3HP2A

Crystal structure of human p38alpha complexed with a pyridinone compound
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
352
structure length
341
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Discovery of N-substituted pyridinones as potent and selective inhibitors of p38 kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 110
structure length 341
sequence length 352
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hp2A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hp2A01
4J71A 2WIPA 1PYEA 3LFEA 4EK8A 5CYIA 3ZRLA 4O7LA 3FSKA 3MDYA 4OGRA 3N51A 3QTRA 3TNPC 3WOWA 4FTAA 4G9RA 2Z7RA 5AUTA 4AT3A 4GUBA 3GP0A 4EQUA 5D11A 2YHVA 5CF5A 4FKGA 4EOSA 1JSUA 3GT8A 4QYYA 2CKQA 4GVAA 3FSFA 5BMSA 2JAMA 3R1YA 3MPAA 3OT3A 3UOJA 1AQ1A 2P2HA 4GYGA 4K9YA 4RFYA 4BCIA 4QP4A 4XUFA 4I0RA 4L68A 4O6LA 3T8OA 4QD6A 2R3PA 3KXZA 2BILB 2C6OA 3UZRA 3C4EA 3W8LA 5IMXA 2BVAA 4YJVA 5LMAA 2I6LA 5J8IA 4AACA 3JR1A 4F4PA 4NIFB 3ZOSA 5JRSA 3R8VA 4CMTA 5I9XA 2CLQA 5CQWA 4ANSA 4DGOA 5BVWA 2FO0A 3RK7A 2J0KA 2W5BA 3BHUA 3NRMA 4CRLA 2W1CA 4C3RA 4QNYA 5M4FA 3OWLA 2C0IA 3KL8A 1UU9A 3PSCA 4ZLYA 4QTCA 5DRBA 3FC2A 5EM7A 4UBAA 2P2IA 3OY3A 1Q8UA 1OM1A 4U8ZA 5B2MA 4D58A 3Q32A 4UWCA 1YOLA 3V04A 5EM5A 3ZC6A 5KUPA 3PE1A 4I5HA 4JLCA 4KSPA 4QMYA 1XBCA 3VS5A 2PUPA 5F1ZA 2WD1A 4FR4A 1REJA 1VZOA 4AAAA 3L8XA 3CCNA 4YR8A 3DXPA 5EHYA 3MIAA 4GIHA 4NM3A 3QGWA 4DINA 4EUUA 1PYXA 2RIOA 2ZDTA 4ANOA 4DGGA 3G6GA 2XBJA 2VTMA 3BYMA 4GW8A 4MHAA 3R9HA 2ZV9A 5LVLA 1LPUA 1NA7A 4EL9A 3II5A 4TN6A 3MV5A 3FMJA 4QQJA 1ZMUA 2LGCA 3HECA 3ZLWA 2HZ0A 2ETRA 4AFJA 4ACHA 1H1RA 2JC6A 5IA3A 2BDFA 4BGHA 4L44A 3WIGA 4DFNA 4O21A 3FLQA 4XEYA 2ITZA 2IW6A 3LOKA 2JKQA 1TQPA 3A4OX 4O6EA 3NCZA 4G9CA 4U7ZA 4ZTQA 3VW8A 3F3ZA 4F9BA 4RA5A 5CSVA 3BQRA 4XRJA 3DLZA 3I5NA 3O0GA 4QP8A 3LFDA 2R3IA 2CGXA 3O17A 4DC2A 5J5TA 3ACKA 3E64A 3AC5A 3D14A 2OU7A 3I0QA 3QTSA 4O7TA 3AC3A 4HVIA 4ANMA 4HYSA 5EQEA 5HNIX 1XH6A 2ONLA 2X4FA 5BVNA 4LUDA 5IF1A 4A06A 4UYAA 2HK5A 2XRWA 3ZH8A 3FWQA 1ZMVA 2YJRA 4IHPA 5GHVA 3VWAA 3WZDA 5CF6A 3N4TA 2A1AB 3QTQA 4TT7A 3QCXA 4D1SA 2B7AA 4M0YA 3BGZA 5ETFA 3LMGA 2ZDUA 4DN5A 1NY3A 4F0GA 2F4JA 4XMOA 4I6QA 4HCVA 4IFGA 4O0WA 3DJ6A 3IKAA 4HZRA 4C38A 3PUPA 3WF8A 5HHWA 4WRGA 5CSHA 2QLQA 1PXLA 3CS9A 3MFSA 3R7VA 1K9AA 1TKIA 1HOWA 3MVLA 3NPCA 4D2TA 4PP7A 3CKXA 2EB3A 4U81A 3MS9A 4FNXA 4DH3A 3ID6C 5K0XA 1UNLA 2YZAA 3UPXA 4BDIA 1V1KA 4O1PA 4UB7A 1TQIA 4YZ9A 3BQCA 3EB0A 4D5KA 5I5ZA 4O27B 2GHMA 5J1VA 2XNEA 4I0TA 5C4LA 3NIEA 4YZNA 5ITAA 3TZ9A 2ITYA 2UZNA 3PY1A 3REPA 5FEEA 3UMWA 2IVUA 4JQEA 3OW3A 3C5IA 2JD5A 2VTIA 2XNOA 3RNYA 4D4RA 2R3HA 4RIXB 4YJNA 4U5JA 4WRSA 5EH0A 5HO6A 3U51A 4G6OA 3MJ2A 4I3ZA 2C3KA 3F7WA 2IW8A 2JGZA 3UIBA 1DAYA 3UZPA 3UMXA 4C61A 3EZVA 2OK1A 3TKUA 4USDA 4EOPA 5K5XA 2R5TA 2PVMA 4RWIA 3VS2A 3GC8A 1WCCA 5DI1A 3WZEA 4CQGA 3MESA 5HE2A 3MYGA 4Z7HA 3VBTA 3OC1A 1UU7A 4G3CA 4IZ5A 2WIHA 3H10A 5HTIA 5AP6A 2FSTX 4FTQA 4AOIA 3AD6A 3QRJA 4C8BA 4J1RA 3F3VA 3ZONA 3IPHA 4R7IA 2JFLA 2PVNA 3D2IA 4YMJA 5AUVA 3IDCA 2X1NA 4MBIA 4GH2A 4XYFA 3F61A 3K3IA 3L9NA 3FLYA 4CFNA 3JUHA 3E7VA 1YXXA 4EBVA 4F9CA 4DCEA 4FYNA 2X0GA 4IC7A 4O81A 4EC9A 2X8EA 4Y46A 5CT7A 3QTZA 1RJBA 4J7BA 5TKDA 4BKJA 3CC6A 4JR7A 3GU6A 2ZAZA 5J79A 4QOXA 2GPHA 5LVNA 3WI6A 2BIYA 3E8DA 4E4XA 3NMUF 4DBNA 5B0XA 5LMKC 2ZM1A 3H0YA 2VRXA 3F3UA 4PL3A 2XKFA 4GT5A 2FUMA 3MN3A 4G6NA 3PYYA 2WU6A 1OUYA 4FIGA 4FTLA 1P2AA 3QYWA 3E63A 4F1TA 4EOIA 2YABA 1Q8ZA 2X2MA 4EHZA 2C1BA 1DAWA 2JDTA 3ROCA 3VBXA 3TNQB 5IH4A 4FTIA 4EOMA 4F65A 3O50A 3GGFA 5AP2A 3T3VA 4JRVA 4RJ8A 2W17A 1XH9A 4BWXA 4YP8A 4FKUA 3FKNA 3D15A 3IO7A 4ZSAA 4GG7A 4FIEA 4H1MA 5I3OA 4TWNA 2XRUA 2R3GA 3VS1A 3PP1A 4PRJA 3MA6A 2ZV7A 2WTKB 4GCJA 4NUSA 5AADA 4OUCA 4HNFA 3ZUTA 5CY3A 3W2RA 4D2SA 2VX3A 3R1QA 3C4XA 5IQFA 3IW8A 4DEAA 3AOXA 3W16A 3FL4A 3LHJA 5DFPA 2XJ0A 3WYXA 3V01A 2PVKA 2OW3A 1OKVA 1H1WA 2QOHA 2VU3A 3EFWA 3LQ8A 4GUEA 5FTOA 3ORIA 3A2CA 3NUSA 1B39A 4XG7A 4BIDA 1Q8WA 3VBVA 3W2SA 2Q0NA 3E5AA 3SVVA 4H1JA 3E93A 3LPBA 5IQGA 2CKPA 2DWBA 4FK3A 3OMVA 1XBAA 2X81A 3OOGA 4FV8A 4LL5A 5KMOA 4RC3A 3BZ3A 5ANDA 3QUDA 4NK9A 3FZSA 5F9EA 3RBWA 3T3UA 2A19B 2XKEA 1G3NA 4IM3A 2IPXA 3D5VA 4FT5A 3L8PA 4J95A 5CWZA 4AZFA 4AA5A 3SC1A 2UZOA 5JH6A 4WA9A 4Z3VA 1BX6A 1B6CB 3QA0A 5ICPA 1IA8A 3PPKA 5M06A 1CTPE 4UEUA 5DR2A 3WF7A 1M2RA 4YO4A 4R77A 3E3BX 4B6LA 4CXAA 4GKIA 1BYGA 4XJ0A 3Q4ZA 4UWBA 4RZVA 2C4GA 3C13A 5E1SA 1KV2A 5IH6A 4RWLA 2QOFA 3DK3A 5C01A 3HUBA 4C4FA 1YW2A 2ERZE 3TIYA 5DVRA 1JNKA 3RCJA 4BR3A 1J7UA 4ZLOA 4EHGA 4DH5A 3UIXA 4CTBA 5EI8A 5C1QB 3U4UA 4GSBA 2Y0AA 4PPAA 4DEEA 5L6PA 3QQGA 2HYYA 4BDKA 4MTAA 3CTQA 3S0OA 3QYZA 2UW5A 2A27A 3GVUA 1OL1A 3IK3A 2OSCA 5HGIA 3WYYA 2O0UA 4DYMA 3QCQA 4E4NA 4O0SA 3OZ6A 3GFEA 4PDPA 2ZM4A 2BRMA 3DXNA 3V6SA 1Q41A 3MPTA 3AG9A 3QA8A 4ZAUA 4PMSA 1TVOA 3F5XA 4R7HA 3TJCA 4A4LA 3POOA 5D1JA 5J1WA 4BHZA 5LMKA 4RFZA 4YJOA 5L8LA 3OD6X 5HU9A 2B1PA 2GQGA 3FE3A 4NT4A 4GFGA 4TRLA 3UOLA 3VBYA 3NVKI 3GI3A 4NH1A 4FVPA 4YJTA 4EKKA 2XK9A 3TI1A 4YTIA 4KWPA 1Y8YA 2R0UA 3RZBA 4AWIA 4UMRA 2BALA 5A54A 1PF8A 4C4JA 3R9DA 4CG9A 5AM6A 3LFQA 5E91A 5I9UA 3R7UA 3N9XA 3RP9A 2W1ZA 2IG7A 1OECA 3HYHA 1OPKA 2E2BA 5KBQA 3IOKA 2GTMA 4OR5A 5M4IA 3A99A 1OL6A 4KD1A 1UNGA 2J7TA 4ZTNA 2VWUA 4JIKA 4TWOA 5E8UA 3T9TA 2XUUA 5HQ0A 2QNJA 1QPEA 3PZHA 4KIKA 4ZMEA 1WVWA 3D0EA 3MY0A 2JLDA 2CCHA 3LXLA 5AV3A 1X8BA 2C1AA 2C5YA 5HORA 5JFVA 1GZKA 3EQHA 3PG1A 4L00A 4YSMA 1WVXA 3AD5A 3GXLA 2OFVA 5ANEA 1OITA 4QMQA 4U40A 3FLWA 1FMKA 3BV3A 5CSWA 4IAIA 3MBLA 2XCHA 4P5QA 2GU8A 4AGWA 3Q2JA 4F9WA 4PV0A 3DFCB 2PE1A 5KCVA 3MY5A 2QO9A 3QC4A 4EI4A 3BE9A 3O51A 2YIQA 3ORMA 4RZWA 4UYNA 3TN8A 2PY3A 3C4WA 3AMYA 3ZM4A 4OTIA 4HGLA 4QMVA 3F5GA 4B4LA 4FSYA 3TUCA 1OL5A 2EB2A 3Q52A 3KULB 4JXFA 3BIZA 5J7HA 4FG9A 4L52A 5M4UA 1PXPA 2C5XA 1Z5MA 4ASDA 4D1XA 5HE1A 4A9YA 5C8NA 4KINA 4IZ7A 2PK9A 3GCUA 3QLFA 4N0SA 4WO5A 5E8ZA 5B2LA 4EUTA 3DJ7A 4G6LA 2H34A 4XLIA 5LCJA 4XRLA 3JPVA 3ELJA 5ETIA 3U4WA 3NVMB 4DE4A 4EJ7A 4BY9E 4H3QA 4XV9A 3NWWA 3ZYAA 2X6DA 4BICA 3F5UA 4IDVA 4IXPA 4RVLA 2E9OA 2F49A 5AV0A 2Z60A 4KKGA 4LFIA 4IAAA 1OL7A 2P3GX 3FMNA 3RAKA 4EK5A 4BDHA 3FLZA 3NUUA 4JNWA 2F7XE 4QMTA 1PHKA 2VTQA 2QOQA 3KMWA 3OG7A 1KSWA 3OY1A 3Q96A 3PY0A 3B8QA 4AOTA 5IPJA 4QMPA 2BKKA 3MSSA 5KMMA 1ZAOA 2EXEA 2OIBA 2QVSE 3OUKA 3QKMA 4FNZA 2JDVA 1M17A 2W5HA 2WGJA 4ZS4A 1BUHA 3AGLA 3RPOA 5IMEA 2J9MA 2VGPA 2IZSA 1OKYA 1H1SA 2ACXA 3UO4A 4CVAA 2XIXA 5C27A 1IAJA 3PWYA 4E5WA 3NX8A 5TE0A 4XG3A 4DEGA 4BF2A 4ZZOA 2OJGA 1F5QA 5HVKA 3FMHA 4TWCA 3LZBA 4RPVA 1Y6BA 5E1EA 3OOMA 2UW4A 4EH6A 4HCUA 4RJ7A 4QQCA 3ZDUA 4FTKA 2C3JA 2OLCA 5IQCA 1WBWA 1ZZ2A 4FKSA 2JBPA 1W8CA 2UW6A 3BLQA 3OCGA 4MXAA 1ZMWA 3TV7A 3U6IA 4LV8A 4PNIA 5KKRC 4MQ2A 5AA9A 4P7EA 4CNHA 4M3QA 3EQIA 3I0OA 4FTNA 2YM3A 4W9XA 4V05A 2BZHB 2HELA 4FKLA 1ZARA 4C59A 4QYFA 3RHKA 5FTQA 2ITXA 1YOJA 4XOYA 3NNVA 3KC3A 3E3PA 5HVYA 5IQDA 4O7RA 4V0GB 4HGSA 4JX7A 3VNTA 3EHAA 3C50A 5H8BA 4BDCA 3QD0A 4GK3A 4NIFA 4RVTA 4C3FA 2F9GA 4WUNA 2VD5A 3EN7A 4HGEA 1CKIA 3SW7A 3GC9A 3R22A 5AIRA 2WMRA 3ROYA 3W2PA 4A9TA 2QI8A 4XV2A 3SA0A 2FSLX 2OWBA 4PP9A 4C3PA 4BI2A 1V0BA 3LCOA 4R1VA 1OUKA 3VJNA 4C4HA 4JIAA 1YXSA 1VEBA 4P4CA 2YACA 5C4KA 4IQ6A 4MBJA 1MQ4A 4AW5A 4IWQA 4BTJA 5LWNA 3ATSA 1QMZA 4IADA 3W8QA 2VO7A 3RPRA 3VIDA 4B9DA 3LVPA 3O71A 4F7NA 3FI8A 3EYHA 2J50A 3F3TA 4F7SA 4G3GA 4A07A 3JY0A 4FKIA 4EBWA 2PZYA 2I0EA 1OBDA 2Y8OA 3Q9WA 3HZTA 2WTDA 4FUYA 4HGTA 3BLHA 4QPMA 4TNDA 5K4JA 3EQPA 4S2ZA 2VTJA 4B99A 4B7TA 3U55A 2BAKA 3PXFA 3E87A 4XNEA 5JQ5A 5C8MA 2P0CA 2ZYBA 3HA8A 3G33A 3PZEA 3Q6WA 3U54A 3G9LX 3JVSA 3NW6A 4F9AA 2BUJA 5L2QA 3EYGA 4LL0A 4DEIA 3JVRA 4KIQA 5EQPA 4OAUC 3OEZA 4ZSEA 4YPDA 5ANKA 3R2BA 3HV5A 4F08A 4UZDA 3QTUA 4YURA 4XX9A 5EDQA 3LE6A 5ANIA 4DFZE 3OT8A 3BLRA 4DG2E 4EJNA 1PMUA 5AIKA 4BBEA 1Y91A 2GFCA 2O63A 4FSWA 3FZOA 3CLYA 5AUYA 4ERWA 5IDNA 4EC8A 1ZYCA 4ALUA 4IVBA 1SZMA 4N70A 2WMBA 5AP4A 3DCVA 2CMWA 4LQMA 1A06A 2ITUA 5HO7A 3RAWA 2G01A 2OZOA 3R7GA 4WIHA 3MY1A 4EQMA 2CKEA 4FV5A 1Q3DA 5DT0A 4GIIA 2XP2A 5AR2A 3MGYA 4KIKB 3UOKA 5E90A 3LMIA 2WTCA 4RMZA 2YAKA 4D4YA 4HJOA 3RPSA 5KO1A 2C47A 1I09A 3HMIA 3LKMA 4QPSA 3ZM9A 3ZFYA 1K2PA 2W5AA 2XH5A 5T6KA 1XH8A 3OUNB 4PDSA 4FKWA 3VQHA 1M2QA 3EZRA 2F57A 3D5XA 1R3CA 4O38A 3OTVA 1ERKA 1LEWA 3A7IA 4XLVA 4CV8A 4CFUA 5AWMA 2PYWA 3MPMA 2W96B 3KGAA 5A4QA 4FIJA 2JFMA 3A8XA 3GCQA 4X21A 5IG1A 4NL0A 3BRBA 4I4FA 4XP3A 1Q5KA 3AT2A 3RALA 4BYJA 3CEKA 3CXWA 4YBJA 3ZSIA 1XQZA 4AFEA 4XOZA 2I1MA 4FG7A 4RWKA 4RWJA 4AT5A 3TDVA 3BKBA 3I6WA 3OS3A 4BKYA 1SYKA 3Q4CA 4ANNA 4DITA 3SG8A 3UO6A 3SX9A 5BX0A 3COMA 3EH9A 4DEDA 5AAEA 4RIXA 5IUGA 4ASZA 3FI4A 1WBSA 2W1EA 3GNIB 3VO3A 3F82A 3KXGA 2W1FA 1Y8GA 2RFSA 2WKMA 1PMVA 3EL7A 5IQBA 2FGIA 3P4KA 2DUVA 4BC6A 5M09A 3W32A 5HBEA 2RG6A 2YIRA 4IACA 4R78A 2BROA 4PWNA 3EN9A 3Q4TA 4HYHA 2FYSA 2F2CB 4ZP5A 5KX8A 2HWPA 4IM2A 4FIHA 4MF0A 4FTOA 3PTGA 3SLSA 1PXIA 2GTNA 5DHJA 1H0WA 3FZ1A 1VJYA 2XK6A 3FMKA 3P23A 3TV4A 3BCEA 4D1ZA 5LVPA 1A48A 1YXUA 3C0GA 3IW7A 5TF9A 3NLBA 3R28A 4E5AX 4BDFA 3AT4A 3HEGA 4QQTA 2B53A 3ZSHA 2ZJWA 5DOSA 1H25A 2YM4A 1FVVA 4FV1A 4F7JA 2HXQA 4IAKA 5JGDA 3KQ7A 4WNPA 4ZJIA 3ZCLA 5AEPA 2XNBA 4APCA 3QWJA 5AP5A 4E6AA 4F6UA 3DDQA 2WU7A 5HO8A 4DFYA 4YTFA 2IVSA 2J2IB 4UZHA 3MH2A 4O22A 4LRJA 4LOOA 3OFMA 3PVWA 4YZMA 3R7EA 3CD3A 3WF5A 4ENXA 3PVGA 2XKDA 4QMSA 4BBMA 3DNDA 4FTCA 4QPAA 5HG8A 2AUHA 3ORLA 4CKJA 3B2WA 5IA2A 1QPJA 4QP1A 3F6XA 2WMAA 3PA4A 3UDBA 2WQMA 4XBRA 1KE7A 5GZAA 3R63A 3O96A 4Y95A 3LW0A 3V8SA 4CFVA 4L7SA 4R5YA 4G31A 4IAZA 4M0ZA 3QD3A 3CSVA 4O0XA 3I60A 4TYHB 4TTHB 5BVOA 2HW7A 4MQ1A 4D2RA 4KIOA 4WG4A 5EW9A 4FEWA 3ZUUA 2JBOA 2YISA 5BVFA 2E9UA 5ANGA 1OPJA 4NKSA 5E8WA 5AA8A 3CP9A 2RGPA 2ERKA 3M11A 5FP5A 1YQJA 2UZBA 4QYEA 3FQSA 4NW6A 4D4SA 2YIXA 5CEKA 4YLKA 1PRYA 4O7SA 4M12A 3F7ZA 3Q53A 3FXXA 4RJ5A 4FEQA 4FTTA 2Z2WA 4YJRA 4DHFA 2V5QA 3FMMA 5JKGA 2RFEA 3BX5A 3QUPA 2F7EE 4L3LA 1M2PA 3QZGA 2WMTA 3IDBA 4MF1A 4XH6A 5DMZA 1Y57A 3HKOA 2CGUA 2WQNA 3MH0A 3NUYA 2ZVAA 2J51A 3ET7A 4W4XA 3BHTA 4PUZA 4CFWA 3UVPA 4YLJA 2IN6A 1H4LA 3V3VA 4DLIA 3R83A 3DB8A 4OBOA 4UV0A 4DBXA 2B4SB 3D5UA 4TPTA 4AW0A 1OL2A 2IVTA 4ALVA 2X39A 2YDKA 4C34A 3A7FA 3LCTA 2OG8A 1OZ1A 3K5VA 5BYYA 4E4LA 3IONA 2QHNA 3CR0A 3R0TA 2ITWA 2YEXA 1OVEA 3DS6A 4HYIA 2HZIA 4TKSA 4YJPA 4CT2A 3GCVA 4G3DA 3ZO4A 3DT1A 2VWWA 2R9SA 1E1XA 3B2TA 1FVTA 3QQLA 4ZOGA 4A9UA 1REKA 4E6CA 3R21A 1XH7A 2OZAB 3OEFX 3Q9ZA 4R7BA 2CGVA 4L45A 2YCSA 1Z9XA 4BBFA 3ZZEA 4PTCA 3VN9A 3EQGA 3VRZA 5L6WL 3UTOA 5JZJA 4L7FA 3KN6A 4XV1A 3I4BA 1YDRE 5BYZA 3OVVA 3R8ZA 5HNBA 2NO3A 4L8MA 4ALWA 3LMHA 3KRRA 4TXCA 3P7BA 4TZRA 1RE8A 4EH9A 2QURA 2CLXA 3G9NA 3NYXA 5ANOA 2Z7QA 4ERKA 3ZLSA 3WZUA 4PMMA 3U87A 4JDIA 1JKKA 3NNUA 4J96A 4FEXA 4YC6A 1OB3A 2QOOA 1IASA 3W18A 3CTJA 3ZFMA 2X9FA 4O0YA 4D55A 3F66A 4EYJA 3P79A 5K4IA 3LFNA 5CEPA 3GFWA 1YHWA 4RIWB 4Z55A 3U8WA 4HCTA 5CQUA 2UVZA 2A4LA 5FXSA 4K6ZA 4AA0A 4AW1A 5LOHA 4LUEA 4DH7A 1P14A 2G1TA 4YZDA 5J9YA 5HG5A 1H8FA 3FKLA 3KXMA 3DAJA 4U42A 4QTAA 5KKRB 4J53A 4CLJA 5CF4A 5IEVA 3A7GA 3A7JA 3FUPA 4CFXA 4S32A 5HE3A 1W84A 2ZM3A 2ZB1A 4KRDA 5GJGA 4FKRA 4WNKA 2QKWB 2YLFA 3R04A 3IGOA 4IX6A 1GJOA 5A4LA 3BHVA 1IRKA 3PVUA 1OIYA 3V51A 2CN8A 5L6OA 4UMPA 5AM7A 4F09A 2X8IA 3MB7A 5DN3A 4BCGA 4DGMA 3HMNA 2WAJA 5FBOA 1ZY4A 4EEVA 1GZNA 2X4ZA 3FLNC 5HOAA 2J0IA 2OH0E 3OXZA 4KS7A 3FQEA 5J95A 1YWRA 4WG3A 4H05A 1SVHA 3TCPA 4XBUA 4O7NA 3EIDA 4E7WA 1YI3A 4EH8A 1P4FA 4QMNA 4O83A 2QCSA 3W10A 4QP6A 3HL7A 1M14A 1H01A 4ZTLA 1O6YA 5GZ8A 4D4VA 3DDPA 3QTIA 1YWNA 2WMXA 5KMNA 2C30A 3FMEA 4G34A 2BRNA 4DFLA 2PE0A 5AP3A 3KMUA 3BYVA 3PA5A 2VWYA 1T46A 2QQ7A 3KULA 4ITIA 3QLGA 5CU0A 3COHA 4CQEA 4IC8A 4CMOA 2PUNA 5AAFA 1GZ8A 2VGOA 2BHEA 4I6BA 2UW8A 4JBOA 4W4YA 4GL9A 4MXZA 2ETMA 3BBWA 4M14A 4MCVA 5E7RA 2IW9A 5J9LA 4O7WA 5J87A 1UU8A 3KMMA 4L01A 2XKCA 4JG7A 4JT3A 4BCNA 4DTKA 1J91A 3O8PA 1ZYSA 1ZYDA 4EWHA 4J52A 4QMOA 2CNQA 3UODA 1GZOA 2IZRA 3AGMA 3NDMA 4CCBA 3CQEA 2CJMA 1J1BA 5AUWA 3KEXA 4R6VA 4GG5A 4FIIA 3QRKA 2C6DA 3KCKA 4O0TA 2EXCX 2WQOA 4O0RA 3RTPA 4ANBA 3DK6A 1LR4A 3UNJA 1J1CA 4U43A 4WSYA 2WHBA 4L3JA 3V6RA 3T9IA 4JVGA 4C57A 4WBBB 4C33A 5FDXA 1Q8TA 2YM7A 2GSFA 1ZXEA 4NM0A 4C2WA 2PZPA 3H9RA 2XB7A 3DTCA 1R1WA 3QALE 4JBVA 4K2RA 4KRCA 4M7IA 4U79A 3LFCA 2UW0A 4NU1A 3FZRA 4Q9ZA 1FBNA 4GFOA 4PY1A 4FSMA 4O82A 2JDOA 3NUPA 5JFSA 3MB6A 3ZXTA 3V8WA 2O64A 2FVDA 2A2AA 3C1XA 3ZRMA 2W0JA 4ENYA 3RMFA 3TL8A 3UC4A 4M13A 4UX9A 2JKMA 2XYNA 2YCRA 5EHOA 5EKOA 2OJIA 4JQ8A 1RDQE 1NVQA 2O3PA 5CS6A 3EMGA 3PP0A 1U59A 3DLSA 3NAYA 4RGJA 4CFFA 4X6RA 4JDJA 2WO6A 3E8EA 5HEZA 4UMUA 2JIVA 3R01A 1XR1A 2CN5A 4ASEA 4CGAA 3ZTXA 2VUWA 1SM2A 3C51A 3COIA 2W4OA 3HV3A 4N57A 4U6RA 3BE2A 2W06A 4QMXA 4EOLA 2UZUE 2PZRA 4DG0E 3U9CA 4WG5A 4DGLC 2BHHA 3LAUA 4X2NA 4FKVA 4FNYA 4U9AA 3NUAA 2OJ9A 2ITVA 5CASA 4V0GA 4Y5QA 3FPMA 3ALNA 3VHEA 5JGBA 3GU4A 4NCTC 4PMTA 2NRYA 3TZ8A 2WB8A 3VHKA 3W33A 5CAVA 4GT3A 4HPTE 4C4IA 3ZLXA 3KA0A 1PMNA 3F69A 4RRVA 2IZTA 3ANQA 2BZIB 1XHAA 3P0MA 4YC8A 4DFXE 5A14A 4BTKA 5E8YA 4BN1A 4LGGA 3ZO2A 5JZNA 5BMMA 2BZJA 4D2WA 3RINA 3KVWA 3TTJA 3GCSA 5CANA 1WMKA 4YJQA 3HMOA 3RPVA 3UZTA 4O86A 3O7LB 3C0IA 3NGAA 3DKOA 3P5KA 3TNIA 4D28A 2QU5A 3EN5A 4OTWA 3TUBA 2XIZA 4G5PA 3TV6A 3Q2MA 3THBA 2XS0A 5EOLA 4Q5HA 2CKOA 2X2LA 3FI2A 3LLTA 3QX2A 1UVRA 3O23A 2HWOA 4NWMA 5IQEA 3QC9A 3MWUA 1XJDA 3PE2A 4LOQA 4DEHA 5A9UA 5DYJA 3PXKA 3SRVA 4Q9SA 1JWHA 4E26A 3DKCA 3DBEA 3UQGA 2XNPA 5LQFA 3FXZA 4XG2A 2QONA 2YFXA 2OXXA 3CY3A 4I21A 4XCUA 1FMOE 2OBJA 5EW3A 4I24A 3W2QA 3ENMA 4EK6A 1MUOA 4YTCA 4I1ZA 2G15A 5C03A 5JFWA 1ATPE 4FKQA 2Y6OA 1YXTA 4XP0A 1WBOA 4JDKA 2JIUA 4C0TA 4IJ9A 4BHNA 3IDPA 4M66A 2B52A 1ZLTA 2PVRA 3VUTA 2KTYA 3IG7A 4MK0A 4U45A 3PLAE 4EHEA 1BI7A 4AQCA 4IFCA 4YPSA 3OBJA 4F0FA 2PPQA 5M55A 1IAHA 3UO5A 4LMNA 3R02A 5T3QA 5HIBA 4FZFB 2Z02A 4EWQA 3MI9A 4RX5A 3S95A 3LJ1A 5I9ZA 3SXRA 2YDJA 4O96A 5BVDA 2QD9A 5GIPE 2P33A 2GS6A 5D12A 5D7AA 4ZK5A 3ULZA 5M51A 2ESMA 5J9ZA 1KV1A 5A4CA 1KUTA 4IIRA 5AJQA 3K54A 5DE2A 3PJCA 5JQ8A 2OF2A 3OROA 4Y85A 4F6SA 3BU5A 2E9PA 4H36A 3VC4A 4U3ZA 4OTRA 3LJ2A 4L9IA 4X2KA 5L2TA 1P4OA 2H6DA 4X3JA 1V0PA 1WBPA 2ZMDA 5FEDA 4DGNA 4GVJA 2J90A 4JG8A 3RVGA 4MXOA 1JKSA 4Z16A 3NCGA 5G6VA 5A6OA 5HIEA 3KKVA 2PMOX 5D10A 3HGKA 1T45A 3AC1A 4TNBA 1FOTA 1ZOEA 3DK7A 3ITZA 4X2JA 3WE4A 3K2LA 3V5LA 4AUAA 3WBLA 3E7OA 2Z7SA 5CU3A 2PMIA 3OCSA 4FZDB 2PTKA 4FUXA 3D9VA 5CZIA 3VUHA 4AE6A 1W82A 4B0GA 3TUDA 5C26A 2QODA 4I23A 4N4SA 4NFMA 1DM2A 3TIZA 4X3FC 4LRMA 5KZIA 1EH4A 5HD7A 1CMKE 1JBPE 3E62A 3FZPA 3PXRA 4W8DA 5HI2A 3H3CA 4O0UA 3R8UA 5CXZA 4JAIA 3Q60A 1IR3A 5AFVA 3DB6A 1P5EA 1B38A 4FTJA 3G2FA 4IB5A 3HDMA 5IEYA 3MVHA 4RJ6A 4OTPA 2Q0BA 3QL8A 1M52A 4O1OA 4YC3A 4JG6A 5HBJA 3ZLYA 3LFFA 3R8PA 2WZJA 4CFMA 1WAKA 2C6LA 3I79A 4FT3A 2A0CX 3TT0A 4EH2A 2XM9A 5DBXA 3VUKA 5L2IA 4RFMA 4B8LA 3M2WA 5JSMA 3FXWA 3PJ1A 5BVKA 1R39A 4KS8A 2JIIA 3DGKA 4CD0A 3BHYA 5HG7A 4EOOA 1WBVA 3GU7A 3W55A 3MFRA 3VS0A 3V5JA 4BZNA 2BR1A 2R3OA 2Q83A 4MEDA 3A8WA 3ANRA 4KKEA 4W4WA 4BIEA 5JK3A 2BAQA 4FVQA 4ITHA 5DEYA 2WELA 4UMQA 4C36A 4DA5A 3EQFA 2XVDA 2XZSA 4C37A 2WMSA 4TYIA 3LQ5A 3PJ2A 2VTOA 4I5MA 4F0IA 2R3RA 4QMWA 2GMXA 2ZOQA 3AXWA 2OF4A 2O65A 2QO2A 4X2FA 4F63A 1M7NA 2H9VA 2VO3A 3BI6A 4UN0C 2GNHA 3VF8A 3BBTB 2VTLA 1F3MC 2Y7JA 4IWDA 3ETAA 3R00A 4N6YA 3OCTA 5CTPA 5HCXA 3ZRKA 4CV9A 1A9UA 5KZ0A 2BZKB 5E8XA 4RJ3A 2C6TA 2UUEA 5FD2A 3GEQA 2VX1A 4EH4A 2YITA 2FSMX 4FL2A 5CVHA 3RM7A 4I92A 5LARA 2J0LA 3QBNA 4TYHA 4FSRA 2JITA 4MH7A 1H0VA 1LEZA 2P4IA 3NNWA 3RKBA 3PDTA 2HAKA 3CPCA 3HRFA 4AW2A 5GJFA 3FAAA 5DIAA 3SQQA 5AX3A 5D7VA 4IWPA 4KA3A 4BDGA 4BZDA 5B2KA 5HTCA 5E4HA 2G2HA 1W98A 4TYGA 4DEBA 1W7HA 1M7QA 3BU6A 5AMNA 3FY2A 5DRDA 5IKWA 4YHJA 3F88A 3HUCA 3S1HA 3TNHA 3COKA 5ETAA 4JQ7A 4RIYB 4ORKA 3NYVA 5FXRA 5CEIA 1Q4LA 2BFYA 3G5DA 5IA5A 3DPKA 3NYOA 4IAFA 3ORTA 4OTQA 5HD4A 3CTHA 4OTDA 4F7LA 1PXJA 1PW2A 2XJ2A 4KBAA 4CYIA 1YI6A 2YN8A 3NS9A 4GT4A 3ZUVA 4IVCA 3RK5A 2R3FA 4O2ZA 3ATTA 4YBKA 1R78A 4C7TA 3HV6A 3CGOA 3QFVA 5FM3A 5E9EA 5BYLA 5IH5A 2PVLA 4GU9A 1KE6A 2PSQA 2YM6A 3ZXZA 2XJ1A 5HE0A 5FTGA 3RI1A 3MVJA 4D2VA 3SRVB 1G8SA 4O91A 4YTHA 3UBDA 2X8DA 2W1IA 4IANA 4F1OA 4PTEA 4BKZA 5DT4A 3CJFA 4IWOA 4YNOA 4FE2A 3MVMA 5BUJA 3BELA 4HNIA 4GK2A 3U6JA 5JMSA 1U5QA 3BYSA 4A7CA 4RSSA 1QPDA 4ZY4A 2XYUA 4JJRA 2BDJA 3IW4A 4QP2A 1ZY5A 5E8VA 4EH5A 4GU6A 3UJGA 1YOMA 1YI4A 2QKRA 3C5UA 3B8RA 2ITTA 4YZBA 4BCMA 3DY7A 2W4JA 5KMLA 3EL8A 2QR7A 4C02A 2WXVA 4ACCA 2OZAA 4CSVA 4OW8A 2WOTA 4O2PA 4YU2A 4GKHA 2RFNA 1O6LA 4Z7GA 5I4NA 2Z7LA 3I81A 3R9OA 3QQKA 5KHWA 1E9HA 1VYZA 2CDZA 3KRXA 2PHKA 5EW8A 3GB2A 4CT1A 4XG6A 4E6QA 5A46A 1YHVA 2YM5A 5ETCA 2W05A 4A4OA 4ASXA 3P1AA 5ACBC 1U54B 4FV3A 4J99A 1K3AA 5EYKA 2HY81 3OWPA 4PL4A 2Y4IC 4V04A 2ZB0A 4D9UA 1QCFA 2Y4PA 4PDOA 2C6IA 3QX4A 3NNXA 3MIYA 3PG3A 5K0KA 3FZTA 4X7QA 4U3YA 5EI6A 1BMKA 5FLFA 3OW4A 3P08A 4M97A 2WFYA 3QKLA 4XHKB 3WIKA 2V62A 2XNGA 3AMAA 3VQUA 4D5HA 4ACMA 5A4EA 4IB3A 2W99B 2PUUA 4S31A 3PIXA 3ZO3A 2EVAA 1CM8A 4RIWA 2PVFA 1YHSA 3DFAA 4FI1A 4AZEA 1MRYA 2B9FA 2HXLA 3L9PA 3SOCA 4EK4A 2C3IB 3HX4A 3KU2A 4L43A 3CQUA 4LG4A 3VF9A 4C35A 4HVSA 4HVHA 4MXXA 2NNWB 4PMPA 3A60A 3SHEA 3KXHA 1J7LA 4FYOA 4AN3A 4BYIA 4FVRA 3TDWA 3LCDA 4J97A 3MFTA 3R7OA 1Q99A 4IDTA 3DQWA 3DV3A 5JN2A 2G2IA 2VTSA 4K33A 4G5JA 4M68A 1TQMA 3UGCA 4G3EA 3I5ZA 4AP7A 2WMVA 3EQRA 1FVRA 4F70A 3G15A 4GYIA 5TOZA 4C62A 1U46A 5DH3A 1H07A 4X6QC 4OTFA 4P2KA 3RCDA 4BTFA 5HX6A 5JFXA 2C68A 5LVMA 4FT9A 3QHRA 3TWJA 4NM7A 2UZLA 3EQDA 4CZYB 4DH1A 4E5BA 4PPBA 4K8AA 5A6NA 2RL5A 1SMHA 2IWIA 3N4VA 2YERA 3SD0A 4QQ5A 3R6XA 3A4PA 4JI9A 3BHHA 3R30A 4IB1A 2YWPA 2VV9A 5IUHA 2PMLX 2XBAA 2UW7A 3GOKA 3HVCA 2QR8A 4H58A 2WTJA 4GJ3A 3DBCA 4QTBA 4ONAA 3LM0A 1FGKA 1G8AA 5CXHA 4EH7A 2R7IA 5CENA 3ZS5A 1IA9A 4Z9LA 2UW3A 3CY2A 2UV2A 3G0EA 1GY3A 2JDSA 4FF8A 4MBLA 4MD9E 4MKCA 3ZSGA 4A9SA 2GNGA 2UVYA 5KMJA 3SXSA 5AV1A 2QO7A 3R8MA 2HZ4A 2OJJA 3BGQA 2O5KA 3PIYA 4CLIA 5D9HA 2XEZA 2GHGA 5CEOA 3QAME 4RVKA 5GZ9A 3HDNA 4TL0A 5BPYA 3RNIA 4C4GA 3DBQA 4EHVA 2HZNA 2V7OA 3AC4A 4FV6A 3P78A 2BDWA 1JKTA 2JAVA 2ZV8A 4RQKA 5CU6A 2ONLC 4IVAA 1KWPA 2IVVA 5EKNA 3IS5A 5DNRA 2R3QA 5H8EA 4I93A 3QWKA 5LCKA 3U9NA 4K0YA 4FK6A 2R3KA 4IE9A 1JPAA 4ZS0A 3HV4A 1Q62A 4FX3A 4DFBA 3TZ7A 4ZTRA 2C5VA 4MAOA 4BL1A 4DAWA 3BV2A 1CSNA 3EKNA 4HVGA 3DAKA 5GIOE 3QD4A 2GQRA 4YO6A 2BIKB 4RX7A 3DQXA 1JSVA 3SW4A 2O8YA 2W7XA 4BDDA 4ZSGA 4KB8A 4YNEA 4BCQA 3QZIA 3V5PA 2C3LA 1PY5A 3PSDA 3R1NA 3OXTA 4P5ZA 3MH1A 4NTTA 3RWPA 3WF9A 1OBGA 3ZEPA 2OFUA 2X2KA 5AV4A 2ITNA 4M15A 3RK9A 1UKHA 2V22A 1PMEA 3QF9A 4MWIA 4IBMA 2RSVA 4BRXA 1L8TA 1GIIA 4FOCA 4CKIA 4NEUA 4PF4A 1KOAA 5HVJA 4FV0A 1HCKA 2YM8A 4EORA 3BWJA 4RLLA 2GS2A 4CRSA 4DFUA 3S2PA 2IO6A 2J5EA 3EN4A 3EKKA 3DKFA 3DZOA 4UMTA 4QTEA 5F20A 5CAPA 2VTPA 4F99A 3DKGA 5IUIA 3DJ5A 4I94A 3SAYA 4KBCA 4QMUA 4D0WA 4DG3E 2VWZA 3W1FA 5AX9A 2GNFA 4Q5EA 3ODYX 2GS7A 4ANLA 2V0DA 1QL6A 2Z8CA 1JSTA 4BI1A 4I22A 3F2RA 2R64A 4Y5HA 4B8MA 3FLSA 4X3FB 3P7CA 2J0JA 3OF0A 2IJMA 3QXOA 3FPQA 3C0HA 4FKOA 3QCYA 4UWYA 4EQCA 3NAXA 4ZY6A 4KKHA 3MTLA 1L3RE 3FYKX 4II5A 3KY2A 1Q24A 2YIYA 1XKKA 3KVXA 4M67A 5AR8A 5AUXA 2VWXA 3JY9A 2C5NA 3O2MA 4FTMA 2XIRA 3PPJA 2OXYA 2QG7A 3R9RA 4M8TA 2PUIA 3PLSA 4F64A 1SVGA 5LWMA 2UZTA 3BYUA 4KAOA 1OKZA 4IZAA 1VYWA 3R9NA 2DS1A 4NYEA 3LLAA 1KE8A 3ZBXA 4O7ZA 3LFAA 1DS5A 1GIJA 2VO0A 3GU8A 3FY0A 3UQCA 2GFSA 1Z57A 2XM8A 3QXPA 4C58A 2UZVA 4FZ7A 3KK8A 2W1DA 3LFSA 3NUNA 4O0VA 3ACJA 4LGHA 4RT7A 3UP7A 3RWQA 3NW5A 4J8MA 4C4EA 2B9JA 3LJ0A 5CNNA 5K9IA 3I7CA 3EFLA 2HOGA 4TYEA 4Y8DA 5BVEA 5IZFA 4AU8A 1PXKA 5L3AA 4AT4A 5CT0A 2JEDA 3BEGA 4BWPA 4MNEA 4ZY5A 2W9FB 4Y73A 2VNYA 2VTHA 3IW5A 4P90A 5L8KA 2QG5A 3K5UA 3Q4UA 4HYUA 4Q2AA 2ITQA 4QP7A 4S33A 1O9UA 4WD5A 3NW7A 1SNUA 3BGPA 4BVUA 4NJ3A 3FMLA 3WF6A 2C6EA 2QOLA 2OH4A 4FC0A 4WSQA 4AN2A 3Q04A 3C7QA 3EFKA 4MNFA 2QU6A 5HCYA 2PL0A 4NJDA 4CTCA 1F0QA 3QHWA 4BDJA 4NKAA 4RC4A 3BEAA 2GNLA 2BTSA 4R3PA 4MD8E 5CNOA 4R8QA 5HIDA 5DG5A 2OO8X 5H3QA 1JKLA 3WZKA 1FQ1B 3PSBA 4I4EA 5EOBA 1Q61A 1S9JA 1H00A 3G0FA 1Q3WA 4RIOA 3A7HA 3OWKA 5A4TA 3UC3A 5CALA 1H26A 2BRHA 3UVQA 4E6DA 3UG2A 4PQNA 5ANJA 3D7ZA 2GCDA 1JOWB 4AE9A 4KUJA 3FDNA 2QC6A 4ZTMA 4QP9A 2OGVA 4BCKA 5CAUA 2HCKA 3SG9A 2XK3A 5FXQA 4IZYA 1CDKA 1MQBA 4WNOA 2QOBA 4RX8A 4ACGA 4FKPA 5HKMA 1IG1A 4DT8A 3RJCA 3PA3A 2XIYA 3KXXA 4LMUA 4AN9A 2ETKA 2XK8A 1DI8A 4AZWA 3E8NA 2YJSA 2RFDA 3ENHA 5F4NA 3G51A 3NZ0A 2GQSA 5AR4A 4FSZA 1W83A 3LIJA 4L53A 1S9IA 3H0ZA 4G2FA 5IQAA 4A9RA 4A4XA 5HU3A 1G5SA 5M56A 1PKGA 3F2AA 5FEQA 3RZFA 2C0OA 2HW6A 1DI9A 4RA4A 3UIUA 1HCLA 1STCE 2XNNA 4LYNA 1H08A 5EDPA 4G16A 5CAOA 2RG5A 1GAGA 4CEGA 4JBQA 4BWKA 3DA6A 4FA2A 5L8JA 5I9VA 1I44A 3VULA 1GNGA 3HP5A 2OIQA 1WFCA 4H3PA 4ARKA 4EZ3A 5CEQA 5TR6A 4O84A 3QGYA 4LRKA 3ORKA 3TNWA 4QT1A 4K77A 4RJ4A 4NZWB 1PXNA 2EUFB 1XBBA 4BI0A 4O7YA 3D4QA 4RQVA 4YUQA 2B9HA 4W9WA 3UNZA 3H9FA 3HAMA 3GC0A 1XH4A 3LFBA 1KE5A 3H30A 2C5OA 2QHMA 3P7AA 4AGUA 1VR2A 3TJDA 3MH3A 4PX6A 2W9ZB 3VUGA 3VUIA 4BIBA 1H24A 3UYTA 3EWHA 5I3RA 3OXIA 3QZFA 1AD5A 2JKOA 4L6QA 3VUDA 3TM0A 4EKLA 2CNVA 4JAJA 1YDTE 3AC2A 2WQBA 3QRTA 2EXMA 2VN9A 4YSJA 4KABA 3CE3A 1U5RA 4H39A 3RAHA 3M1SA 3HAVA 3EFJA 3PXQA 4APPA 5JT2A 2XA4A 4FIFA 4FT0A 2Y4IB 2BRBA 3FJQE 3OHTA 5I9YA 1LUFA 4CKRA 3SXFA 2HIWA 5CEMA 1GIHA 1XO2B 2RKUA 2UZWE 3TG1A 4M69A 2F2UA 5I9WA 2V55A 2QLUA 1BL7A 2CPKE 5K3YA 3U6HA 1ZRZA 3Q3BA 2WEVA 2IZUA 3QD2B 4U41A 4EZ5A 1BI8A 3BYOA 5FDPA 1H28A 2P55A 3KFAA 4DLJA 4LOPA 4PL5A 4G3FA 3ZHPC 1Q8YA 2YIWA 2J4ZA 4YLLA 2UVXA 4FT7A 2PE2A 4QYHA 4OAVB 3AC8A 3N4UA 2XK4A 2YA9A 4G17A 2VWBA 4LI5A 4AOJA 3JS2A 3WE8A 3HMMA 4F1MA 4KSQA 2QOIA 3EQBA 3LM5A 2QOCA 3R1SA 2X7GA 2WNTA 3LCSA 2FA2A 3FC1X 3VS3A 2W1GA 3ZEWA 4GJ2A 1URWA 2HY0A 4CZUA 3EJ1A 4MD7E 5IEXA 3FV8A 4RVMA 5LXMA 2YCQA 2F7ZE 4AF3A 1BL6A 4OTGA 5C9CA 3LXKA 2VWIA 4E3CA 3SGCA 3KREA 2B9IA 2FSOX 3BWFA 3GQLA 5BQ0A 5BUEA 2YAAA 3ORXA 1ZYLA 4IX4A 4AZSA 3W2CA 2X9EA 3TACA 4NW5A 4BGGA 4RIYA 4BTMA 1Q97A 5LJJA 4I41A 4FEUA 4JX3A 4YZCA 5D41A 4I0SA 2JKKA 4E73A 1BKXA 4FODA 1KE9A 2WQEA 1APME 3DZQA 2RF9A 4BDAA 3IECA 4AA4A 4NM5A 3VS6A 4USFA 3P86A 4BFMA 5F94A 4F9YA 2VTRA 4FSTA 3QQHA 3LCKA 5DR6A 4D9TA 4ZZNA 3ZZWA 2FB8A 4U0IA 4RC2A 2I0YA 3FL5A 1NT2A 1IEPA 2JDRA 2R3NA 2O2UA 3ZO1A 5B7VA 4MVFA 4FV7A 2NRUA 5FQDC 5IDPA 3R71A 4ZTHA 4FV4A 4MNEB 4ZSLA 3GQIA 4NSTA 4Y72A 3C9WA 3ODZX 3ZFXA 5M07A 2AC5A 5HLWA 2OJFE 2I40A 5M08A 2UZDA 5AAGA 3UOHA 5H9BA 4EK3A 4MXYA 5J5SA 5EI2A 4E8AA 2NPQA 5G1XA 4EH3A 1GOLA 4IJPA 5KMKA 4JOAA 4EOQA 1CKJA 3IW6A 1H1PA 5AR3A 4AGCA 3KRLA 3DBFA 3TKHA 3HNGA 2LAVA 3FQHA 2VO6A 1ZOHA 2R3MA 3UQFA 3PJ3A 1CKPA 3F3WA 2BPMA 4HVDA 4RG0A 2UZEA 3VVHA 3VW6A 5M57A 2XIKA 4ZMFA 4IX5A 4QTDA 2OIDA 4QYGA 5AP1A 5EM8A 3O8UA 3OCBA 1R0EA 3QKKA 4FZ6A 4OTHA 3UIMA 3FHIA 4AGDA 2I7QA 4EONA 3K3JA 4PTGA 3PY3A 2XEYA 1MP8A 2QOKA 5H2UA 3Q5ZA 2E9NA 3R7IA 4YGAA 1PKDA 2DYLA 3OBGA 4R1YA 4LGDA 1U54A 3ALOA 2BCJA 2FH9A 2VWVA 3VBWA 4HW7A 5BNJA 3RPYA 4I6FA 2CGWA 1QPCA 2J0MB 3C4CA 3CD8A 3CQWA 5EQYA 4RX9A 2B55A 3MW1A 1W0XC 2ZMCA 3F9NA 4IM0A 4FTUA 4BCHA 4CG8A 5DPVA 3FBVA 2VTNA 3V5QA 3WILA 4O7VA 2G2FA 3D7TA 3QRUA 4QNAA 1URCA 4TYJA 3PJ8A 2PZ5A 5EG3A 5CSPA 3MTFA 4S34A 3L9MA 4GFMA 1JQHA 2CHLA 4ID7A 4MYGA 2AYPA 5EHLA 4OT6A 2C69A 2YLEA 2WOUA 4IB0A 4W8EA 4GEOA 4XV3A 5FGKA 3VS4A 5HBHA 3PWDA 4GV1A 3O7LD 4DCAA 3A62A 4LV5A 5LMBA 1YXVA 4AG8A 2VZ6A 4ZSJA 1NVRA 2OI4X 5IU2A 2Y6MA 3D5WA 5M44A 3DBDA 2W1HA 4FMQA 4FSUA 4TY1A 4HOKA 5DA3A 1OMWA 1ND4A 2WMQA 5GJDA 4BZOA 4QMMA 2I0VA 2WTVA 3IGGA 4NCTA 4L42A 5CAQA 4PNKA 2WTWA 1OIRA 3HLLA 2X7OA 4PDYA 4DTAA 5TO8A 2R3JA 2Y9QA 3FHRA 2G9XA 3BPRA 5CU4A 5CF8A 5AP7A 4E20A 4AX8A 3WARA 4CZTA 5L4QA 3EN6A 3GOPA 3AQVA 1JAMA 4GMYA 4AZVA 4FBXA 3E92A 1ZZLA 4MXCA 4CYJA 3VJOA 5C8KA 4JL9A 3MFUA 5EYMA 4HZSA 1MRVA 3PRIA 2PMNX 2PULA 4EYMA 1FGIA 4J8NA 3V5WA 4UALA 3UNKA 4QP3A 4FEVA 3Q6UA 3VUMA 4EOKA 1RW8A 3L8VA 5CI6A 5CI7A 5DWRA 3G90X 5AUUA 2UW9A 5AR7A 5M53A 2BFXA 3KN5A 1WBNA 1BLXA 4IX3A 2GNIA 4J98A 4UXQA 4I6HA 3PVBA 5FG8A 4M69B 4AZTA 4OT5A 1LP4A 3KK9A 3NUXA 5AP0A 5CZHA 3FEGA 2PVHA 1JLUE 1OIUA 2J6MA 3BU3A 3ORPA 1YVJA 3GU5A 4JDHA 4QO9A 1Y6AA 2ITPA 2GNJA 4MX9A 3HP2A 4ZTSA 2R3LA 3TKIA 5M4CA 4ITJA 3QQJA 4GS6A 4XG4A 3V8TA 2OXDA 3POZA 5IA0A 4DH8A 4KBKA 1WZYA 2BKZA 1OKWA 2WPAA 3DNEA 2BAJA 3QQUA 4WBOA 5KHXA 4X0MA 3TZMA 2B54A 4KIPA 4XP2A 3ZC5A 4BB4A 3PIZA 1ZYJA 1UU3A 4R3RA 3A61A 2X7FA 2C6MA 4FTRA 5KNJA 3NIZA 3OWJA 1JVPP 3C4FA 4WUAA 4BCOA 4U80A 5T68A 5JRQA 2GDOA 5HG9A 2BTRA 2CNUA 5AUZA 4IMYA 5FBNC 3S4QA 3EOCA 4ZIMA 3C4ZA 4DT9A 4NTSA 3FKOA 4U44A 2EU9A 2BRGA 5HTBA 3GBZA 2KULA 4FV2A 3ZMMA 4FL3A 5J7BA 2BMCA 2WEIA 5CVFA 3CGFA 4USEA 3I6UA 4ZJJA 3KB7A 2YWVA 4XS2A 3GCPA 4ZZMA 1SNXA 5JEBA 4NFNA 4R3CA 4QMZA 3NR9A 3TTIA 2ZV2A 4L67A 3E8CA 4K18A 4WOVA 5DR9A 3DU8A 5IQIA 3G6HA 5EDRA 3SOAA 5E8SA 1OGUA 3MA3A 3FMDA 4BCPA 4M84A 5FUTA 3HA6A 4BCFA 1YRPA 3SKCA 2W4KA 3GC7A 1ZWSA 3CJGA 3NEWA 1R0PA 4Y83A 2WMWA 5HESA 3ULIA 3RAIA 3D94A 2ITOA 2H96A 5EK7A 5IA4A 1PXMA 4TWPA 3F2NA 4PPCA 5ACKA 2B0QA 3NYNA 4S30A 4AXAA 2YZLA 1U4DA 3LXPA 4X3FA 5IISA 4QMLA 2NP8A 4DF3A 3V5TA 5HCZA 3H9OA 1H1QA 5CLPA 3JYAA 4W4VA 3UG1A 3PRFA 4X2GA 2PU8A 2VNWA 3CBLA 4D0XA 4KNBA 4UXLA 3F5PA 3Q9XA 5CX9A 3R2YA 1NVSA 2PZIA 2YDIA 3KF7A 4I20A 4K1BA 4L3PA 5GNKA 3SDJA 2VTAA 5GINE 4UY9A 4H3BA 2C6KA 2J5FA 4GRBA 4N6ZA 3R8LA 1YDSE 2DQ7X 4BCJA 5DGZA 3TEIA 4OLIA 4WNMA 4YHFA 5AR5A 5EFQA 4ZJVA 3Q9YA 1OIQA 2VTTA 4ZXTA 3AT3A 1FINA 3HRCA 2PVJA 2WTIA 4I5PA 2I0HA 3FI3A 3FYJX 3GUBA 1OPLA 3PXYA 4BDEA 4IH8A 5EM6A 2YCFA 3D83A 5L2WA 4JRNA 2VX0A 2AC3A 3CIKA 2V7AA 4TW9A 4IVDA 1ZOGA 1UKIA 5BUIA 4OBQA 5JGAA 3ZBFA 4I5CA 4CCUA 4MWHA 5CU2A 2OICA 3W2OA 3AD4A 4FG8A 3M42A 5F95A 1UWHA 5FWKK 5HLPA 3D7TB 5DT3A 3ZU7A 3TXOA 4FSNA 3QRIA 3UE4A 2R7BA 4XG8A 5DEWA 3KRJA 3QU0A 4XG9A 5FP6A 3UP2A 4ZEGA 3VAPA 1AGWA 5HICA 4BDBA 2R0IA 5KMIA 3QUEA 5EYCA 4YJUA 3E88A 4E1ZA 2X6EA 2WTKC 3L8SA 1PJKA 4HPUE 1WBTA 5CSXA 5IQHA 5KBRA 4RBLA 3UYSA 5H8GA 4V01A 4F6WA 3VRYA 3PFQA 1SVEA 4FZAB 4IW0A 4FKJA 4YJSA 2H8HA 2XCKA 3H4JA 4FICA 4FKTA 3SV0A 4ANQA 3PXZA 3HMPA 3Q5IA 1H27A 3QTWA 3CKWA 5FRIA 4CMUA 3RGFA 2CSNA 3R73A 5E8TA 5L2SA 1YKRA 2XK7A 1UNHA 5KE0A 2PWLA 3QZHA 5TT7A 3RHXA 1UA2A 3UPZA 4BGQA 3ERKA 4YHTA 4OBPA 3CPBA 3NSZA 3QCSA 5DLSA 3VBQA 5HNGA 4K11A 5HX8A 3R7YA 3RM6A 5I0BA 4FGRA 5LVOA 1PXOA 4EZ7A 3ZDIA 1FPUA 4IEBA 5FM2A 2WMUA 4G1WA 5AV2A 2XMYA 1KOBA 3MJ1A 5CVGA 4WT6A 3S3IA 4WKQA 1MRUA 2C0TA 1OI9A 2XF0A 4QRCA 3QTXA 3AMBA 4FSQA 3HRBA 3IQ7A 1NXKA 1YWVA 4E4MA 4FGBA 2R2PA 3L1SA 4R5SA 4D2PA 1RQQA 1XH5A 4FL1A 5E92A 3EQCA 4RLKA 2SRCA 4AS0A 1E1VA 5HZNA 4FV9A 3D2KA 2XNMA 3OP5A 4L46A 3JXWA 4C2VA 5A3XA 2GHLA 3DAEA 1J7IA 3P9JA 3UVRA 3HV7A 1UWJA 2CCIA 3S00A 3KCFA 4IAYA 3IOPA 4FOBA 3I7BA 3DTWA 3L9LA 4JBPA 2OKRA 2REIA 5EYDA 4WHZA 3LQ3A 1V0OA 3QQFA 3DXQA 2HENA 5K5NA 3WZJA 3ORZA 4ACDA 3PPZA 1NW1A 4ZLZA 3GENA 1WVYA 2EWAA 2PVYA 2R4BA 1UV5A 4LM5A 4E93A 3LXNA 5HLNA 3KRWA 3ORNA 3VS7A 5IA1A 3DOGA 4U97A 2E9VA 3O8TA 4JS8A 4EOJA 1XWSA 3KXNA 3KF4A 3I1AA 4DTBA 2VAGA 4JR3A 1J3HA 3OTUA 1O6KA 4FNWA 4GK4A
chains in the Genus database with same CATH superfamily
4J71A 2WIPA 1PYEA 3LFEA 4EK8A 5CYIA 3ZRLA 4O7LA 3FSKA 3MDYA 4OGRA 3N51A 3QTRA 3TNPC 2NYAA 3WOWA 4FTAA 4G9RA 2Z7RA 5AUTA 4AT3A 4GUBA 3GP0A 4EQUA 5D11A 2YHVA 5CF5A 4FKGA 4EOSA 1JSUA 3GT8A 4QYYA 2CKQA 4GVAA 3FSFA 5BMSA 2JAMA 3R1YA 3MPAA 3OT3A 3UOJA 1AQ1A 2P2HA 4GYGA 4K9YA 4RFYA 4BCIA 4QP4A 4XUFA 4I0RA 4L68A 4O6LA 3T8OA 4QD6A 2R3PA 3KXZA 2BILB 2C6OA 3UZRA 3C4EA 3W8LA 5IMXA 2BVAA 4YJVA 5LMAA 2I6LA 5J8IA 4AACA 3JR1A 4F4PA 4NIFB 3ZOSA 5JRSA 3R8VA 4CMTA 5I9XA 2CLQA 5CQWA 4ANSA 4DGOA 5BVWA 2FO0A 3RK7A 2J0KA 2W5BA 3BHUA 3NRMA 4CRLA 2W1CA 4C3RA 4QNYA 5M4FA 3OWLA 2C0IA 3KL8A 1UU9A 3PSCA 4ZLYA 4QTCA 5DRBA 3FC2A 5EM7A 4UBAA 2P2IA 3OY3A 4AXEA 1Q8UA 1OM1A 4U8ZA 5B2MA 4D58A 3Q32A 4UWCA 1YOLA 3V04A 5EM5A 3ZC6A 5KUPA 3PE1A 4I5HA 4JLCA 4KSPA 4QMYA 1XBCA 3VS5A 2PUPA 5F1ZA 2WD1A 4FR4A 1REJA 1VZOA 4AAAA 3L8XA 3CCNA 4YR8A 3DXPA 5EHYA 3MIAA 4GIHA 4NM3A 3QGWA 4DINA 4EUUA 1PYXA 2RIOA 2ZDTA 3ML1A 4ANOA 4DGGA 3G6GA 2XBJA 2VTMA 3BYMA 4GW8A 4MHAA 3R9HA 2ZV9A 5LVLA 1LPUA 1NA7A 4EL9A 3II5A 4TN6A 3MV5A 3FMJA 4QQJA 1ZMUA 2LGCA 3HECA 3ZLWA 2HZ0A 2ETRA 4AFJA 4ACHA 1H1RA 2JC6A 5IA3A 2BDFA 4BGHA 4L44A 3WIGA 4DFNA 4O21A 3FLQA 4XEYA 2ITZA 2IW6A 3LOKA 2JKQA 1TQPA 3A4OX 4O6EA 3NCZA 4G9CA 4U7ZA 4ZTQA 3VW8A 3F3ZA 4F9BA 4RA5A 5CSVA 3BQRA 4XRJA 3DLZA 3I5NA 3O0GA 4QP8A 3LFDA 2R3IA 2CGXA 3O17A 4DC2A 5J5TA 3ACKA 3E64A 3AC5A 3D14A 2OU7A 3I0QA 3QTSA 4O7TA 3AC3A 4HVIA 4ANMA 4HYSA 2XANA 5HNIX 5EQEA 1XH6A 2ONLA 2X4FA 5BVNA 4LUDA 5IF1A 4A06A 4UYAA 2HK5A 3UDSA 2XRWA 3ZH8A 3FWQA 1ZMVA 2YJRA 4IHPA 5GHVA 3VWAA 3WZDA 5CF6A 3N4TA 2A1AB 3QTQA 4TT7A 3QCXA 4D1SA 2B7AA 4M0YA 3BGZA 5ETFA 3LMGA 2ZDUA 4DN5A 1NY3A 4F0GA 2F4JA 4XMOA 3PFYA 4I6QA 4HCVA 4IFGA 4O0WA 3DJ6A 3IKAA 4HZRA 4C38A 3PUPA 3WF8A 5HHWA 4WRGA 5CSHA 2QLQA 1PXLA 3CS9A 3MFSA 3R7VA 1K9AA 1TKIA 1HOWA 3MVLA 3NPCA 4D2TA 4PP7A 3CKXA 2EB3A 4U81A 3MS9A 4FNXA 4DH3A 3ID6C 5K0XA 1UNLA 2YZAA 3UPXA 4BDIA 1V1KA 4O1PA 4UB7A 1TQIA 4YZ9A 3BQCA 3EB0A 4D5KA 5I5ZA 4O27B 2GHMA 5J1VA 2XNEA 4I0TA 5C4LA 3NIEA 4YZNA 5ITAA 3TZ9A 2ITYA 2UZNA 3PY1A 3REPA 5FEEA 3UMWA 2IVUA 4JQEA 3OW3A 3C5IA 2JD5A 2VTIA 2XNOA 3RNYA 4D4RA 2R3HA 4RIXB 4YJNA 4U5JA 4WRSA 5EH0A 5HO6A 3U51A 4G6OA 3MJ2A 4I3ZA 2C3KA 3F7WA 2IW8A 2JGZA 3UIBA 1DAYA 3UZPA 3UMXA 4C61A 3EZVA 2OK1A 3TKUA 4USDA 4EOPA 5K5XA 2R5TA 2PVMA 4RWIA 3VS2A 3GC8A 1WCCA 5DI1A 3WZEA 4CQGA 3O5AA 3MESA 5HE2A 3MYGA 4Z7HA 3VBTA 3OC1A 1UU7A 4G3CA 4IZ5A 2WIHA 3H10A 5HTIA 5AP6A 2FSTX 4FTQA 4AOIA 3AD6A 3QRJA 4C8BA 4J1RA 3F3VA 3ZONA 3IPHA 4R7IA 2JFLA 2PVNA 3D2IA 4YMJA 5AUVA 3IDCA 2X1NA 4MBIA 4GH2A 4XYFA 3F61A 3K3IA 3L9NA 3FLYA 4CFNA 3JUHA 3E7VA 1YXXA 1W2FA 4EBVA 4F9CA 4DCEA 4FYNA 2X0GA 4IC7A 4O81A 4EC9A 2X8EA 4Y46A 5CT7A 3QTZA 1RJBA 4J7BA 5TKDA 4BKJA 3CC6A 4JR7A 3GU6A 2ZAZA 5J79A 4QOXA 2GPHA 5LVNA 3WI6A 2BIYA 3E8DA 4E4XA 3NMUF 4DBNA 5B0XA 5LMKC 2ZM1A 3H0YA 2VRXA 3F3UA 4PL3A 2XKFA 4GT5A 2FUMA 3MN3A 4G6NA 3PYYA 2WU6A 1OUYA 4FIGA 4FTLA 1P2AA 3QYWA 3E63A 4F1TA 4EOIA 2YABA 1Q8ZA 2X2MA 4EHZA 2C1BA 1DAWA 2JDTA 3ROCA 3VBXA 3TNQB 5IH4A 4FTIA 4EOMA 4F65A 3O50A 3GGFA 5AP2A 3T3VA 4JRVA 4RJ8A 2W17A 1XH9A 4BWXA 4YP8A 4FKUA 3FKNA 3D15A 3IO7A 4ZSAA 4GG7A 4FIEA 4H1MA 5I3OA 4TWNA 2XRUA 2R3GA 3VS1A 3PP1A 4PRJA 3MA6A 2ZV7A 2WTKB 4GCJA 4NUSA 5AADA 4OUCA 4HNFA 3ZUTA 5CY3A 3W2RA 4D2SA 2VX3A 3R1QA 3C4XA 5IQFA 3IW8A 4DEAA 3AOXA 3W16A 3FL4A 3LHJA 5DFPA 2XJ0A 3WYXA 3V01A 2PVKA 2OW3A 1OKVA 1H1WA 2QOHA 2VU3A 3EFWA 3LQ8A 4GUEA 5FTOA 3ORIA 3A2CA 3NUSA 1B39A 4XG7A 4BIDA 1Q8WA 3VBVA 3W2SA 2Q0NA 3E5AA 3SVVA 4H1JA 3E93A 3LPBA 5IQGA 2CKPA 2DWBA 4FK3A 3OMVA 1XBAA 2X81A 3OOGA 4FV8A 4LL5A 5KMOA 4RC3A 3BZ3A 5ANDA 3QUDA 4NK9A 3FZSA 5F9EA 3RBWA 3UDTA 3T3UA 2A19B 2XKEA 1G3NA 4IM3A 2IPXA 3D5VA 4FT5A 3L8PA 4J95A 5CWZA 4AZFA 4AA5A 3SC1A 2UZOA 5JH6A 4WA9A 4Z3VA 4O4BB 1BX6A 1B6CB 3QA0A 5ICPA 2X0PA 1IA8A 3PPKA 5M06A 1CTPE 4UEUA 5DR2A 3WF7A 4AQKA 1M2RA 4YO4A 4R77A 3E3BX 4B6LA 4CXAA 2XARA 4GKIA 1BYGA 4XJ0A 3Q4ZA 4UWBA 4RZVA 2C4GA 3C13A 5E1SA 1KV2A 5IH6A 4RWLA 2QOFA 3DK3A 5C01A 3HUBA 4C4FA 1YW2A 2ERZE 3TIYA 5DVRA 1JNKA 3RCJA 4BR3A 1J7UA 4ZLOA 4EHGA 4DH5A 3UIXA 4CTBA 5EI8A 5C1QB 3U4UA 4GSBA 2Y0AA 4PPAA 4DEEA 5L6PA 3QQGA 2HYYA 4BDKA 4MTAA 3CTQA 3S0OA 3QYZA 2UW5A 2A27A 4O4FA 3GVUA 1OL1A 3IK3A 2OSCA 5HGIA 3WYYA 2O0UA 4DYMA 3QCQA 4E4NA 4O0SA 3OZ6A 3GFEA 4PDPA 2ZM4A 2BRMA 3DXNA 3V6SA 1Q41A 3MPTA 3AG9A 3QA8A 4ZAUA 4PMSA 1TVOA 3F5XA 4R7HA 3TJCA 4A4LA 3POOA 5D1JA 5J1WA 4BHZA 5LMKA 4RFZA 4YJOA 5L8LA 3OD6X 5HU9A 2B1PA 2GQGA 3FE3A 4NT4A 4GFGA 4TRLA 3UOLA 3VBYA 3NVKI 3GI3A 4NH1A 4FVPA 4YJTA 4EKKA 2XK9A 3TI1A 4YTIA 4KWPA 1Y8YA 2R0UA 3RZBA 4AWIA 4UMRA 2BALA 5A54A 1PF8A 4O4DA 4C4JA 3R9DA 4CG9A 5AM6A 3LFQA 5E91A 5I9UA 3R7UA 3N9XA 3RP9A 2W1ZA 2IG7A 1OECA 3HYHA 3BLAA 1OPKA 2E2BA 5KBQA 3NFGB 3IOKA 2GTMA 2A98A 4OR5A 3A99A 1OL6A 4KD1A 5M4IA 1UNGA 2J7TA 4ZTNA 2VWUA 4JIKA 4TWOA 5E8UA 3T9TA 2XUUA 5HQ0A 2QNJA 1QPEA 3PZHA 4KIKA 4ZMEA 1WVWA 3D0EA 3MY0A 2JLDA 2CCHA 3LXLA 5AV3A 1X8BA 2C1AA 2C5YA 5HORA 5JFVA 1GZKA 3EQHA 3PG1A 4L00A 4YSMA 1WVXA 3AD5A 3GXLA 2OFVA 5ANEA 1OITA 4QMQA 4U40A 3FLWA 1FMKA 3BV3A 5CSWA 4IAIA 3MBLA 2XCHA 4P5QA 2GU8A 4AGWA 3Q2JA 4F9WA 4PV0A 3DFCB 2PE1A 5KCVA 3MY5A 2QO9A 3QC4A 4EI4A 3BE9A 3O51A 2YIQA 3ORMA 4RZWA 4UYNA 3TN8A 2PY3A 3C4WA 3AMYA 3ZM4A 4QDVA 4OTIA 4HGLA 4QMVA 3F5GA 4B4LA 4FSYA 3TUCA 1OL5A 3W0QA 2EB2A 3Q52A 3KULB 4JXFA 4O7SA 3BIZA 5J7HA 4FG9A 4L52A 5M4UA 1PXPA 2C5XA 1Z5MA 4ASDA 4D1XA 5HE1A 4A9YA 5C8NA 4KINA 4IZ7A 2PK9A 3GCUA 3QLFA 4N0SA 4WO5A 5E8ZA 5B2LA 4EUTA 3DJ7A 4G6LA 2H34A 4XLIA 5LCJA 4XRLA 3JPVA 3ELJA 5ETIA 3U4WA 3NVMB 4DE4A 4EJ7A 4BY9E 4H3QA 4XV9A 2AQXA 3NWWA 3ZYAA 2X6DA 4BICA 3F5UA 4IDVA 4IXPA 4RVLA 2E9OA 2F49A 5AV0A 2Z60A 4KKGA 4LFIA 4IAAA 1OL7A 2P3GX 3FMNA 3RAKA 4EK5A 4BDHA 4BJJA 3FLZA 3NUUA 4JNWA 2F7XE 4QMTA 1PHKA 2VTQA 2QOQA 3KMWA 3OG7A 1KSWA 3OY1A 3Q96A 3PY0A 3B8QA 4AOTA 5IPJA 4QMPA 2BKKA 3MSSA 5KMMA 1ZAOA 2EXEA 2OIBA 2QVSE 3OUKA 3QKMA 4FNZA 2JDVA 1M17A 2W5HA 2WGJA 4F78A 4ZS4A 1BUHA 3AGLA 3RPOA 5IMEA 2J9MA 2VGPA 2IZSA 4MUQA 1OKYA 1H1SA 2ACXA 3UO4A 4DDGA 4CVAA 2XIXA 5C27A 1IAJA 3PWYA 4E5WA 3NX8A 5TE0A 4XG3A 4DEGA 4BF2A 4ZZOA 2OJGA 1F5QA 5HVKA 3FMHA 4TWCA 3LZBA 4RPVA 1Y6BA 5E1EA 3OOMA 2UW4A 4EH6A 4HCUA 4RJ7A 2X0OA 4QQCA 3ZDUA 4FTKA 2C3JA 2OLCA 5IQCA 1WBWA 1ZZ2A 4FKSA 2JBPA 1W8CA 2UW6A 3BLQA 3OCGA 4MXAA 1ZMWA 3TV7A 3U6IA 4LV8A 4PNIA 5KKRC 4MQ2A 5AA9A 4P7EA 4CNHA 4M3QA 3EQIA 3I0OA 4FTNA 2YM3A 4W9XA 4V05A 2BZHB 2HELA 4FKLA 1ZARA 4C59A 4QYFA 3RHKA 5FTQA 2ITXA 1YOJA 4XOYA 3NNVA 3KC3A 3E3PA 5HVYA 5IQDA 4O7RA 4V0GB 4HGSA 4JX7A 3VNTA 3EHAA 3C50A 5H8BA 4BDCA 3W0SA 3QD0A 4GK3A 4NIFA 4RVTA 4C3FA 2F9GA 4WUNA 2VD5A 3EN7A 4HGEA 1CKIA 3SW7A 3GC9A 3R22A 5AIRA 2WMRA 3ROYA 3W2PA 4A9TA 2QI8A 4XV2A 3SA0A 2FSLX 2OWBA 4PP9A 4C3PA 4BI2A 1V0BA 3LCOA 4R1VA 1OUKA 3VJNA 4C4HA 4JIAA 1YXSA 1VEBA 4P4CA 2YACA 5C4KA 4IQ6A 4MBJA 1MQ4A 4AW5A 4IWQA 4BTJA 5LWNA 3ATSA 1QMZA 4IADA 3W8QA 2VO7A 3RPRA 3VIDA 4B9DA 3LVPA 3O71A 4F7NA 3FI8A 3EYHA 2J50A 3F3TA 4F7SA 4G3GA 4A07A 3JY0A 4FKIA 4EBWA 2PZYA 2I0EA 1OBDA 2Y8OA 3Q9WA 3HZTA 2WTDA 4FUYA 4HGTA 3BLHA 4QPMA 4TNDA 5K4JA 3EQPA 4S2ZA 2VTJA 4B99A 4B7TA 3U55A 2BAKA 3PXFA 3E87A 4XNEA 5JQ5A 5C8MA 2P0CA 2ZYBA 3HA8A 3G33A 3PZEA 3AKLA 3Q6WA 3U54A 3G9LX 3JVSA 3NW6A 4F9AA 2BUJA 5L2QA 3EYGA 4LL0A 4DEIA 3JVRA 4KIQA 5EQPA 4AXDA 4OAUC 3OEZA 4ZSEA 4YPDA 5ANKA 3R2BA 3HV5A 4F08A 4UZDA 4LDTA 3QTUA 4YURA 4XX9A 5EDQA 3LE6A 5ANIA 4DFZE 3OT8A 3BLRA 4DG2E 4EZ3A 4EJNA 1PMUA 5AIKA 4BBEA 1Y91A 2GFCA 2O63A 4FSWA 3FZOA 3CLYA 5AUYA 4ERWA 5IDNA 4EC8A 1ZYCA 4ALUA 4IVBA 1SZMA 4N70A 2WMBA 5AP4A 3DCVA 2CMWA 4LQMA 1A06A 2ITUA 5HO7A 3RAWA 2G01A 2OZOA 3R7GA 4WIHA 3MY1A 4EQMA 2CKEA 4FV5A 1Q3DA 5DT0A 4GIIA 2XP2A 5AR2A 3MGYA 4KIKB 3UOKA 5E90A 3LMIA 2WTCA 4RMZA 2YAKA 4D4YA 4HJOA 3RPSA 5KO1A 2C47A 1I09A 3HMIA 3LKMA 4QPSA 3ZM9A 3ZFYA 1K2PA 2W5AA 2XH5A 5T6KA 1XH8A 3OUNB 4PDSA 4FKWA 3VQHA 1M2QA 3EZRA 2F57A 3D5XA 1R3CA 4O38A 3OTVA 1ERKA 1LEWA 3A7IA 4XLVA 4CV8A 4CFUA 5AWMA 2PYWA 3MPMA 2W96B 3KGAA 5A4QA 4FIJA 2JFMA 3A8XA 3GCQA 4X21A 5IG1A 4NL0A 3BRBA 4I4FA 3W0OA 4XP3A 1Q5KA 3AT2A 3RALA 4BYJA 3CEKA 3CXWA 4YBJA 3ZSIA 1XQZA 4AFEA 4XOZA 2I1MA 4FG7A 4RWKA 4RWJA 4AT5A 3TDVA 3BKBA 3I6WA 3OS3A 4BKYA 1SYKA 3Q4CA 4ANNA 4DITA 3SG8A 3UO6A 3SX9A 5BX0A 3COMA 3EH9A 4DEDA 5AAEA 4RIXA 5IUGA 4ASZA 3FI4A 1WBSA 2W1EA 3GNIB 3VO3A 3F82A 3KXGA 2W1FA 1Y8GA 2RFSA 2WKMA 1PMVA 3EL7A 5IQBA 2FGIA 3P4KA 2DUVA 4BC6A 5M09A 3W32A 5HBEA 2RG6A 2YIRA 4IACA 4R78A 2BROA 4PWNA 3EN9A 3Q4TA 4HYHA 2FYSA 2F2CB 4ZP5A 5KX8A 2HWPA 4IM2A 4FIHA 4MF0A 4FTOA 3PTGA 4QEBA 3SLSA 1PXIA 2GTNA 5DHJA 1H0WA 3FZ1A 1VJYA 2XK6A 3FMKA 3P23A 3TV4A 3BCEA 4D1ZA 5LVPA 1A48A 1YXUA 3C0GA 3IW7A 5TF9A 3NLBA 3R28A 4E5AX 4BDFA 3AT4A 3HEGA 4QQTA 2B53A 3ZSHA 2ZJWA 5DOSA 4DDIA 1H25A 2YM4A 1FVVA 4FV1A 4F7JA 2HXQA 4IAKA 2XAOA 5JGDA 3KQ7A 4WNPA 4ZJIA 3ZCLA 5AEPA 2XNBA 4APCA 3QWJA 5AP5A 4E6AA 4F6UA 3DDQA 2WU7A 5HO8A 4DFYA 4YTFA 2IVSA 2J2IB 4UZHA 3MH2A 4O22A 4LRJA 4LOOA 3OFMA 3PVWA 4YZMA 3R7EA 3CD3A 3WF5A 4ENXA 3PVGA 2XKDA 4QMSA 4BBMA 3DNDA 4FTCA 4QPAA 5HG8A 2AUHA 3ORLA 4CKJA 3B2WA 5IA2A 1QPJA 4QP1A 3F6XA 2WMAA 3PA4A 3UDBA 2WQMA 4XBRA 1KE7A 5GZAA 3R63A 3O96A 4Y95A 3LW0A 3V8SA 4CFVA 4L7SA 4R5YA 4G31A 4IAZA 4M0ZA 3QD3A 3CSVA 4O0XA 3I60A 4TYHB 4TTHB 5BVOA 2HW7A 4MQ1A 4D2RA 4KIOA 4WG4A 5EW9A 4FEWA 3ZUUA 2JBOA 2YISA 5BVFA 2E9UA 5ANGA 1OPJA 4NKSA 5E8WA 5AA8A 3CP9A 2RGPA 2ERKA 3M11A 5FP5A 1YQJA 2UZBA 2IF8A 3FQSA 4NW6A 4QYEA 2YIXA 4D4SA 4YLKA 5CEKA 1PRYA 4M12A 3F7ZA 3Q53A 3FXXA 4RJ5A 4FEQA 4FTTA 2Z2WA 4YJRA 1ST4A 4DHFA 2V5QA 3FMMA 5JKGA 2RFEA 3BX5A 3QUPA 2F7EE 4L3LA 1M2PA 3QZGA 2WMTA 3IDBA 4MF1A 4XH6A 5DMZA 1Y57A 1XMMA 3HKOA 2CGUA 2WQNA 3MH0A 3NUYA 2ZVAA 2J51A 3ET7A 4W4XA 3BHTA 4PUZA 4CFWA 3UVPA 4YLJA 2IN6A 1H4LA 3V3VA 4DLIA 3R83A 3DB8A 4OBOA 4UV0A 4DBXA 2B4SB 3D5UA 4TPTA 4AW0A 1OL2A 2IVTA 4ALVA 2X39A 2YDKA 4C34A 3A7FA 3LCTA 4QDEA 2OG8A 1OZ1A 3K5VA 5BYYA 4E4LA 3IONA 2QHNA 3CR0A 3R0TA 2ITWA 2YEXA 1OVEA 3DS6A 4HYIA 2HZIA 4TKSA 4YJPA 4CT2A 3GCVA 4G3DA 3ZO4A 3DT1A 2VWWA 2R9SA 1E1XA 3B2TA 1FVTA 3QQLA 4ZOGA 4A9UA 1REKA 4E6CA 3R21A 1XH7A 2OZAB 3OEFX 3Q9ZA 4R7BA 2CGVA 4L45A 2YCSA 1Z9XA 4BBFA 3ZZEA 4PTCA 3VN9A 3EQGA 3VRZA 5L6WL 3UTOA 5JZJA 4L7FA 3KN6A 4XV1A 3I4BA 1YDRE 5BYZA 3OVVA 3R8ZA 5HNBA 2NO3A 4L8MA 4ALWA 3LMHA 3KRRA 4TXCA 3P7BA 4TZRA 1RE8A 4EH9A 2QURA 2CLXA 3G9NA 3NYXA 5ANOA 2Z7QA 4ERKA 3ZLSA 3WZUA 4PMMA 3U87A 4JDIA 1JKKA 3NNUA 4J96A 4FEXA 4YC6A 1OB3A 2QOOA 1IASA 3W18A 3CTJA 1XMLA 3ZFMA 2X9FA 4O0YA 4D55A 3F66A 4EYJA 3P79A 5K4IA 3LFNA 5CEPA 3GFWA 1YHWA 4RIWB 4Z55A 3U8WA 4HCTA 5CQUA 2UVZA 2A4LA 5FXSA 4K6ZA 4AA0A 4AW1A 5LOHA 4LUEA 4DH7A 1P14A 2G1TA 4YZDA 5J9YA 4FJVA 5HG5A 1H8FA 3FKLA 3KXMA 3DAJA 4U42A 4QTAA 5KKRB 4J53A 4CLJA 5CF4A 5IEVA 3A7GA 3A7JA 3FUPA 4CFXA 4S32A 5HE3A 1W84A 2ZM3A 2ZB1A 4KRDA 5GJGA 4FKRA 4WNKA 2QKWB 2YLFA 3R04A 3IGOA 4IX6A 1GJOA 5A4LA 3BHVA 1IRKA 3PVUA 1OIYA 3V51A 2CN8A 5L6OA 4UMPA 5AM7A 4F09A 2X8IA 3MB7A 5DN3A 4BCGA 4DGMA 3HMNA 2WAJA 5FBOA 1ZY4A 4EEVA 1GZNA 2X4ZA 3FLNC 5HOAA 2J0IA 2OH0E 3OXZA 4KS7A 3FQEA 5J95A 1YWRA 4WG3A 4H05A 1SVHA 3TCPA 4XBUA 4O7NA 3EIDA 4E7WA 1YI3A 4EH8A 1P4FA 4QMNA 4O83A 2QCSA 3W10A 4QP6A 3HL7A 1M14A 1H01A 4ZTLA 1O6YA 5GZ8A 4D4VA 3DDPA 3QTIA 1YWNA 2WMXA 5KMNA 2C30A 3FMEA 4G34A 2BRNA 4DFLA 2PE0A 5AP3A 3KMUA 3BYVA 3PA5A 2VWYA 1T46A 2QQ7A 3KULA 4ITIA 3QLGA 5CU0A 3COHA 4CQEA 4IC8A 4CMOA 2PUNA 5AAFA 1GZ8A 2VGOA 2BHEA 4I6BA 2UW8A 4JBOA 4W4YA 4GL9A 4MXZA 2ETMA 3BBWA 4M14A 4MCVA 5E7RA 2IW9A 5J9LA 4O7WA 5J87A 1UU8A 3KMMA 4L01A 2XKCA 4JG7A 4JT3A 4BCNA 4DTKA 1J91A 3O8PA 1ZYSA 1ZYDA 4EWHA 4J52A 4QMOA 2CNQA 3UODA 1GZOA 2IZRA 3AGMA 3NDMA 4CCBA 3CQEA 2CJMA 1J1BA 5AUWA 3KEXA 4R6VA 4DHJA 4GG5A 4FIIA 3QRKA 2C6DA 3KCKA 4O0TA 2EXCX 2WQOA 4O0RA 3RTPA 4ANBA 3DK6A 1LR4A 3UNJA 1J1CA 4U43A 4WSYA 2WHBA 4L3JA 3V6RA 3T9IA 4JVGA 4C57A 4WBBB 4C33A 5FDXA 1Q8TA 2YM7A 2GSFA 1ZXEA 4NM0A 4C2WA 2PZPA 3H9RA 2XB7A 3DTCA 1R1WA 3QALE 4JBVA 4K2RA 4KRCA 4M7IA 4U79A 3LFCA 2UW0A 4NU1A 3FZRA 4Q9ZA 1FBNA 4GFOA 4PY1A 4FSMA 4O82A 2JDOA 3NUPA 5JFSA 3MB6A 3ZXTA 3V8WA 2O64A 2FVDA 2A2AA 3C1XA 3ZRMA 2W0JA 4ENYA 3RMFA 3TL8A 3UC4A 4M13A 4UX9A 2JKMA 2XYNA 2YCRA 5EHOA 5EKOA 2OJIA 4JQ8A 1RDQE 1NVQA 2O3PA 5CS6A 3EMGA 3PP0A 1U59A 3DLSA 3NAYA 4RGJA 4CFFA 4X6RA 4JDJA 2WO6A 3E8EA 5HEZA 4UMUA 2JIVA 3R01A 1XR1A 2CN5A 4ASEA 4CGAA 3ZTXA 2VUWA 1SM2A 3C51A 3COIA 2W4OA 3HV3A 4N57A 4U6RA 3BE2A 2W06A 4QMXA 4EOLA 2UZUE 2PZRA 4DG0E 3U9CA 4WG5A 4DGLC 2BHHA 3LAUA 4X2NA 4FKVA 4FNYA 4U9AA 3NUAA 2OJ9A 2ITVA 5CASA 4V0GA 4Y5QA 3FPMA 3ALNA 3VHEA 5JGBA 3GU4A 4NCTC 4PMTA 2NRYA 3TZ8A 2WB8A 3VHKA 3W33A 5CAVA 4GT3A 4HPTE 4C4IA 3ZLXA 3KA0A 1PMNA 3F69A 4RRVA 2IZTA 3ANQA 2BZIB 1XHAA 3P0MA 4YC8A 4DFXE 5A14A 4BTKA 5E8YA 4BN1A 4LGGA 3ZO2A 5JZNA 5BMMA 2BZJA 4D2WA 3RINA 3KVWA 3TTJA 3GCSA 5CANA 4JMQA 1WMKA 4YJQA 3HMOA 3RPVA 3UZTA 4O86A 3O7LB 3C0IA 3NGAA 3DKOA 3P5KA 3TNIA 4D28A 1W2DA 2QU5A 3EN5A 4OTWA 3TUBA 2XIZA 4G5PA 3TV6A 3Q2MA 3THBA 2XS0A 5EOLA 4Q5HA 2CKOA 2X2LA 3FI2A 3LLTA 3QX2A 1UVRA 3O23A 2HWOA 4NWMA 5IQEA 3QC9A 3MWUA 1XJDA 3PE2A 4LOQA 4DEHA 5A9UA 5DYJA 3PXKA 3SRVA 4Q9SA 1JWHA 4E26A 3DKCA 3DBEA 3UQGA 2XNPA 5LQFA 3FXZA 4XG2A 2QONA 2YFXA 2OXXA 3CY3A 4I21A 4XCUA 1FMOE 2OBJA 5EW3A 4I24A 3W2QA 3ENMA 4EK6A 1MUOA 4YTCA 4I1ZA 2G15A 5C03A 5JFWA 1ATPE 4FKQA 2Y6OA 1YXTA 4XP0A 1WBOA 4JDKA 2JIUA 4C0TA 4IJ9A 4BHNA 3IDPA 4M66A 2B52A 1ZLTA 2PVRA 3VUTA 2KTYA 3IG7A 4MK0A 4U45A 3PLAE 4EHEA 1BI7A 4AQCA 4IFCA 4YPSA 3OBJA 4F0FA 2PPQA 5M55A 1IAHA 3UO5A 4LMNA 3R02A 5T3QA 5HIBA 4FZFB 2Z02A 4EWQA 3MI9A 4RX5A 3S95A 3LJ1A 5I9ZA 3SXRA 2YDJA 4O96A 5BVDA 2QD9A 5GIPE 2P33A 2GS6A 5D12A 5D7AA 4ZK5A 3ULZA 5M51A 2ESMA 5J9ZA 1KV1A 5A4CA 1KUTA 4IIRA 5AJQA 3K54A 5DE2A