3HP2A

Crystal structure of human p38alpha complexed with a pyridinone compound
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
352
structure length
341
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Discovery of N-substituted pyridinones as potent and selective inhibitors of p38 kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 110
structure length 341
sequence length 352
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hp2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hp2A01
3N4VA 4KIPA 3BX5A 1ZYJA 4JG7A 3F7WA 4RIWA 5CSVA 4HNIA 4F99A 4F6UA 1WVYA 3GC8A 1WBTA 1H08A 3MPAA 3FL5A 2X2KA 4M67A 3NGAA 2XBAA 4CV8A 3HL7A 3FPMA 3QQHA 4FMQA 3UIUA 2XYUA 1Q99A 2CKEA 2XNEA 3HV6A 4NK9A 4QTBA 4QPMA 3ZYAA 5KMNA 3NDMA 1YDSE 2W9ZB 4WT6A 5FP6A 3V5JA 3RCDA 4F70A 3LIJA 4OT6A 1XH5A 4N6ZA 4UX9A 3LLTA 4QNYA 2XRWA 2OGVA 1KWPA 2VTOA 4QPAA 3KXXA 4FYNA 3DKOA 3F5XA 3QLFA 2CLQA 5M08A 4MXZA 3FJQE 4C4JA 4DEHA 4QQTA 4XJ0A 4F1MA 1OBDA 3Q5IA 3R8LA 1H8FA 4FYOA 3OBJA 2BILB 2JIUA 2ZVAA 3NUXA 4WUNA 3ZLYA 5ICPA 3HV7A 3GU4A 4IACA 5FXQA 1I44A 3RAIA 5FM2A 4BL1A 4WNKA 3POOA 4DTKA 4BR3A 2JGZA 4USDA 3E8DA 4M66A 4KIKB 4TW9A 3MTLA 3OWKA 4CD0A 5IPJA 2VX0A 2XIRA 3DTCA 4O7ZA 4GUBA 4DEIA 4RC2A 2VWYA 3QQFA 4NM7A 4UEUA 4YC6A 5EH0A 5KKRC 3P86A 5KHWA 4FTIA 5DR6A 3P5KA 3SHEA 1GIJA 2YCSA 3ZLWA 3KRXA 1NA7A 3BHYA 3CPBA 3IG7A 4IX6A 2R3HA 4IZYA 5B7VA 1OPJA 4YZMA 3ROYA 3A7JA 1SNUA 3PXYA 4IW0A 4BDIA 4BBMA 3BYSA 3FLQA 4FTCA 3EN4A 4FTJA 2ITQA 5IDNA 3H9RA 3S0OA 3CPCA 1Q41A 3EL8A 3FY0A 3EQFA 4WOVA 4LGDA 5E8VA 4LG4A 2HW7A 4MX9A 5AAEA 2WU6A 4GFGA 4QMMA 3MH0A 4RG0A 3WI6A 5BQ0A 3OW4A 5IQIA 1WBWA 4EKLA 3KY2A 4RRVA 4A06A 3O7LB 1FINA 4AGWA 3G9LX 4FSQA 2DUVA 2VTRA 4OW8A 4FKLA 2JKMA 4CFNA 5M56A 1H0WA 5AR5A 3COIA 4ACCA 4EBWA 4I92A 3QHRA 4FUYA 4C33A 4DG0E 4XG6A 2XM8A 1O6YA 4Y83A 3IS5A 4GS6A 1H01A 3NNXA 3VUMA 4EH7A 4PTCA 5CEMA 4FIEA 4LGGA 4RVKA 4BCKA 5KKRB 4KBCA 4DT9A 2GSFA 4NEUA 4AOJA 5A4LA 3TCPA 1UVRA 4X3FC 4C4HA 5BNJA 5LMKA 3S00A 4H1JA 2WOTA 3U6IA 3LKMA 1PMUA 3DBFA 2WELA 3NAYA 3DK7A 3LLAA 4XV3A 1UKHA 3RM7A 3VS6A 4ENYA 2XM9A 2AC3A 3FMMA 3WYYA 5KHXA 2C69A 2PMLX 3E8EA 1Q61A 2RFNA 3GOKA 2OZOA 3QRJA 3FPQA 3SA0A 1OBGA 5KNJA 2BHEA 2CHLA 2W0JA 2WTWA 3PPKA 5G1XA 4U43A 1IG1A 4UWYA 3FXXA 1PHKA 1QPCA 3VS0A 5CAPA 5L4QA 3CQUA 2GFSA 4U80A 2J50A 4DTAA 5D7VA 2ERKA 3GI3A 2GNLA 2QOCA 4O7SA 3U4UA 4KAOA 4G6OA 5AWMA 4BDDA 4B99A 5EKOA 4MBJA 5AIRA 2CPKE 4IVCA 4UMTA 4ZSGA 1PY5A 4J99A 2CNVA 2I0HA 1QCFA 3HUCA 3MV5A 3RPVA 3E88A 3AT2A 2VX3A 3BELA 3D9VA 3ZRMA 4RX5A 3AGMA 3C7QA 4AQCA 4G16A 2J7TA 2IW9A 4BCNA 2XK6A 5CAUA 4MXOA 5CQWA 4XBRA 5EYDA 3V5TA 5A9UA 3KRLA 4FNZA 4D1ZA 4J1RA 5JT2A 4WUAA 5L8LA 4JDIA 1TQPA 4JG6A 3O96A 1S9JA 2QKRA 3EYGA 5E8WA 4V01A 4WNOA 2UW7A 2ETMA 3R1QA 3A61A 3FBVA 3R8PA 1PW2A 3S2PA 4JG8A 1PXLA 1S9IA 1SM2A 3HV4A 3FDNA 2FUMA 4IDVA 4ZZMA 1SVGA 5I9UA 5AUTA 1OUKA 5JN2A 1X8BA 2QU6A 3L1SA 4APCA 3QQKA 3VRYA 2Q0NA 1YHVA 3B8RA 3QCSA 3E3BX 3VS5A 3ZRLA 2XK3A 4ANBA 2PVYA 4L68A 4EWHA 4AZEA 4PL5A 4GL9A 5HIEA 3CD8A 5DR9A 4FC0A 3HGKA 3P78A 5IEYA 5HOAA 4KRCA 2W1FA 5HIBA 4TNBA 2WNTA 2WXVA 1SYKA 4FIIA 5B2MA 1FGIA 2W06A 2J4ZA 4BDKA 3QAME 4QMSA 3GFWA 2ZM4A 4D5KA 2OJGA 4FTAA 3IQ7A 2BKZA 2XNNA 3PIYA 3HECA 3K54A 5LVLA 5D10A 2HZ4A 4D58A 1Q3WA 5A3XA 1Q24A 3UP7A 2W4JA 2B9HA 3AGLA 5EYMA 3G90X 2ZV2A 1JAMA 1LUFA 1JBPE 2XZSA 2YITA 4J8MA 1G3NA 5LMKC 4JQ7A 1NT2A 2H8HA 3RMFA 4EH3A 4PX6A 2PVLA 4I6QA 2GTMA 4JDKA 4LL5A 4MXCA 4AN3A 3PY1A 1LEZA 2NRUA 3AC2A 4KBAA 3RZBA 5E4HA 3PXRA 3OBGA 5CAVA 3PXZA 3ZFXA 3EQIA 4MQ2A 4ZTQA 4D2TA 1RDQE 4AZTA 5LOHA 3H10A 2VO0A 4L44A 1ZOEA 3MW1A 5GZ9A 5DT0A 4AU8A 3Q9WA 4FIJA 4BKZA 5F20A 1G8AA 1Q3DA 5AP3A 4RZWA 4UYAA 2A0CX 4A9SA 5I9WA 2ZV8A 4BI2A 3FQEA 1CKJA 2ZDUA 4TTHB 4DG2E 3MVMA 3N51A 5E9EA 3PXQA 4JBPA 5ANGA 4BCOA 4TRLA 4CFXA 1CM8A 5GJFA 2FSTX 1UU3A 2WIHA 3CR0A 3JY9A 4RQKA 3HZTA 3LAUA 4UXLA 4XP2A 5IA1A 1I09A 3OCBA 3W33A 5EK7A 1Y57A 4NW5A 3RP9A 4CMOA 2W7XA 5FRIA 5EOBA 4JX3A 3NR9A 1GZ8A 3QCXA 4U44A 2PU8A 3C4ZA 2E9OA 4JIKA 4YZBA 4RC4A 3TEIA 3HUBA 4E8AA 3GQIA 3HDNA 3FI2A 2WTVA 4L7SA 4LFIA 3D0EA 3MH3A 4CFWA 4JBVA 3R7IA 4GH2A 5H8BA 4BCQA 5A6NA 5M4UA 2R3FA 3VJOA 4Z16A 3VBXA 4FKVA 4BDHA 3EQBA 3SXSA 2YCQA 5L6PA 2BAQA 2QQ7A 2O5KA 3COKA 3DA6A 3EN5A 3R9DA 3FZOA 4B4LA 2HXQA 4AOIA 3RBWA 5IQAA 3ENMA 2W5AA 2YFXA 3ZH8A 4E4LA 3QQJA 4MBLA 2R3PA 3SOAA 3BBWA 3DU8A 4C2VA 4PMSA 3LJ0A 5B2KA 4BGGA 3KFAA 4I5CA 1H07A 1JKTA 2BDFA 3NYXA 4UMRA 1YXVA 3ZU7A 4JRVA 4CFUA 3VO3A 3TDWA 3UOJA 4TZRA 3VVHA 1PMEA 1JOWB 1XKKA 3C51A 3KVXA 4O7VA 2C6MA 4AFJA 3IGGA 2VWXA 3QRIA 2JDOA 1W0XC 4GK2A 2XIYA 4R1VA 3S95A 3MVHA 3K5VA 4E5AX 2YDKA 2VWBA 2GS6A 4GT4A 4KKHA 3RPRA 3OXTA 3ROCA 1T45A 1ZRZA 1ZYLA 2JKKA 2B9JA 3JY0A 4I1ZA 3BU5A 4EH6A 2H34A 2IVTA 2YACA 4IAKA 3H0YA 4Y95A 5CVGA 4EK8A 4BZOA 5CALA 2YZLA 5ETCA 5IH5A 5M07A 3Q6WA 3ULZA 4C4IA 1PMVA 3QTZA 3EQHA 3HLLA 5GJDA 5E8YA 5L8JA 5AFVA 3MH1A 1BKXA 4TYIA 2VWUA 3F69A 3QRTA 5IISA 2JKQA 3P23A 4HGTA 4YUQA 4LGHA 2XH5A 3ZFYA 3OCGA 5CEIA 4IC7A 2VNYA 3S4QA 4S31A 3IK3A 4NJDA 4YBKA 2R3LA 4BWPA 3Q96A 3ZUVA 3LFCA 3EH9A 3LM5A 3NNUA 5AV3A 5FXRA 5IMXA 2UZBA 4WBBB 3GCQA 1XH8A 3BE2A 3WYXA 3C5IA 3NRMA 2RF9A 2C30A 3O17A 4OTFA 2J5EA 1URCA 2VWIA 4LOOA 3MS9A 2C0OA 2A27A 3CTJA 2REIA 1GZNA 4YC3A 3PVWA 3OVVA 5CF8A 4H05A 3V6SA 3MJ2A 3MJ1A 4ZY4A 1AD5A 1AQ1A 3NWWA 2VTLA 3OT8A 2I6LA 3WILA 3NX8A 5CF4A 2VUWA 4O0WA 3FQHA 4FKPA 2PUNA 3EKNA 4DG3E 5EYKA 4MAOA 1ZOGA 4IM2A 4O6EA 3ELJA 5EDQA 4O2ZA 3OXIA 3ACJA 3NPCA 1U54A 2UZUE 2W5BA 4JLCA 1XBCA 3ACKA 4G1WA 4RBLA 3ZXZA 4BDFA 5I9VA 2C5OA 3OD6X 3IGOA 4MF1A 3QTUA 3R73A 2QG5A 3ORNA 4NIFB 4FUXA 4GJ2A 3CEKA 3OMVA 5EFQA 3NYVA 4X2NA 4F64A 3UZPA 3ORZA 5HI2A 3AT4A 4IH8A 3UMXA 1Q8WA 4QMQA 2UW0A 1ZAOA 3FZTA 2YDJA 3PXKA 4YLJA 2QI8A 3NVMB 2UVZA 3ZHPC 5GINE 3CJGA 4U5JA 2R5TA 4FA2A 4CG8A 1FMOE 2XCHA 3F3UA 4EK3A 4ZJJA 4YPDA 4BDJA 1YXTA 4YR8A 3R9NA 4HZSA 3T3UA 1UU7A 4KSQA 4ZSLA 4OTRA 4QYGA 3NUUA 4XNEA 3UDBA 4CFFA 2IVUA 4QMYA 2C6LA 1XO2B 3DB8A 3PY0A 3VUKA 3U87A 3A8XA 4J98A 4C4EA 4YJTA 3QBNA 3U9NA 2BIKB 1YQJA 4WG3A 4EOPA 4LUDA 4OBOA 3QYZA 5J9ZA 1UU9A 3FWQA 2QOLA 5K0XA 4EC8A 3IONA 2JAMA 3G51A 3W10A 3ZTXA 5GNKA 2OO8X 4PDOA 1PKGA 5DT4A 3ZBXA 3NUNA 4KD1A 4ITJA 2LAVA 4PDYA 4KABA 1P4OA 3CKWA 2F49A 3AC1A 3VBWA 1VYZA 3W55A 2J0IA 3LCDA 3D5XA 3QKLA 5HIDA 1B6CB 3VRZA 2HYYA 3DLSA 1RQQA 3F3VA 1FPUA 5DFPA 3WF8A 4YTFA 3BKBA 3KU2A 4ORKA 1U4DA 4UZDA 2XF0A 4XHKB 3KQ7A 3ZZWA 2O3PA 4DT8A 3FSFA 3HA8A 3KK9A 5IUIA 5E92A 1A9UA 3R8MA 3ZS5A 2X4ZA 4DEEA 1W98A 4CMUA 2ZMDA 3DT1A 4RZVA 4O0YA 3QGYA 5TF9A 1Q97A 3HMIA 3QRKA 4AA5A 4JBOA 4YJPA 4U41A 4UB7A 4E26A 4AF3A 4EOIA 3LJ2A 2PL0A 3BGZA 4YPSA 3EHAA 3LFAA 2X0GA 2QR7A 4FOBA 4FNYA 4O0RA 2XCKA 3LOKA 3OWJA 1O6LA 2VO7A 3TG1A 1OL7A 3K2LA 3W18A 5LQFA 4LOQA 3ID6C 3GC0A 4JAJA 4ZMEA 4FSTA 4RWJA 5CNOA 4CQGA 2G1TA 3MPTA 1PMNA 4N0SA 2Y0AA 4OAVB 2UZVA 4FNXA 4WHZA 2ZAZA 2HCKA 4HYUA 3WZKA 4JR7A 4ASXA 1R0PA 4XG8A 3QFVA 4MNEA 3Q32A 4W9WA 3NNVA 2B9IA 3ATTA 4BZDA 5J7HA 4BHNA 3NLBA 2CKPA 4DLJA 4G3FA 5FBOA 2A1AB 3F2RA 4WRGA 3KC3A 3Q4TA 4B8MA 2BRMA 4QP9A 2FO0A 2R3IA 3KVWA 3L9PA 5DWRA 4ALUA 5C1QB 2BAJA 4UXQA 2XIKA 3I5NA 2ITTA 4ZXTA 5BX0A 4QQCA 4R5YA 4DN5A 4ZJVA 2X9FA 4UWCA 3UVQA 2UW4A 4KIOA 4YHTA 3FMEA 4C7TA 1ZZLA 4L46A 4X2FA 4A4XA 3DZQA 5JRSA 5JGAA 4IAFA 2V22A 4BFMA 4EQUA 4D2RA 3ZXTA 4G9CA 1GNGA 2EXCX 3MESA 3GVUA 4AXAA 4QTAA 4CQEA 1GZOA 1DAWA 3N4TA 3DKGA 1ERKA 3WF6A 3CE3A 4LOPA 5AAFA 2ZOQA 2BR1A 2UUEA 5C8MA 3V5PA 3WZJA 4AN9A 4F9AA 4DC2A 3ODYX 5I9ZA 2HY81 1VJYA 5LVNA 2R3RA 4FTLA 2ITZA 2ONLA 4H1MA 3FC1X 4FKGA 3KK8A 2X6DA 1OIYA 5C9CA 5CY3A 4R6VA 5BPYA 4IAAA 3DAEA 5J7BA 4WO5A 4UYNA 4CV9A 3KCKA 3AD4A 2YHVA 3F6XA 4HPTE 4ITHA 4OBPA 4ANLA 4Y46A 4F65A 1YXSA 2C0TA 2HY0A 4AGCA 1NW1A 5EG3A 4FEVA 5IA2A 2VN9A 3TNQB 3PE2A 3UZTA 2BPMA 3UO5A 1QL6A 3PIZA 3RCJA 3ORLA 3C5UA 2PHKA 4ALWA 5HE3A 4EH2A 3Q3BA 3QLGA 2W1EA 3SRVA 4RLKA 4X2GA 2QOIA 1OUYA 3R00A 4BIDA 3KMUA 3EIDA 2QLUA 5EW9A 4BCJA 3HRFA 4UZHA 1JSUA 3R7YA 3EKKA 2IZSA 3QF9A 4X6RA 3OT3A 4H39A 5HBJA 1YWRA 3H30A 4FICA 4EOQA 3OWPA 4RLLA 4DH3A 5K5XA 4CXAA 4DA5A 4W4YA 3UQFA 3VS1A 3DNEA 2C3IB 4YJRA 3MIYA 1U59A 5CYIA 3WF7A 2VTPA 2ITXA 5H2UA 4PF4A 1OL2A 4O2PA 1B38A 4CFMA 3WBLA 4D55A 4FV5A 4RA5A 2GHGA 3D2IA 3Q2JA 5LJJA 4E4MA 2VTJA 1REJA 3TNPC 3NIZA 4FIHA 3R83A 2OXDA 3F5PA 1M7NA 5DRDA 3BYMA 3Q04A 5H8GA 3EQCA 4CRSA 4DGMA 4ACMA 3RPYA 3I7BA 4AZSA 4IB1A 4DTBA 1OL5A 3LCTA 4K77A 2WMWA 3ZDIA 3O8UA 2GMXA 3GNIB 3UOHA 1K9AA 3W2PA 4AOTA 5E91A 4FSWA 3UIMA 4DF3A 4NU1A 1H1QA 2V7OA 2W1HA 4J52A 4NTSA 5DVRA 3TNHA 4DBNA 1XH4A 4FNWA 2PY3A 5J95A 3W8LA 4M0ZA 4UN0C 2VO3A 3VHEA 4JVGA 5D9HA 3R28A 4FL1A 4DH7A 3OEZA 3QA0A 1KE8A 4GG5A 4OTPA 4U9AA 3ZEPA 1VEBA 3I4BA 3IW8A 3F2NA 1PXIA 4LRMA 4YTCA 4QT1A 2Q0BA 3HRBA 4RIOA 3U4WA 3LMIA 3ORTA 2R3JA 3D5VA 4U79A 2XJ2A 3VS3A 3LXLA 1ZWSA 3MVJA 1P14A 2OI4X 3PP0A 3MFRA 3R22A 4R5SA 3G6HA 4MXXA 3OOGA 4GFOA 3UTOA 3ZUTA 3R02A 2QURA 4FL3A 1J91A 2ONLC 4ITIA 4Y85A 4QMNA 2BDWA 2QO9A 1ZXEA 2XEYA 1FOTA 3MVLA 4O7LA 3GB2A 3PPZA 2IJMA 4MWHA 2O2UA 4QQJA 4UBAA 3G5DA 5AX9A 2BRGA 5IA3A 1ZLTA 2XJ1A 3DK6A 3GU8A 3FUPA 1PYEA 4AW5A 4E4XA 5AMNA 2OLCA 1YKRA 3BHVA 4FL2A 3EOCA 1DAYA 1XWSA 4Y5HA 5AV2A 4IBMA 4GKIA 2RFSA 3OROA 4GMYA 4NCTA 2C1BA 3DXNA 2HZ0A 5AM6A 4MKCA 4IMYA 4FTQA 2YERA 5IA5A 3KXGA 5BVEA 3M42A 3TNIA 4DEGA 3NCZA 2XB7A 3UNZA 3VUHA 3QCYA 1J1CA 3GU5A 3MN3A 1KE7A 1YOJA 3HVCA 3BZ3A 4EHEA 1GJOA 4BCIA 3VIDA 4D4RA 3FXWA 2YM3A 3A60A 1J1BA 4Q9SA 3RKBA 3R9RA 2QODA 3AG9A 3ZMMA 3QALE 1YWNA 5A4EA 2QO2A 3R1YA 2GHLA 5HVJA 4I6HA 4WNMA 4MD8E 1STCE 5KZ0A 5HLWA 2I40A 2GQSA 3PLAE 1H1RA 4O27B 3TNWA 1OIRA 3C0IA 3DBDA 4BHZA 4EOOA 4EZ7A 3MSSA 1Y8YA 3AOXA 4BCPA 2F2UA 4RJ4A 4FV7A 4MXYA 5HESA 5AM7A 1OZ1A 4R7HA 5CAQA 4XV2A 3QRUA 4BTKA 3W8QA 5A4QA 4U3YA 1W84A 4L01A 1XR1A 2R3NA 3QTQA 4C62A 4RWLA 3VNTA 3SRVB 3TIYA 3ZO1A 5DG5A 4HCUA 4FV9A 3EYHA 1J7UA 2J5FA 2VWZA 3DBQA 2B7AA 3PLSA 3LCOA 3TKUA 4EH9A 2YIRA 3QD3A 3R9OA 4YSJA 4XRJA 3CJFA 3IOKA 2ITNA 4O7NA 4BDCA 4OTGA 1F0QA 2BVAA 5HU3A 2W05A 4HW7A 2C68A 5AV0A 2VNWA 2JDSA 4EWQA 2X2MA 3HMPA 1W7HA 4FKRA 2CDZA 1RJBA 2XNMA 5FDXA 2HIWA 3O51A 3W2RA 5HG7A 4FSYA 3LFBA 4JBQA 3ZCLA 3LQ5A 1JKKA 4AZFA 5L6WL 3B2TA 1Q4LA 3BWJA 3DGKA 4AX8A 4QQ5A 4AACA 2R3QA 3FMKA 3P4KA 2ERZE 5ETIA 2QOBA 4FF8A 3SX9A 1VZOA 4RVLA 2QNJA 1XH7A 4NKAA 4BCGA 5FUTA 3QA8A 2IZTA 2YCRA 3KMWA 4G3DA 4A9TA 4M69A 5DIAA 4ZLOA 4GRBA 5IH6A 2BCJA 1W83A 4AW0A 5HQ0A 4FG7A 1OPLA 5LCKA 4F6WA 3G0FA 3PIXA 2OIDA 3LCSA 3POZA 4PY1A 2P3GX 3KRJA 4L3JA 4WSQA 5IDPA 4R77A 4CG9A 3NZ0A 4U0IA 3VS2A 2Y4PA 4FKUA 4TWCA 5KMIA 1Y91A 3FC2A 4K8AA 1YXXA 1OI9A 2B4SB 3PSDA 2BFYA 3QTSA 4NCTC 4BGQA 2R0IA 2G2HA 4IZAA 5EI8A 5BVKA 3N9XA 4GK4A 2C5YA 3DJ6A 3ZC6A 2ZJWA 4QO9A 4O96A 1YVJA 4BI1A 3DNDA 4OGRA 3VUDA 4NUSA 2PVKA 4CMTA 5CSXA 1GIIA 2HZNA 2Z8CA 3OUKA 2VTNA 2GDOA 4ANQA 2NNWB 3FYJX 4BBEA 5FTQA 2Z7QA 4G31A 5M4CA 1K3AA 2WMSA 4DH1A 4PP7A 2X6EA 1YWVA 5TE0A 3UP2A 4Z7GA 3D5UA 5HORA 4U45A 1CDKA 3C4XA 5IH4A 5AR2A 1H0VA 3ZEWA 2Z2WA 5CSHA 5HE0A 3V8SA 4A07A 3TXOA 5A6OA 5IU2A 2GCDA 4AZVA 3I81A 3PFQA 1F3MC 5EM8A 5HLNA 5JQ5A 4YURA 3L8PA 4MK0A 4CEGA 2E9UA 4JXFA 2W4OA 2XNGA 3TV7A 2W1IA 3AC4A 1JQHA 4IC8A 1Q8UA 2G01A 4LV5A 4C4GA 4D2SA 2HOGA 3TZ8A 2XRUA 2C1AA 1GZKA 2DS1A 4DAWA 3FMLA 2B55A 3MY1A 1ZYDA 1GAGA 5AUWA 4PMPA 2HAKA 1ZMUA 2YIXA 5LXMA 4QP3A 1APME 4HYSA 4O0XA 2R9SA 1JLUE 3EQPA 4R8QA 4EORA 3Q4CA 5HE2A 4EHZA 2BRNA 5M06A 3VWAA 4HGLA 5EI2A 1LP4A 2VTMA 2B53A 3EMGA 4FIGA 3SD0A 4DEBA 4AE6A 3SGCA 2IZUA 3FLSA 4AE9A 1TQIA 3QQUA 4KS8A 4EC9A 4K0YA 2J90A 4IAYA 1Q8ZA 3NVKI 2V5QA 5KZIA 4O21A 3PJCA 3TZMA 5LWNA 2JC6A 3PJ2A 4EBVA 4K2RA 4O83A 2HK5A 2F4JA 5FDPA 4G5JA 3LFEA 4HCVA 4AT5A 2FGIA 4XG4A 5H8EA 3QD0A 5TR6A 3KB7A 3KA0A 2CKQA 4IQ6A 5EDRA 4Z9LA 3UMWA 3KCFA 2EUFB 3HEGA 3EJ1A 3H9OA 3PRIA 3P7BA 5T6KA 4RJ3A 4USEA 3PZHA 4APPA 5EYCA 3KN6A 3PVBA 4F9WA 1UNLA 3THBA 3R7UA 3AMAA 4O0VA 4IB5A 4ZLYA 3F5UA 2HZIA 4PPBA 4S33A 4O22A 2WMXA 4FZDB 3SW7A 2GS2A 2UZNA 3O0GA 4XP3A 4XV1A 2RG5A 2XIXA 3QKKA 1KE6A 2UW5A 2WAJA 4OTHA 3UOLA 3ZO3A 2BZKB 3BGPA 2FH9A 2QKWB 2VU3A 5A4TA 5HNIX 4CZTA 3QHWA 5ANDA 4GT5A 4IM0A 4HVIA 4M14A 2WHBA 3K3IA 3QTWA 4XG3A 3UGCA 2YM5A 3E8NA 4C35A 5GIPE 2Y8OA 1HCLA 3FYKX 3HYHA 3L8VA 5CZIA 4S34A 4C37A 2VWWA 3QTIA 2CNUA 2EXMA 4NH1A 5G6VA 3BU3A 3V51A 2QOQA 1BI7A 4L67A 4ZEGA 3UZRA 3I7CA 4NIFA 1NVRA 2X4FA 3OHTA 4DFYA 5AV1A 4E1ZA 3SG9A 4QP4A 4G9RA 5CVFA 1ZY5A 3PZEA 5AA8A 5TOZA 2DQ7X 2B52A 3VC4A 2QOOA 5ANIA 2W99B 4TNDA 5AR3A 4P7EA 5TT7A 3D14A 3MI9A 2WQEA 5ANJA 4M69B 2CLXA 2C5VA 4DYMA 3TZ7A 4BKYA 5DT3A 3W2SA 3D7TA 4K11A 2IG7A 2ETRA 4XUFA 5FEQA 1Q8TA 4RT7A 3TUCA 3ALNA 4KB8A 4ACDA 3A2CA 4JAIA 4YZ9A 4BIBA 5FD2A 3FLWA 4GU9A 2IVSA 2QR8A 3G6GA 4XLIA 4CGAA 2OZAB 2X39A 3UQCA 1W8CA 2I0VA 1ZY4A 2ITUA 3BHTA 4MCVA 4UV0A 4D4YA 4E6QA 4NL0A 3NYOA 2VGPA 3DAJA 1MQBA 4NM3A 4HGSA 3OP5A 4Y8DA 4O7YA 3UVPA 5HD4A 4LUEA 5IF1A 4TYHB 1SVEA 5I9YA 3BRBA 4G6LA 4O1PA 5FLFA 4GKHA 1IAHA 2PPQA 2PZIA 2WOUA 3PY3A 4BRXA 4ASDA 4BTFA 4CLIA 1P2AA 4QYEA 3AT3A 4IJ9A 4D4SA 4IVAA 3GENA 1PYXA 4FT3A 5AUXA 3R8ZA 2JIVA 5IQHA 5AX3A 5HKMA 4C02A 3BU6A 3FMHA 3V6RA 4CTCA 3R8UA 3VS4A 4MVFA 3RVGA 3OG7A 2C3LA 4DEDA 2YAAA 2XK4A 2CKOA 1IR3A 2AUHA 3QXPA 2NP8A 5ETFA 1WMKA 2W4KA 1MUOA 1OGUA 2WTIA 1Y6AA 5IQFA 3PSBA 2IVVA 4O0UA 4ZIMA 1R1WA 2Y6OA 4QTCA 5EQYA 5KMMA 3RZFA 5FTGA 2XK8A 2PUPA 4QMUA 2VV9A 5HBHA 4AAAA 2YM4A 4FSUA 3PVGA 1JVPP 2R3KA 2UW6A 4TY1A 5HG5A 3SW4A 4ACHA 5CT7A 1ATPE 3Q6UA 4PDPA 3ORIA 4CNHA 5BVOA 4FTUA 2BAKA 3BE9A 2WGJA 1BYGA 5AP7A 3WZUA 4CKJA 3G15A 5EQEA 4L3LA 4BY9E 2FVDA 2O65A 4PP9A 3ZZEA 4B6LA 2W1ZA 3RNIA 2JIIA 4IWDA 4B8LA 3UOKA 3REPA 4FKWA 4FEQA 2VD5A 2X81A 4I22A 1UWHA 4O38A 3TM0A 3PXFA 2B9FA 3LFNA 3R1SA 4I5MA 3RNYA 5J1VA 3E63A 3D4QA 4X6QC 4EOMA 4ERKA 2VAGA 2RIOA 5LMBA 2YZAA 3NSZA 3JYAA 4II5A 2GTNA 5CF6A 2GQRA 3LVPA 1DM2A 2R0UA 4M13A 5BVDA 4FTRA 5FM3A 2WEIA 4J8NA 4NSTA 4Y72A 3QGWA 5E8ZA 3TTIA 4GIHA 4D2VA 4K6ZA 5AEPA 4M0YA 2BMCA 5F1ZA 4BICA 4GVJA 4XBUA 1FVRA 5CEKA 4FT5A 4A9UA 1RW8A 4N70A 2XVDA 5HTIA 2CCHA 3GCSA 4TL0A 3IDCA 1SZMA 4U97A 4ANOA 4C3FA 5LMAA 3FI4A 5BUJA 5L2QA 4CLJA 3QUPA 1R3CA 1WBPA 3NYNA 5E8SA 3U9CA 3OTUA 1KE9A 1DI9A 1PJKA 2GPHA 4DEAA 4F09A 2C6KA 4F0GA 4IE9A 3TI1A 4F7LA 4PTEA 1OKZA 4Q9ZA 2PE0A 4D5HA 3GC7A 3HX4A 2PUIA 4U8ZA 3OOMA 4I6BA 3ODZX 2B1PA 2WIPA 2X2LA 2RSVA 1UV5A 4A4OA 3O23A 4RFZA 1WFCA 1XQZA 3A7IA 1IA9A 3KXZA 4E73A 4DITA 4P4CA 3U6HA 1MRUA 4DGOA 1PXOA 5AP2A 3Q52A 2IN6A 4MWIA 4QMPA 3VQHA 3D7ZA 3WZEA 4C59A 4OR5A 4I6FA 3AC8A 5BVWA 4HYIA 1QPEA 1ZMVA 3D7TB 3GBZA 4HNFA 5J9YA 2WQMA 2C4GA 4P5QA 4FK3A 3RHKA 2IZRA 5CQUA 5BYLA 1OB3A 4WSYA 3R2BA 4YZCA 3ZO2A 3C4FA 3LQ3A 3A7HA 3PP1A 3UODA 4CRLA 5IG1A 4U3ZA 1U46A 5HU9A 2R3OA 2QCSA 1J7LA 3PJ1A 1ZMWA 2UV2A 3GP0A 4IDTA 5DH3A 4XG7A 5AR4A 3H4JA 1H24A 4EL9A 4UMQA 5CI7A 2YLEA 3Q9ZA 3LQ8A 2F7ZE 3AMBA 3LFQA 2Y6MA 1Z9XA 3R2YA 4AGDA 5BVNA 3BPRA 3CCNA 3Q4ZA 2ETKA 3L9MA 2IW8A 3GXLA 1V1KA 2P2HA 3EFKA 4H3PA 4XX9A 3DPKA 2UZOA 3PA5A 5FEEA 4LM5A 3QUDA 5J8IA 3VUTA 1PRYA 5JGDA 4EH5A 2BALA 1UNHA 4CCBA 4D0WA 3QL8A 5HX6A 3MTFA 4EK4A 4YTHA 5DI1A 4YJQA 3PTGA 5E90A 4XH6A 3CY2A 2ZV9A 3G9NA 4D9TA 3QQLA 3RHXA 4Q5HA 2WMTA 2GS7A 2WQNA 5CS6A 5IUGA 1OITA 2WTJA 2JDTA 4M97A 2A19B 5CASA 4H3BA 3Q4UA 4MD7E 3FAAA 2I0EA 1FMKA 1PXMA 4U42A 5H3QA 2J6MA 5LCJA 1YOMA 4KA3A 4BDAA 3BYUA 1CMKE 5DGZA 2CN5A 2O63A 2XUUA 3E7VA 1E1VA 2YJSA 5KE0A 4YZNA 2C0IA 4D2PA 1YDRE 4OUCA 4ZLZA 2NPQA 4CZUA 3GEQA 5C8NA 5CEOA 3DK3A 1WVXA 1JSTA 2CMWA 2ITYA 4FZ6A 1DI8A 5HICA 2G9XA 5JSMA 4C61A 3LXPA 5TKDA 3WIKA 3BQCA 3NS9A 5HTBA 1WBSA 4M68A 4BI0A 1LEWA 4J53A 1OKWA 2HW6A 3F61A 2OK1A 1VYWA 4ZK5A 3F66A 4FX3A 1MRYA 4B9DA 4O7WA 3OZ6A 4E7WA 3FKOA 3QTRA 3VAPA 4W4VA 4DGNA 1BI8A 3DDPA 4DHFA 4GCJA 3HKOA 4IX4A 4BKJA 4JDJA 3DXPA 2W1DA 2BZJA 4ZTLA 4BZNA 1K2PA 4CT1A 4AW2A 4DH8A 2XJ0A 4ZMFA 1H25A 2VX1A 2YJRA 4IFGA 3FZPA 4Z55A 2WTKC 4HZRA 4CVAA 1B39A 1YI6A 3Q9XA 4TYEA 5AR7A 4YMJA 2H96A 5CZHA 4UY9A 3BLQA 4JNWA 4H36A 5GHVA 4FVQA 4BVUA 3MDYA 5L6OA 4IEBA 4I0SA 4MXAA 1DS5A 5CU6A 3RGFA 3QWJA 2LGCA 4RSSA 1T46A 4AFEA 3ZSGA 5D41A 3PSCA 3PG1A 1H00A 3WE4A 4FI1A 2RKUA 3LFSA 3DFCB 5IA0A 1BLXA 1UU8A 4R78A 1O6KA 3MH2A 4FV3A 4JI9A 2O64A 4EZ5A 5CANA 5L2IA 3SXFA 3JVRA 3AC3A 4Y5QA 5CNNA 3QX4A 4J7BA 1WCCA 2VRXA 5BMMA 4QMOA 3V01A 4EZ3A 3FHIA 3GGFA 3AC5A 3VS7A 4OTWA 5D1JA 3PUPA 3MB7A 2F9GA 2Z7SA 3FZSA 4L3PA 4HVHA 2UZLA 2QU5A 3TWJA 3ZOSA 4FK6A 4YO4A 1H1PA 4L43A 2OJJA 4HPUE 4RX7A 4GVAA 4TPTA 5D12A 5HHWA 3DJ5A 3SQQA 1OECA 2WTKB 3D94A 2XKFA 3QZIA 2OBJA 3BQRA 5EW8A 3SDJA 4AGUA 3U8WA 5CSPA 2C6DA 4EQCA 3DY7A 5KMKA 4FT9A 1A06A 2VTQA 1XHAA 2NRYA 3OWLA 5T68A 5JZNA 2QLQA 5IQBA 2OJ9A 5KMJA 4JQEA 4RWKA 4OAUC 1JWHA 4TN6A 1OIUA 4BYJA 3LZBA 2PMNX 3R7GA 1E9HA 3QU0A 2GFCA 5CU2A 3FLNC 3EB0A 3NAXA 3RK7A 5KMLA 4R7IA 1OL1A 2C6OA 2XYNA 4OTIA 4A9YA 4ZTMA 4L8MA 4J97A 5M57A 3DXQA 2NO3A 3BHUA 2YM7A 3KMMA 2WPAA 3S1HA 4FOCA 3IW7A 4EYJA 2YM6A 1YRPA 1LPUA 4QTDA 5ACKA 2RGPA 3TACA 4F6SA 2FYSA 2XKEA 3ERKA 3HAMA 2W17A 2RG6A 2RL5A 3PVUA 3RINA 3ZDUA 4ZAUA 3R30A 2EB2A 2XNBA 2IWIA 4FTKA 2PMOX 2OFUA 2R7BA 2YIYA 4JR3A 5DN3A 4YNEA 4FKJA 2XEZA 4E3CA 4FSNA 2A2AA 2W5HA 3ZSIA 4R7BA 1L8TA 4BCHA 3RI1A 4ASZA 1IAJA 2JDRA 5AUUA 3A4OX 1SMHA 5AAGA 4FV1A 3EZVA 3ZLXA 5DRBA 3P7AA 2C5NA 3DOGA 3F5GA 3RWQA 3C13A 4ALVA 4IFCA 1BMKA 5EM7A 4EI4A 4BGHA 4EKKA 4V04A 3VBVA 4AG8A 3DKFA 4BBFA 3ET7A 4G17A 3HV3A 3IECA 2FA2A 4QMXA 4W9XA 2XS0A 3QXOA 4YP8A 5AR8A 4X2JA 5HG9A 5DR2A 5F9EA 5E1SA 3DLZA 2YWPA 3ORKA 4IX5A 5BUEA 4FEXA 3PG3A 2OU7A 3WF5A 3A7GA 2J9MA 4DINA 2ZMCA 2ESMA 1PKDA 5HVKA 5ANOA 5LWMA 1NVSA 4FZAB 4FT7A 5KUPA 1WVWA 3I0OA 1OPKA 4PMMA 3RPSA 3W2CA 2Q83A 5DMZA 2OXXA 4EK5A 3JR1A 5IZFA 3CP9A 1SNXA 2Y4IC 3FEGA 3VBYA 5M51A 3AXWA 2OF4A 4K18A 2EB3A 4WA9A 2PZPA 1BX6A 3C4WA 4ZY5A 2WMBA 2XKDA 4ZSJA 4YGAA 4PUZA 3Q53A 4PDSA 1ZYSA 3LXNA 2GNGA 4R3CA 3RALA 1YHWA 3D5WA 3O7LD 1R78A 2F7EE 3MA6A 3UC4A 2GHMA 4OT5A 4CZYB 1IEPA 3IW6A 2HWOA 4FR4A 3V8WA 4RJ5A 4BF2A 4F1OA 2KTYA 4ARKA 5K9IA 4PWNA 5CLPA 5J1WA 2CGWA 4GW8A 2ACXA 4RQVA 3DCVA 5L2TA 4O0SA 5DE2A 5JKGA 2E2BA 4A7CA 5DNRA 4AW1A 3S3IA 3R9HA 1YDTE 2WO6A 4PPAA 4KS7A 3V5WA 3VHKA 4MD9E 4U40A 4WD5A 3BV3A 3KRWA 5K4JA 4XG9A 4ENXA 1UA2A 5F95A 4ZTHA 4E6CA 2F2CB 1OIQA 5JEBA 1CKPA 2Y4IB 4ZTRA 5CENA 3Q60A 4RFYA 4ZSEA 4TT7A 4L6QA 4UALA 3ZONA 4CKIA 3GCPA 5JFWA 1PXJA 4CT2A 3QKMA 3W2OA 3ZBFA 1U5RA 5KO1A 4KKGA 1JSVA 2P4IA 3VUIA 4J71A 2VTHA 3QZGA 3VBTA 3R1NA 4X7QA 4C2WA 2QD9A 4X2KA 3CTHA 4ACGA 5JGBA 2YIWA 3COHA 3UNJA 3LW0A 3R6XA 2PYWA 3EFJA 5C4LA 3B8QA 3TUDA 4IB3A 4FVPA 5DPVA 4GK3A 3ANQA 3WIGA 3EZRA 3F7ZA 4BDEA 2YEXA 4QYYA 4EJ7A 4ZS4A 1BUHA 1WZYA 3MGYA 4N4SA 2AC5A 2BTRA 3KULA 3DAKA 2Z7LA 3I6WA 5IQGA 3TIZA 3EQRA 3SC1A 4AUAA 2C6TA 3FMJA 3L8SA 4PL4A 2FSOX 1M14A 1M7QA 2X8EA 1M17A 1R0EA 4GV1A 4IWOA 5FQDC 3RAWA 4GIIA 3R7EA 3FMNA 3LPBA 3OXZA 4A4LA 5ETAA 1TQMA 4CSVA 5F4NA 5AJQA 3BV2A 1XH9A 2A4LA 3CLYA 3FL4A 3FQSA 3MFUA 2V62A 3LCKA 4RJ8A 1PF8A 5HD7A 2OSCA 2XP2A 3O71A 3AD5A 3COMA 1HOWA 5CU4A 2UVYA 3FKNA 5DEYA 1NY3A 3HMNA 1E1XA 5CXZA 5J9LA 3EFLA 4XRLA 2WFYA 4E5WA 3OCTA 3RK5A 4LI5A 3I60A 1QPJA 4WG5A 5DEWA 2AYPA 2BHHA 3DB6A 4FV2A 4ZP5A 4M84A 3N4UA 2C5XA 2PVJA 4HVGA 3UYTA 2YCFA 4M3QA 3GCVA 5ANKA 4BB4A 4CCUA 3VULA 2KULA 4E4NA 2V55A 1R39A 2J0MB 3RWPA 4ID7A 4I94A 2PWLA 3KREA 4MYGA 5EQPA 3W16A 4O81A 3T9TA 1OKYA 4FGBA 3QZHA 2ZYBA 4FV4A 3OCSA 4C58A 2I0YA 2PTKA 3F3WA 5BMSA 4AS0A 4YC8A 3LMGA 3LHJA 4IAIA 5EM6A 3BWFA 3TZ9A 4QD6A 3IO7A 5DHJA 4NYEA 2PZ5A 5BVFA 3BLHA 5I0BA 2GNIA 2X7FA 4YJSA 3VW8A 2BUJA 1MQ4A 3CXWA 3JPVA 4L9IA 1XBBA 3T9IA 4DCEA 4M8TA 4G3EA 3HP5A 3BLRA 2X1NA 2OZAA 3UO6A 3ATSA 2IO6A 5HLPA 3U51A 5EHLA 4EEVA 5M44A 4EUTA 5KBQA 3PDTA 4N57A 3NW7A 4BN1A 4ZZOA 3V8TA 3H9FA 4USFA 2OIQA 3I79A 2E9PA 2J0LA 4TYHA 5IEVA 4FODA 5HG8A 5KBRA 4ASEA 4JJRA 4AT3A 2PULA 1WAKA 4JDHA 3UBDA 2CJMA 3UO4A 4KUJA 3UYSA 4FTOA 4TYGA 1CTPE 3L9NA 2O8YA 4FSRA 1M2PA 4MTAA 2J0JA 2JEDA 2F7XE 2PVMA 2SRCA 4QYFA 2WTCA 4PNKA 2OF2A 4E6AA 4DE4A 3Q5ZA 1U5QA 4DFZE 5ANEA 4DFUA 3FSKA 3KF4A 4RIYA 1Q8YA 4EJNA 1V0OA 4QOXA 4V0GB 3V04A 3DBEA 4F0FA 1M52A 3HRCA 3MB6A 4FV0A 4HYHA 3WOWA 5LVMA 4D1SA 5M4FA 4EHGA 5CU3A 4R3PA 3H0ZA 2O0UA 4TWNA 5GZ8A 3OC1A 3UE4A 4BYIA 5JFVA 3C4EA 3NEWA 4AT4A 3DBCA 4FKOA 5ACBC 3G2FA 1BL6A 4Z7HA 4IXPA 4X3FB 4XG2A 4OTQA 3TDVA 2UZWE 3I1AA 2UVXA 4FG9A 2XKCA 5M09A 1V0BA 4G3CA 5DLSA 4PNIA 4XV9A 2QC6A 4X0MA 4NFMA 4RIWB 2F57A 4BDGA 5BUIA 2JD5A 3FKLA 3ZM4A 1ZZ2A 2W1CA 3HP2A 5FWKK 5CX9A 4BDBA 4FTNA 3E3PA 4FKTA 1AGWA 5CWZA 2XNOA 5AUVA 4V05A 5EHYA 2PVRA 4XLVA 5K4IA 4NTTA 4PTGA 4F1TA 2DYLA 1EH4A 4YJUA 1TVOA 3PA4A 1GOLA 3KULB 2ZDTA 2QHNA 3G33A 4IVDA 2X8IA 3E5AA 3C9WA 3A8WA 2FSLX 3QQGA 3EQGA 1WBNA 3R01A 4EK6A 5JK3A 3GUBA 3GQLA 2JFLA 5AP1A 5F94A 2H9VA 3M11A 3EL7A 4W4XA 3GU7A 1G5SA 5E8TA 3M2WA 1W82A 4YU2A 1JKSA 2C3KA 3EN6A 4YZDA 2PVFA 4H58A 2OG8A 2BFXA 2WEVA 1YW2A 2QHMA 2ITPA 3QUEA 3IPHA 4EOKA 5BYYA 5L2SA 2J51A 3BHHA 2GNHA 3P79A 4GFMA 4M12A 4FKSA 4I4EA 5D11A 2WTDA 4AWIA 4O6LA 5CF5A 2P55A 5CSWA 3SVVA 3ORPA 2EU9A 1XH6A 5L8KA 1CSNA 3KEXA 5LVOA 4RVMA 3V3VA 2VGOA 4XMOA 3TUBA 5B2LA 2BKKA 5JRQA 4QMLA 1YXUA 4KKEA 1UWJA 3TKHA 5EW3A 2P2IA 2Z60A 3FY2A 3ITZA 1LR4A 2QVSE 2VTIA 4GUEA 3SAYA 3R8VA 2R2PA 4J95A 4KINA 3SLSA 3PYYA 3P7CA 3CGOA 4XYFA 4I4FA 4W8EA 4EONA 3E93A 2CGUA 2W1GA 3OF0A 2EVAA 1YI4A 4IHPA 4OBQA 3B2WA 4RIXA 3ETAA 3QX2A 5HX8A 5GZAA 4NM5A 3FMDA 1H27A 3DJ7A 3MWUA 4YLKA 5E8UA 5AP0A 2OWBA 1J7IA 2YN8A 3VN9A 4BIEA 3NUAA 4BCFA 3A99A 4M7IA 3NUPA 3MFSA 2OJIA 4IIRA 5JQ8A 1UNGA 3DFAA 4P5ZA 3LJ1A 3NNWA 4QRCA 3QC9A 5HE1A 4TWPA 4W8DA 1IASA 5M53A 3C1XA 4IAZA 2C47A 4HCTA 3ANRA 2Y9QA 4YLLA 3A62A 4MQ1A 3GCUA 1Z5MA 4BCMA 4O1OA 2VTTA 4LMNA 3RK9A 3QD2B 3EN9A 4Z3VA 3NCGA 5CTPA 2WMQA 4GU6A 3T3VA 3VF9A 4GYIA 2YISA 4L42A 4O7TA 4AA4A 4ZZNA 5FEDA 4FKQA 4DFBA 4RA4A 2R7IA 3PJ3A 2FSMX 2G2FA 4FSZA 3WF9A 4MNFA 3RJCA 4TWOA 1ZARA 3TTJA 4IZ5A 3E64A 2YLFA 5KX8A 5E7RA 3AMYA 4C57A 4IWPA 4QP8A 4QYHA 3DKCA 4X3JA 5AP4A 4IADA 2YIQA 4RIYB 4LV8A 5AIKA 3UC3A 3W1FA 3DZOA 1V0PA 4FKIA 4IZ7A 3CQWA 5IQDA 3QWKA 4RMZA 3EN7A 4FT0A 5FTOA 3RM6A 4ANMA 3KN5A 5LARA 4UMPA 4IVBA 2BDJA 3VUGA 5IUHA 3R0TA 4TXCA 1J3HA 2WMVA 4F08A 5IQCA 4I24A 5EDPA 2YWVA 3MPMA 4LRJA 4C0TA 1Q5KA 2PVNA 3VQUA 5JH6A 2YAKA 4AN2A 2J0KA 3PWYA 3UJGA 2BZIB 5AADA 3PPJA 4F7NA 5CU0A 4AA0A 4CYIA 2WQBA 4BWKA 4GYGA 1YOLA 1PXPA 3CD3A 4EQMA 5HBEA 5DBXA 4ANNA 3SKCA 4NJ3A 3JXWA 2GQGA 4S30A 4XEYA 3OTVA 3HAVA 4FVRA 3V5QA 3AQVA 1NVQA 1M2RA 1M2QA 1P4FA 3NIEA 3V5LA 4RX9A 3ORMA 3A7FA 4I93A 4C4FA 3HMOA 3TV4A 4YJVA 4PPCA 1KV2A 5JFXA 3QZFA 4ANSA 2OIBA 2JFMA 3JS2A 3SOCA 3FLZA 4MEDA 4E93A 5DYJA 2WU7A 2IW6A 2UZEA 4Q5EA 4MF0A 4YO6A 4FTTA 4E20A 3HNGA 5C27A 3GC9A 4B0GA 3BIZA 4JOAA 1OM1A 2P33A 4J96A 3IW4A 2WMAA 2I7QA 3KRRA 3OFMA 4RPVA 3HA6A 2YABA 3QTXA 4O0TA 4U7ZA 5CEQA 3BEAA 3UIBA 4FG8A 4QMTA 2XIZA 3F2AA 4QP1A 1Z57A 1Q62A 4XOZA 3R7OA 2JBOA 1YI3A 2I1MA 4JQ8A 5EI6A 3UQGA 2ZM1A 3Q9YA 4C34A 4TYJA 4F9BA 5CAOA 3CC6A 3RTPA 3ORXA 5J79A 4RVTA 3BBTB 2JKOA 5IKWA 2BRBA 4D4VA 5HVYA 1BL7A 4YNOA 4WNPA 4I0RA 4R1YA 3ULIA 4EH8A 2R3MA 2OJFE 5CI6A 4W4WA 2JLDA 2ZB1A 1ZYCA 1YHSA 3D2KA 5CT0A 4E6DA 1GY3A 2P0CA 4NM0A 5HGIA 4RIXB 3HDMA 3KKVA 1JNKA 2C6IA 3ZFMA 4O82A 2BRHA 4I23A 4CKRA 5AUYA 5HO6A 2OW3A 2WZJA 4O84A 2QOHA 3GU6A 3OY1A 3M1SA 5B0XA 3CY3A 2HWPA 3DS6A 2VWVA 4BTMA 4RJ6A 3MYGA 4IB0A 1JPAA 3IW5A 4K33A 3SXRA 5C26A 3ZM9A 2G2IA 5EHOA 4C8BA 3U6JA 4I41A 3FHRA 2PE2A 3E87A 3I5ZA 1KUTA 4LYNA 1P5EA 3F88A 3LFDA 2B54A 4DGGA 4ZS0A 4IWQA 4PRJA 4C38A 4G34A 5HZNA 4NFNA 5C8KA 4JIAA 4KNBA 1URWA 2GNJA 4NT4A 3P1AA 4S32A 4I3ZA 3UVRA 2C3JA 1REKA 2X9EA 5AP5A 4M15A 2HELA 1F5QA 3F82A 4DFNA 3LMHA 4FZFB 5JMSA 5H9BA 4PV0A 3HMMA 5JZJA 2IPXA 5M55A 2DWBA 2JAVA 3DTWA 5E1EA 4F0IA 1H1SA 4ZTSA 4DLIA 5EOLA 3U54A 5AUZA 5I9XA 3I6UA 3ZLSA 1KSWA 4CYJA 2WMUA 4S2ZA 2GNFA 1H4LA 3UPZA 2XMYA 5CEPA 4HGEA 3QYWA 3TJCA 5K0KA 4XP0A 3ALOA 2HXLA 4JX7A 5AP6A 5HNBA 3DQXA 4JS8A 2CGVA 4I20A 3CTQA 2Z02A 5HO7A 4E5BA 3IKAA 3LXKA 4GSBA 4FE2A 1FVVA 1L3RE 4MHAA 4WKQA 2ZV7A 4IM3A 2H6DA 3FE3A 5HCXA 4D1XA 3G0EA 4KSPA 4CFVA 4YBJA 2OXYA 2CNQA 2ZM3A 4JT3A 5C03A 3LM0A 3RAHA 3U55A 5J87A 3PWDA 2ZB0A 4WBOA 3TKIA 2PZYA 4YSMA 1PXKA 3KXHA 4R3RA 4YJOA 3BCEA 2YDIA 3ENHA 3R63A 4RWIA 3HV5A 4F9YA 4UMUA 4LL0A 4CTBA 3TN8A 3OEFX 3NMUF 2C6EA 3BYOA 2OH0E 5FP5A 4PMTA 3H3CA 2JDVA 4EH4A 4ERWA 5AV4A 1KOAA 2R64A 1QMZA 3TT0A 5DA3A 5EKNA 4HVSA 4F63A 3JVSA 4YTIA 4DFLA 4GJ3A 5J5SA 3LFFA 2EXEA 5FGKA 4KRDA 3WE8A 2XK9A 3F3TA 5C4KA 3CIKA 2XNPA 1KV1A 3BYVA 1H1WA 4LMUA 4OTDA 1Y6BA 3PJ8A 2OKRA 4RJ7A 4ZJIA 3E8CA 1CKIA 3F3ZA 4RX8A 2VTAA 2CSNA 3WZDA 4HJOA 4RGJA 4DGLC 3MY5A 3ZO4A 5HO8A 5IMEA 4FGRA 4BC6A 4F7JA 3AD6A 3D83A 3R04A 1VR2A 3BI6A 4FZ7A 1WBOA 4QMZA 1A48A 2HENA 4PL3A 4WG4A 3QCQA 3GFEA 4GEOA 2VO6A 2RFEA 4NWMA 3GOPA 4WIHA 5A46A 4Q2AA 2PSQA 3O8PA 2XA4A 3QC4A 3TV6A 4QTEA 1O9UA 5K5NA 4FEWA 2BROA 5L3AA 2E9VA 2YA9A 4G5PA 4KWPA 1QPDA 1FBNA 1G8SA 4XOYA 2CN8A 2BTSA 2R3GA 2WQOA 3KXMA 4FBXA 3DV3A 4C3PA 1MRVA 1HCKA 4QMVA 4X21A 4D28A 3FZ1A 4N6YA 3II5A 3CKXA 1NXKA 3KXNA 4G3GA 1PXNA 1UKIA 5HNGA 4B7TA 5FXSA 3CGFA 4F9CA 4FIFA 5KMOA 2ITWA 4EOJA 3ZSHA 1FQ1B 3TJDA 4D0XA 3C4CA 3CBLA 2JBPA 3E62A 3I0QA 4I0TA 5M4IA 3CQEA 5HEZA 4ONAA 4DFXE 4QNAA 2QOFA 4FV8A 4OLIA 3VW6A 2CCIA 3IDPA 3CS9A 4HVDA 2CGXA 2V0DA 4I5PA 4QP2A 4GT3A 3BEGA 3C50A 3DDQA 5HCZA 4EOLA 3T8OA 4Y73A 1XJDA 2RFDA 3P9JA 3CSVA 5GIOE 4JL9A 5A4CA 2PE1A 1U54B 4G2FA 5CVHA 3PRFA 4PQNA 5FG8A 2UW8A 3NW5A 4H3QA 2UZDA 5ITAA 3PA3A 3TL8A 1KOBA 1XBAA 2VTSA 3P0MA 4GG7A 4ZOGA 2OICA 2EWAA 3Q2MA 1H28A 4P90A 4EUUA 2JITA 3RAKA 3FXZA 1GIHA 2WMRA 1ZOHA 3WARA 4EOSA 1SVHA 3MY0A 4K9YA 4KIKA 3NW6A 1IA8A 4L52A 1JKLA 4C3RA 4RC3A 5A14A 3O2MA 3JUHA 4D2WA 2GU8A 2J2IB 5DOSA 1FVTA 5BYZA 5TO8A 5I5ZA 4QMWA 4LRKA 2V7AA 4ZSAA 2Y7JA 1OMWA 3IDBA 1ND4A 2XBJA 3BGQA 2QO7A 4FSMA 4L45A 3W32A 4NW6A 3OW3A 4F4PA 3SG8A 4I21A 4U81A 4XS2A 5JFSA 4L7FA 3FI8A 1OKVA 2BZHB 4XCUA 4FV6A 4L00A 4MH7A 4D9UA 4P2KA 3EWHA 2PVHA 5CXHA 2QOKA 5K3YA 5LVPA 3MA3A 5I3RA 4DH5A 2R4BA 2PK9A 3F9NA 4YJNA 4DBXA 4JRNA 3C0GA 4O91A 4NZWB 2PUUA 2WD1A 3R71A 1MP8A 5FBNC 4A9RA 3GT8A 5GJGA 4AP7A 5IA4A 1IRKA 3QD4A 4BTJA 5D7AA 4KBKA 5HTCA 3VJNA 3MFTA 3ZRKA 3MBLA 3P08A 4RFMA 2X7GA 4I5HA 3D15A 3KGAA 4MBIA 2B0QA 2W9FB 3UPXA 3VF8A 4TKSA 1H26A 4KIQA 4WRSA 4IX3A 2UW9A 5E8XA 3UG2A 3R21A 3W2QA 4UWBA 2E9NA 4F7SA 2G15A 4L53A 4NKSA 2QONA 5KCVA 3PE1A 3ZC5A 4U6RA 3VBQA 3SV0A 5C01A 3IOPA 2UZTA 5AA9A 5I4NA 2ITOA 3O50A 3LE6A 3FZRA 2BIYA 2PMIA 4QP7A 3L9LA 3EFWA 1FGKA 2X8DA 4BWXA 2VZ6A 3A4PA 4EHVA 2QG7A 4IJPA 4ZTNA 4ZY6A 2OH4A 3KL8A 3R7VA 3E92A 3EQDA 2OFVA 4AZWA 2UW3A 4C36A 2WB8A 3KF7A 4K1BA 4QP6A 3K5UA 5IEXA 3E7OA 4QPSA 3UNKA 3C0HA 3NUYA 5I3OA 2YM8A 3FLYA 3OUNB 3OY3A 4V0GA 2ITVA 5T3QA 3UIXA 1TKIA 2Z7RA 5J5TA 5IQEA 4G6NA 3DQWA 2XK7A 4LQMA 4O86A 3FI3A 2PZRA 5EM5A 1RE8A 4DCAA 1OVEA 1WBVA 4YHFA 3RPOA 3NUSA 3L8XA 5A54A 4MNEB 4O7RA 4EYMA 4FEUA 3UG1A 5L2WA 4X3FA 5HCYA 4FTMA 2FB8A 2WKMA 4YHJA 4IANA 4HOKA 3ZUUA 3O8TA 1KE5A 3MIAA 2W96B 2X7OA 1Y8GA 3OS3A 3K3JA 1OL6A 3FV8A
chains in the Genus database with same CATH superfamily
3N4VA 4KIPA 3BX5A 1ZYJA 4JG7A 3F7WA 4RIWA 5CSVA 4HNIA 4F99A 4F6UA 1WVYA 3GC8A 1WBTA 1H08A 3MPAA 3FL5A 2X2KA 4M67A 3NGAA 2XBAA 4CV8A 3HL7A 3FPMA 3QQHA 4FMQA 3UIUA 2XYUA 1Q99A 2CKEA 2XNEA 3HV6A 4NK9A 4QTBA 4QPMA 3ZYAA 5KMNA 3NDMA 4AXDA 1YDSE 2W9ZB 4WT6A 5FP6A 3V5JA 3RCDA 4F70A 3LIJA 4OT6A 1XH5A 4N6ZA 4UX9A 3LLTA 4QNYA 2XRWA 2OGVA 1KWPA 2VTOA 4QPAA 3KXXA 4FYNA 3DKOA 3F5XA 3QLFA 2CLQA 5M08A 4MXZA 3FJQE 4C4JA 4DEHA 4QQTA 4XJ0A 4F1MA 1OBDA 3Q5IA 3R8LA 1H8FA 4FYOA 3OBJA 2BILB 2JIUA 2ZVAA 3NUXA 4WUNA 3ZLYA 5ICPA 3HV7A 3GU4A 4IACA 5FXQA 1I44A 3RAIA 5FM2A 4BL1A 4WNKA 3POOA 4DTKA 4BR3A 2JGZA 4USDA 3E8DA 4M66A 4KIKB 4TW9A 3MTLA 3OWKA 4CD0A 5IPJA 2VX0A 2XIRA 3DTCA 4O7ZA 4GUBA 4DEIA 4RC2A 2VWYA 3QQFA 4NM7A 4UEUA 4YC6A 5EH0A 5KKRC 3P86A 5KHWA 4FTIA 5DR6A 3P5KA 3SHEA 1GIJA 2YCSA 3ZLWA 3KRXA 1NA7A 3BHYA 3CPBA 3IG7A 4IX6A 2R3HA 4IZYA 5B7VA 1OPJA 4YZMA 3ROYA 3A7JA 1SNUA 3PXYA 4IW0A 4BDIA 4BBMA 3BYSA 3FLQA 4FTCA 3EN4A 4FTJA 2ITQA 5IDNA 3H9RA 3S0OA 3CPCA 1Q41A 3EL8A 3FY0A 3EQFA 4WOVA 4LGDA 5E8VA 4LG4A 2HW7A 4MX9A 5AAEA 2WU6A 4GFGA 4QMMA 3MH0A 4RG0A 3WI6A 5BQ0A 3OW4A 5IQIA 1WBWA 4EKLA 3KY2A 4RRVA 4A06A 3O7LB 1FINA 4AGWA 3G9LX 4FSQA 2DUVA 2VTRA 4OW8A 4FKLA 2JKMA 4CFNA 5M56A 1H0WA 5AR5A 3COIA 4ACCA 3PFYA 4EBWA 4I92A 3QHRA 4FUYA 4C33A 4DG0E 4XG6A 2XM8A 1O6YA 4Y83A 3IS5A 4GS6A 1H01A 3NNXA 3VUMA 4EH7A 4PTCA 5CEMA 4FIEA 4LGGA 4RVKA 4BCKA 5KKRB 4KBCA 4DT9A 2GSFA 4NEUA 4AOJA 5A4LA 3TCPA 1UVRA 4X3FC 4C4HA 5BNJA 5LMKA 3S00A 4H1JA 2WOTA 3U6IA 3LKMA 1PMUA 3DBFA 2WELA 3NAYA 3DK7A 3LLAA 4XV3A 1UKHA 3RM7A 3VS6A 4ENYA 2XM9A 2AC3A 3FMMA 3WYYA 5KHXA 2C69A 2PMLX 3BL9A 3E8EA 1Q61A 2RFNA 3GOKA 2OZOA 3QRJA 3FPQA 3SA0A 1OBGA 5KNJA 2BHEA 2CHLA 2W0JA 2WTWA 3PPKA 5G1XA 4U43A 1IG1A 4UWYA 3FXXA 1PHKA 1QPCA 3VS0A 5CAPA 5L4QA 3CQUA 3AKJA 2GFSA 4U80A 2J50A 4DTAA 5D7VA 2ERKA 3GI3A 2GNLA 2QOCA 4O7SA 3U4UA 4KAOA 4G6OA 5AWMA 4BDDA 4B99A 5EKOA 4MBJA 5AIRA 2CPKE 4IVCA 4UMTA 4ZSGA 1PY5A 4J99A 2CNVA 2I0HA 1QCFA 3HUCA 3MV5A 3RPVA 3E88A 3AT2A 2VX3A 3BELA 3D9VA 3ZRMA 3W0PA 4RX5A 3AGMA 3C7QA 4AQCA 4G16A 2J7TA 2IW9A 4BCNA 2XK6A 5CAUA 4MXOA 5CQWA 4XBRA 5EYDA 3V5TA 5A9UA 3KRLA 4FNZA 4D1ZA 4J1RA 5JT2A 4WUAA 5L8LA 4JDIA 1TQPA 4JG6A 3O96A 1S9JA 2QKRA 3EYGA 5E8WA 4V01A 4WNOA 2UW7A 2ETMA 3R1QA 3A61A 3FBVA 3R8PA 1PW2A 3S2PA 4JG8A 1PXLA 1S9IA 1SM2A 3HV4A 3FDNA 2FUMA 4IDVA 4ZZMA 1SVGA 5I9UA 5AUTA 1OUKA 5JN2A 1X8BA 4AQKA 2QU6A 3L1SA 4APCA 3QQKA 3VRYA 2Q0NA 1YHVA 3B8RA 3QCSA 3E3BX 3VS5A 3ZRLA 2XK3A 4ANBA 2PVYA 4L68A 4EWHA 4AZEA 4PL5A 4GL9A 5HIEA 3CD8A 5DR9A 4FC0A 3HGKA 3P78A 5IEYA 5HOAA 4KRCA 2W1FA 5HIBA 4TNBA 2WNTA 3VONA 2WXVA 1SYKA 4FIIA 5B2MA 1FGIA 2W06A 2J4ZA 4BDKA 3QAME 4QMSA 3GFWA 2ZM4A 4D5KA 2OJGA 4FTAA 3IQ7A 2BKZA 2XNNA 3PIYA 3HECA 3K54A 5LVLA 5D10A 2HZ4A 4D58A 1Q3WA 5A3XA 1Q24A 3UP7A 2W4JA 2B9HA 3AGLA 5EYMA 3G90X 2ZV2A 1JAMA 1LUFA 1JBPE 2XZSA 2YITA 4J8MA 1G3NA 5LMKC 4JQ7A 1NT2A 2H8HA 3RMFA 4EH3A 4PX6A 2PVLA 4I6QA 2GTMA 4JDKA 4LL5A 4MXCA 4AN3A 3PY1A 1LEZA 2NRUA 3AC2A 4KBAA 3RZBA 5E4HA 3PXRA 3OBGA 5CAVA 3PXZA 3ZFXA 3EQIA 4MQ2A 4ZTQA 4D2TA 1RDQE 4AZTA 5LOHA 3H10A 2VO0A 4L44A 1ZOEA 3MW1A 5GZ9A 5DT0A 4AU8A 4QDEA 3Q9WA 4FIJA 4BKZA 5F20A 1G8AA 1Q3DA 5AP3A 4RZWA 4UYAA 2A0CX 4A9SA 5I9WA 2ZV8A 4BI2A 3FQEA 1CKJA 2ZDUA 4TTHB 4DG2E 3MVMA 3N51A 5E9EA 3PXQA 4JBPA 5ANGA 4BCOA 4TRLA 4CFXA 1CM8A 5GJFA 2FSTX 1UU3A 2WIHA 3CR0A 3JY9A 4RQKA 3HZTA 3LAUA 4UXLA 4XP2A 5IA1A 1I09A 3OCBA 3W33A 5EK7A 1Y57A 4NW5A 3RP9A 4CMOA 2W7XA 5FRIA 5EOBA 4JX3A 3NR9A 1GZ8A 3QCXA 4U44A 2PU8A 3C4ZA 2E9OA 4JIKA 4YZBA 4RC4A 3TEIA 3HUBA 4E8AA 3GQIA 3HDNA 3FI2A 2WTVA 4L7SA 4LFIA 3D0EA 3MH3A 4CFWA 4JBVA 3R7IA 4GH2A 5H8BA 4BCQA 5A6NA 5M4UA 2R3FA 3VJOA 4Z16A 3VBXA 4FKVA 4BDHA 3EQBA 3SXSA 2YCQA 5L6PA 2BAQA 2QQ7A 2O5KA 3COKA 3DA6A 3EN5A 3R9DA 3FZOA 4B4LA 4QEBA 2HXQA 4AOIA 3RBWA 5IQAA 3ENMA 2W5AA 2YFXA 3ZH8A 4E4LA 3QQJA 4MBLA 2R3PA 3SOAA 3BBWA 3DU8A 4C2VA 4PMSA 3LJ0A 5B2KA 4BGGA 3KFAA 4I5CA 1H07A 1JKTA 2BDFA 3NYXA 4UMRA 1YXVA 3ZU7A 4JRVA 4CFUA 3VO3A 3TDWA 3UOJA 4TZRA 3VVHA 1PMEA 1JOWB 1XKKA 3C51A 3KVXA 4O7VA 2C6MA 4AFJA 3IGGA 2VWXA 3QRIA 2JDOA 1W0XC 4GK2A 2XIYA 4R1VA 3S95A 3MVHA 3K5VA 4E5AX 2YDKA 2VWBA 2GS6A 4GT4A 4KKHA 3RPRA 3OXTA 3ROCA 1T45A 1ZRZA 3BLAA 1ZYLA 2JKKA 2B9JA 3JY0A 4I1ZA 3BU5A 4EH6A 2H34A 2IVTA 2YACA 4IAKA 3H0YA 4Y95A 5CVGA 4EK8A 4BZOA 5CALA 4DHJA 2YZLA 5ETCA 5IH5A 5M07A 3Q6WA 3ULZA 4C4IA 1PMVA 3QTZA 3EQHA 3HLLA 5GJDA 5E8YA 5L8JA 5AFVA 3MH1A 1BKXA 4TYIA 2VWUA 3F69A 3QRTA 5IISA 4FJVA 2JKQA 3P23A 4HGTA 4YUQA 4LGHA 2XH5A 3ZFYA 3OCGA 5CEIA 4IC7A 2VNYA 3S4QA 4S31A 3IK3A 4NJDA 4YBKA 2R3LA 4BWPA 3Q96A 3ZUVA 3LFCA 3EH9A 3LM5A 3NNUA 5AV3A 5FXRA 5IMXA 2UZBA 4WBBB 3GCQA 1XH8A 3BE2A 3WYXA 3C5IA 3NRMA 2RF9A 2C30A 3O17A 4OTFA 2J5EA 1URCA 2VWIA 4LOOA 3MS9A 2C0OA 2A27A 3CTJA 2REIA 1GZNA 4YC3A 3PVWA 3OVVA 5CF8A 4H05A 3V6SA 3MJ2A 3MJ1A 4ZY4A 1AD5A 1AQ1A 3NWWA 2VTLA 3OT8A 2I6LA 3WILA 3NX8A 5CF4A 2VUWA 4O0WA 3FQHA 4FKPA 2PUNA 4O4EA 3EKNA 4DG3E 5EYKA 4MAOA 1ZOGA 4IM2A 4O6EA 3ELJA 5EDQA 4O2ZA 3OXIA 3ACJA 3NPCA 1U54A 2UZUE 2W5BA 4JLCA 1XBCA 3ACKA 4G1WA 4RBLA 3ZXZA 4BDFA 5I9VA 2C5OA 3OD6X 3IGOA 4MF1A 3QTUA 3R73A 2QG5A 3ORNA 4NIFB 4FUXA 4GJ2A 3CEKA 3OMVA 5EFQA 3NYVA 4X2NA 4F64A 3UZPA 3ORZA 5HI2A 3AT4A 4IH8A 3UMXA 1Q8WA 4QMQA 2UW0A 1ZAOA 3FZTA 2YDJA 3PXKA 3W0SA 4YLJA 2QI8A 3NVMB 2UVZA 3ZHPC 5GINE 3CJGA 4U5JA 3TMOA 2R5TA 4FA2A 4CG8A 1FMOE 2XCHA 3F3UA 4EK3A 4ZJJA 4YPDA 4BDJA 1YXTA 4YR8A 3R9NA 4HZSA 3T3UA 1UU7A 4KSQA 4ZSLA 4OTRA 4QYGA 3NUUA 4XNEA 3UDBA 4CFFA 2IVUA 4QMYA 2C6LA 1XO2B 3DB8A 3PY0A 3VUKA 3U87A 3A8XA 4J98A 4C4EA 4YJTA 3QBNA 3U9NA 2BIKB 1YQJA 4WG3A 4EOPA 4LUDA 4OBOA 3QYZA 5J9ZA 1UU9A 3FWQA 2QOLA 5K0XA 4EC8A 3IONA 2JAMA 3G51A 3W10A 3ZTXA 5GNKA 2OO8X 4PDOA 1PKGA 5DT4A 3ZBXA 3NUNA 4KD1A 4ITJA 2LAVA 4PDYA 4KABA 1P4OA 3CKWA 2F49A 3AC1A 3VBWA 1VYZA 3W55A 2J0IA 3LCDA 3D5XA 3QKLA 5HIDA 1B6CB 3VRZA 2HYYA 3DLSA 1RQQA 3F3VA 1FPUA 5DFPA 3WF8A 4YTFA 3BKBA 3KU2A 2XARA 4ORKA 1U4DA 4UZDA 2XF0A 4XHKB 3KQ7A 3ZZWA 2O3PA 4DT8A 3FSFA 3HA8A 3KK9A 5IUIA 5E92A 1A9UA 3R8MA 3ZS5A 2X4ZA 4DEEA 1W98A 4CMUA 2ZMDA 3DT1A 4RZVA 4O0YA 3QGYA 5TF9A 1Q97A 3HMIA 3QRKA 4AA5A 4JBOA 4YJPA 4U41A 4UB7A 4E26A 4AF3A 4EOIA 3LJ2A 2PL0A 3BGZA 4YPSA 3EHAA 3LFAA 2X0GA 2QR7A 4FOBA 4FNYA 4O0RA 2XCKA 3LOKA 3OWJA 1O6LA 2VO7A 3TG1A 1OL7A 3K2LA 3W18A 5LQFA 4LOQA 3ID6C 3GC0A 4JAJA 4ZMEA 4FSTA 4RWJA 5CNOA 4CQGA 2G1TA 3MPTA 1PMNA 4N0SA 2Y0AA 4OAVB 2UZVA 4FNXA 4WHZA 2ZAZA 2HCKA 4HYUA 3WZKA 4JR7A 4ASXA 1R0PA 4XG8A 3QFVA 4MNEA 3Q32A 4W9WA 3NNVA 2B9IA 3ATTA 4BZDA 5J7HA 4BHNA 3NLBA 2CKPA 4DLJA 4G3FA 5FBOA 2A1AB 3F2RA 4WRGA 3KC3A 3Q4TA 4B8MA 2BRMA 4QP9A 2FO0A 2R3IA 3KVWA 3L9PA 5DWRA 4ALUA 5C1QB 2BAJA 4UXQA 2XIKA 3I5NA 3UDTA 2ITTA 4ZXTA 5BX0A 4QQCA 4R5YA 4DN5A 4ZJVA 2X9FA 4UWCA 3UVQA 2UW4A 4KIOA 4YHTA 3FMEA 4C7TA 1ZZLA 4L46A 4X2FA 4A4XA 3DZQA 5JRSA 5JGAA 4IAFA 2V22A 4BFMA 4EQUA 4D2RA 3ZXTA 4G9CA 1GNGA 2EXCX 3MESA 3GVUA 4AXAA 4QTAA 4CQEA 1GZOA 1DAWA 3N4TA 3DKGA 1ERKA 3WF6A 3CE3A 4LOPA 5AAFA 2ZOQA 2BR1A 2UUEA 5C8MA 3V5PA 3WZJA 4AN9A 4F9AA 4AXFA 4DC2A 3ODYX 5I9ZA 2HY81 1VJYA 5LVNA 2R3RA 4FTLA 2ITZA 2ONLA 4H1MA 3FC1X 4FKGA 3KK8A 2X6DA 1OIYA 5C9CA 5CY3A 4R6VA 5BPYA 4IAAA 3DAEA 5J7BA 4WO5A 4UYNA 4CV9A 3KCKA 3AD4A 2YHVA 3F6XA 4HPTE 4ITHA 4OBPA 4ANLA 4Y46A 4F65A 1YXSA 2C0TA 2HY0A 4AGCA 1NW1A 5EG3A 4AAYA 4FEVA 5IA2A 2VN9A 3TNQB 3PE2A 3UZTA 2BPMA 3UO5A 1QL6A 3PIZA 3RCJA 3ORLA 4DHZA 3C5UA 2PHKA 4ALWA 5HE3A 4EH2A 3Q3BA 3QLGA 2W1EA 3SRVA 4RLKA 4X2GA 2QOIA 1OUYA 3R00A 4BIDA 3KMUA 3EIDA 2QLUA 5EW9A 4BCJA 3HRFA 4UZHA 1JSUA 3R7YA 3EKKA 2IZSA 3QF9A 4X6RA 3OT3A 4H39A 5HBJA 1YWRA 3H30A 4FICA 4EOQA 1W2CA 3OWPA 4RLLA 4DH3A 5K5XA 4CXAA 4DA5A 4W4YA 3UQFA 3VS1A 3DNEA 2C3IB 4YJRA 3MIYA 1U59A 5CYIA 3WF7A 2VTPA 2ITXA 4JMQA 5H2UA 4PF4A 1OL2A 4O2PA 1B38A 4CFMA 3WBLA 4D55A 4FV5A 4RA5A 2GHGA 3D2IA 3Q2JA 5LJJA 4E4MA 2VTJA 1REJA 3TNPC 3NIZA 4FIHA 3R83A 2OXDA 3F5PA 1M7NA 5DRDA 3BYMA 3Q04A 5H8GA 3EQCA 4CRSA 4DGMA 4ACMA 3RPYA 3I7BA 4AZSA 4IB1A 4DTBA 1OL5A 3LCTA 4K77A 2WMWA 3ZDIA 3O8UA 2GMXA 3GNIB 3UOHA 1K9AA 3W2PA 4AOTA 5E91A 4FSWA 3UIMA 4DF3A 4NU1A 1H1QA 2V7OA 2W1HA 4J52A 4NTSA 5DVRA 3TNHA 4DBNA 1TFFA 1XH4A 4FNWA 2PY3A 5J95A 3W8LA 4M0ZA 4UN0C 2VO3A 3VHEA 4JVGA 5D9HA 3R28A 4FL1A 4DH7A 3OEZA 3QA0A 1KE8A 4GG5A 4OTPA 4U9AA 3ZEPA 1VEBA 3I4BA 3IW8A 3F2NA 1PXIA 4LRMA 4YTCA 4QT1A 2Q0BA 3HRBA 4RIOA 3U4WA 3LMIA 3ORTA 2R3JA 3D5VA 4U79A 2XJ2A 3VS3A 3LXLA 1ZWSA 3MVJA 1P14A 2OI4X 3PP0A 3MFRA 3R22A 4R5SA 3G6HA 4MXXA 3OOGA 4GFOA 3UTOA 3ZUTA 3R02A 2QURA 4FL3A 1J91A 2ONLC 4ITIA 4Y85A 4QMNA 2BDWA 2QO9A 1ZXEA 2XEYA 1FOTA 3MVLA 4O7LA 3GB2A 3PPZA 2IJMA 4MWHA 2O2UA 4QQJA 4UBAA 3G5DA 5AX9A 2BRGA 5IA3A 1ZLTA 2IF8A 2XJ1A 3DK6A 3GU8A 3FUPA 1PYEA 4AW5A 4E4XA 5AMNA 2OLCA 1YKRA 3BHVA 4FL2A 3EOCA 1DAYA 1XWSA 4Y5HA 5AV2A 4IBMA 4GKIA 2RFSA 3OROA 4GMYA 4NCTA 2C1BA 3DXNA 2HZ0A 5AM6A 4MKCA 4IMYA 4FTQA 2YERA 5IA5A 3KXGA 5BVEA 3M42A 3TNIA 4DEGA 3NCZA 2XB7A 3UNZA 3VUHA 1G8JA 3QCYA 1J1CA 3GU5A 3MN3A 1KE7A 1YOJA 3HVCA 3BZ3A 4EHEA 1GJOA 4BCIA 3VIDA 4D4RA 3FXWA 2YM3A 3A60A 1J1BA 4Q9SA 3RKBA 3R9RA 2QODA 3AG9A 3ZMMA 3QALE 1YWNA 5A4EA 2QO2A 3R1YA 2GHLA 5HVJA 4I6HA 4WNMA 4MD8E 1STCE 5KZ0A 5HLWA 2I40A 2GQSA 2NYAA 3PLAE 1H1RA 4O27B 3TNWA 1OIRA 3C0IA 3DBDA 4BHZA 4EOOA 4EZ7A 3MSSA 1Y8YA 3AOXA 4BCPA 2F2UA 4RJ4A 4FV7A 4MXYA 5HESA 5AM7A 1OZ1A 4R7HA 5CAQA 4XV2A 3QRUA 4BTKA 3W8QA 5A4QA 4U3YA 1W84A 4L01A 1XR1A 2R3NA 3QTQA 4C62A 4RWLA 3VNTA 3SRVB 3TIYA 3ZO1A 5DG5A 4HCUA 4FV9A 3EYHA 1J7UA 2J5FA 2VWZA 3DBQA 2B7AA 3PLSA 3LCOA 3TKUA 4EH9A 2YIRA 3QD3A 3R9OA 4YSJA 4XRJA 3CJFA 3IOKA 2ITNA 4O7NA 4BDCA 4OTGA 1F0QA 2BVAA 5HU3A 2W05A 4HW7A 2C68A 5AV0A 2VNWA 2JDSA 4EWQA 2X2MA 3HMPA 1W7HA 4FKRA 2CDZA 1RJBA 2XNMA 5FDXA 2HIWA 3O51A 3W2RA 5HG7A 4FSYA 3LFBA 4JBQA 3ZCLA 3LQ5A 1JKKA 4AZFA 5L6WL 3B2TA 4MUQA 1Q4LA 3BWJA 3DGKA 4AX8A 4QQ5A 4AACA 2R3QA 3FMKA 3P4KA 2ERZE 5ETIA 2QOBA 4FF8A 3SX9A 1VZOA 4RVLA 2QNJA 1XH7A 4NKAA 4BCGA 5FUTA 3QA8A 2IZTA 2YCRA 3KMWA 4G3DA 4A9TA 4M69A 5DIAA 4ZLOA 4GRBA 5IH6A 2BCJA 1W83A 4AW0A 5HQ0A 4FG7A 1OPLA 5LCKA 4F6WA 3G0FA 3PIXA 4AXEA 2OIDA 3LCSA 3POZA 4PY1A 2P3GX 3KRJA 4L3JA 4WSQA 5IDPA 4R77A 4CG9A 3NZ0A 4U0IA 3VS2A 2Y4PA 4FKUA 4TWCA 5KMIA 1Y91A 3FC2A 4K8AA 1YXXA 1OI9A 2B4SB 3PSDA 2BFYA 3QTSA 4NCTC 4BGQA 2R0IA 2G2HA 4IZAA 5EI8A 5BVKA 3N9XA 4GK4A 2C5YA 3DJ6A 3ZC6A 2ZJWA 4QO9A 4O96A 1YVJA 4BI1A 3DNDA 4OGRA 3VUDA 4NUSA 2PVKA 4CMTA 5CSXA 1GIIA 2HZNA 2Z8CA 3OUKA 2VTNA 2GDOA 4ANQA 2NNWB 3FYJX 4BBEA 5FTQA 2Z7QA 4G31A 5M4CA 1K3AA 2WMSA 4DH1A 4PP7A 2X6EA 1YWVA 5TE0A 3UP2A 4Z7GA 3D5UA 5HORA 4U45A 1CDKA 3C4XA 5IH4A 5AR2A 1H0VA 3ZEWA 2Z2WA 5CSHA 5HE0A 3V8SA 4A07A 3TXOA 5A6OA 5IU2A 2GCDA 4AZVA 3I81A 3PFQA 1F3MC 5EM8A 5HLNA 5JQ5A 4YURA 3L8PA 4MK0A 4CEGA 2E9UA 4JXFA 2W4OA 2XNGA 3TV7A 2W1IA 3AC4A 1JQHA 4IC8A 1Q8UA 2G01A 4LV5A 4C4GA 4D2SA 2HOGA 3TZ8A 2XRUA 2C1AA 1GZKA 2DS1A 4DAWA 3FMLA 2B55A 3MY1A 1ZYDA 1GAGA 5AUWA 4PMPA 2HAKA 1ZMUA 2YIXA 5LXMA 4QP3A 1APME 4HYSA 4O0XA 2R9SA 1JLUE 3EQPA 4R8QA 4EORA 3Q4CA 5HE2A 4EHZA 2BRNA 5M06A 3VWAA 4HGLA 5EI2A 1LP4A 2VTMA 2B53A 3EMGA 4FIGA 3SD0A 4DEBA 4AE6A 3SGCA 2IZUA 1XMMA 3FLSA 4AE9A 1TQIA 3QQUA 4KS8A 4EC9A 4K0YA 2J90A 4IAYA 1Q8ZA 3NVKI 2V5QA 5KZIA 4O21A 3PJCA 3TZMA 5LWNA 2JC6A 3PJ2A 4EBVA 4K2RA 4O83A 2HK5A 2F4JA 5FDPA 4G5JA 3LFEA 4HCVA 4AT5A 2FGIA 4XG4A 5H8EA 4O4BB 3QD0A 5TR6A 3KB7A 3KA0A 2CKQA 4IQ6A 5EDRA 4Z9LA 3UMWA 3UDSA 3KCFA 2EUFB 3HEGA 3EJ1A 3H9OA 3PRIA 4AXCA 3P7BA 5T6KA 4RJ3A 4USEA 3PZHA 4APPA 5EYCA 3KN6A 3PVBA 4F9WA 1UNLA 3THBA 3R7UA 3AMAA 4O0VA 4IB5A 4ZLYA 3F5UA 2HZIA 4PPBA 4S33A 4O22A 2WMXA 4FZDB 3SW7A 2GS2A 3UDZA 2UZNA 3O0GA 4XP3A 4XV1A 2RG5A 2XIXA 3QKKA 1KE6A 2UW5A 2WAJA 4OTHA 3UOLA 3ZO3A 2BZKB 3BGPA 3O5AA 2FH9A 2QKWB 2VU3A 5A4TA 5HNIX 4CZTA 3QHWA 5ANDA 4GT5A 4IM0A 4HVIA 4M14A 2WHBA 3K3IA 3QTWA 4XG3A 3UGCA 2YM5A 3E8NA 4C35A 5GIPE 2Y8OA 1HCLA 3FYKX 3HYHA 3L8VA 5CZIA 4S34A 4C37A 2VWWA 3QTIA 2CNUA 2EXMA 4NH1A 5G6VA 3BU3A 3V51A 2QOQA 1BI7A 4L67A 4ZEGA 3UZRA 3I7CA 4NIFA 1NVRA 2X4FA 3OHTA 4DFYA 5AV1A 4E1ZA 3SG9A 4QP4A 4G9RA 5CVFA 1ZY5A 3PZEA 5AA8A 5TOZA 2DQ7X 2B52A 3VC4A 2QOOA 5ANIA 2W99B 4TNDA 5AR3A 4P7EA 5TT7A 1VLRA 3D14A 3MI9A 2WQEA 5ANJA 4M69B 2CLXA 2C5VA 4DYMA 3TZ7A 4BKYA 5DT3A 3W2SA 3D7TA 4K11A 2IG7A 2ETRA 4XUFA 5FEQA 1Q8TA 4RT7A 3TUCA 3ALNA 4KB8A 4ACDA 3A2CA 4JAIA 4YZ9A 2A98A 4BIBA 5FD2A 3FLWA 4GU9A 2IVSA 2QR8A 3G6GA 4XLIA 4CGAA 2OZAB 2X39A 3UQCA 1W8CA 2I0VA 1ZY4A 2ITUA 3BHTA 4MCVA 4UV0A 4D4YA 4E6QA 4NL0A 3NYOA 2VGPA 3DAJA 1MQBA 4NM3A 4HGSA 3OP5A 4Y8DA 4O7YA 3UVPA 5HD4A 4LUEA 5IF1A 4TYHB 1SVEA 5I9YA 3BRBA 4G6LA 4O1PA 5FLFA 4GKHA 1IAHA 2PPQA 2PZIA 2WOUA 3PY3A 4BRXA 4ASDA 4BTFA 4CLIA 1P2AA 4QYEA 3AT3A 4IJ9A 4D4SA 4IVAA 3GENA 1PYXA 4FT3A 5AUXA 3R8ZA 2JIVA 5IQHA 5AX3A 5HKMA 4C02A 3BU6A 3FMHA 3V6RA 4CTCA 3R8UA 3VS4A 4MVFA 3RVGA 3OG7A 2C3LA 4DEDA 2YAAA 2XK4A 2CKOA 1IR3A 2AUHA 3QXPA 2NP8A 5ETFA 1WMKA 2W4KA 1MUOA 1OGUA 2WTIA 1Y6AA 5IQFA 3PSBA 2IVVA 4O0UA 4ZIMA 1R1WA 2Y6OA 4QTCA 5EQYA 5KMMA 3RZFA 5FTGA 2XK8A 2PUPA 4QMUA 2VV9A 5HBHA 4AAAA 2YM4A 4FSUA 3PVGA 1JVPP 2R3KA 2UW6A 4TY1A 5HG5A 3SW4A 4ACHA 5CT7A 1ATPE 3Q6UA 4PDPA 3ORIA 4CNHA 5BVOA 4FTUA 2BAKA 3BE9A 2WGJA 1BYGA 5AP7A 3WZUA 4CKJA 3G15A 5EQEA 4L3LA 4BY9E 2FVDA 2O65A 4PP9A 3ZZEA 4B6LA 2W1ZA 3RNIA 2JIIA 4IWDA 4B8LA 3UOKA 3REPA 4FKWA 4FEQA 2VD5A 2X81A 4I22A 1UWHA 4O38A 3TM0A 3PXFA 2B9FA 3LFNA 3R1SA 4I5MA 3RNYA 5J1VA 3E63A 3D4QA 4X6QC 4EOMA 4ERKA 2VAGA 2RIOA 5LMBA 2YZAA 3NSZA 3JYAA 4II5A 2GTNA 5CF6A 2GQRA 3LVPA 1DM2A 2R0UA 4M13A 5BVDA 4FTRA 5FM3A 2WEIA 4J8NA 4NSTA 4Y72A 3QGWA 5E8ZA 3TTIA 4GIHA 4D2VA 4K6ZA 5AEPA 4M0YA 2BMCA 5F1ZA 4BICA 4GVJA 4XBUA 1FVRA 5CEKA 4FT5A 4A9UA 1RW8A 4N70A 2AQXA 2XVDA 2CCHA 3GCSA