4FIGA

Catalytic domain of human pak4
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
293
structure length
292
Chain Sequence
RVSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PAK 4
publication title Type II p21-activated kinases (PAKs) are regulated by an autoinhibitory pseudosubstrate.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 91
structure length 292
sequence length 293
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-06-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4figA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4figA01
1NVQA 3R8VA 1BKXA 1H07A 3A8WA 2YHVA 1UNHA 4I0RA 4CMTA 3THBA 3Q9YA 4WG3A 5FBOA 5HU3A 4D28A 1FVVA 3SX9A 4K1BA 3TUCA 2JEDA 4DTKA 3UP2A 5IA1A 3SGCA 4PMPA 3KRXA 1H24A 4XG8A 4ANMA 2LAVA 1YHVA 5FG8A 4GG5A 4FTTA 4ANSA 3MI9A 2QU6A 3ORLA 1YRPA 4YTFA 4O7NA 2XMYA 2HZNA 4Y8DA 4UY9A 4MH7A 3OW3A 2GFSA 3MJ1A 5DHJA 5D10A 2WNTA 2QLUA 1W7HA 5E92A 2IW8A 1CKJA 4O82A 3F5PA 4IXPA 2XJ0A 4FEXA 4JG7A 4FTLA 2JIUA 3PP1A 2C6KA 4NKSA 3O8PA 4RLKA 2YJSA 4Y5QA 3SOCA 4BCOA 5K0KA 4ANBA 4R3PA 2BTRA 1OIQA 3FLZA 4KA3A 3P5KA 3KN6A 2CN5A 1BL7A 2GHLA 1TQMA 2QHNA 4C33A 5IA4A 2OBJA 3R8MA 3ZUVA 2QURA 3TNHA 2JDVA 4IM0A 5C8MA 4MXCA 4FIJA 1E9HA 3TNWA 2UVXA 2IN6A 3CP9A 4RWJA 4WHZA 4U0IA 3DKFA 4YNOA 5IPJA 4JT3A 4WG5A 4QQTA 5FDXA 2C30A 3CD3A 1REKA 5CTPA 4AOTA 3LCOA 2A0CX 4G6OA 2PVYA 4YO6A 1FOTA 5EI8A 5EM5A 2XB7A 2A4LA 4TYJA 4ZP5A 2XIRA 1XHAA 1XJDA 4PL3A 2ITOA 4ZSGA 2C6OA 2W05A 4XMOA 2HIWA 3GXLA 2XH5A 3FLWA 2CCHA 1ERKA 3FKOA 4QQ5A 5IA2A 1XH7A 2PVKA 3RZBA 3ROYA 2OK1A 3SG9A 3F82A 4QNYA 4QYYA 4RIYB 2WQNA 5CVHA 5L8JA 4OTQA 1OZ1A 5L2WA 2VTMA 5L2QA 1L8TA 3OCSA 2YCQA 4B4LA 4NCTA 4H39A 2R3FA 2CDZA 3NNWA 3Q6WA 3SDJA 4W4YA 1VR2A 3A8XA 4FZAB 2WQEA 4TNBA 4APPA 4D2SA 3Q9XA 4DFUA 4EKKA 5F94A 2R4BA 2QCSA 4QTBA 3E8NA 5BPYA 1STCE 5HVKA 5IDNA 1A9UA 4XOZA 3T3UA 2WIHA 4C7TA 4FGBA 5I9XA 1ZYJA 4I5PA 5M55A 3C5IA 2HELA 1UU8A 4FSZA 3UO6A 4N57A 3NCZA 1KE5A 4RLLA 1U46A 5CU6A 1V0OA 4FOBA 2YM7A 3GEQA 3LFNA 3G6HA 4J52A 3R7EA 4EH8A 4MD7E 3ZC5A 1H28A 1U4DA 4FTMA 4JS8A 4JVGA 1UV5A 1R3CA 4MD9E 4RA4A 4BBMA 2B54A 1WVXA 2UW8A 3C0IA 1XH4A 4JNWA 1DS5A 4WO5A 5JZNA 2X0GA 2X4FA 5LCKA 3A99A 5I9UA 4MXZA 2VGOA 3G9LX 5K3YA 5DLSA 3RINA 4FI1A 5F9EA 4G6LA 4CFWA 3OWKA 3Q32A 3WF5A 2WMTA 1JSUA 5AADA 4QQJA 3DPKA 2VTOA 1NVRA 5A6NA 4HW7A 2W7XA 2CKPA 3PPZA 4K11A 2OZOA 3EN9A 3AC8A 3QD0A 5HO8A 3BLRA 2WQMA 4J8MA 5EYCA 1JOWB 1LR4A 1QL6A 4EH6A 3ITZA 2W1ZA 2QOIA 3BHUA 1Q41A 5LWMA 3L8VA 2X6DA 4RA5A 2O3PA 3ZLXA 3BGZA 3UIXA 4A9YA 4DTBA 3QU0A 2PZYA 4GU6A 3Q96A 3NYNA 4NL0A 5AX3A 2EXEA 3RP9A 4E4XA 4XRJA 3IW4A 4FYNA 3BWFA 3E7VA 1WBTA 1ZMVA 2WTDA 3LCDA 3LPBA 3OXZA 3Q4CA 4WT6A 3KULA 3UMXA 2VZ6A 5F95A 4FVRA 4DBXA 3BYVA 3C1XA 4QP3A 4BKYA 3BYUA 2XNBA 4DEDA 3LCTA 4J8NA 3PVGA 2VTJA 3MDYA 4GUEA 4IZAA 4XRLA 4ACMA 4BHNA 4PTEA 4JJRA 4XG2A 3QFVA 1REJA 5BMSA 2NO3A 3Q60A 3GOPA 4M67A 4ZTLA 2UW7A 4D4VA 3DLSA 4I21A 2RF9A 4TWCA 4G1WA 3SHEA 4G3DA 3NUXA 4EYMA 2UZNA 3LOKA 4RIXB 2Z02A 4E26A 4DEAA 5AP6A 3CS9A 3IO7A 3LZBA 4ENYA 1CSNA 3VUHA 4ZAUA 5LVMA 5J1WA 3DFCB 4XG7A 4GT4A 2REIA 2CGXA 4O96A 2PMLX 4BBEA 4L43A 3EN5A 1H8FA 3DB6A 4I93A 5CVFA 5C1QB 1PW2A 5JT2A 4Y46A 2YM6A 4TRLA 3GCSA 4O21A 1DM2A 2JIVA 4BDJA 4ZTQA 3HMNA 3ORZA 1P4FA 3OY1A 4FX3A 4GKIA 3FLSA 4BYJA 3PP0A 4TTHB 5DG5A 1JAMA 5G6VA 3DJ5A 4IAKA 4USEA 5DEWA 3K3IA 2PUUA 3HMPA 5TO8A 1H4LA 3SC1A 2JFLA 3PXKA 3U9NA 3ORNA 1UU7A 2EB3A 4TW9A 5AUWA 2OJFE 3F66A 2QI8A 4QYEA 2VAGA 3BRBA 4FL3A 3RM6A 4L6QA 4P5ZA 4F64A 4LUEA 2JDRA 3EN6A 3C4XA 4PRJA 5BX0A 4YC6A 3DK6A 3SQQA 3VQUA 2PE2A 4YSMA 3ZZEA 4U5JA 2WOUA 3OCTA 2WQBA 4G6NA 4QP8A 2R3JA 4WUNA 4O7RA 2R3NA 5BVNA 4YZMA 3ZEPA 3PE2A 5BMMA 2RFSA 1KE9A 3IGOA 3L9LA 4KAOA 3IPHA 3PA4A 4X2JA 5GNKA 5HGIA 2V7OA 2BUJA 5EI6A 4I23A 4WG4A 4C3RA 4YJVA 1UWHA 2C3KA 3Q52A 2X39A 3JVRA 2QOBA 4LRJA 2X7GA 5AP5A 4O0VA 3LM5A 3NVMB 3FQHA 4CV9A 4XX9A 2BIYA 3LCSA 4L53A 1R39A 2BFXA 2VUWA 3UC3A 3HGKA 3AGMA 4ACDA 5KE0A 3FC2A 2CLXA 2IVUA 2W4JA 5AP3A 5LQFA 3W10A 2BALA 4H3QA 5A46A 3FL5A 4N70A 1P2AA 1YXXA 5HCXA 4G5JA 2VWIA 3HV4A 4IB3A 1OL7A 3P79A 2W99B 2J50A 3WARA 4O6EA 4HVHA 1GIJA 3LHJA 1O9UA 2J0MB 4QPSA 3W2OA 3FI8A 3VS1A 5L2IA 1K2PA 2WGJA 2P0CA 4JAIA 3PG1A 4G9RA 4OTGA 1PF8A 4HYIA 4PTGA 5LMAA 3BGPA 2G1TA 4D2VA 1V0BA 3S0OA 4X3FB 5AR4A 4FVPA 3ZTXA 1U59A 4U7ZA 1IG1A 3ZDUA 3UOHA 4X7QA 2FO0A 3PSBA 4MX9A 5HE3A 3TV7A 1MRUA 2PVMA 3NIZA 4XBUA 4NTSA 4EQUA 5E9EA 5IUGA 3OZ6A 1P14A 5K4JA 3LQ8A 4X2KA 4NYEA 3HV5A 2JKKA 4YC8A 5HNIX 3E93A 3IW6A 1ZYSA 3IW7A 3UG2A 4D4RA 2O64A 5BNJA 4FTJA 3R8LA 2F2UA 4IMYA 3ANQA 2V55A 4FKPA 2OXDA 2R0IA 3DT1A 4AW2A 2OJGA 3ZBXA 1M7NA 3CLYA 3QF9A 5E91A 3MVMA 5ANOA 5IG1A 3VIDA 4FTOA 4R8QA 3B8QA 2YN8A 1KE6A 3OFMA 4OTDA 5EQPA 3OD6X 3OCBA 4AOJA 4G5PA 2V62A 1ZZLA 4EOOA 1OIRA 2CCIA 2UW6A 4DFBA 2PTKA 5CNNA 2UZUE 2BZHB 4DEIA 3R9OA 4N6ZA 2BAQA 3UGCA 5IEVA 3LQ3A 1OL1A 1W82A 2B4SB 2Q0NA 3E92A 3P9JA 5ETFA 3A61A 3ZCLA 4BCJA 4ACHA 5M09A 4F7JA 4FV9A 5HNBA 3KK9A 3BYSA 3D5VA 3WF8A 5CAOA 4HGEA 5ACKA 5DMZA 4QYGA 5HTCA 4YJQA 1IR3A 5T68A 5K5XA 5A4EA 4GCJA 4N4SA 2FA2A 2R9SA 4ZJIA 5L6PA 2BKZA 1H1RA 4FUYA 3O2MA 5C01A 4AE9A 1YDSE 4ANQA 2P2IA 3POOA 2Y0AA 5HICA 3R73A 3CPBA 5BYZA 3W2QA 1TQPA 3A7HA 4V01A 1GZ8A 5FXRA 4TN6A 4CTCA 3ZO3A 4M3QA 4XG9A 2CNQA 2JFMA 1J91A 5D41A 3ZLWA 1ZY5A 4FT5A 3ZUUA 1ZOGA 2HWOA 2G15A 3ULIA 2G01A 4IIRA 2ITXA 3COIA 4O7ZA 4F6SA 3F3ZA 3C4FA 1UNGA 3OWJA 4C4IA 2JDOA 3UIMA 2C3IB 3U9CA 2VO7A 4GIIA 2X81A 4DFYA 3TCPA 4CRSA 5H2UA 5I9WA 4CXAA 3VWAA 1R78A 3D4QA 4N0SA 5F20A 3TV6A 4EI4A 5HESA 4W4XA 5CAVA 3OHTA 3SW4A 2BZIB 5DOSA 4EOPA 5JSMA 3ZDIA 4PNIA 3Q9WA 2CNVA 4NJDA 5IEYA 4IJPA 3FC1X 3KA0A 1UU9A 3KGAA 4DGGA 1V1KA 3IECA 3RPVA 3JY9A 2DUVA 2OZAB 4Z3VA 2YIXA 4I4FA 3POZA 4PMMA 4DGLC 3M11A 5KNJA 1Q4LA 4EUUA 1XH5A 5ITAA 3BBTB 5EHOA 2RG5A 2XEYA 4NIFB 4AT3A 4JDIA 4EJNA 4X3FA 3ZSHA 2RGPA 3MH1A 3AT2A 4OTWA 5KMOA 3KN5A 2XNGA 3PE1A 4QMOA 3FBVA 2XM9A 4EORA 4IFCA 2G2FA 5GZ9A 3UJGA 4ANNA 3QRJA 3UYSA 3ENHA 3HMMA 4FV5A 4YJSA 4AW1A 3GFEA 3QRIA 4CYJA 2IWIA 5D9HA 1ZMUA 1Q5KA 4JL9A 4CLIA 4FNWA 5B2MA 3HRFA 2Y7JA 4Y85A 4HNIA 1Q97A 4KKEA 1H0WA 1M2QA 4RJ7A 1Y57A 4KB8A 4WBOA 5L2SA 2HAKA 2BVAA 1NA7A 1LEZA 2UZDA 5HTIA 4FEWA 4IM2A 2BDWA 3EZVA 3U8WA 5JKGA 4M69B 2GU8A 3DV3A 3D7ZA 3K2LA 5CI7A 3GCPA 3DBDA 4IAZA 4IDVA 3FL4A 4MQ1A 5BVOA 4U3YA 3MY5A 1J7IA 4IAFA 1JLUE 3LXKA 5CSVA 5A3XA 1ZWSA 2ITWA 4GMYA 4BI1A 4C62A 2IG7A 1HCLA 3GBZA 3HP5A 2Y4IB 3L9NA 4WD5A 1Y6BA 4FT7A 4FTCA 3IDCA 4MAOA 4EH3A 3HECA 5BVFA 4QP6A 2BROA 4S31A 1VEBA 1VZOA 5ANGA 3VRYA 4OTIA 1Y8GA 2UZBA 4D2RA 5I9VA 4UYAA 5M57A 3LW0A 2ZV2A 3R28A 3GI3A 2I0YA 4QO9A 1ZYDA 4TKSA 5CSWA 3R2YA 1PKGA 3R1NA 4KWPA 4AQCA 1Z57A 2PZRA 4IB5A 4YPSA 4QYFA 4K2RA 2E9UA 1ZRZA 2R3OA 3FPMA 4QTAA 3F3UA 1UVRA 1BI8A 5I0BA 3TIZA 3AD5A 2WTVA 4LQMA 3VUGA 4F1TA 3EQBA 3D5UA 4I0SA 2C5VA 5DR2A 5GHVA 2PZ5A 5ANDA 5ANJA 3TN8A 3UTOA 3PY1A 4AUAA 4D58A 3ODYX 3HUCA 3WOWA 2NP8A 1TVOA 4DG0E 3QQKA 2VO3A 1H27A 4FTUA 4TT7A 5C03A 4E20A 4L3LA 4B8MA 3BE9A 2WFYA 2QR7A 3R7GA 2QKRA 2WMQA 1UU3A 2YZAA 5JQ8A 5BVWA 5AX9A 5AAEA 1YXSA 5CF4A 5HG7A 1Q8WA 1BL6A 4RBLA 2PK9A 3EWHA 3Q3BA 4RGJA 3L9PA 4LOPA 2VTLA 4M97A 2VTHA 4BGQA 3OMVA 5AIKA 1U54B 2ZVAA 2J9MA 3TI1A 5HIEA 1I09A 4RFMA 4YGAA 2QC6A 3G51A 3DKCA 4AACA 4PL5A 4AN9A 3JS2A 5HBHA 4FZDB 4XJ0A 2OZAA 5DWRA 5KMJA 3KXMA 3TNIA 5GZ8A 2V0DA 2W17A 4ACGA 1OBGA 2F49A 2XBAA 1FPUA 4IQ6A 3TNPC 5IQEA 4ZSJA 3DJ7A 4ZJVA 5JGDA 1XH6A 3ATSA 4GVAA 2H9VA 4FKSA 4M68A 3FSKA 1YW2A 4Z9LA 3O8UA 5HCYA 3RZFA 3V5TA 3N9XA 4O7VA 3RPYA 2PE0A 4ARKA 2HZ4A 3A4PA 1PKDA 2C0TA 2IZTA 2C6LA 4K77A 3FXWA 5A6OA 4H3BA 4LV5A 4APCA 5KKRB 3QQGA 2SRCA 4UBAA 4FR4A 3UYTA 3QLGA 4LG4A 5EW8A 4BIDA 3LMHA 4DLIA 2QU5A 5HVJA 4EK3A 3LFCA 4O83A 4DA5A 4EK8A 3QRTA 3P0MA 4UX9A 3MPMA 1R1WA 5LMKC 3IK3A 5GJFA 4QP1A 1GOLA 4JBQA 4BDHA 3DTCA 4FKTA 3OUNB 4E93A 2HOGA 4ITJA 4GFGA 1RW8A 5CZHA 5E8UA 1OKVA 3BX5A 4ZSEA 5AUZA 1ZOEA 2VV9A 3Q4UA 2EXMA 2ONLA 5B2LA 1WFCA 3A7FA 5LXMA 4IZ7A 3KEXA 4FV1A 3TJCA 4M66A 3RCDA 4D2TA 2PVNA 4MD8E 3RPRA 4QTEA 3IOPA 2IO6A 4AAAA 2YLFA 2JITA 3HYHA 2PVHA 5KZ0A 1F5QA 3G33A 2FSTX 1KSWA 2WU6A 4U80A 2RKUA 2WTKB 3H0ZA 5J9LA 4FKUA 1ZY4A 3U6HA 4HYUA 4C3FA 4WRSA 3AC4A 5BQ0A 5CAPA 4YJOA 1PYXA 2A2AA 3PVUA 5FBNC 3MPAA 1IEPA 3MYGA 4ZXTA 4DF3A 5EW3A 3LFEA 3SXSA 2R3LA 3EHAA 4ERWA 1GAGA 2XKCA 2W1GA 4L44A 3RHKA 4Q9ZA 3RGFA 5LOHA 3W55A 5TR6A 1L3RE 4JBVA 2ITUA 3G0FA 3QWJA 5HG9A 3ZU7A 5KO1A 3ZZWA 4LI5A 4X2GA 4D9UA 4LGHA 2VX3A 5AV2A 2VTAA 4FKOA 2VRXA 4HZRA 2PVRA 3WZKA 3BYMA 4QNAA 5AUUA 5EYDA 2J0KA 3IDPA 3PPJA 3W18A 4ALVA 1OBDA 3OCGA 3FV8A 5DI1A 5BVEA 3PJ1A 2XYUA 2QHMA 3VW8A 3GU5A 2GNIA 4W9WA 3VRZA 1GIIA 3BPRA 1U5RA 3NYVA 4D5KA 2CN8A 2FYSA 3MGYA 3GU4A 2UZEA 2Z7LA 4DG3E 2ITVA 3HV3A 4JBOA 4I4EA 4CVAA 4DEHA 2W9FB 1SNUA 5M56A 5AP2A 3NLBA 1Y91A 2CLQA 2E9NA 2YCSA 5J8IA 5HLWA 5C4LA 3DB8A 5CT0A 4I5MA 5C8NA 3FSFA 4I0TA 3NW7A 4GYGA 4FV2A 5HI2A 3EYHA 3WZDA 4RX5A 2LGCA 4CV8A 2C6MA 4ZY4A 4BTJA 4ZOGA 1OKZA 1DI9A 5IH5A 3R02A 1X8BA 3QQJA 4HZSA 3QBNA 3CSVA 1YXUA 4I6FA 3IKAA 2VNYA 4F9AA 1Y8YA 2IW9A 3I60A 3PLSA 2WTJA 4IZYA 2XNOA 1JKSA 4HOKA 4JQEA 4J99A 4J97A 4R7HA 3UNJA 4AZWA 3MFRA 3EN4A 4MXYA 4R3CA 3ZONA 3VN9A 3LFBA 4UMUA 3Q2JA 5IQIA 1QPCA 3F3VA 3QWKA 2QLQA 4H1MA 5HO6A 2J5FA 5IQCA 4AF3A 4O84A 4IZ5A 5HE1A 1G8AA 1KV1A 3FKLA 3U51A 3V8WA 2ERZE 3BQRA 3H9OA 5AJQA 5M4FA 2PZIA 3FYKX 3JVSA 3KRLA 3W2SA 3HA6A 4UEUA 4ITHA 5J95A 4D4SA 3BU5A 1ZYCA 4F99A 5FXSA 5AAGA 4LV8A 4YTIA 3SXRA 2KTYA 3KRJA 2XJ1A 3IQ7A 3K54A 1IA8A 3DLZA 4YJNA 4LGGA 3AD4A 1U5QA 3HX4A 4J95A 2J0IA 4C4GA 5L8KA 2C47A 3LCKA 2J0JA 3DS6A 3PSCA 4CNHA 5JFWA 3ORIA 1YWRA 4FK3A 1M17A 2ZB0A 2RL5A 3EQDA 2FB8A 3KULB 3PUPA 4FIHA 4KSQA 4TYIA 5E8VA 4UXQA 2JAMA 4EOLA 3QD2B 3KF4A 4NT4A 1J3HA 4S32A 5E7RA 3QC9A 4WKQA 4C38A 2IVSA 5BUIA 4WNOA 3G2FA 3QLFA 1YOLA 2BAKA 3CQUA 4FV7A 4RQKA 1Q8YA 2FVDA 4KS7A 4LOOA 5AP7A 4EBVA 1WBVA 3CCNA 4FSNA 5KCVA 4MCVA 2PUPA 3V51A 3OW4A 3PJ8A 3SV0A 2UW5A 2GMXA 5DH3A 3MVLA 5AR2A 4YZNA 5FXQA 2IZUA 2QOKA 2OFVA 2WOTA 1SVEA 3EL8A 3FZSA 3P4KA 4QOXA 3DOGA 4M0ZA 3WE4A 3KCFA 3VF9A 3ZRMA 3LKMA 1XR1A 2BTSA 3PZEA 4J96A 2JBOA 2XS0A 3MS9A 4W4WA 4FE2A 3VW6A 4MEDA 5IZFA 3B2TA 4EYJA 4B9DA 5AAFA 4UMQA 3BHTA 5TF9A 1Q8TA 2BAJA 5CU2A 4B6LA 3DQXA 4BDDA 1O6YA 4XS2A 3V6RA 4CLJA 5GZAA 4AGUA 2YLEA 4DHFA 2PU8A 3PJ3A 2Z7QA 5HTBA 4YBJA 2YISA 3CY2A 2XIZA 4NM3A 1JPAA 4XBRA 3B2WA 4UN0C 1MUOA 4UWYA 4DEGA 2OGVA 5GIPE 4GSBA 5L8LA 3QTWA 4I5CA 3F69A 2Z8CA 3EQGA 5HG8A 4H36A 2R3KA 3Q4ZA 3NAYA 4E6DA 4IFGA 2C0OA 3A62A 3MTFA 5EDQA 5H3QA 5EHYA 2F7ZE 5FTOA 5CF8A 2WMRA 4ALUA 4CFFA 2BRHA 2CHLA 2VTTA 3D9VA 1KUTA 3RCJA 4G16A 1H00A 3OVVA 4A9RA 3EJ1A 4PDYA 3GGFA 2YM5A 4ZMEA 2XNMA 2UZVA 5CASA 1VYWA 4MK0A 3ZXZA 2R5TA 2XCHA 4CTBA 4D9TA 5L6OA 4BN1A 4Z16A 4WBBB 1GY3A 3OUKA 4PNKA 2GNHA 4XYFA 4QT1A 3KREA 2UW4A 3QYWA 2R3MA 4ZEGA 3H0YA 5IDPA 3R30A 4NKAA 5IUHA 2XIXA 3C0GA 4YHJA 3FMHA 5CQWA 4AZSA 5EM8A 3PIZA 1XO2B 3JY0A 3RVGA 4A7CA 1W0XC 3MBLA 2YIRA 4E5BA 3F88A 3DAEA 2FSLX 3AMYA 3DA6A 4OGRA 3DNEA 3KU2A 4AFEA 3FEGA 5AM7A 3UMWA 3V8SA 2C69A 2OLCA 3FHIA 3V5QA 1J7LA 3W33A 4O0TA 2HWPA 2EWAA 2OKRA 2OF2A 3DXNA 4FZ7A 2WELA 1NXKA 4XG3A 5HLPA 1EH4A 3RPOA 4UMPA 3WYXA 3NR9A 4QD6A 3R1SA 1H26A 2XKFA 5DT0A 4CFVA 3BHVA 4QP2A 3GCUA 4L68A 3RJCA 2QODA 4E73A 3R7UA 3V5PA 2VWBA 5FGKA 2GTMA 5AP1A 3ZO1A 1Q8UA 2YFXA 5AMNA 1BMKA 3FYJX 4CRLA 3U6JA 4K33A 2QOQA 3RAKA 3FI4A 3HLLA 2ITYA 3EFWA 2AC3A 2YDIA 4RX8A 1PXMA 3COKA 4AG8A 4C36A 1FGIA 2A1AB 1YI6A 2RFDA 5IQBA 3QGWA 2IPXA 5M44A 5E8WA 2FGIA 4C4JA 4RPVA 2BDJA 3G0EA 4PP9A 3MTLA 4QMVA 3RK7A 1YHSA 1FMOE 3GU8A 2E9VA 4I5HA 4FV8A 4U41A 2NPQA 2WPAA 4O2PA 4BWKA 4QMUA 4GJ2A 5KHWA 5FTQA 4BGGA 3GCQA 4F6UA 1XKKA 4CFUA 3MN3A 3KRRA 4YZBA 4DG2E 4FV0A 5KMMA 2XK8A 2DYLA 4XLIA 2J6MA 4I22A 3EQFA 3FMMA 5CALA 3EMGA 5EQYA 3Q53A 3OEFX 4GRBA 5H8BA 2ZV9A 3ZHPC 4YMJA 2G2IA 3QX4A 1DI8A 4YNEA 4EH4A 2B1PA 4RVKA 4FSTA 4F6WA 3PPKA 4BCFA 2YABA 3CE3A 4BDKA 2Y6MA 2HXLA 4BC6A 4Y83A 4GK2A 4IVAA 1A48A 2ZDTA 2BILB 2B9JA 5CNOA 4O0XA 5FTGA 2GNLA 2XK7A 3KY2A 3U87A 3SW7A 2QOLA 5KMLA 4NW6A 4O1OA 4D4YA 2R7BA 3KXNA 4RWLA 4EZ7A 2W1HA 3AOXA 5JFSA 3OXIA 3F7ZA 3MA6A 4YLKA 3P7AA 5ANEA 4BTMA 2JDTA 4CZYB 3EZRA 4IB1A 3KRWA 2CPKE 1IAHA 4XV3A 3OT8A 5H8EA 2OI4X 5DRBA 3HEGA 2YITA 4O0SA 3DK7A 4IEBA 4I3ZA 4R1VA 3A7GA 3H4JA 3AT3A 3MVJA 4O7YA 4G2FA 3R9HA 2PY3A 2W1CA 3DBFA 4F0FA 3W8LA 1H08A 3VO3A 2Z60A 2IVTA 2QNJA 2X2LA 4BBFA 3HRCA 3FZRA 3AMBA 3DDPA 3NNXA 2GFCA 4O0WA 5DPVA 4CSVA 5DNRA 4U9AA 4QTCA 3C50A 3Q04A 4PPAA 2AYPA 2QG5A 2RFNA 1JKLA 4UZHA 3SKCA 4EOSA 4DCAA 2B55A 4F70A 5BVDA 3I5NA 4BDGA 3SRVA 4IBMA 2P55A 2B7AA 3PRFA 1W84A 3E63A 3DKOA 2FUMA 2O2UA 2O5KA 4FTAA 1ZARA 1MQBA 3FHRA 4I6QA 5J87A 3SXFA 5J5SA 2NRUA 1OL5A 5HG5A 4DT8A 2VTQA 2ZM3A 5IQHA 3Q6UA 3P08A 4LFIA 4J1RA 5EYMA 4FG7A 3EFJA 4GW8A 3IOKA 3QHRA 3UO4A 3BLHA 5IQGA 5AV3A 2WIPA 2GHMA 1K9AA 3NW5A 3FXZA 3IGGA 5HLNA 2GTNA 5A14A 1OVEA 2ZYBA 3O96A 3BELA 5KBRA 3I79A 2IJMA 1SYKA 4AGDA 4E3CA 5CANA 3T3VA 4U3ZA 1CMKE 3OWPA 2XIYA 4BZDA 4CMOA 1PMVA 3MY0A 3EQRA 4F9CA 2R3RA 5HQ0A 4RSSA 3R9RA 4JLCA 3AGLA 4X0MA 3NNUA 3TACA 3C4CA 3CBLA 1G5SA 4D2WA 2X2KA 4O81A 1WBPA 2GQRA 4JX7A 3I0QA 4AN3A 5E4HA 2W5HA 4IWOA 3W16A 2NRYA 4DBNA 4FIGA 1YWVA 3PWDA 5L3AA 4CCBA 4ZLOA 4M0YA 1M52A 5HEZA 4FIEA 3I6WA 3VBVA 4OBQA 5CAUA 3ZSIA 3QTQA 4BCNA 2YIWA 4AX8A 4O22A 4HGTA 5HD7A 4XG6A 4CQGA 5M53A 3EL7A 5LMBA 3VS3A 3LMIA 3HNGA 1GNGA 1PXJA 3VJOA 3UQFA 4EQCA 4F08A 1OGUA 4NH1A 3CKWA 2GDOA 4B0GA 3FAAA 4FL2A 2EB2A 4HGSA 3KXGA 5D1JA 3V01A 2BRGA 2QO7A 2UW9A 1WBWA 2B52A 3COMA 3I1AA 3OROA 1Q3DA 2XRUA 4KSPA 5EW9A 5IUIA 4IADA 4YZDA 2ITTA 4LUDA 4M13A 4UB7A 2VWZA 3RBWA 4O6LA 4JRVA 3UOKA 1PHKA 3R21A 4FKRA 4BCKA 3L8XA 3RWQA 1O6LA 1YHWA 3BV2A 2WKMA 3ORTA 4RJ6A 3RM7A 2HK5A 1VYZA 3UOLA 4CFXA 4EKLA 4BCQA 5EOLA 3FXXA 4XLVA 5LVPA 4QYHA 2HW7A 5DT4A 4CKJA 3GP0A 2QQ7A 4J7BA 4X2NA 2UV2A 5A4TA 2ETKA 4TWOA 4U42A 3W2RA 3U55A 3TZMA 4DLJA 3CR0A 4ID7A 3R9NA 5LARA 2XK4A 2PVFA 3CTJA 4BKJA 1M14A 4I6BA 4USDA 2VWUA 1PMEA 3GCVA 2C6EA 5CU0A 2CNUA 4TPTA 5D7VA 4EL9A 2I0EA 3LJ0A 3FMEA 2GCDA 2W4OA 4KABA 4FICA 2O63A 4XNEA 4DH5A 4O7SA 3F2AA 2QO9A 4N6YA 3R8ZA 1PXNA 4AGCA 3QZGA 1XBBA 2R3HA 3FZPA 2YWPA 3NRMA 3HAVA 4BYIA 1B6CB 4ACCA 3K5VA 4IH8A 1H1PA 3NWWA 4M84A 4CZTA 2KULA 4L45A 4ASEA 5J7BA 2W0JA 5FD2A 5IKWA 3HDMA 2I1MA 4C8BA 4A07A 4E5AX 3DXPA 3VBYA 3QL8A 4ZLZA 3P23A 3GU7A 4WSYA 2PYWA 4J53A 1H25A 3F3WA 3ELJA 4KRCA 4LMNA 3R1YA 2R2PA 4JDJA 1NW1A 3QCSA 3VS4A 2O0UA 3RMFA 3KMMA 4E4MA 1UKIA 3KMUA 5AFVA 5M4CA 1PRYA 2PMNX 3QQUA 3FLQA 2WTIA 4OW8A 5CS6A 3MFSA 4FKLA 2WU7A 3TTJA 4I41A 1PY5A 1K3AA 3QXOA 4QMQA 3C4ZA 1VJYA 5C9CA 5AUTA 5HU9A 3PYYA 4QMLA 4FZ6A 2X6EA 5LVLA 4UMRA 2V5QA 2XBJA 4IAIA 4E4NA 5E1SA 4XG4A 4BR3A 5JRQA 3QUPA 3RAWA 3COHA 3NNVA 4IX3A 4MNFA 4PPCA 4EK4A 4ZY5A 2QR8A 1WBOA 1ZOHA 1KE8A 3JUHA 3PXZA 4C61A 1XBCA 5HNGA 4BRXA 2CJMA 5E8TA 4CGAA 4RWKA 3GENA 3LLAA 3H30A 5AA9A 3EFLA 5FDPA 3KB7A 2X9EA 3F5XA 5KMNA 4HCTA 3WZUA 2R3GA 4FIFA 4L46A 4W8EA 4DH3A 4IVBA 2OF4A 4RIWA 5DVRA 5JH6A 2HENA 4NTTA 4PUZA 3QQHA 4AE6A 1KV2A 5KX8A 3UOJA 1WAKA 1YI4A 4O7TA 5AEPA 3G15A 3DK3A 3R00A 5K5NA 2YJRA 4S33A 2PVLA 2QD9A 5DBXA 4IX6A 3S3IA 3TG1A 3BBWA 4IB0A 4S2ZA 3EKKA 3R01A 1Q62A 2EU9A 4NU1A 3R9DA 5H8GA 3VUIA 4QRCA 4C4FA 5AR5A 3UNKA 4E4LA 3NPCA 5JMSA 3G5DA 5CT7A 3PVBA 4D0XA 4YTCA 3A60A 5IA3A 4GJ3A 2H8HA 1DAYA 3HP2A 2ZM4A 4YBKA 3FLYA 3JPVA 4D5HA 1PMUA 2UZOA 3NS9A 3PXFA 4QQCA 3W2PA 4FEQA 5M06A 3MH2A 2UW0A 3FWQA 5D12A 4LRKA 5AWMA 5ICPA 2BCJA 4AGWA 4C3PA 2BR1A 4U97A 2W5AA 4C37A 1UWJA 3F6XA 4QMSA 2OU7A 4C02A 4YR8A 5M08A 2XKEA 2VTRA 4RIOA 5JQ5A 5DYJA 3D2IA 3S00A 2X1NA 2PVJA 1RE8A 3O7LD 3OWLA 3QTZA 2XIKA 4PDOA 4ENXA 4LM5A 4F1MA 4RX9A 4EOIA 2JGZA 3LFDA 4CYIA 3VUTA 4BCHA 1JQHA 4Z7HA 4FL1A 4EH5A 4F09A 3R2BA 3QUDA 4II5A 4MWHA 4X21A 3VS0A 3H9FA 5GINE 3PY3A 1A06A 3RNIA 4PY1A 3HDNA 3GC0A 3KL8A 4TWPA 4XV1A 1KWPA 3QGYA 1H1SA 3ALNA 3VAPA 3QKMA 4DC2A 5TE0A 1JNKA 1YDTE 1Y6AA 1HOWA 2QO2A 3I7CA 3LAUA 4GS6A 4RQVA 4RZVA 4JX3A 4K18A 3ZS5A 3WF9A 4EZ3A 4F4PA 4O86A 3BZ3A 5IQAA 3QCYA 4HYSA 5HX6A 2HCKA 3GT8A 4CD0A 4JBPA 2OH4A 5HVYA 3TIYA 5IMEA 3QYZA 1H0VA 5G1XA 3PJ2A 2AUHA 4EJ7A 1OKWA 5C26A 1KOAA 3RWPA 3ID6C 2J4ZA 4XP2A 4DTAA 5CEPA 1ZMWA 2PZPA 3MSSA 3QQFA 4FUXA 2A19B 3PIXA 4UZDA 5J5TA 3DCVA 4JI9A 4F7SA 1PXPA 3TNQB 2W1DA 4FV6A 4R1YA 3UNZA 4YPDA 3ROCA 4O0RA 4TZRA 4AA0A 2C68A 1CKIA 4V0GA 3WF6A 5IH4A 3WIGA 3CD8A 3EFKA 3NW6A 4PF4A 5DE2A 4K9YA 3B8RA 2PHKA 5AR3A 1PXLA 4KNBA 5BVKA 4EOKA 3N51A 4PMSA 2UZLA 3AC5A 3GU6A 3W1FA 2H34A 5JGBA 4GL9A 4MF0A 3BEAA 3BWJA 3M2WA 4XV2A 4BIEA 3SLSA 4F9BA 3Q9ZA 1OIYA 1QMZA 1OPJA 2A27A 1BI7A 4QP9A 4AT5A 4CKRA 3ACJA 5KKRC 4FSMA 3ZLYA 2XNEA 3V5WA 5DIAA 3PVWA 4R7IA 4NM0A 4A4LA 3GOKA 4YJUA 3ZOSA 4QMZA 3H10A 3F5UA 4DGMA 5ETIA 1XWSA 2X8IA 3FJQE 4DGNA 3OP5A 3ZRLA 3AC1A 2BKKA 4OT6A 5CY3A 4PDPA 4G3CA 4FNXA 4C0TA 3MWUA 3EIDA 5AUVA 2P33A 3TKIA 4ANLA 5IMXA 3ETAA 5I5ZA 3QA0A 3V5LA 1BLXA 5T6KA 4O0YA 1T45A 3A7JA 5AIRA 4RJ3A 3NYXA 1GZKA 4GH2A 3WBLA 4EQMA 3EN7A 5B7VA 5DRDA 2B0QA 4ZTMA 1UA2A 3LFAA 4F7NA 5AM6A 2BFYA 2YERA 4U43A 5GIOE 3Q5ZA 3MIAA 1JKTA 4A4OA 1Z9XA 5J1VA 4L3PA 3FZTA 4DE4A 2OXXA 5EYKA 3RK9A 4FKIA 4G3FA 4JOAA 1ZLTA 4ERKA 3BLQA 5E8ZA 4RMZA 5M07A 5I9YA 1OIUA 4X6QC 3E3PA 4XHKB 4DYMA 1ZXEA 4W8DA 1Q8ZA 2VX1A 3F2NA 1YQJA 2PE1A 3FQSA 3KVXA 4GFOA 4I20A 4LL0A 4R3RA 3OG7A 3D0EA 1H01A 4XUFA 3T9TA 2RG6A 2VTIA 4MKCA 5DN3A 5A9UA 2UZWE 2RIOA 4IWPA 4JQ8A 4CT1A 1O6KA 4YHTA 3UZPA 4FT0A 4EOMA 4DITA 4O38A 5HZNA 3W8QA 1WVWA 3F2RA 5FM3A 2CMWA 4TYHB 2OIBA 5CU3A 3UC4A 4RC4A 4G9CA 4JG6A 5E8SA 4LOQA 3ZFMA 5AV0A 1M2PA 4KBAA 1NY3A 5AA8A 1E1XA 1MRVA 3BU3A 2WMXA 3GUBA 1KE7A 1PXKA 5K9IA 2VWYA 3OBGA 4KIOA 4U79A 4C35A 1PMNA 3Q2MA 4P7EA 1LP4A 1ZYLA 3AD6A 5FEDA 2DQ7X 4KKHA 4L42A 3U4UA 1URCA 2ZM1A 3FQEA 1Q61A 5F1ZA 4NEUA 2WMUA 4FK6A 3ATTA 1GZOA 4RG0A 1YVJA 3PJCA 4RJ8A 3MESA 3DXQA 2OJ9A 2YCRA 1OKYA 1FGKA 4BZOA 4ZMFA 3KXXA 3CY3A 3R0TA 1P5EA 3D83A 3LFSA 1URWA 2XM8A 1JWHA 3DJ6A 1GZNA 4KBCA 3TT0A 5JK3A 2BMCA 2OIDA 3QC4A 5FWKK 4WA9A 4FKVA 4OAVB 2WMVA 3O7LB 3O8TA 4QPMA 2WEIA 2C1BA 3I7BA 4KIQA 4YJRA 5IA5A 4HVGA 2C3JA 5J9ZA 1UKHA 2C5OA 4TY1A 3PRIA 4UWCA 2F4JA 4BFMA 4MXAA 4AN2A 1LUFA 3UODA 3UVRA 4MBLA 2YEXA 4BDEA 3D7TA 3KKVA 2IW6A 2X7OA 5DEYA 2GS6A 4BCMA 3UE4A 2YM4A 5CLPA 4BWPA 4E6CA 5HORA 4H1JA 4OR5A 4D1SA 5LJJA 3OT3A 3P86A 2CKOA 1YOJA 2WMWA 2VTNA 1YDRE 3ORMA 3ZM4A 4BY9E 3DAKA 4EONA 2EXCX 5JZJA 4CCUA 3F61A 2ZMCA 5HOAA 3AXWA 2PMOX 4A9SA 3I81A 5I3RA 4FKJA 2NNWB 2ETRA 5IH6A 5HE0A 5KBQA 4FSUA 3SA0A 5EOBA 5ACBC 2XVDA 4USFA 3CQEA 4LYNA 3ENMA 4MVFA 2VTPA 3LXLA 2FSMX 4J71A 3KXHA 5LVNA 3NAXA 4U44A 3O17A 3QD4A 4BCPA 4I24A 2F57A 3C7QA 2CSNA 4MNEA 5LMKA 4E1ZA 4YTHA 3OS3A 4DN5A 1P4OA 3DNDA 3HA8A 4EK5A 2UVZA 4FC0A 3TZ8A 3UIUA 1OMWA 3AQVA 4LL5A 2Y6OA 2ITPA 5D7AA 5JN2A 2YDJA 4FG8A 4E6AA 2ZDUA 3E8EA 4D0WA 5BYLA 3GQIA 3TDWA 4DH8A 3A2CA 4MBJA 4JDKA 1LPUA 5EH0A 4FGRA 3HV6A 4FF8A 3MV5A 4C57A 2F2CB 2VWVA 2WHBA 4XH6A 3LIJA 2VU3A 3T8OA 2Q83A 3TUDA 5EM6A 4AOIA 4NM7A 5T3QA 3VBXA 4C2VA 4BI0A 2PULA 5CVGA 4EHGA 3I6UA 3PZHA 2XJ2A 5EKNA 4P90A 4D55A 4TYHA 5HE2A 4IX4A 3K5UA 1JSVA 4BHZA 5HHWA 1PYEA 2OFUA 4OTFA 3VULA 4G34A 3QZHA 2ZOQA 1QCFA 4RC2A 5BUJA 4EZ5A 1XBAA 4BCIA 1IASA 2XK9A 3QZIA 4DH7A 1BYGA 4Z55A 4L7FA 5IISA 3UDBA 1FBNA 1OI9A 3LJ1A 3CEKA 3OXTA 3WYYA 4HGLA 3VBTA 4RVLA 3TTIA 2P2HA 3NUYA 2XK3A 3HVCA 4BTFA 4WNMA 3R7VA 3V04A 2WD1A 4UWBA 4IDTA 2C5XA 4I92A 2JBPA 2ITZA 4B8LA 3H3CA 5CZIA 3R8UA 3VS2A 2XNPA 4ZZOA 1ATPE 3E88A 2OJIA 2BHEA 4HPTE 3AC2A 2G9XA 4M12A 4QMWA 4RJ4A 1AQ1A 4NK9A 1V0PA 3SRVB 3C4EA 4G3GA 4BDCA 3U54A 3NVKI 2WEVA 4NFNA 1J1CA 2ESMA 5DGZA 4RT7A 1MQ4A 1WZYA 3PLAE 3LXPA 1Q3WA 4JAJA 3R04A 4G31A 4IVDA 3QKKA 3F5GA 4FMQA 4UMTA 5CQUA 2XNNA 1MRYA 3LXNA 4FIIA 5CYIA 4CFMA 2XF0A 3F9NA 2UW3A 4J98A 2QOOA 4L9IA 3R63A 3NZ0A 1G3NA 2X8EA 2YIQA 4ANOA 3G6GA 4DFZE 1T46A 2VO6A 1QPDA 4RZWA 3D15A 3TZ7A 3UG1A 2YM3A 3QKLA 2QONA 4L67A 3D5XA 5CEKA 2OW3A 3ZC6A 3QRUA 3FY2A 4R5SA 3AMAA 3SOAA 3FMKA 1XH9A 4YLLA 4AS0A 4DFXE 2I0VA 4CQEA 4GT3A 4IJ9A 5DFPA 2JKMA 4U81A 4JDHA 2J2IB 5TKDA 4EOQA 1FVTA 3RALA 2R3QA 5JGAA 2BZJA 2HYYA 4IHPA 4Z7GA 3F7WA 1MP8A 2OG8A 4MXXA 4U45A 4XV9A 3VNTA 3BQCA 4HPUE 5E8XA 3D94A 2HZIA 3FMJA 4UALA 3LFQA 5FEEA 4IC7A 4DINA 3ZYAA 3I4BA 3SG8A 1UNLA 1XQZA 3GFWA 3GQLA 3FMLA 3ZXTA 2YWVA 1W98A 3TWJA 2P3GX 4PDSA 3LQ5A 2Y8OA 1RDQE 3CGOA 2C4GA 2RFEA 3FE3A 3FKNA 3PXQA 3ACKA 4V04A 4MXOA 4FSQA 5AUYA 2VWXA 3LVPA 4ZZNA 5H9BA 4ZTRA 4MBIA 3ZFYA 4AZFA 4D2PA 3ZMMA 4AFJA 4YC3A 3OTUA 2J0LA 3MW1A 4AU8A 2XEZA 4AZEA 2YACA 1SMHA 2IVVA 3OBJA 5FLFA 4TL0A 4FSWA 1YI3A 2HW6A 3BHYA 4L8MA 4YJTA 4V05A 4AZVA 2HY81 3NUUA 1QPEA 4ZZMA 2GPHA 2HXQA 4YO4A 3EB0A 2F7XE 1R0EA 4B7TA 3VS6A 4BDIA 4BL1A 4ITIA 4OLIA 3NYOA 1OPLA 2WMBA 2XYNA 3FDNA 3UVQA 3O0GA 3RAHA 3DBEA 3DDQA 4BKZA 4MF1A 4O2ZA 4O91A 4AXAA 4EH9A 4GVJA 4C34A 5KMIA 3F3TA 5FQDC 2XP2A 4D1ZA 1OL2A 4IW0A 1S9IA 2WAJA 3S1HA 2GQSA 3QAME 4PQNA 2X2MA 4YHFA 2QOFA 4YP8A 4DCEA 4OTRA 3MH3A 4BTKA 4U6RA 4WOVA 1W83A 1WMKA 4IWQA 4JRNA 5BUEA 2YA9A 3L9MA 4OUCA 3MVHA 3ZFXA 3MB6A 5JFXA 2C5YA 2GSFA 2W9ZB 2XK6A 2Z7SA 3GC8A 3O50A 4FTQA 4FTKA 4RIYA 3C4WA 4OBOA 4PP7A 2H96A 4BGHA 4I6HA 1SNXA 2Y9QA 1I44A 4Y95A 4W4VA 4QMYA 1SZMA 2BRNA 3BI6A 3ZRKA 1DAWA 1FQ1B 2V7AA 3BEGA 2VO0A 3HV7A 2XZSA 4FKQA 3T9IA 3EYGA 4EWQA 5A4CA 4WSQA 5KUPA 2HY0A 4KIPA 1YWNA 4XEYA 5KMKA 2ZV8A 4HJOA 2C1AA 4BB4A 3ZLSA 4GYIA 1ZAOA 4RVMA 4U40A 2PMIA 3VHEA 2JAVA 4PTCA 2ITNA 3ZEWA 4H05A 3HKOA 3RTPA 2BZKB 5AV4A 3TDVA 3DKGA 4KKGA 4EHEA 3RK5A 5A4LA 3KXZA 4Q5HA 3JXWA 3KF7A 4FZFB 4IAYA 4IANA 2ZAZA 2F7EE 5E8YA 1FINA 4TXCA 3CJFA 1RJBA 4UXLA 4WUAA 3VF8A 2W5BA 4F65A 2WZJA 2W96B 5JRSA 4BF2A 2O8YA 2WTWA 1FMKA 5CSHA 1PJKA 4C59A 4ZS4A 3NSZA 3UP7A 4B99A 3ORXA 3ZSGA 3TKUA 4OTHA 3KVWA 1TQIA 4O7LA 4CZUA 2Z2WA 3LFFA 4S34A 4GT5A 3S2PA 1XH8A 3ZO2A 4X3FC 1M7QA 1TKIA 4W9XA 2XCKA 3SVVA 3ZO4A 3QX2A 2E2BA 2WTCA 1SVHA 3PA5A 4TWNA 1IA9A 3IS5A 1WBSA 5C8KA 4O7WA 3LE6A 5EKOA 3AG9A 4UYNA 3KCKA 3NUSA 5TOZA 2GNFA 4R78A 3GNIB 4PX6A 2Y4PA 2J90A 2QOHA 5HO7A 5LVOA 2OXYA 5CXZA 1Q99A 4DEEA 4BCGA 2GS2A 3ORKA 4M14A 3CKXA 3FPQA 3FLNC 5HD4A 3CQWA 4FEUA 2PL0A 4GK4A 3II5A 4RFZA 4RIWB 4UV0A 4C4EA 3PY0A 3IW8A 3RAIA 1WVYA 3CC6A 5EQEA 4BWXA 3VBWA 4KIKB 1JKKA 4ALWA 2GS7A 4WNPA 4A9TA 3NX8A 4ZLYA 2I7QA 3ANRA 3G90X 3HZTA 2X9FA 4FNZA 3WZEA 1OECA 2C6TA 2J7TA 4G17A 4GFMA 4NUSA 5FUTA 3D14A 3FI2A 4GV1A 2WQOA 3DQWA 3FZ1A 3OTVA 2GNJA 5EHLA 4EHZA 5CENA 2B9HA 3RNYA 2WMAA 3JYAA 4E7WA 1H1WA 5E90A 5K0XA 4M8TA 3NUAA 4CFNA 4TNDA 5HX8A 1OITA 5F4NA 4RIXA 3R1QA 4FYOA 2O65A 3QXPA 5LWNA 4CG9A 4HVDA 4IM3A 4CMUA 3S95A 4ONAA 4HVIA 4PMTA 5BYYA 2C3LA 2CGUA 4R77A 3E62A 4YZCA 5DT3A 3G9NA 5AUXA 3FY0A 3IG7A 4OBPA 2BIKB 3KC3A 4L01A 4ZK5A 4ZSLA 3R7OA 5CSPA 3O23A 3CTHA 4HCVA 4ASXA 1NT2A 3NDMA 4FTRA 2BRBA 3ET7A 3DZQA 2BRMA 2OH0E 4DT9A 3GVUA 2UVYA 5HCZA 3C13A 5I9ZA 3EKNA 5EDPA 2WMSA 5HIDA 3IDBA 3FUPA 2JDSA 3CXWA 3PXRA 4Q2AA 3BU6A 4IC8A 2ACXA 4L7SA 4GIHA 3VC4A 4K6ZA 4YJPA 3K3JA 3DBQA 3WIKA 4FA2A 3HMIA 4KD1A 2PWLA 3MY1A 4FKWA 5ANIA 3I0OA 2OWBA 2DWBA 2Q0BA 4H58A 4IACA 4NW5A 3H9RA 3VVHA 4EHVA 2R3IA 4FBXA 1Z5MA 2C5NA 2CGVA 2QVSE 4JIKA 3P7BA 4KRDA 2I6LA 3Q4TA 2VNWA 3DU8A 4NM5A 3E3BX 4FT3A 1ND4A 4AWIA 2YIYA 3V6SA 5HBEA 3E7OA 1GIHA 4E5WA 5GJDA 2P4IA 2YAKA 4FSRA 5DR6A 3TL8A 4RJ5A 3M1SA 1APME 4V0GB 3PG3A 2W1FA 4C58A 2OO8X 4BIBA 3VUKA 3QTUA 1PXOA 2B9FA 3OF0A 4XP3A 3N4UA 4EBWA 2HZ0A 2YAAA 3VHKA 3IW5A 4AW5A 4FG9A 2WO6A 3BGQA 4LMUA 4Q5EA 4DH1A 4MWIA 5M4UA 4K8AA 2CKEA 4GK3A 3PSDA 3D5WA 5TT7A 3TKHA 2X8DA 3BV3A 4NJ3A 4MHAA 4RX7A 3QCQA 4PL4A 2JKOA 2OJJA 2ITQA 4R6VA 4YSJA 4DAWA 3A4OX 3QA8A 2E9OA 4X3JA 2CKQA 1S9JA 3UZTA 2X7FA 4X6RA 4Y72A 4QP4A 4E6QA 2YZLA 4NZWB 4FODA 4F0GA 2QG7A 3GC9A 5EG3A 2ZV7A 2FSOX 1M2RA 5C27A 2WXVA 3VS5A 3MH0A 5IQFA 3C9WA 5HKMA 4KIKA 5FP5A 3R7IA 3DAJA 4GKHA 4CG8A 1SM2A 3QQLA 5AR8A 3ALOA 3VQHA 4IWDA 1OUKA 4C4HA 4FNYA 3N4VA 5CEIA 4F0IA 2GHGA 5FM2A 3RI1A 2F9GA 4CEGA 3V8TA 5CF6A 3KMWA 1YOMA 4FT9A 5CEMA 2EUFB 5DA3A 5FRIA 1FVRA 5I4NA 2ONLC 2PPQA 5DR9A 3NCGA 2AC5A 4BZNA 3I5ZA 2Y4IC 3WF7A 2QKWB 3E5AA 2GNGA 4TYGA 1J1BA 4PPBA 2X4ZA 4QTDA 3BKBA 4F9WA 3EH9A 5EK7A 3OEZA 2OIQA 3OC1A 4M7IA 3ZH8A 3QHWA 4BI2A 2WB8A 4PV0A 4WIHA 2R7IA 3VJNA 3QALE 1WBNA 3QTRA 4QMXA 4ASDA 5ANKA 4WRGA 4RC3A 2QOCA 4FSYA 4I94A 3PDTA 2JIIA 3NUPA 3MPTA 4HYHA 3UIBA 2R0UA 4P2KA 4DFLA 3O71A 3CGFA 4KINA 3R8PA 4ZIMA 4TYEA 3VS7A 3AT4A 1CM8A 2JLDA 3UPXA 4GUBA 3AC3A 2J5EA 2JKQA 4MQ2A 3E87A 3PTGA 4DGOA 2PUNA 3C5UA 3WE8A 2XA4A 3PXYA 4QPAA 5ETAA 3W2CA 1Q24A 3WZJA 2R64A 2W4KA 1CKPA 3QZFA 5KZIA 4E8AA 4YLJA 5CEQA 1WCCA 2DS1A 2VWWA 3MB7A 3N4TA 5EDRA 5AV1A 3TEIA 1R0PA 3EQCA 3QTIA 3OOGA 4Q9SA 5KHXA 3HUBA 2XRWA 4O0UA 5EM7A 1QPJA 5CI6A 5AP4A 5EI2A 4GU9A 4ZSAA 3CJGA 2V22A 3L8PA 4QMTA 3TJDA 3C0HA 5IU2A 5HBJA 4AA4A 5IF1A 1BX6A 4EC9A 3MA3A 2IZSA 5EFQA 1YXTA 3ZM9A 1KOBA 4O27B 4KUJA 4FKGA 3TUBA 3V5JA 4U8ZA 3PFQA 2ZB1A 3BIZA 3DFAA 2UZTA 5L2TA 4EK6A 5FP6A 4ZY6A 2Z7RA 3R7YA 5AR7A 5M4IA 5HIBA 4AA5A 4OAUC 4F63A 5M51A 4EC8A 3O51A 2YCFA 5E1EA 1ZZ2A 3NIEA 4ZTNA 3RPSA 1CTPE 3HL7A 3BHHA 2ETMA 4JR3A 1OUYA 1F3MC 3FZOA 1NVSA 3ERKA 4F1OA 3CTQA 4YU2A 2BHHA 1AGWA 3TXOA 3P1AA 1RQQA 3BYOA 2EVAA 3REPA 3ZBFA 3CPCA 5CXHA 1OB3A 4JQ7A 5CX9A 3D7TB 5B2KA 4DFNA 3HAMA 3QTXA 3EOCA 3MJ2A 4QMMA 4NWMA 4YURA 5ETCA 3CIKA 3Q5IA 4M15A 3U6IA 4FV3A 3ODZX 4RVTA 3LJ2A 4NIFA 4IVCA 4R7BA 4L52A 5B0XA 2UUEA 4F9YA 5J7HA 2R3PA 5CU4A 3SAYA 3FI3A 2J51A 2JC6A 3FMDA 4IX5A 4ZTSA 1YKRA 5CSXA 5FEQA 2I40A 3QUEA 4HCUA 4YZ9A 3SD0A 5CAQA 5CWZA 4RFYA 4XCUA 3TZ9A 3UQCA 4L00A 4HNFA 3RHXA 3LLTA 3MFUA 4IE9A 4MTAA 4AP7A 1SVGA 4BDAA 4C2WA 3U4WA 4A4XA 5CF5A 5L4QA 3TM0A 3GB2A 3WI6A 2C0IA 4G3EA 1B39A 4JG8A 4CT2A 4P5QA 5JEBA 4WNKA 4YUQA 3QTSA 4FTIA 4MNEB 1AD5A 4X2FA 2VTSA 1J7UA 4OTPA 3L8SA 3VBQA 2OSCA 3QRKA 4OT5A 4M69A 1JSTA 3IONA 4JIAA 2B53A 2XUUA 3QCXA 2C6IA 3M42A 4AZTA 2WTKC 1G8SA 2C6DA 3L1SA 3HRBA 2W1IA 4CKIA 4LRMA 2VGPA 2XKDA 4BDFA 3R22A 4I1ZA 1H1QA 3P7CA 4HVSA 4BICA 3MFTA 4JXFA 4MYGA 5C4KA 3S4QA 5J9YA 3OOMA 3RKBA 4EH2A 2JD5A 3GC7A 3EQIA 4PWNA 4JR7A 1IRKA 4GEOA 3UO5A 4QMPA 2PUIA 2GQGA 4FV4A 2RSVA 4P4CA 4H3PA 4IAAA 4ZJJA 5CEOA 3OY3A 1IAJA 2E9PA 3QD3A 2BDFA 1GJOA 4NCTC 3JR1A 3DBCA 1W8CA 4ZS0A 1OL6A 4EWHA 4AT4A 1E1VA 4A9UA 3KFAA 3UPZA 2ERKA 3DY7A 2YM8A 3A7IA 3R6XA 1HCKA 4EEVA 5IQDA 1CDKA 2G2HA 3R71A 3E64A 3W32A 4EOJA 4GG7A 3ORPA 3D2KA 4Y73A 1PXIA 2VN9A 2BPMA 2YDKA 3UBDA 4XP0A 1JBPE 3WILA 3TV4A 3KQ7A 3BE2A 4O1PA 3LM0A 3VUMA 5J79A 2W06A 5D11A 4ZTHA 4KBKA 2W1EA 2I0HA 3PWYA 4RRVA 4EH7A 1LEWA 3NGAA 3NUNA 4L3JA 3VUDA 4QMNA 2H6DA 4EUTA 3PA3A 3EQHA 1YXVA 3FMNA 3HMOA 4FOCA 4LGDA 3LMGA 1F0QA 1OM1A 2OICA 3PIYA 4FVQA 4KS8A 3E8DA 4NSTA 3KK8A 5GJGA 4BDBA 5A4QA 1JVPP 4DEBA 5LCJA 1U54A 4S30A 5K4IA 2PSQA 5A54A 3UQGA 5JFVA 4BVUA 5IEXA 2FH9A 3E8CA 4XOYA 5I3OA 3MIYA 4QP7A 3R83A 3V3VA 4F7LA 4D1XA 4A06A 4Y5HA 4R5YA 5AP0A 3UVPA 3NEWA 5IA0A 3DTWA 2CGWA 1BUHA 3BCEA 3DZOA 2VD5A 4NFMA 1OPKA 4FTNA 3EQPA 4RWIA 2ZJWA 1B38A 2VX0A 4ASZA 4FEVA 3UZRA 2ZMDA 5L6WL 2B9IA 3DGKA 3C51A 4AW0A 2IZRA 3NMUF 3ULZA 4K0YA 4ORKA 3ZUTA 3P78A
chains in the Genus database with same CATH superfamily
1NVQA 3R8VA 1BKXA 1H07A 3A8WA 2YHVA 1UNHA 4I0RA 4CMTA 3THBA 3Q9YA 4WG3A 5FBOA 5HU3A 4D28A 1FVVA 3SX9A 4K1BA 3TUCA 2JEDA 4DTKA 3UP2A 5IA1A 3SGCA 4PMPA 3KRXA 1H24A 4XG8A 4ANMA 2LAVA 1YHVA 5FG8A 4GG5A 4FTTA 4ANSA 3MI9A 2QU6A 3ORLA 1YRPA 4YTFA 4O7NA 2XMYA 2HZNA 4Y8DA 4UY9A 4MH7A 3OW3A 2GFSA 3MJ1A 5DHJA 5D10A 2IEWA 2WNTA 2QLUA 1W7HA 5E92A 2IW8A 1CKJA 4O82A 3F5PA 4IXPA 2XJ0A 4FEXA 4JG7A 4FTLA 2JIUA 3PP1A 2C6KA 4NKSA 3O8PA 4RLKA 2YJSA 4Y5QA 3SOCA 4BCOA 3ML1A 5K0KA 4ANBA 4R3PA 2BTRA 1OIQA 3FLZA 4KA3A 3P5KA 3KN6A 2CN5A 1BL7A 2GHLA 1TQMA 2QHNA 4C33A 5IA4A 2OBJA 3R8MA 3ZUVA 2QURA 3TNHA 2JDVA 4IM0A 5C8MA 4MXCA 4FIJA 1E9HA 3TNWA 2UVXA 2IN6A 3CP9A 4RWJA 4WHZA 4U0IA 3DKFA 4YNOA 5IPJA 4JT3A 4WG5A 4QQTA 5FDXA 2C30A 3CD3A 1REKA 5CTPA 4AOTA 3LCOA 2A0CX 4G6OA 2PVYA 4YO6A 1FOTA 5EI8A 5EM5A 2XB7A 2A4LA 4TYJA 4ZP5A 2XIRA 1XHAA 1XJDA 4PL3A 2ITOA 4ZSGA 2XARA 2C6OA 2W05A 4XMOA 2HIWA 3GXLA 2XH5A 3FLWA 2CCHA 1ERKA 3FKOA 4QQ5A 5IA2A 1XH7A 3BL9A 2PVKA 3RZBA 3ROYA 2OK1A 3SG9A 3F82A 4QNYA 4QYYA 4RIYB 2WQNA 5CVHA 5L8JA 4OTQA 1OZ1A 5L2WA 2VTMA 5L2QA 1L8TA 3OCSA 2YCQA 4B4LA 4NCTA 4H39A 2R3FA 2CDZA 3NNWA 3Q6WA 3SDJA 4W4YA 1VR2A 3A8XA 4FZAB 2WQEA 4TNBA 4APPA 4D2SA 3Q9XA 4DFUA 4EKKA 5F94A 2R4BA 2QCSA 4QTBA 3E8NA 5BPYA 1STCE 5HVKA 5IDNA 1A9UA 4XOZA 3T3UA 2WIHA 4C7TA 4FGBA 5I9XA 1ZYJA 4I5PA 5M55A 3C5IA 2HELA 1UU8A 4FSZA 3UO6A 4N57A 3NCZA 1KE5A 4RLLA 1U46A 5CU6A 1V0OA 4FOBA 2YM7A 3GEQA 3LFNA 3G6HA 4J52A 3R7EA 4EH8A 4MD7E 3ZC5A 1H28A 1U4DA 4FTMA 4JS8A 4JVGA 1UV5A 1R3CA 4MD9E 4RA4A 4BBMA 2B54A 1WVXA 2UW8A 3C0IA 1XH4A 4JNWA 1DS5A 4WO5A 5JZNA 2X0GA 2X4FA 5LCKA 3A99A 5I9UA 4FJVA 4MXZA 2VGOA 3G9LX 5K3YA 3VONA 5DLSA 3RINA 4FI1A 5F9EA 4G6LA 4CFWA 2A98A 3OWKA 3Q32A 3WF5A 2WMTA 1JSUA 5AADA 4QQJA 3DPKA 2VTOA 1NVRA 5A6NA 4HW7A 2W7XA 2CKPA 3PPZA 4K11A 2OZOA 3EN9A 3AC8A 3QD0A 5HO8A 3BLRA 2WQMA 4J8MA 2XAMA 5EYCA 1JOWB 1LR4A 1QL6A 4EH6A 3ITZA 4DDIA 2W1ZA 2QOIA 3BHUA 1Q41A 5LWMA 3L8VA 2X6DA 4RA5A 2O3PA 3ZLXA 3BGZA 3UIXA 4A9YA 4DTBA 3QU0A 2PZYA 4GU6A 3Q96A 3NYNA 4NL0A 5AX3A 2EXEA 3RP9A 4E4XA 4XRJA 3IW4A 4FYNA 3BWFA 3E7VA 1WBTA 1ZMVA 2WTDA 3LCDA 3LPBA 3OXZA 3Q4CA 4WT6A 3KULA 3UMXA 2VZ6A 3NFGB 5F95A 4FVRA 4DBXA 3BYVA 3C1XA 4QP3A 4BKYA 3BYUA 2XNBA 4DEDA 3LCTA 4J8NA 3PVGA 2VTJA 3MDYA 4GUEA 4IZAA 4XRLA 4ACMA 4BHNA 4PTEA 4JJRA 4XG2A 3QFVA 1REJA 5BMSA 2NO3A 3Q60A 3GOPA 4M67A 4ZTLA 2UW7A 4D4VA 3DLSA 4I21A 2RF9A 4TWCA 4G1WA 3SHEA 4G3DA 3NUXA 4EYMA 2UZNA 3LOKA 4RIXB 2Z02A 4E26A 4DEAA 5AP6A 3CS9A 3IO7A 3LZBA 4ENYA 1CSNA 3VUHA 4ZAUA 5LVMA 5J1WA 3DFCB 4XG7A 4GT4A 2REIA 2CGXA 4O96A 2PMLX 4BBEA 4L43A 3EN5A 1H8FA 3DB6A 4I93A 5CVFA 5C1QB 1PW2A 5JT2A 4Y46A 2YM6A 4TRLA 3GCSA 4O21A 1DM2A 2JIVA 4BDJA 4ZTQA 3HMNA 3ORZA 1P4FA 3OY1A 4FX3A 4GKIA 3FLSA 4BYJA 3PP0A 4TTHB 5DG5A 1JAMA 5G6VA 3DJ5A 4IAKA 4USEA 5DEWA 3K3IA 2PUUA 3HMPA 5TO8A 1H4LA 3SC1A 2JFLA 3PXKA 3U9NA 3ORNA 1UU7A 2EB3A 4TW9A 5AUWA 2OJFE 3F66A 2QI8A 4QYEA 2VAGA 3BRBA 4FL3A 3RM6A 3P5JC 4L6QA 4P5ZA 4F64A 4LUEA 2JDRA 3EN6A 3C4XA 4PRJA 5BX0A 4YC6A 3DK6A 3SQQA 3VQUA 2PE2A 4YSMA 3ZZEA 4U5JA 2WOUA 3OCTA 2WQBA 4G6NA 4QP8A 2R3JA 4WUNA 4O7RA 2R3NA 5BVNA 4YZMA 3ZEPA 3PE2A 5BMMA 2RFSA 1KE9A 3IGOA 3L9LA 4KAOA 3IPHA 3PA4A 4X2JA 5GNKA 5HGIA 2V7OA 2BUJA 5EI6A 4I23A 4WG4A 4C3RA 4YJVA 1UWHA 2C3KA 3Q52A 2X39A 3JVRA 2QOBA 4LRJA 2X7GA 5AP5A 4O0VA 3LM5A 3NVMB 3FQHA 4CV9A 4XX9A 2BIYA 3LCSA 4L53A 1R39A 2BFXA 2VUWA 3UC3A 3HGKA 3AGMA 4ACDA 5KE0A 3FC2A 2CLXA 2IVUA 2W4JA 5AP3A 5LQFA 3W10A 2BALA 4H3QA 5A46A 3FL5A 4N70A 1P2AA 1YXXA 5HCXA 4G5JA 2VWIA 3HV4A 4IB3A 1OL7A 3P79A 2W99B 2J50A 3WARA 4O6EA 4HVHA 1GIJA 3LHJA 1O9UA 2J0MB 4QPSA 3W2OA 3FI8A 3VS1A 5L2IA 1K2PA 2WGJA 2P0CA 4JAIA 3PG1A 4G9RA 4OTGA 1PF8A 4HYIA 4PTGA 5LMAA 3BGPA 2G1TA 4D2VA 1V0BA 3S0OA 4X3FB 5AR4A 4FVPA 3ZTXA 1U59A 4U7ZA 1IG1A 3ZDUA 3UOHA 4X7QA 2FO0A 3PSBA 4MX9A 5HE3A 3TV7A 1MRUA 2PVMA 3NIZA 4XBUA 4NTSA 4EQUA 5E9EA 5IUGA 3OZ6A 1P14A 5K4JA 3LQ8A 4X2KA 4NYEA 3HV5A 2JKKA 4YC8A 5HNIX 3E93A 3W0NA 3IW6A 1ZYSA 3IW7A 3UG2A 4D4RA 2O64A 5BNJA 4FTJA 3R8LA 2F2UA 4IMYA 3ANQA 2V55A 4FKPA 2OXDA 2R0IA 3DT1A 4AW2A 2OJGA 3ZBXA 1M7NA 3CLYA 3QF9A 5E91A 3MVMA 5ANOA 5IG1A 3VIDA 4FTOA 4R8QA 3B8QA 2YN8A 1KE6A 3OFMA 4OTDA 5EQPA 3OD6X 3OCBA 4AOJA 4G5PA 2V62A 1ZZLA 1TFFA 4EOOA 1OIRA 2CCIA 2UW6A 4DFBA 2PTKA 5CNNA 2UZUE 2BZHB 4DEIA 3R9OA 4N6ZA 2BAQA 3UGCA 5IEVA 3LQ3A 1OL1A 1W82A 2B4SB 2Q0NA 3E92A 3P9JA 5ETFA 3A61A 3ZCLA 4BCJA 4ACHA 5M09A 4F7JA 4FV9A 5HNBA 3KK9A 3BYSA 3D5VA 3WF8A 5CAOA 4HGEA 5ACKA 5DMZA 4QYGA 5HTCA 4YJQA 1IR3A 5T68A 5K5XA 5A4EA 4GCJA 4N4SA 2NYAA 2FA2A 2R9SA 4ZJIA 5L6PA 2BKZA 1H1RA 4FUYA 3O2MA 5C01A 4AE9A 1YDSE 4ANQA 2P2IA 3POOA 2Y0AA 5HICA 3R73A 3CPBA 5BYZA 3W2QA 1TQPA 3A7HA 4V01A 1GZ8A 5FXRA 1ST0A 4TN6A 4CTCA 3ZO3A 4M3QA 4XG9A 2CNQA 2JFMA 1J91A 5D41A 3ZLWA 1ZY5A 4FT5A 3ZUUA 1ZOGA 2HWOA 2G15A 3ULIA 2G01A 4IIRA 2ITXA 3COIA 4O7ZA 4F6SA 3F3ZA 3C4FA 1UNGA 3OWJA 4C4IA 2JDOA 3UIMA 2C3IB 3U9CA 2VO7A 4GIIA 2X81A 4DFYA 3TCPA 4CRSA 5H2UA 5I9WA 4CXAA 3VWAA 1R78A 3D4QA 4N0SA 5F20A 3TV6A 4EI4A 5HESA 4W4XA 1W2DA 5CAVA 3OHTA 3SW4A 2BZIB 5DOSA 4EOPA 5JSMA 3ZDIA 4PNIA 3Q9WA 2CNVA 4NJDA 5IEYA 4IJPA 3FC1X 3KA0A 1UU9A 3KGAA 4DGGA 1V1KA 3IECA 3RPVA 3JY9A 2DUVA 2OZAB 4Z3VA 2YIXA 4I4FA 3POZA 4PMMA 4DGLC 3M11A 5KNJA 1G8JA 3BL7A 1Q4LA 4EUUA 1XH5A 5ITAA 3BBTB 5EHOA 2RG5A 2XEYA 4NIFB 4AT3A 4JDIA 4EJNA 4X3FA 3ZSHA 2RGPA 3MH1A 3AT2A 4OTWA 5KMOA 3KN5A 2XNGA 3PE1A 4QMOA 3FBVA 2XM9A 4EORA 4IFCA 2G2FA 5GZ9A 3UJGA 4ANNA 3QRJA 3UYSA 3ENHA 3HMMA 4FV5A 4YJSA 4AW1A 3GFEA 3QRIA 4CYJA 2IWIA 5D9HA 1ZMUA 1Q5KA 4JL9A 4CLIA 4FNWA 5B2MA 3HRFA 2Y7JA 4Y85A 4HNIA 1Q97A 4KKEA 1H0WA 1M2QA 4RJ7A 1Y57A 4KB8A 4WBOA 5L2SA 2HAKA 2BVAA 1NA7A 1LEZA 2UZDA 5HTIA 4FEWA 4IM2A 2BDWA 3EZVA 3U8WA 5JKGA 4M69B 2GU8A 3DV3A 3D7ZA 3K2LA 5CI7A 3GCPA 3DBDA 4IAZA 4IDVA 3FL4A 4MQ1A 5BVOA 2X0OA 3MY5A 4U3YA 1J7IA 4IAFA 1JLUE 3LXKA 5CSVA 5A3XA 1ZWSA 2ITWA 4GMYA 4BI1A 4C62A 2IG7A 1HCLA 3GBZA 3HP5A 2Y4IB 3L9NA 4WD5A 1Y6BA 4FT7A 4FTCA 3IDCA 4MAOA 4EH3A 3HECA 2ZFYA 5BVFA 4QP6A 2BROA 4S31A 1VEBA 1VZOA 5ANGA 3VRYA 4OTIA 1Y8GA 2UZBA 4D2RA 5I9VA 4UYAA 5M57A 3LW0A 2ZV2A 3R28A 3GI3A 2I0YA 4QO9A 1ZYDA 4TKSA 5CSWA 3R2YA 1PKGA 3R1NA 4KWPA 4AQCA 1Z57A 2PZRA 4IB5A 4YPSA 4QYFA 4K2RA 2E9UA 1ZRZA 2R3OA 3FPMA 4QTAA 3F3UA 1UVRA 1BI8A 5I0BA 3TIZA 3AD5A 2WTVA 4LQMA 3VUGA 4F1TA 3EQBA 3D5UA 4I0SA 2C5VA 5DR2A 5GHVA 2PZ5A 5ANDA 5ANJA 3TN8A 3UTOA 3PY1A 4AUAA 4D58A 3ODYX 3HUCA 3WOWA 2NP8A 1TVOA 4DG0E 3QQKA 4AAYA 2VO3A 3AKJA 1H27A 4FTUA 4TT7A 5C03A 4E20A 4L3LA 4B8MA 3BE9A 2WFYA 2QR7A 3R7GA 2QKRA 2WMQA 1UU3A 2YZAA 5JQ8A 4AXFA 5BVWA 5AX9A 5AAEA 1YXSA 5CF4A 5HG7A 1Q8WA 1BL6A 4RBLA 2PK9A 3EWHA 3Q3BA 4RGJA 3L9PA 4LOPA 2VTLA 4M97A 2VTHA 4BGQA 3OMVA 5AIKA 1U54B 2ZVAA 2J9MA 3TI1A 5HIEA 1I09A 4RFMA 4YGAA 2QC6A 3G51A 3DKCA 4AACA 4PL5A 4AN9A 3JS2A 5HBHA 4FZDB 4XJ0A 2OZAA 5DWRA 5KMJA 3KXMA 3TNIA 5GZ8A 2V0DA 2W17A 4ACGA 1OBGA 2F49A 2XBAA 1FPUA 4IQ6A 3TNPC 5IQEA 4ZSJA 3DJ7A 4ZJVA 5JGDA 1XH6A 3ATSA 4GVAA 2H9VA 1OGYA 4FKSA 4M68A 3FSKA 1YW2A 4Z9LA 3O8UA 5HCYA 3RZFA 3V5TA 3N9XA 4O7VA 3W0SA 3RPYA 2PE0A 4ARKA 2HZ4A 3A4PA 1PKDA 2C0TA 2IZTA 2C6LA 4O4FA 4K77A 3FXWA 5A6OA 4H3BA 4LV5A 4APCA 5KKRB 3QQGA 2SRCA 4UBAA 4FR4A 3UYTA 3QLGA 4LG4A 5EW8A 4BIDA 3LMHA 4DLIA 2QU5A 5HVJA 4EK3A 3LFCA 4O83A 4DA5A 4EK8A 3QRTA 3P0MA 4UX9A 3MPMA 1R1WA 5LMKC 3IK3A 5GJFA 4QP1A 1GOLA 4JBQA 4BDHA 3DTCA 4FKTA 3OUNB 4E93A 2HOGA 4ITJA 4GFGA 1RW8A 5CZHA 5E8UA 1OKVA 3BX5A 4ZSEA 5AUZA 1ZOEA 2VV9A 2X0QA 3Q4UA 2EXMA 2ONLA 5B2LA 1WFCA 3A7FA 5LXMA 4IZ7A 3KEXA 4FV1A 3TJCA 4M66A 3RCDA 4D2TA 2PVNA 4MD8E 3RPRA 4QTEA 3IOPA 2IO6A 4AAAA 2YLFA 2JITA 3HYHA 2PVHA 5KZ0A 1F5QA 3G33A 2FSTX 1KSWA 2WU6A 4U80A 2RKUA 2WTKB 3H0ZA 5J9LA 4FKUA 1ZY4A 3U6HA 4HYUA 4C3FA 4WRSA 3AC4A 5BQ0A 5CAPA 4YJOA 1PYXA 2A2AA 3PVUA 5FBNC 3MPAA 1IEPA 3MYGA 4ZXTA 4I6LA 4DF3A 5EW3A 3LFEA 3SXSA 2R3LA 3EHAA 4ERWA 1GAGA 2XKCA 2W1GA 4L44A 3RHKA 4Q9ZA 3RGFA 5LOHA 3W55A 5TR6A 1L3RE 4JBVA 2ITUA 3G0FA 3QWJA 5HG9A 3ZU7A 5KO1A 3ZZWA 4LI5A 4X2GA 4D9UA 4LGHA 2VX3A 5AV2A 2VTAA 4FKOA 2VRXA 4HZRA 2PVRA 3WZKA 3BYMA 4QNAA 5AUUA 5EYDA 2J0KA 3IDPA 3PPJA 3W18A 4ALVA 1OBDA 3OCGA 3FV8A 5DI1A 5BVEA 3PJ1A 2XYUA 2QHMA 3VW8A 3GU5A 2GNIA 4W9WA 3VRZA 1GIIA 3BPRA 1U5RA 3NYVA 4D5KA 3PUFC 2CN8A 2FYSA 3MGYA 3GU4A 2UZEA 2Z7LA 4DG3E 2ITVA 3HV3A 4JBOA 4I4EA 4CVAA 4DEHA 2W9FB 1SNUA 5M56A 5AP2A 3NLBA 1Y91A 2CLQA 2E9NA 2YCSA 5J8IA 5HLWA 5C4LA 3DB8A 5CT0A 4I5MA 5C8NA 3FSFA 4I0TA 3NW7A 4GYGA 4FV2A 5HI2A 3EYHA 3WZDA 4RX5A 2LGCA 4CV8A 2C6MA 4ZY4A 4BTJA 4ZOGA 1OKZA 1DI9A 5IH5A 3R02A 1X8BA 3QQJA 4HZSA 3QBNA 3CSVA 1YXUA 4I6FA 3IKAA 2VNYA 4F9AA 1Y8YA 2IW9A 3I60A 3PLSA 2WTJA 4IZYA 2XNOA 1JKSA 4HOKA 4JQEA 4J99A 4J97A 4R7HA 3UNJA 4AZWA 3MFRA 3EN4A 4MXYA 4R3CA 3ZONA 3VN9A 3LFBA 4UMUA 3Q2JA 5IQIA 1QPCA 3F3VA 3QWKA 2QLQA 4H1MA 5HO6A 2J5FA 5IQCA 4AF3A 4O84A 4IZ5A 5HE1A 1G8AA 1KV1A 3FKLA 3U51A 3V8WA 2ERZE 3BQRA 3H9OA 5AJQA 5M4FA 2PZIA 3FYKX 3JVSA 3KRLA 3W2SA 3HA6A 4UEUA 4ITHA 5J95A 4D4SA 3BU5A 1ZYCA 4F99A 5FXSA 1W2CA 4LV8A 4YTIA 5AAGA 3SXRA 2KTYA 3KRJA 2XJ1A 3IQ7A 3K54A 1IA8A 3DLZA 4YJNA 4LGGA 3AD4A 1U5QA 3HX4A 4J95A 2J0IA 4C4GA 5L8KA 2C47A 3LCKA 2J0JA 3DS6A 3PSCA 4CNHA 5JFWA 3ORIA 1YWRA 4FK3A 1M17A 2ZB0A 2RL5A 3EQDA 2FB8A 3KULB 3PUPA 4FIHA 4KSQA 4TYIA 5E8VA 4UXQA 2JAMA 4EOLA 3QD2B 3KF4A 4NT4A 1J3HA 4S32A 5E7RA 3QC9A 4WKQA 4C38A 2IVSA 5BUIA 4WNOA 3G2FA 3QLFA 1YOLA 2BAKA 3CQUA 4FV7A 4RQKA 1Q8YA 2FVDA 4KS7A 4LOOA 5AP7A 4EBVA 1WBVA 3CCNA 4FSNA 5KCVA 4MCVA 2PUPA 3V51A 3OW4A 3PJ8A 3SV0A 4O4CA 2UW5A 2GMXA 5DH3A 3MVLA 5AR2A 4YZNA 5FXQA 2IZUA 2QOKA 2OFVA 2WOTA 1SVEA 3EL8A 3FZSA 3P4KA 4QOXA 3W0MA 3DOGA 4M0ZA 3WE4A 3KCFA 3VF9A 3ZRMA 3LKMA 1XR1A 2BTSA 3PZEA 4J96A 2JBOA 2XS0A 3MS9A 4W4WA 4FE2A 3VW6A 4MEDA 5IZFA 3B2TA 4EYJA 4B9DA 5AAFA 4UMQA 3BHTA 5TF9A 1Q8TA 2BAJA 5CU2A 4B6LA 3DQXA 4BDDA 1O6YA 4XS2A 3V6RA 4CLJA 5GZAA 4AGUA 2YLEA 4DHFA 2PU8A 3PJ3A 2Z7QA 5HTBA 4YBJA 2YISA 3CY2A 2XIZA 4NM3A 1JPAA 4XBRA 3B2WA 4UN0C 1MUOA 4UWYA 4DEGA 2OGVA 5GIPE 4GSBA 5L8LA 3QTWA 4I5CA 3F69A 2Z8CA 3EQGA 5HG8A 4H36A 2R3KA 3Q4ZA 3NAYA 4E6DA 4IFGA 2C0OA 3A62A 3MTFA 5EDQA 5H3QA 5EHYA 2F7ZE 5FTOA 5CF8A 2WMRA 4ALUA 4CFFA 2BRHA 2CHLA 2VTTA 3D9VA 1KUTA 3RCJA 4G16A 1H00A 3OVVA 4A9RA 3W0QA 3EJ1A 4PDYA 3GGFA 2YM5A 4ZMEA 2XNMA 2UZVA 5CASA 1VYWA 4MK0A 3ZXZA 2R5TA 2XCHA 4CTBA 4D9TA 5L6OA 4BN1A 4Z16A 4WBBB 1GY3A 3OUKA 4PNKA 2GNHA 4XYFA 4QT1A 3KREA 2UW4A 3QYWA 2R3MA 4ZEGA 3H0YA 5IDPA 3R30A 4NKAA 5IUHA 2XIXA 3C0GA 4YHJA 3FMHA 5CQWA 4AZSA 5EM8A 3PIZA 1XO2B 3JY0A 3RVGA 4A7CA 1W0XC 3MBLA 2YIRA 4E5BA 3F88A 3DAEA 2FSLX 3AMYA 3DA6A 4OGRA 3W0PA 1W2FA 3DNEA 3KU2A 4AFEA 5AM7A 3UMWA 3V8SA 2C69A 2OLCA 3FHIA 3V5QA 3FEGA 1J7LA 3W33A 4O0TA 2HWPA 2EWAA 2OKRA 2OF2A 3DXNA 4FZ7A 2WELA 1NXKA 4XG3A 5HLPA 1EH4A 3RPOA 4UMPA 3WYXA 3NR9A 4QD6A 3R1SA 1H26A 2XKFA 5DT0A 4CFVA 3BHVA 4QP2A 3GCUA 4L68A 3RJCA 2QODA 4E73A 3R7UA 3V5PA 2VWBA 5FGKA 2GTMA 5AP1A 3ZO1A 1Q8UA 2YFXA 5AMNA 1BMKA 3FYJX 4CRLA 3U6JA 4K33A 2QOQA 3RAKA 3FI4A 3HLLA 2ITYA 1VLRA 3EFWA 2AC3A 2YDIA 4RX8A 1PXMA 3COKA 4AG8A 4C36A 1FGIA 2A1AB 1YI6A 2RFDA 5IQBA 3QGWA 2IPXA 5M44A 5E8WA 2FGIA 4C4JA 4RPVA 2BDJA 3G0EA 4PP9A 3MTLA 4QMVA 3RK7A 1YHSA 1FMOE 3GU8A 2E9VA 4I5HA 4FV8A 4U41A 2NPQA 2WPAA 4O2PA 4BWKA 4QMUA 4GJ2A 5KHWA 3W0RA 5FTQA 4BGGA 3GCQA 4F6UA 1XKKA 4CFUA 3MN3A 3KRRA 4YZBA 4DG2E 4FV0A 5KMMA 2XK8A 2DYLA 4XLIA 2J6MA 4I22A 3EQFA 3FMMA 5CALA 3EMGA 5EQYA 3Q53A 3OEFX 4GRBA 5H8BA 2ZV9A 3ZHPC 4YMJA 2G2IA 3QX4A 1DI8A 4YNEA 4EH4A 2B1PA 4RVKA 4FSTA 4F6WA 3PPKA 4BCFA 2YABA 3CE3A 4LV7A 4BDKA 2Y6MA 2HXLA 4BC6A 4Y83A 4GK2A 4IVAA 1A48A 2ZDTA 2BILB 2B9JA 5CNOA 4O0XA 5FTGA 2GNLA 2XK7A 3KY2A 3U87A 3SW7A 2QOLA 5KMLA 4NW6A 4O1OA 4D4YA 2R7BA 3KXNA 4RWLA 4EZ7A 2W1HA 3AOXA 5JFSA 3OXIA 3F7ZA 3MA6A 4YLKA 3P7AA 5ANEA 4BTMA 2JDTA 4CZYB 3EZRA 4IB1A 3KRWA 2CPKE 1IAHA 3TMOA 4XV3A 3OT8A 5H8EA 2OI4X 5DRBA 3HEGA 2YITA 4O0SA 3DK7A 4IEBA 4I3ZA 4R1VA 3A7GA 3H4JA 3AT3A 3MVJA 4O7YA 3TYKA 4G2FA 3R9HA 2PY3A 2W1CA 3DBFA 4F0FA 3W8LA 1H08A 3VO3A 2Z60A 2IVTA 2QNJA 2X2LA 4BBFA 3HRCA 3FZRA 3AMBA 3DDPA 3NNXA 2GFCA 4O0WA 5DPVA 4CSVA 5DNRA 4U9AA 4QTCA 3C50A 3Q04A 4PPAA 2AYPA 2QG5A 2RFNA 1JKLA 4UZHA 3SKCA 4EOSA 4DCAA 2B55A 4F70A 5BVDA 3I5NA 4BDGA 3SRVA 4IBMA 2P55A 2B7AA 3PRFA 1W84A 3E63A 3DKOA 2FUMA 2O2UA 2O5KA 4FTAA 1ZARA 1MQBA 3FHRA 4I6QA 5J87A 3SXFA 5J5SA 2NRUA 1OL5A 5HG5A 4DT8A 2VTQA 2ZM3A 5IQHA 3Q6UA 3P08A 4LFIA 4J1RA 5EYMA 4FG7A 3EFJA 4GW8A 3IOKA 3QHRA 3UO4A 3BLHA 5IQGA 5AV3A 4QEBA 2WIPA 2GHMA 1K9AA 3NW5A 3FXZA 3IGGA 5HLNA 2GTNA 5A14A 1OVEA 2ZYBA 3O96A 3BELA 5KBRA 3I79A 2IJMA 1SYKA 4AGDA 4E3CA 5CANA 3T3VA 4U3ZA 1CMKE 3OWPA 2XIYA 4BZDA 4CMOA 1PMVA 3MY0A 3EQRA 4F9CA 2R3RA 5HQ0A 4RSSA 3R9RA 4JLCA 3AGLA 4X0MA 3NNUA 3TACA 3C4CA 3CBLA 1G5SA 4D2WA 2X2KA 4O81A 1WBPA 2GQRA 4JX7A 3I0QA 4AN3A 5E4HA 2W5HA 4IWOA 3W16A 2NRYA 4DBNA 4FIGA 1YWVA 3PWDA 5L3AA 4CCBA 4ZLOA 4M0YA 1M52A 5HEZA 4FIEA 3I6WA 3VBVA 4OBQA 3UDTA 5CAUA 3ZSIA 3QTQA 4BCNA 2YIWA 4AX8A 4O22A 4HGTA 5HD7A 4XG6A 4CQGA 5M53A 3EL7A 5LMBA 3VS3A 3LMIA 3HNGA 1GNGA 1PXJA 3VJOA 4QDVA 3UQFA 4EQCA 4F08A 1OGUA 4NH1A 3CKWA 2GDOA 4B0GA 3FAAA 4FL2A 2EB2A 4HGSA 3KXGA 5D1JA 3V01A 2BRGA 2QO7A 2UW9A 1WBWA 2B52A 3COMA 3I1AA 3OROA 1Q3DA 2XRUA 4KSPA 5EW9A 5IUIA 4IADA 4YZDA 2ITTA 4LUDA 4M13A 4UB7A 2VWZA 3RBWA 4O6LA 4JRVA 3UOKA 1PHKA 3R21A 4FKRA 4BCKA 3L8XA 3RWQA 1O6LA 1YHWA 3BV2A 2WKMA 3ORTA 4RJ6A 3RM7A 2HK5A 1VYZA 3UOLA 4CFXA 4EKLA 4BCQA 5EOLA 3FXXA 4XLVA 5LVPA 4QYHA 2HW7A 5DT4A 4CKJA 3GP0A 2QQ7A 4J7BA 4X2NA 2UV2A 5A4TA 2ETKA 4TWOA 4U42A 3W2RA 3U55A 3TZMA 4DLJA 3CR0A 4ID7A 3R9NA 5LARA 2XK4A 2PVFA 3CTJA 4BKJA 1M14A 4I6BA 4USDA 2VWUA 2XALA 1PMEA 3GCVA 2C6EA 5CU0A 2CNUA 3KIOC 4TPTA 5D7VA 4EL9A 2I0EA 3LJ0A 3FMEA 2GCDA 2W4OA 4KABA 4FICA 2O63A 4XNEA 4DH5A 4O7SA