU6A 4IAYA 1YXSA 5IH4A 4PDPA 5DRDA 1CKIA 2YZLA 4O81A 1WBPA 5EOBA 3SGCA 4A9RA 3WZKA 3SW7A 4ORKA 2RKUA 5LMKC 2C6EA 4DFNA 1PHKA 1PXPA 1YXXA 4J7BA 1UWHA 2OJ9A 3QD0A 3U8WA 3VBYA 2HZ4A 3CPCA 3PJ2A 2XIYA 3MTFA 3VBWA 4O1PA 4KIKB 4F64A 4S32A 3SOCA 3ODZX 4LGHA 3F2AA 3PIXA 4OTRA 2XVDA 2C6KA 4OW8A 4Y8DA 3ZEWA 4U0IA 3I0QA 3PE2A 3KFAA 3DOGA 5FDPA 4LRJA 3P86A 1ZOEA 3EN9A 3F5XA 4KRDA 4UMPA 5IQBA 3UPXA 5GIPE 1GZKA 3WZEA 5AV1A 5LVNA 1H1PA 2F7ZE 3BHYA 4S33A 2HY0A 1PKGA 2HW6A 4FL2A 2WNTA 4RSSA 3SV0A 4YTHA 5B2LA 4NT4A 3GC8A 4G2FA 4UWCA 3Q96A 4RVKA 4GFMA 4UMTA 2J7TA 2V0DA 3C4FA 3F2RA 2HELA 3D14A 3JXWA 1GAGA 2IW6A 1SVHA 2YEXA 3MESA 4IM0A 2XCKA 4FIFA 3UC3A 4C58A 5D7AA 1A48A 4IMYA 4ZTRA 4AOIA 4DEDA 5J7HA 4B7TA 3Q52A 4QQTA 5D41A 4BKZA 4O38A 3TM0A 2ITTA 3GCSA 2HY81 3HV5A 4C3RA 2I7QA 3HVCA 3VVHA 4C0TA 4CFFA 4DHFA 2GNHA 4G31A 1Q8UA 4USEA 4IB0A 3RJCA 3HRFA 5A6OA 4X0MA 3LJ2A 3I7CA 4L68A 4RLKA 4D9UA 2JKOA 2WO6A 4GJ3A 3P9JA 3I5ZA 4FV7A 3RPOA 1GY3A 4CZYB 3Q9ZA 2VTIA 4D2TA 2XK7A 2R3HA 4PPCA 2V5QA 5IDNA 2WOTA 1NXKA 2WEIA 3HAMA 4C4GA 1ZYJA 2XYNA 3OF0A 4BCMA 4PNIA 3R9DA 5IZFA 4PDYA 5GIOE 3NYOA 1Q3DA 2VZ6A 5KMJA 3EYHA 5CSXA 3E63A 1WVYA 4JBQA 4I5HA 4FTCA 2XUUA 4HNIA 1OBDA 1T45A 4D4RA 2ETRA 1YDSE 5AUUA 3QLFA 2J50A 2WTCA 4QP6A 4AA0A 5DE2A 2IN6A 3F6XA 5AUZA 3FXZA 3M1SA 5KX8A 3O0GA 3OWLA 1RE8A 3D5XA 2PPQA 5IKWA 4E6DA 2XZSA 4U3ZA 5A6NA 2QHMA 4UMUA 3LCKA 1URWA 5J5TA 4YC8A 4M7IA 4FEUA 3TJDA 4F4PA 3ZS5A 2I0EA 5C03A 3GENA 3UJGA 5AP2A 3MJ2A 3THBA 5CAUA 2PVNA 4BHNA 4KSPA 3E64A 4AT4A 4CRSA 2G2HA 3LW0A 4FKLA 4TWNA 1NW1A 3PP0A 3KB7A 3ANRA 3GCQA 1CMKE 3FZSA 3KF4A 2B9JA 4MH7A 3RAKA 3FV8A 5DBXA 5BVEA 4JOAA 4RIXA 3DKCA 4RIOA 5CEIA 1G8SA 3O8PA 3BU5A 5IQDA 2XKCA 5BPYA 4IX6A 4RJ6A 5HVJA 1Q5KA 2PVRA 5IUHA 5L2IA 4W9XA 2VTNA 4X3FC 5M57A 4L44A 3QZIA 4WUAA 4EBVA 1Q8YA 2X4FA 2ZB0A 1UNLA 3A62A 1ZOGA 3LMGA 4FX3A 4K8AA 4RWIA 3UYTA 1QL6A 4KS7A 1Q24A 3L9NA 3QZFA 4O86A 4C4EA 2BTSA 1GIIA 4FSTA 4NFNA 4NUSA 4N57A 2QOQA 3IKAA 4H3QA 4I24A 5HE1A 3VIDA 4XP2A 4EBWA 3SXSA 2X2LA 2PWLA 4GVJA 4KB8A 5CSVA 3O51A 5HOAA 3G0FA 4J95A 4YJSA 3ZZWA 5KHXA 4IX3A 4IVDA 4HCVA 4IFGA 2J2IB 4LMNA 4CLJA 2OBJA 2BRNA 3PDTA 3TV4A 2R3MA 4XG9A 4Q9ZA 4DLIA 2ONLA 4AFJA 5CY3A 4OBOA 5F94A 2G2IA 2JAMA 4EI4A 4WOVA 3FMMA 2QQ7A 2XA4A 4AF3A 3R01A 5KKRC 3A99A 3VBXA 3U87A 3TNIA 2HYYA 2ITXA 1WBOA 4GU9A 4C38A 4BDGA 3CE3A 3OUNB 3Q4CA 5DEWA 3U51A 4EONA 5HTBA 1B39A 2P3GX 3CY3A 2A4LA 3JY0A 4KBCA 5FTOA 4CFXA 4DFZE 1BI8A 2BKZA 4O0XA 4HVIA 2WFYA 4D4YA 3ORNA 3AMAA 3A7GA 5HCYA 3OZ6A 4IZ5A 4AFEA 3LLAA 2E9UA 3R02A 1KE9A 3PTGA 4R3RA 3VUDA 4DFYA 4O82A 3AC2A 4IB5A 5CI7A 3P08A 3VS0A 4O0RA 4CYJA 4YO6A 3LFQA 3DTWA 4D4SA 1OKWA 1J1CA 2JDVA 2Z2WA 2UZDA 4KUJA 4FK3A 4KWPA 5J7BA 4FV8A 4UX9A 2B7AA 5DN3A 3S0OA 3A7FA 4KSQA 2B55A 4E5AX 4EOMA 1YWVA 3OCSA 3PY0A 3QCSA 3WARA 4BL1A 3UZRA 2FSLX 2YIQA 5DR6A 5J1VA 2QC6A 2FA2A 3VUTA 4IH8A 3AGMA 3HMIA 5I0BA 3V5TA 1TQPA 5HTCA 3HRBA 4FKSA 3LIJA 2VTSA 5AM7A 3OD6X 3EJ1A 1BLXA 4S2ZA 3LFEA 4BZNA 3DTCA 2XNPA 1XHAA 5AV2A 2UW0A 3RM7A 2ZAZA 4D2WA 4EC8A 4EHEA 1IR3A 4BGQA 2RG5A 5L2WA 4DH3A 2R3LA 1W0XC 3TACA 3S95A 5DYJA 3LXKA 2ESMA 3E3PA 3OOGA 3OXZA 4PUZA 3LFFA 4BCFA 3TL8A 4U79A 4I21A 3BHHA 5DT3A 4FE2A 1U46A 3KVXA 3ORZA 3E3BX 4XS2A 5A3XA 4DT9A 3AQVA 4F63A 4G3FA 3VUGA 3W16A 2GQSA 2YDJA 1SYKA 1Y91A 1GIHA 1Q97A 2OIDA 4QQCA 2HXLA 4PTGA 3DFAA 4KAOA 4UMQA 3KCFA 4CV9A 4DFLA 3TT0A 4FV1A 4UALA 3LQ8A 2XBAA 1Q41A 1Y8YA 4ZJVA 4FG9A 4UZDA 5EYKA 3I79A 4Y46A 5EYDA 2JBPA 4F1OA 3D5VA 5DI1A 4L7FA 4E5WA 4BBEA 4GSBA 5I9UA 2R7BA 4M0ZA 4AU8A 2P33A 5A54A 4XJ0A 5EYMA 4FT3A 3QZHA 1I44A 5EI6A 2G1TA 1KE5A 1FMOE 2YWPA 3G9NA 2WB8A 4IJ9A 3MI9A 5EM8A 5TT7A 3FZTA 3L9MA 4GMYA 3W33A 3NAXA 4FSUA 4BIBA 1G5SA 3LM5A 4CQEA 3WILA 4HZRA 1OUKA 5E4HA 1YXUA 2YIYA 5HTIA 2R0UA 4O0WA 5L8LA 3PSCA 2PE2A 3SXFA 3DGKA 1ZY5A 4CCBA 1HCKA 1H27A 1ZMUA 3BE2A 4R5SA 4PMPA 3OEZA 4RFMA 4Y72A 2ETKA 4LV8A 2X39A 3FLWA 4AOJA 4FV6A 4TWCA 4U97A 5EFQA 4AZVA 4FZAB 4M0YA 2RGPA 4Q5EA 4EH4A 4QPMA 1W84A 1U5RA 4YLKA 2NP8A 4FSWA 2P2HA 2C3IB 4PWNA 2CNQA 4M67A 3W2CA 3B8RA 5EI2A 3TV6A 4AW0A 2QKWB 3MPMA 5BVKA 3W18A 4C4JA 3HUBA 3FYKX 5L4QA 3H30A 3AC4A 3M42A 5C9CA 4AOTA 5CALA 5B0XA 4G6LA 4F1MA 4CKIA 2UVZA 1YDTE 3AOXA 2UW4A 3IQ7A 2BHEA 2H9VA 1Z5MA 2YFXA 3KK9A 2OFUA 3MPTA 5ANDA 5ACBC 4ZZOA 4RQVA 3O23A 4DE4A 2GFCA 4FG8A 3TIZA 3S00A 2J0JA 4EH5A 1DS5A 2XJ1A 1Q3WA 3K3IA 3P7AA 2QI8A 5E8XA 2XS0A 3RK7A 1PKDA 2V62A 3A8WA 4FVPA 5JT2A 3FYJX 5B2KA 4ZLYA 3QUDA 1A9UA 3JUHA 1Q8ZA 5LMBA 3T8OA 3ZRLA 4BBFA 2IW8A 2XIRA 1WFCA 2QLUA 5KCVA 3LFNA 3BQRA 4F9AA 4QP7A 4JNWA 3WZJA 1SZMA 4ENYA 4FT5A 3MFTA 4XG6A 5EQPA 3C0GA 3OXTA 4QPAA 4JG8A 4YBKA 2W9ZB 2C1AA 3MVHA 4PQNA 3QTZA 3ERKA 4IM2A 5LVLA 2H34A 4CFVA 4R3PA 1YOLA 4XH6A 4Z3VA 2UVXA 4FKUA 1YXTA 2QR8A 4GG5A 4I6HA 4UY9A 3IONA 3UDBA 5IQHA 3CQUA 4XOYA 4EQMA 2CKPA 3H4JA 3POZA 4ZSJA 4FV0A 2F9GA 2WMAA 4NTTA 5I3OA 3G9LX 5H9BA 4L53A 4TZRA 4PTCA 4K11A 4U80A 3POOA 4R3CA 4RVTA 3SQQA 1KUTA 1MP8A 1YDRE 4IAFA 3BYVA 2OH0E 3GCPA 3OCGA 3S3IA 2B52A 3N4VA 3OT8A 2WMUA 3V5QA 4D28A 1QPJA 2H96A 1ZMVA 5CF4A 1V0BA 5EDRA 1Q8WA 4U9AA 3TNQB 4S34A 3BV2A 4O0SA 4IC8A 3MDYA 5ETCA 3W2SA 4FGRA 2JIVA 3UOKA 5H8BA 2C6TA 3KN5A 3DBFA 5I9XA 4U42A 1Y57A 4XLVA 4KIOA 3NDMA 4XLIA 4IX5A 4FK6A 3OTUA 4H39A 3OP5A 2B9FA 5DT4A 3A2CA 2YAAA 3SLSA 1YQJA 5M51A 3BYMA 1ZYSA 3ZH8A 4GRBA 3R7VA 4F0GA 4LOOA 2W96B 3U6JA 3VBVA 3GGFA 3K54A 5E8SA 5IA5A 3VW6A 3TKIA 2UW8A 1YXVA 2YN8A 5JQ5A 2VTJA 2QD9A 3CKXA 2RG6A 3RWQA 4FKRA 4Y83A 3RPYA 4B8LA 1V0OA 2RL5A 4N6YA 2ZMDA 4XG2A 5CEKA 4FSYA 4MQ1A 2XJ2A 2R3RA 4A4LA 4AGUA 3EOCA 2ITVA 2XM9A 2PVHA 3KQ7A 4FZDB 2WELA 2VGPA 2VWUA 4TYIA 4EK8A 5M07A 1OZ1A 1K3AA 3NYVA 4YU2A 1MRVA 4YZBA 4YSMA 3RWPA 4LM5A 3PY3A 3WI6A 2YA9A 3AT3A 3HRCA 4J8MA 5LQFA 2CSNA 3ATSA 3HMOA 3G6HA 4EOIA 3TZ9A 4RRVA 4DGMA 4K6ZA 4MXAA 4BDIA 2OWBA 1DAWA 2SRCA 3V8SA 4P90A 1YW2A 5A4TA 3PA5A 5KHWA 2Q0NA 5HG8A 2YJRA 2WTIA 5LCJA 4BY9E 2IZRA 4C36A 4CFUA 3HV7A 3KGAA 5EYCA 4Y5QA 2X9EA 3R28A 3RALA 3LXPA 4N70A 4YJVA 3G15A 3CC6A 1E1XA 5HQ0A 5HZNA 4CMUA 3ZO4A 3ACKA 3CR0A 4GV1A 5K4IA 3DXNA 4GUEA 3SRVB 1SMHA 3C4WA 2FO0A 2GTMA 3PVWA 4YNOA 5DWRA 1IAHA 3BYOA 2QURA 5FWKK 4B6LA 2VX1A 4JT3A 1WBWA 5LVMA 1OM1A 4FNZA 5B7VA 4F0IA 2OLCA 4R77A 5FUTA 5EHYA 4D2SA 5LMKA 4IEBA 2WTDA 2QOIA 3MGYA 5KMKA 5ANOA 1VYZA 2OJGA 3GXLA 4GK4A 4NFMA 4C4FA 4A9UA 4GJ2A 3WIKA 2IVVA 5H2UA 2WMTA 4U44A 1PXMA 2VTLA 4NJDA 4FF8A 4BDDA 3NR9A 2BILB 3QWJA 2YM6A 3UNKA 3C5UA 2O65A 4IXPA 4WRGA 2G01A 5FM2A 2ACXA 4ZY6A 3U6HA 2W1DA 3LXNA 3AXWA 1BKXA 4IDVA 1XH4A 4BBMA 2ZB1A 2V22A 2HZNA 4IADA 5BUJA 2W0JA 3QBNA 5LARA 5CAPA 3D5UA 3FE3A 3SG8A 4IAKA 2ZMCA 4RJ3A 3DXQA 2VX0A 4HCTA 3ZXTA 3EQFA 4O7WA 5C4KA 5I9ZA 1E1VA 4JBVA 2W5HA 5DOSA 5AR4A 2BROA 4AT5A 3MVJA 2OG8A 2QG5A 1S9JA 3R1YA 4RVMA 4E26A 2EVAA 2PUPA 2WIHA 4F9BA 3DBEA 4DAWA 2BDJA 1H1WA 2PMLX 3IW4A 4PDSA 4RJ5A 4I6QA 1CM8A 3VQUA 5IA2A 4X2JA 4EUTA 3OFMA 3DAKA 3R21A 3R6XA 5AAGA 3R9RA 4S30A 2QOLA 3MFUA 4IWDA 2VD5A 4WNOA 4II5A 3SOAA 4R1YA 3VS1A 2OH4A 3SC1A 5GJDA 2IW9A 4J8NA 3ZLXA 1XJDA 3TNWA 4BCQA 3NSZA 4FGBA 2RIOA 2PK9A 3PRFA 3QCXA 4OBQA 5DVRA 4WG4A 5HORA 3R7OA 4YJRA 4YZNA 3L8SA 3QX4A 4E5BA 4TRLA 5CX9A 3OWJA 3W2PA 1GZNA 2QOFA 2GQGA 4UYNA 1ZLTA 3UBDA 2OGVA 2WMRA 2X9FA 5K0KA 1B38A 2PHKA 1XBBA 4LYNA 3MTLA 3D7TB 1OB3A 5GNKA 4DTKA 3FPQA 1PXLA 5ANKA 4E93A 3JPVA 3VS2A 3TDVA 5GHVA 3VJNA 3GOKA 2XRUA 4BCNA 5E90A 5M08A 4P7EA 3GNIB 1OIQA 2VO3A 4C2WA 3WF6A 2WQNA 3FHRA 1XR1A 4PPAA 5AAEA 3UOJA 2VGOA 3TKHA 2F7XE 5FLFA 3ZO1A 4XV1A 2ITNA 4E4XA 2NO3A 5CU0A 3QC9A 3P78A 5EHLA 4F1TA 2UZLA 4QMMA 1R0PA 3IW6A 3VRYA 3LHJA 4IB3A 4GH2A 3MH1A 4ZOGA 3ZLWA 4ACGA 4EH6A 3I5NA 4Y95A 3ATTA 3BHVA 4WA9A 4YC3A 3R7GA 2XCHA 5CU6A 5J9ZA 1WBNA 4XYFA 3OG7A 2HWOA 4YZDA 1IASA 3EFWA 5IQGA 1PXOA 3AT2A 3S2PA 2FH9A 5AIRA 4BGGA 4FKJA 3KKVA 5CEPA 3PA3A 4TN6A 2Y4IC 3HDNA 4BF2A 4Z7HA 5EOLA 4X6RA 3P7CA 5HO8A 4X2KA 4JG6A 4JX3A 2VN9A 5HHWA 1ZYLA 3Q32A 1OVEA 2XRWA 4RA4A 4X2NA 3DPKA 3UNZA 4FIIA 4M69B 4IC7A 2GS2A 4OTGA 4X3FA 1WCCA 1DI8A 3LE6A 2R0IA 3NGAA 3ORTA 1QMZA 3GUBA 4U43A 3R1QA 5L2SA 3RHKA 3TXOA 2OJFE 2PMOX 4LL5A 3EQPA 4GCJA 3UYSA 5I3RA 4TNDA 3C4CA 4DTBA 4FT0A 2GNJA 3NUYA 4FUXA 4DN5A 4YZ9A 3OBJA 3D5WA 3MH0A 2UZVA 3AD5A 4IBMA 1DAYA 1IA8A 4FKIA 5ETIA 2F4JA 4ZSAA 4O91A 4QYGA 4F7NA 2WU6A 3GU6A 3C5IA 3C4XA 3DZOA 5IEYA 2YHVA 3L9PA 4QP2A 1P2AA 5K3YA 4RIYA 3G2FA 2OZAA 3LFDA 3SKCA 2BZIB 3D7ZA 4ITIA 3WF8A 4EOLA 3RMFA 2Z7RA 1YOMA 2WQBA 2UZNA 3MFSA 4FODA 4CCUA 3IDCA 3QD4A 4K0YA 3IPHA 5E1EA 3EB0A 3GC0A 5HCXA 2P2IA 2OF2A 2FSTX 1BUHA 3QGYA 4RWJA 2F2CB 5KMIA 2IZUA 2EUFB 3TKUA 3C1XA 4AA5A 4RWLA 3C13A 4K18A 5ANEA 3RCJA 2GU8A 2Y8OA 5K5XA 5DMZA 1TKIA 2QHNA 5IUIA 1ZWSA 3NNWA 5ANGA 3ENHA 4MEDA 3R71A 1V0PA 2EWAA 3PIYA 3PG1A 3VS6A 3D9VA 4P2KA 3FWQA 3ZFXA 4TXCA 4BYJA 4EORA 5J9YA 4G16A 2JDTA 4NJ3A 4P5ZA 3UQFA 1M2PA 3NS9A 4O6LA 5BYLA 4B99A 4EOQA 2WD1A 4IACA 4J53A 5LVPA 2PU8A 2OIQA 4HNFA 3E7VA 3OTVA 5C8NA 3NNXA 2RFSA 2DQ7X 2NRUA 2WTKC 3BBTB 5EK7A 1YKRA 2CLXA 4BDEA 5HD4A 2IPXA 3EKNA 1ZARA 2J0MB 4FIHA 5F95A 3ULZA 1M2QA 4Z9LA 1OPJA 2RFDA 4UN0C 3PUPA 5HO7A 4BCGA 1Q99A 1ZOHA 1M14A 3EN6A 4MQ2A 3OBGA 2O64A 3DA6A 2Y4PA 5CSPA 2Z7QA 4FTOA 2YM7A 1OBGA 4BDAA 5L8JA 1PJKA 1RJBA 1R0EA 4ACCA 3F3ZA 5GZ8A 4RLLA 2F2UA 3RK9A 4QP9A 3D2IA 5HX6A 3V6RA 3UMXA 4GUBA 4BIEA 3D15A 4KKHA 1FINA 4DGGA 3TUCA 3MB7A 3HV4A 2QOCA 3QTIA 3VS5A 2J5FA 2ITQA 4G9RA 5AR3A 3R8LA 2QO9A 1MUOA 3ORMA 3ZFMA 3LVPA 1NT2A 4BI1A 2XNBA 3U9CA 4GS6A 5JQ8A 4YTFA 4BI0A 3ZM9A 1H4LA 3PJ3A 3FQHA 1YVJA 4QMPA 4NZWB 3V51A 4BWKA 3NVMB 3ZRMA 4E7WA 3H0YA 4NW6A 3MH2A 5J8IA 2IG7A 3AGLA 1BI7A 3PYYA 5KO1A 2I1MA 3F66A 1VYWA 4EOJA 3E8CA 3I4BA 3OT3A 1WZYA 5EW8A 5FXQA 5AAFA 3BYUA 4YGAA 2ZV9A 1UKIA 2VTAA 2WTVA 3EN4A 3AMBA 1NVQA 3ZHPC 4C62A 3UIXA 5GJFA 1VZOA 3VUMA 4PP9A 3EFKA 2WGJA 3CY2A 3CGOA 4FZFB 4KKGA 5DT0A 4TKSA 2WQEA 5BVFA 3II5A 4AE6A 2O5KA 5HU3A 3DXPA 5HICA 3PFQA 2HZIA 4XX9A 2B4SB 1Y8GA 1YHWA 4MXZA 3RI1A 5JK3A 4U8ZA 5AP0A 4EH8A 2YIWA 4TNBA 3HX4A 3P1AA 2C5NA 4ALUA 4ZMEA 2FVDA 2H8HA 3BZ3A 2YZAA 3DB8A 2C5OA 4MBLA 5LWNA 4OTIA 2XH5A 2WPAA 3TN8A 3VNTA 4CTCA 2FUMA 2ERZE 2ITYA 3BYSA 4IE9A 4EQUA 3DDPA 1REKA 4CT1A 3CD8A 3UO5A 4NM3A 3FEGA 4LQMA 1VEBA 4U7ZA 4V05A 4FSQA 4PMTA 3I0OA 1P14A 4FR4A 2HZ0A 2QVSE 2X1NA 2XMYA 2OK1A 3R22A 3VBQA 2C6LA 3ZC5A 3QHRA 2W1IA 1KE8A 3NUXA 5HIDA 2I6LA 2X0GA 3R7IA 5A4EA 3VS7A 3Q4TA 5FGKA 3DAJA 4CNHA 5CANA 3G5DA 4EL9A 2ERKA 4IW0A 4RIWA 2BVAA 3QTRA 4FT7A 1IG1A 4PDOA 3IO7A 4JI9A 3E87A 4QMXA 4QMSA 4IVAA 4DBNA 3UO6A 3PXKA 3TIYA 4YHTA 3RVGA 3W2RA 4EKKA 4ANOA 5CASA 2GCDA 1OPKA 2ZOQA 3EFLA 4FTTA 5D12A 3EKKA 2PVMA 3BU3A 4AX8A 3CD3A 4FOBA 2GDOA 2YCFA 3DZQA 3EQBA 3NW7A 3Q2MA 5D1JA 2XK4A 4AWIA 4J71A 5C27A 4JQ7A 4XP3A 3FDNA 5CVFA 3VC4A 5H8EA 5H8GA 3IDBA 1OI9A 3CLYA 3G33A 3UQCA 4CGAA 2VTPA 2YCQA 1M2RA 3ETAA 2F7EE 4JX7A 3QQGA 4RIXB 2I0HA 5L6WL 4Y5HA 1U54A 4PNKA 4PTEA 2WHBA 3EZVA 3A4OX 3LJ0A 4DG0E 5KNJA 4FKQA 4WG5A 1A06A 1WVWA 1PW2A 4IAZA 3OROA 5L3AA 2OXXA 1TQMA 1OMWA 3PPZA 4EZ7A 1YHVA 2PZIA 3KRWA 3R1SA 3QALE 4ANBA 2BRBA 2ITPA 4RIWB 5AIKA 3ZUVA 3JYAA 4L00A 5J95A 5AJQA 1U4DA 2BDFA 2XM8A 5CSHA 4ZIMA 3P4KA 4FC0A 3HP5A 4QTDA 3DBQA 2REIA 4JLCA 3LFBA 1PMEA 1KOAA 2Z60A 4MD8E 3V5LA 5LJJA 1H0WA 3V8TA 3TUBA 4K33A 5DG5A 3SDJA 3CPBA 3PIZA 1H0VA 3EQHA 4KINA 4WSYA 4GIHA 3W1FA 4GK3A 2YISA 3Q5IA 1OITA 2C68A 4FSRA 4R5YA 4WNKA 5AUXA 5T6KA 1YI3A 4MNEA 4HGSA 2UV2A 4IFCA 5JFSA 4A06A 4RG0A 3F3WA 4U40A 4AN2A 5CNNA 4AW2A 5HIEA 5KBQA 2C3KA 4KKEA 5BVDA 4KIQA 2C30A 3MWUA 3PXYA 4APPA 3IOPA 3Q3BA 4RX8A 2C69A 3H9OA 4QMUA 4QYYA 4U45A 2YWVA 4QMVA 3NNUA 3QQLA 3ZM4A 5EQEA 4HGEA 3RINA 3O50A 4BTJA 4W4XA 3ZSIA 4YNEA 3DCVA 1J3HA 3RGFA 5HIBA 2OIBA 4OAVB 4NM0A 4CVAA 2J0KA 3W8LA 2IVSA 3BHTA 4J99A 3E5AA 4L3JA 4A9SA 3N4UA 4GKHA 4O7RA 4DLJA 1URCA 1PYEA 3QXOA 4B0GA 3QRJA 3PPKA 4I0RA 2IVUA 5EDPA 3EYGA 4CKJA 4EOPA 2OFVA 3E8EA 3FI8A 2C3LA 4GYIA 5M56A 4YPSA 3QRUA 4XUFA 4FZ6A 5G1XA 5E8VA 4LUDA 4ARKA 2XNOA 4HOKA 3PA4A 1IRKA 1XH8A 4JQEA 2Y6OA 4RGJA 4CXAA 1Q4LA 5AP3A 2OXDA 4DFBA 1U59A 1W8CA 1ZXEA 3GC9A 3IDPA 2VTMA 4ZTQA 5C8KA 2WMQA 3ZUUA 2HWPA 2B53A 4O7LA 4UMRA 2UZOA 1OIUA 3BU6A 3DKOA 4YBJA 4FL1A 4FEWA 2F57A 3W2OA 4AACA 2J51A 3NIZA 5FTGA 1RW8A 1P4FA 4F9CA 4MNEB 3I6UA 5EKNA 3HV3A 4IX4A 2JIUA 4FEQA 1YI4A 2R3KA 3R0TA 2LAVA 3QTXA 2B9HA 2XBJA 2IO6A 5D7VA 3ZBFA 3QU0A 5A46A 5IF1A 4ZLZA 3CQWA 3BI6A 3NAYA 4OTFA 2CNVA 3G51A 5KMOA 4EUUA 5KUPA 4IHPA 3TI1A 2XJ0A 4BWXA 4RJ7A 2VRXA 4BTKA 4MWHA 5GZ9A 5CXZA 5F9EA 4QD6A 2BIYA 1WBVA 2C5XA 5AA8A 4BN1A 1GZ8A 2NNWB 3MJ1A 4QTBA 2WU7A 4ZTLA 5HESA 3WZDA 4L45A 1Y6AA 2EXMA 3ZMMA 4Y73A 4QMQA 2KTYA 2XNEA 2KULA 5HD7A 1OECA 4JJRA 4IQ6A 2UUEA 3LCDA 3FAAA 4FV2A 3QF9A 3GVUA 2W17A 1KE6A 3R2BA 1OKYA 2UZTA 5D11A 3GB2A 2OZOA 3F5PA 1W98A 3PVUA 2OKRA 4RWKA 2VTTA 1L8TA 2W1HA 5EDQA 3TZMA 3FY2A 4CSVA 2VWZA 4AZTA 4O2ZA 5M53A 2JITA 4F6UA 3QX2A 4F7SA 2X7FA 2IWIA 3ORXA 4G3CA 2AUHA 2PY3A 4KD1A 2BR1A 4IVBA 4L42A 2JKKA 1REJA 2FYSA 4E6QA 2GHGA 3ZLYA 4I3ZA 5FP6A 2J6MA 4NK9A 1OL7A 3LFSA 3BGQA 3Q04A 4CG8A 3QD2B 1H26A 3F82A 1ZZLA 3EFJA 4CMOA 3NIEA 5EM5A 5J1WA 3KRLA 2BRMA 3P23A 3RM6A 3FJQE 3K5VA 4C3PA 2XB7A 4D5KA 2XIXA 2ZDTA 4BDFA 4YJOA 5DEYA 3NYNA 5K5NA 2J0LA 4C4IA 2DYLA 1H1SA 3HGKA 4PL3A 3VHEA 3ZDUA 4ANQA 5TO8A 4ZS4A 3Q2JA 5CLPA 3FLYA 4AAAA 5JMSA 2YIRA 4U3YA 3QLGA 4BKYA 2Y7JA 1LUFA 1UVRA 5ANJA 3MY5A 4NIFA 3BGZA 5CEQA 4BCOA 3AG9A 5M09A 3COMA 4M13A 3NUUA 1Y6BA 4MAOA 3EIDA 3NUNA
chains in the Genus database with same CATH superfamily
3UP7A 4BCJA 4S31A 3R8PA 4F70A 3O17A 3A61A 2G15A 1R39A 3KULA 2C1BA 3MFRA 3QTSA 4J98A 3WOWA 1K2PA 1EH4A 3QQKA 5CI6A 5HKMA 5BNJA 2GHLA 1YWRA 3AC8A 3C9WA 1TQIA 3MY0A 4GL9A 4TT7A 4NWMA 5CF5A 4EK5A 4B8MA 1XBCA 4L9IA 3BEGA 3R83A 3KREA 3RKBA 5CF8A 4A9TA 3W0SA 4FEVA 5FXRA 2A0CX 4QP8A 4IWOA 2QKRA 1Q62A 2IVTA 3FI2A 4BHZA 4EWHA 1OGYA 1PMVA 3BE9A 4FTMA 5DHJA 1OL6A 1GZOA 1UU8A 4KABA 4I4FA 3JY9A 4FZ7A 3U4WA 5HVKA 5CAQA 5EHOA 4C59A 1CTPE 4R1VA 3MIYA 3FMHA 4EOKA 3CKWA 3UDSA 4O83A 2JEDA 3NRMA 3B8QA 5BUEA 2QOHA 3VS4A 3IW5A 5AR8A 3PXFA 3NEWA 2NRYA 2YDKA 5IEXA 5CYIA 4NIFB 4I41A 1RQQA 2J4ZA 4O6EA 5CWZA 1CKPA 3GI3A 4USDA 2AC3A 3K3JA 4E8AA 2W1FA 4I0TA 2BZHB 1BL6A 1H01A 2GHMA 4E20A 1GIJA 3MVLA 4A4XA 2XP2A 3EQDA 5CT0A 3V6SA 3QQFA 4JR3A 5FRIA 2VWXA 4MKCA 4D4VA 4ERKA 3C4ZA 5EQYA 3KULB 1CDKA 1XQZA 4C02A 4QP1A 4DEHA 4JIKA 3PXRA 3RNYA 4UZHA 4HYUA 2GTNA 4F09A 4HVDA 3R63A 1XH7A 2GMXA 4OGRA 3R9OA 2XANA 3CBLA 4JDHA 4YJTA 3VRZA 3V01A 1F3MC 5CS6A 1Z9XA 4D9TA 4O84A 1M7NA 2XF0A 4O0UA 4RA5A 4GT3A 2QCSA 3COKA 3F7WA 3DJ6A 1UU3A 4DF3A 3ZDIA 3C51A 2ITWA 3HYHA 4W9WA 4XV9A 1WVXA 3QL8A 4MCVA 3V5WA 3W8QA 2PUUA 4YLJA 4YPDA 4OT5A 5IA1A 2PVYA 4BKJA 2ITZA 3UG2A 2UZWE 4JDJA 3F3UA 4M68A 4WSQA 5F20A 2PZ5A 4FTQA 2BZKB 4AN9A 1JKKA 1BL7A 1FVVA 4EYMA 3D94A 1G3NA 3EH9A 1HCLA 3BQCA 3DJ5A 3UC4A 4ASZA 3KC3A 4CYIA 1G8JA 5JEBA 3CJGA 5J5SA 3RZFA 2Y9QA 3E93A 5CVHA 3PJ8A 4AS0A 4NYEA 2B54A 3AC3A 2QO7A 3TDWA 1KSWA 2PVLA 3DAEA 2JKMA 3RBWA 1AD5A 4X3JA 4FIGA 2OI4X 3PPJA 3HP2A 4L46A 4V0GA 4X7QA 5E1SA 4TTHB 5TF9A 2JDSA 4EEVA 3KU2A 2C6OA 3QTWA 5AEPA 3EQRA 1U5QA 4ZK5A 4D2PA 3VULA 4RZWA 3VBTA 3HLLA 4ANMA 4FV9A 4Z7GA 3S1HA 1XMMA 1JSVA 2A2AA 3UTOA 4GYGA 1H1QA 2WXVA 4IWQA 4FKPA 4FT9A 2P0CA 5HG5A 5HNBA 1R78A 3OCTA 4WUNA 5EM6A 4DEEA 3R9NA 3SD0A 3BHUA 5M06A 2Z8CA 4YLLA 5AUVA 3UIBA 3R7UA 3ROCA 3PLSA 3QAME 4JRNA 4PPBA 3TZ7A 3COIA 2GSFA 4E6CA 5BX0A 3VAPA 1UA2A 4XCUA 2V7AA 3P5KA 2XKFA 5AX3A 3K5UA 4M15A 5ITAA 2IJMA 4F08A 2RF9A 3WF5A 4D1SA 4JDIA 3WZUA 3CJFA 3A4PA 3IW7A 3LCOA 5JZNA 4F6WA 3U6IA 4AUAA 2ZJWA 1SVGA 2X7GA 4M14A 3AD6A 3EHAA 3V8WA 4ZEGA 5IG1A 3UNJA 4B4LA 1FVTA 4E4NA 2OW3A 4BCIA 3ANQA 3O8TA 4G3GA 2EXEA 3VHKA 3CSVA 1BX6A 1UU9A 4JDKA 5AV3A 3ZBXA 2R3JA 4I6FA 4V0GB 3EZRA 3BKBA 3WYYA 4QTAA 1FVRA 4RX9A 2AQXA 3NW5A 4W4YA 4AGCA 2WMXA 4X2FA 4CZUA 4WD5A 4AN3A 2CNUA 3LCSA 5KZ0A 4BDCA 3LQ3A 3MY1A 1WBTA 2G2FA 4HW7A 3NPCA 3V5PA 4CZTA 3AD4A 2JLDA 3L9LA 4TYHA 4ZSLA 2E9VA 4L3PA 1KV1A 1JKTA 2O0UA 3FY0A 4FSNA 4RBLA 4XG7A 5DA3A 5BMMA 5HBJA 4DA5A 5A14A 4NTSA 3IW8A 1NVSA 2WQOA 2E9PA 4FTIA 4ZAUA 2CHLA 2DS1A 4K9YA 4CRLA 4AT3A 5I9WA 3PVGA 4W8EA 4DC2A 1H28A 5HLPA 2ITOA 3ET7A 3KN6A 1SM2A 2CGXA 3SHEA 3SX9A 2UW3A 3P0MA 5IQAA 2YACA 3LOKA 4MX9A 3HUCA 4YZMA 4JG7A 4YJUA 3UVQA 4ZZNA 4HJOA 4TY1A 2Z02A 4XG4A 2VWWA 4FIEA 3UO4A 2QOOA 5FP5A 3V04A 3LLTA 2RSVA 2GPHA 3FC1X 1T46A 4F6SA 5TR6A 3ZFYA 3ZO3A 2PZPA 2ZM4A 4BFMA 2PVFA 3IS5A 5EW9A 4QNYA 4B9DA 1J91A 1FPUA 1ZY4A 3UIMA 5HU9A 4C2VA 1QPCA 2W06A 2BZJA 3F3TA 4NH1A 4W4WA 4E3CA 4ZP5A 2H6DA 5E8ZA 3TZ8A 2X81A 5BVWA 2VV9A 2ZM1A 3P79A 4PP7A 5CQWA 3RAIA 4L67A 3FMJA 3DLSA 3ALNA 5IQEA 3QHWA 4H3BA 4JVGA 3GFWA 4DEAA 5F4NA 4NL0A 5GZAA 2R3IA 3UP2A 3FI4A 4TL0A 2UW9A 3B2WA 3F5GA 4C4HA 5JN2A 3I6WA 2W5BA 1YRPA 3RK5A 2WOUA 4BWPA 3R7YA 1WMKA 1NA7A 1J7UA 1ZYCA 3QGWA 3G0EA 3W32A 5EI8A 2XKEA 4KBAA 3FBVA 3R00A 4O7NA 4LV7A 3ULIA 4JQ8A 4C8BA 3B2TA 2A1AB 3DLZA 3DJ7A 3MA6A 2VNYA 4G3EA 4D2VA 1PXIA 4Z55A 5CEMA 5ICPA 5CU4A 4UBAA 4DH1A 2CLQA 1ZRZA 3T9IA 1KOBA 4FRFA 4ZTMA 2CJMA 2HW7A 3IOKA 4LFIA 3UMWA 5HX8A 5L8KA 5IQCA 4LGGA 5AV4A 5AWMA 4ZS0A 3UIUA 4NKAA 2I40A 3HDMA 4IZ7A 4QMOA 2C0IA 2CGUA 3MIAA 5DLSA 4JS8A 4ZXTA 5LOHA 3GQLA 4MF1A 2ZV8A 3RAWA 4J96A 2XNMA 1J7LA 4EKLA 4O0TA 4O0YA 1CKJA 4IM3A 4NCTC 5JGDA 1OKVA 3QRTA 4H58A 4H3PA 3PZEA 4JXFA 4QO9A 4OT6A 4MXYA 5E92A 3R8VA 3ZEPA 3ZUTA 4O4DA 2JDRA 4KIKA 4AZWA 3LMHA 4D0WA 4QP3A 5AP4A 1F0QA 2WMSA 3MS9A 4N0SA 4O96A 3KCKA 3QUEA 5AV0A 3GC7A 3TTIA 4ANNA 4O7VA 3R8UA 5FEEA 3OHTA 2PSQA 1H8FA 4DGNA 3NW6A 1H1RA 2PZYA 4O1OA 3O8UA 4FMQA 3KXNA 4O7YA 3QQUA 2R3FA 4C33A 4JBOA 4OTPA 1R1WA 4FVQA 3ZTXA 4D1XA 5HBHA 2OXYA 3F2NA 5IISA 3FHIA 2BRGA 3DBDA 4X3FB 4YP8A 3QUPA 3R9HA 3RNIA 5HE0A 4BTMA 1MRYA 3OY1A 2W9FB 4KNBA 4YHFA 4PY1A 5HGIA 2X2KA 4MNFA 3ELJA 4FTKA 3SVVA 2UZEA 1FMKA 4QMZA 3DFCB 3R8ZA 3VO3A 2BTRA 5IMEA 3PZHA 4RVLA 4G5PA 4EZ3A 1GOLA 5B2MA 3FMDA 4RX5A 4DT8A 5C4LA 2C5YA 2W05A 3F88A 5JZJA 4DITA 4YMJA 4TYJA 3VF9A 4USFA 4N4SA 4QQ5A 3FZPA 2C4GA 3ALOA 3FLQA 4WBBB 3MV5A 4QT1A 4RIYB 4C7TA 2OZAB 3DT1A 3BIZA 3HMPA 5KKRB 2HK5A 3GP0A 5LWMA 3Q4UA 1IEPA 1XMLA 4RPVA 4KA3A 4PL5A 4BDKA 4J1RA 3LFCA 4EZ5A 3NLBA 4LOPA 1H00A 3H9RA 3T3UA 1S9IA 3A60A 1JKLA 4DINA 2QO2A 4E1ZA 1G8AA 2HAKA 3NZ0A 3HEGA 4FIJA 3DV3A 4AW1A 5IU2A 4ASXA 4NM7A 3KVWA 3ORPA 3PVBA 4AXFA 5AR5A 4TWOA 5IH6A 4EH7A 2X8IA 3ZZEA 1KV2A 1MQBA 2OSCA 2G9XA 4NEUA 5HO6A 4DH8A 1H08A 3MVMA 5ACKA 2R3QA 4GT4A 3QQJA 4RFYA 1FGIA 2UZBA 4W8DA 4O7SA 1YOJA 4UWBA 4H1MA 5DIAA 4OTDA 4CT2A 3KF7A 5JKGA 2QU5A 3A7IA 2CKQA 4E4LA 2DUVA 3A8XA 4FTNA 3T3VA 5BVOA 3QFVA 2R7IA 4GIIA 5AFVA 4GFOA 2OO8X 4HCUA 4XRJA 5CZIA 3NX8A 3ORLA 1IA9A 4QP4A 4ITJA 4DEGA 5AUTA 4DH7A 3PLAE 5E9EA 3F3VA 4QYFA 3ZLSA 2R2PA 3HMNA 3QKLA 3ENMA 4DG2E 5JFWA 1WBSA 3R2YA 4BVUA 4JAIA 3D0EA 3F69A 3FPMA 3C50A 3V3VA 1IAJA 2JDOA 3GCUA 4EH9A 3FMNA 3E92A 3TJCA 3NMUF 1SNXA 2XIKA 4D0XA 4I4EA 1Z57A 3LJ1A 3H10A 4Y85A 3G6GA 4MTAA 2JC6A 3KMUA 3QA8A 4PX6A 2RFNA 4M12A 3GU5A 4RMZA 4WRSA 2R3OA 1JVPP 3TG1A 4HVSA 2QNJA 3MSSA 4L43A 3IGGA 4JIAA 4E4MA 5DH3A 4TYGA 2VAGA 2P55A 2GS7A 2CN8A 3PWDA 2FSMX 4QOXA 5IDPA 3BX5A 3W55A 3I60A 4BI2A 4R8QA 2R5TA 2CPKE 2J0IA 3QA0A 4CLIA 4XOZA 5DRBA 2E9OA 4IZAA 3O96A 5E8TA 2R64A 3EWHA 4QTCA 5FTQA 4DCAA 3FUPA 2JD5A 1W2CA 3OVVA 3VS3A 5IQFA 5M44A 4G6NA 4ALVA 3GU7A 2IZSA 4LUEA 4IANA 1LEZA 4L52A 4CV8A 5HVYA 2HOGA 3O7LD 2C5VA 4HYIA 3R1NA 3NUAA 2CGWA 4EYJA 5K4JA 4JR7A 1XH9A 5AM6A 4C34A 3ZXZA 2I0VA 5DGZA 5FD2A 2W1CA 3G90X 4FSMA 5C8MA 2XKDA 5KBRA 3SA0A 3UVRA 4BJJA 4DTAA 4KRCA 4YJPA 1JAMA 2WAJA 4RJ8A 1JQHA 5J9LA 2Y6MA 2YCSA 2JFMA 3EMGA 3FL4A 1E9HA 4BDHA 3KY2A 5FEDA 2W7XA 2CKOA 3JR1A 3H3CA 5C1QB 3AC5A 3FQEA 4HYSA 4LV5A 2XNNA 1FBNA 2PTKA 2FGIA 2O8YA 2VTRA 3NCZA 3N9XA 4PF4A 1BYGA 1M7QA 2HCKA 3DS6A 3PE1A 2AC5A 3QRIA 3DKGA 5DFPA 2QOKA 5DR9A 4DG3E 4DHJA 3GCVA 4I1ZA 5EW3A 1Q61A 4YSJA 3OC1A 1P4OA 1TVOA 1PXNA 2LGCA 4BDBA 5HG7A 5IMXA 1OPLA 2E2BA 4ANLA 5FXSA 3BPRA 4GEOA 4IB1A 2OU7A 3ZOSA 2Y0AA 4DBXA 3QCYA 2VO6A 3O5AA 2VWVA 3FC2A 3C0HA 1GNGA 4Q2AA 4QMLA 4HVHA 4NU1A 3BV3A 3PXQA 3E88A 1O6KA 1UNGA 4D55A 4FBXA 3KRJA 3FLSA 4JBPA 3Q5ZA 1K9AA 3HV6A 4XG8A 3OEFX 4ONAA 4ZZMA 4QTEA 3QRKA 3W0OA 4EH3A 5A4LA 3ACJA 4F9WA 5IH5A 3D83A 2ZDUA 3WBLA 3W0RA 3PJ1A 5L2TA 2W1GA 5M4IA 1LPUA 4JL9A 5AUYA 1STCE 3UVPA 3U55A 4RZVA 2BFXA 2BAQA 2VX3A 5AMNA 5CEOA 5LMAA 3HZTA 3KXGA 1NY3A 4UYAA 4FTLA 3RZBA 5AP7A 4L7SA 2F49A 4EK3A 2VO0A 3R73A 2J5EA 4I94A 2CCIA 4AZSA 4EK4A 3SG9A 4M66A 4H1JA 4XBRA 5I5ZA 3NVKI 4LRMA 5CVGA 4FTUA 4BZDA 3P7BA 2BFYA 3KMWA 3VUHA 2FSOX 4EOSA 1U54B 2YM8A 2HENA 3UODA 5K0XA 4TYEA 2B0QA 2C0OA 5FEQA 4RJ4A 2GS6A 5FBNC 5TKDA 2XEYA 5CAVA 2J90A 2W1EA 4XMOA 3U4UA 3UGCA 4BIDA 4WNMA 3EL8A 2P4IA 4RC3A 1JWHA 4V04A 4HPTE 2YCRA 5C01A 4G9CA 2EU9A 4YJQA 3NCGA 3PXZA 4O7ZA 2PYWA 3H9FA 3OUKA 5IA3A 4IZYA 1LR4A 4GT5A 3KXMA 2GNLA 4NW5A 5LCKA 3R8MA 3QTUA 3DKFA 3AT4A 1AGWA 4DCEA 4G3DA 3CTHA 3KXZA 4GKIA 3I81A 4M8TA 4BICA 4YJNA 2XK6A 2YIXA 1DI9A 4FNYA 1OL1A 2UW5A 2X6DA 3OWKA 2DWBA 3NWWA 1O6LA 4P5QA 5JH6A 4HVGA 4I5CA 4FTRA 5HLWA 5JRQA 4FJVA 4RC4A 2YITA 4H05A 2UVYA 2QU6A 2C6DA 2Z7SA 3KXXA 5DPVA 1FGKA 3CIKA 2VWYA 4HPUE 4OR5A 5CQUA 5EKOA 2JGZA 3RHXA 5D9HA 4CTBA 5AADA 3V5JA 2BPMA 1V1KA 5FM3A 4ZJJA 1PRYA 4K1BA 4FV5A 4AQKA 1X8BA 3HKOA 4JMQA 5CXHA 4G17A 2YJSA 5BQ0A 3QXPA 2I0YA 1ERKA 4BCHA 3F61A 5D10A 3KRRA 4IWPA 3CGFA 4I20A 3IK3A 4KS8A 4BR3A 3DQWA 3ORIA 5HNGA 4C35A 2YM4A 5DR2A 3FSKA 5A4CA 2JKQA 4M3QA 4K77A 2OJIA 3ZSHA 1QPDA 3FZOA 3OMVA 3EN7A 3MPAA 4FNXA 4CQGA 4UEUA 4HYHA 4IJPA 5M4FA 3CP9A 3C0IA 3VW8A 4A4OA 1JPAA 4OTQA 4C3FA 4DFUA 1XO2B 3FSFA 4O4BB 5ETAA 3BLQA 5BUIA 2BDWA 5IEVA 3ODYX 4FKOA 4MHAA 3ITZA 3BL9A 4BYIA 4O4CA 4EH2A 2W4OA 3KL8A 4F0FA 3JS2A 4FKTA 3D4QA 2W1ZA 3E62A 4MF0A 5LVOA 3SXRA 5DNRA 2BKKA 2B9IA 4DH5A 4WG3A 3O2MA 4BCKA 2CGVA 4NM5A 5I4NA 1LEWA 3F5UA 4I6BA 4MYGA 5HCZA 4EJ7A 5ETFA 1W82A 5AP5A 4OAUC 1I09A 2ZV7A 4X21A 3LXLA 4E6AA 3HA8A 4EHGA 5CNOA 5GJGA 3GOPA 3RTPA 4YUQA 5K9IA 4DEBA 5KMLA 3A7HA 4KIPA 4XP0A 1KE7A 2WQMA 3QWKA 4O0VA 5CZHA 4OUCA 1XKKA 3O7LB 2X8DA 4E73A 4XG3A 4TWPA 5CU2A 5CENA 3GU8A 5IQIA 3N51A 1JSUA 5CU3A 1OL5A 3ZONA 4C61A 5GINE 1OIYA 3E7OA 4XHKB 4D58A 1XWSA 2VWIA 1CSNA 3ID6C 4FG7A 3WE8A 4ZLOA 4CG9A 4AA4A 4I92A 4KBKA 4U6RA 4BDJA 4IAIA 5M4UA 4R78A 2OICA 2BAJA 4HGTA 3KEXA 3PG3A 4L3LA 1XBAA 2X7OA 4LOQA 4F7JA 4OLIA 2VTHA 3C7QA 2WTJA 1OIRA 3QQHA 4FA2A 2WMWA 3JVRA 2YLEA 4BGHA 3BRBA 4EQCA 4UXQA 5G6VA 3FQSA 2Z7LA 4PMMA 5ANIA 3DNDA 3E8DA 3MBLA 3ZYAA 3UQGA 4GG7A 3DDQA 4MXOA 1J7IA 1L3RE 3C4EA 3CS9A 4LI5A 5A4QA 4ZTHA 4UB7A 3MH3A 4O4FA 2HIWA 1JNKA 5CT7A 5TOZA 3U54A 3FKLA 3HA6A 2OF4A 2R3GA 1XH5A 2ONLC 3IG7A 4O27B 1LP4A 3OCBA 4DEIA 3MN3A 4DYMA 4J97A 4MVFA 3DY7A 3EQIA 2QONA 3LPBA 2YM3A 5EG3A 3I1AA 3LMIA 4X6QC 3WIGA 3QZGA 4QPSA 4D5HA 4AGWA 3W10A 3LZBA 3BELA 2C6MA 2X0QA 2AYPA 2GNFA 2PUNA 2C0TA 4V01A 3JVSA 4ZJIA 5HE3A 5HLNA 4FL3A 2R4BA 3FKNA 4G6OA 1BMKA 1JSTA 4ZY5A 3SW4A 1UV5A 1UWJA 4TW9A 2VO7A 4GK2A 4A9YA 4I22A 4RC2A 4YTIA 2C47A 3REPA 4AQCA 4C37A 1OL2A 5AP1A 1FOTA 4QMWA 1W7HA 4YZCA 5JGBA 3PSDA 1OGUA 4LG4A 1P5EA 4MBIA 3FMKA 4OTHA 3MW1A 3ROYA 4EHZA 3QCQA 4FYNA 3GU4A 4Q5HA 3ZRKA 2GFSA 5CTPA 3KRXA 5CF6A 5H3QA 3Q53A 3TNPC 5HEZA 3Q60A 4EJNA 2GNGA 5KZIA 4AGDA 2B1PA 3S4QA 4CFNA 5AP6A 1PMNA 1ZZ2A 2PVKA 1VR2A 2XK3A 3MA3A 1O6YA 1YI6A 4IAAA 4DFXE 2YM5A 3CTJA 4YR8A 4M97A 4AXDA 1F5QA 3HMMA 1QPEA 5CAOA 3UPZA 5EM7A 3AMYA 3NUPA 2BHHA 4TPTA 3Q6WA 4AW5A 1DM2A 1OUYA 2X6EA 3BCEA 4MXXA 4EK6A 4YURA 4CEGA 2X4ZA 2A98A 5E91A 4ERWA 3FLZA 4LL0A 4XV2A 2JAVA 4XV3A 3SAYA 1AQ1A 3L1SA 4MD9E 3ZC6A 3BGPA 3Q9XA 2IZTA 2W4KA 4F99A 3LCTA 2CKEA 4HGLA 4ASEA 4FTAA 4GW8A 4FI1A 4UV0A 5L2QA 3GQIA 5I9YA 5HNIX 3SRVA 3R30A 3KXHA 2AEGA 2PMIA 3M2WA 4AXAA 1GJOA 3VF8A 3RP9A 3HECA 4C57A 2BUJA 3CTQA 5CSWA 4FV4A 4PV0A 3UE4A 1NVRA 4WNPA 5IPJA 5KMMA 3KK8A 3OWPA 4AZEA 4NCTA 1ND4A 3WF9A 4PMSA 3VN9A 5IA4A 2WKMA 3EL7A 1OKZA 1WAKA 4XBUA 2CDZA 4WIHA 5J87A 4ITHA 4MXCA 3BWJA 4WO5A 2WMBA 2BCJA 2JFLA 4WKQA 4ZTNA 3U9NA 3W2QA 4F7LA 4QMNA 2CN5A 2NPQA 3LAUA 3MYGA 3KA0A 3DU8A 3PWYA 4PL4A 4DHIB 4QQJA 3R04A 3NYXA 3UZPA 3DK6A 3UZTA 3CXWA 4G5JA 5AX9A 4ID7A 4QYEA 4U41A 5FBOA 4NKSA 2Y4IB 1W83A 5M4CA 3EQGA 3Q9WA 4D1ZA 5BVNA 2GNIA 2ZM3A 1PMUA 2BALA 2OJJA 3QD3A 4AE9A 5L6OA 4APCA 5FDXA 2XK9A 3BBWA 5JFXA 4AXCA 4MK0A 5HBEA 4BB4A 3LKMA 4XNEA 3FI3A 4XRLA 2QOBA 4ASDA 3Q4ZA 5I9VA 2XNGA 2PVJA 3CQEA 4DGOA 2BMCA 2JBOA 4JAJA 3TCPA 1M52A 3Q6UA 1ATPE 1JLUE 4O7TA 4L6QA 2O63A 4CKRA 4I0SA 5A9UA 2QODA 3COHA 3E8NA 5FQDC 2ZV2A 1APME 1TFFA 3HNGA 3IGOA 2E9NA 4L8MA 3R7EA 2FB8A 2UW7A 3NFGB 4NSTA 4PRJA 2RFEA 2WIPA 3FXXA 3RCDA 5L6PA 4RQKA 4D2RA 2BAKA 4OTWA 5AR7A 3MB6A 3FMEA 5E8UA 5TE0A 3WF7A 1SNUA 4RT7A 1ZMWA 2VTQA 4ACHA 4CFWA 2PMNX 3DK7A 3QKMA 3VQHA 3BWFA 2CMWA 4EC9A 4WT6A 3WYXA 5T3QA 3VWAA 4Z16A 5LXMA 1FQ1B 5BV3A 2ZYBA 2W5AA 2VTOA 4MBJA 2PL0A 1QCFA 3TUDA 2W99B 4FKVA 3ZSGA 4BTFA 3KMMA 2YERA 3D7TA 3QTQA 2XK8A 4FVRA 3L8PA 2VUWA 4GFGA 3RPVA 4WHZA 4YTCA 2VU3A 3FL5A 4X2GA 4FNWA 5KE0A 3T9TA 3O71A 4IVCA 3FZ1A 3VUIA 1PXJA 3L8VA 3HL7A 3EQCA 4U5JA 2WMVA 3WE4A 4AG8A 5AA9A 4QYHA 3DBCA 1KWPA 5IUGA 2CCHA 1MRUA 4CMTA 2UW6A 2O2UA 2A19B 3QYWA 4ACDA 5HI2A 1XH6A 5JSMA 4F78A 4O22A 2YDIA 2O3PA 3D2KA 5AR2A 3DQXA 2YLFA 4EWQA 4FKWA 3DB6A 4I93A 2WZJA 5T68A 4I23A 3VUKA 4YO4A 3TYKA 3QYZA 2BIKB 1PF8A 1JOWB 3FMLA 1B6CB 5BYZA 3TWJA 2WTKB 4LRKA 1M17A 1MQ4A 4R7HA 3ZO2A 4FEXA 3UOLA 4FTJA 4ZSEA 4CD0A 2V7OA 1PXKA 4QNAA 2PE1A 2W4JA 2EXCX 4LMUA 1JKSA 1JBPE 2X8EA 1VLRA 2BRHA 3HAVA 5BMSA 3OS3A 4OBPA 4TYHB 3FLNC 5JGAA 4I5MA 4QMYA 4F65A 3OW4A 3RAHA 2A27A 2UZUE 3DNEA 4M69A 4MWIA 4GVAA 3F7ZA 3TTJA 4ALWA 3PSBA 4FOCA 4ANSA 2IF8A 3W0PA 2R9SA 4MD7E 3DK3A 4G1WA 3OW3A 4R7BA 4DGLC 2C3JA 3TEIA 4I5PA 4ZSGA 1VJYA 2R3NA 2EB3A 3QKKA 3FXWA 5E8WA 3FZRA 2VWBA 1J1BA 4QMTA 1UKHA 4QRCA 3GEQA 4L01A 5HE2A 3RPSA 4AZFA 4UXLA 4O4EA 3GBZA 5IA0A 1H25A 1O9UA 3CCNA 4IIRA 4ZTSA 4O2PA 3I7BA 1HOWA 2XIZA 3H0ZA 3ORKA 1H24A 3PP1A 4UWYA 4R6VA 5E7RA 2QG7A 4A07A 1YHSA 3A7JA 5AUWA 5JFVA 2YABA 2GQRA 4BCPA 5C26A 1UNHA 1PYXA 2WEVA 4U81A 2PZRA 4M84A 5JRSA 3EN5A 3OOMA 4ENXA 2QLQA 1ZYDA 2YAKA 4RX7A 5M55A 2PULA 4ACMA 2X2MA 2ITUA 3ZU7A 4A7CA 2ETMA 4BC6A 3LM0A 4LGDA 1YWNA 4YC6A 2R3PA 3NNVA 3IECA 3OXIA 3BEAA 5HG9A 3TV7A 1SVEA 4K2RA 2J9MA 5J79A 4J52A 1RDQE 4ZMFA 3GFEA 4R7IA 2HXQA 3NUSA 4FSZA 1H07A 4RFZA 3FKOA 1R3CA 5BYYA 1ZAOA 2PE0A 4JRVA 3F9NA 5E8YA 3ZCLA 3L8XA 5F1ZA 3K2LA 4G34A 3GT8A 4IDTA 4N6ZA 2C6IA 4FICA 2WTWA 4H36A 4Q9SA 3LFAA 4FYOA 2V55A 2EB2A 2ZVAA 4HZSA 2Q83A 3N4TA 5FG8A 4FV3A 3VJOA 3AKJA 3BLHA 3Q9YA 4FKGA 4CFMA 3QC4A 2XYUA 3CEKA 5EH0A 3OY3A 2Q0BA 1UU7A 4AP7A 4YHJA 3UOHA 2XEZA 4EHVA 2JIIA 3AC1A 4WBOA 4BRXA 1PY5A 4W4VA 2VNWA 3LQ5A 3PY1A 3BLRA 3M11A 4ZY4A 4EOOA 4FUYA 3TNHA 1Q8TA 2QR7A 4P4CA 4XEYA 3PRIA 4F9YA 5KMNA 4BZOA 3RPRA 2PUIA 4O21A 3UG1A 3PJCA 4GU6A 4IAYA 1YXSA 5IH4A 3AKLA 4PDPA 5DRDA 1CKIA 2XARA 2YZLA 1WBPA 5EOBA 4O81A 3SGCA 4A9RA 3WZKA 3SW7A 4ORKA 2RKUA 5LMKC 2C6EA 4DFNA 1PHKA 1PXPA 1YXXA 4J7BA 1UWHA 2OJ9A 3QD0A 4DHZA 3U8WA 3VBYA 2HZ4A 3CPCA 3PJ2A 2XIYA 3MTFA 3VBWA 4O1PA 4KIKB 4F64A 4S32A 3SOCA 3ODZX 4LGHA 3F2AA 3PIXA 4OTRA 2XVDA 2C6KA 4OW8A 4Y8DA 3ZEWA 4U0IA 3I0QA 3PE2A 3KFAA 3DOGA 5FDPA 4LRJA 3P86A 1ZOEA 3EN9A 3F5XA 4KRDA 4UMPA 5IQBA 3UPXA 5GIPE 1GZKA 3WZEA 5AV1A 5LVNA 1H1PA 2F7ZE 3BHYA 4S33A 2HY0A