4K6ZA

The jak1 kinase domain in complex with compound 37
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
290
structure length
279
Chain Sequence
VDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSLKPHIADLKKEIEILRNLYHENIVKYKGICTEGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGDFGLTKAIETDKETVKDDRDSPVFWYAPECLMQSKFYIASDVWSFGVTLHELLTYCDSDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEALLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK1
publication title Design and evaluation of novel 8-oxo-pyridopyrimidine Jak1/2 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 279
sequence length 290
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4k6zA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4k6zA01
5M51A 1UNLA 1ZZLA 2Y6MA 5CVFA 2WU6A 3L9LA 4OT5A 2GQRA 1BI8A 4JLCA 4PP7A 3KU2A 4KSPA 4WRSA 4PL3A 4W9XA 3BPRA 4C4GA 4DCEA 3EOCA 2IN6A 3F7ZA 4DINA 2HK5A 4F1MA 3ACKA 5KMLA 1M7NA 4G5JA 4XG4A 3BYVA 5CNNA 5L4QA 4NFNA 2QO9A 4PNIA 1XH7A 3A2CA 3QD2B 4RX9A 2WMAA 1QMZA 2Q0NA 3TWJA 3WF6A 1BKXA 2OZOA 3BRBA 1YQJA 1U5RA 2IW6A 3ZRMA 4WUAA 3QA0A 5LMAA 3FLQA 4FT7A 4XX9A 4ZY5A 2W5BA 5DR9A 4EH3A 3IECA 3DU8A 4EK6A 4FTQA 2PHKA 3EHAA 4BDHA 4EH2A 5KX8A 4UN0C 5CAOA 4ZJJA 4R7HA 5LARA 3ZRKA 1XO2B 3C13A 4MAOA 4PPBA 4CTBA 5HVKA 3BLQA 2JAVA 3LCDA 4M0YA 3C4EA 4RSSA 5ANDA 1ZWSA 4PY1A 5ANJA 2YCQA 3V5TA 5HCYA 3E8DA 4CFUA 4M8TA 4UZDA 5CZHA 4F9YA 2UW7A 2PE1A 4DGNA 4DH8A 5L2WA 3LJ0A 4APCA 4Y95A 2CGWA 4YJNA 3AD4A 3PRIA 4XV1A 3UVQA 4ZSAA 2B52A 2PVFA 1RJBA 3SX9A 3FEGA 4ITJA 1OIYA 4G17A 4D4SA 3UIBA 4CFWA 3LFFA 4LV5A 2IG7A 3TZ9A 3NZ0A 2CMWA 3EZRA 3MJ2A 4QOXA 4TYHB 1ZYLA 5DT3A 4AOTA 3ATTA 2WQEA 4OBPA 4GT5A 3ZSIA 3IONA 2FSOX 4GVJA 5HIEA 4KWPA 4U9AA 5GHVA 3KULB 3UPZA 2JKKA 2RL5A 1LPUA 4WA9A 5A3XA 3W55A 3NCZA 1OZ1A 3R22A 3N4VA 3ALNA 4RZWA 3RI1A 3OC1A 5JFSA 5D12A 5B2KA 5CZIA 3UO4A 3NYXA 1P4OA 3PP0A 4P5QA 3BE9A 2GNLA 4P7EA 3FJQE 1B38A 4ZZOA 2ETMA 4V05A 3BHTA 4D4YA 5IQBA 4X6RA 3QZGA 2PVRA 1F5QA 3H9OA 3KCFA 1WVWA 3RJCA 2JITA 3R9RA 1STCE 4EOOA 2HWOA 3LXNA 3MVJA 4Z3VA 5J87A 3OT8A 3PJ1A 3QD4A 4AGWA 3DPKA 3PJ2A 4LGHA 3W8LA 3EIDA 1Q61A 5LMKC 1CM8A 4I4FA 3P79A 4BI0A 1BYGA 3MSSA 3BGZA 1PW2A 3UOKA 1U46A 1LUFA 2XMYA 5H8EA 2XBAA 4RQKA 5GJFA 3FV8A 3EKKA 4EHEA 4ANMA 1R3CA 2GFCA 3ZXTA 3ZZWA 3E87A 4O0XA 5BVKA 3PIYA 2UW8A 1YOJA 1WCCA 1K2PA 3MBLA 3SOAA 4DEEA 3LQ3A 1GY3A 5JKGA 4WIHA 1GAGA 4HJOA 4CFFA 4LFIA 4UYAA 3QTQA 2XM8A 2R7IA 2ZB1A 3RGFA 2GNFA 1AQ1A 3OY1A 1YHVA 4IZ7A 4C8BA 4XV2A 3D2IA 3CLYA 5DRBA 2LAVA 3R9NA 3DXQA 3MVMA 2PZPA 4QTEA 4LMUA 5KHXA 3P86A 4FODA 3ZHPC 5M06A 3UQCA 2W1GA 3Q4UA 4CEGA 4FL2A 3P08A 3C0IA 2B9HA 1JLUE 2GMXA 2PZ5A 3AC8A 2XRUA 3NYOA 3OHTA 4U81A 1YXTA 5DRDA 5E8ZA 4QPAA 2W9ZB 4NM0A 1TQPA 3ZO1A 2CKPA 2W4JA 3E8NA 3DZOA 4R8QA 4GUEA 3NAXA 3P9JA 3C5IA 5F94A 4Q9ZA 2Y8OA 3NRMA 4C02A 1OBDA 2ZV7A 4NCTC 2Q0BA 4QMLA 1MRVA 4FZAB 3RWQA 2HY0A 2W17A 3FLYA 4NTTA 4P5ZA 3HA8A 4D0XA 1B39A 3VAPA 4IDVA 2JFMA 1ZMUA 1UKIA 4GSBA 4EQMA 3DBDA 4NW6A 1IG1A 5BYYA 2X2MA 2EXCX 1FBNA 3GU8A 5CU6A 3UE4A 3UNKA 1Q8WA 5FXQA 3K3IA 4YHFA 1WBTA 4FF8A 4UY9A 3PVGA 4EKLA 2OGVA 4RIYA 4MHAA 3K54A 3HP5A 4F6SA 3WILA 2UW5A 2E9PA 2ZV9A 4FIFA 1OI9A 2PMOX 4L42A 4HNFA 4O0TA 4F9CA 2HW7A 1PY5A 3FXWA 4BIBA 1H4LA 2G15A 4OTQA 4QMWA 3FQSA 3PWYA 5CT0A 5LMKA 2Z7LA 2EWAA 5M57A 4BBMA 4BCHA 1P4FA 5FTQA 1JKTA 2ESMA 3HMOA 2B9JA 4DGLC 4DFBA 4YJQA 4G3DA 5FP5A 3O8TA 2I6LA 2WQBA 4EBWA 5B2LA 3W2PA 2BZIB 2A27A 5AMNA 5CYIA 4ALUA 2BRNA 2ITXA 4RJ5A 3W2SA 4O81A 3ZU7A 3L8PA 5EQPA 2UZLA 1GIIA 3HKOA 3LFAA 3EQRA 3VRYA 2W1FA 4QYYA 2CNVA 1CMKE 1ZLTA 4OTFA 5IH6A 1NY3A 3E88A 4FZFB 2H96A 1XWSA 4IAIA 4RFYA 4E20A 1YDTE 4MD9E 1XQZA 4Z7GA 3OP5A 4CT2A 3QTSA 4G5PA 2WMSA 4Z55A 4NKSA 4H3QA 1OL7A 3RPRA 4Z16A 3AOXA 4O96A 2V22A 1ZYSA 4HZRA 2RFDA 2VTOA 5DEWA 3ZUTA 4EC8A 4L01A 4RMZA 2QOBA 3TG1A 4AXAA 3NUXA 4PDPA 2QONA 3Q60A 2XJ0A 3VJNA 4MXYA 2EB3A 3ZTXA 4KS7A 2ZVAA 4FKGA 4XG9A 4MNFA 3KRRA 1NVSA 4Y73A 3FI2A 2G2HA 4M84A 3UG2A 2ACXA 4NCTA 1JSUA 2J5EA 2HZIA 2Z7QA 3NUYA 3QC4A 4G9RA 3L9PA 4GVAA 2J0IA 5CY3A 5HG7A 1YKRA 4CQGA 4D1ZA 3H30A 5TT7A 5DR2A 3OF0A 4JRVA 4UX9A 4FZ7A 5DA3A 5HBEA 1PMUA 1REKA 1GOLA 3VRZA 4TWPA 1XR1A 4NIFB 4C2WA 2C5YA 4FG9A 1U4DA 3T9IA 2IPXA 3CPCA 3QRKA 3UJGA 3NEWA 1SZMA 4CYIA 4CCUA 3FLZA 3UOHA 2JGZA 3PA5A 4X2JA 3F3TA 3NNVA 5J7HA 3QQJA 3E3BX 2DYLA 4EOPA 3PA3A 1Q3WA 2Y7JA 4UEUA 3QRIA 2BROA 5AR5A 4NM5A 3V5LA 4E5WA 4USFA 2WIHA 3EN6A 2O2UA 3TZ8A 5KMIA 4I4EA 4GIIA 4CV8A 3CIKA 2A2AA 4FL3A 4OGRA 1RW8A 1M2PA 4ZTNA 4M69B 2YZLA 3ZC6A 2OIBA 3QQHA 4L46A 5DFPA 3ETAA 3PSCA 3TEIA 1H26A 4WRGA 3GU4A 3UTOA 4F65A 4RA5A 5AFVA 5CVHA 5BQ0A 3OT3A 4S32A 4M0ZA 5AUVA 4I5CA 1L3RE 1OVEA 4O38A 4UWCA 5HVYA 4EKKA 3C4WA 2RFSA 5IZFA 1PXJA 2FSTX 5HESA 3SRVB 3VF8A 3KXHA 3E5AA 4DLJA 3MH1A 4J1RA 2GQSA 1UWHA 5FP6A 4DCAA 3RTPA 1Q3DA 4YZMA 1M2RA 1KE8A 1PXMA 4MCVA 1XBCA 2UW4A 4GFOA 3RPYA 4KA3A 3VBVA 4C38A 5CAUA 5KO1A 3FLNC 3GCQA 4FKOA 4JQEA 4LG4A 4BGGA 2HAKA 5JFXA 5DEYA 4O6EA 3BHHA 4I0TA 3MIYA 5DPVA 4Y8DA 3JVRA 2F9GA 3LM0A 3NPCA 1CKIA 2QC6A 4IW0A 4BI1A 5IDNA 2FYSA 4NKAA 4YLLA 1F3MC 1KE6A 3MH2A 4FSYA 2AC5A 5EHOA 4AG8A 1KUTA 4QD6A 2ITUA 3CE3A 3CKXA 2R9SA 4O7LA 2WTKC 1J7LA 2BRBA 2VTJA 3COIA 3GU6A 5AUTA 5FBOA 4J53A 4DBNA 3FLSA 2BIYA 3NGAA 4S2ZA 3UG1A 4RIOA 4F9WA 5BVNA 3NVKI 2G1TA 2JD5A 4OTHA 1VYZA 5HLWA 2RG5A 4YHJA 4Y72A 4UMQA 4ZZNA 3VVHA 3HUCA 2OIQA 1U54B 4IXPA 5AR2A 5DMZA 4ZS4A 3F2NA 4P4CA 3R6XA 3RK7A 2PTKA 4O2PA 3EN9A 1LP4A 2GU8A 5CANA 2ITWA 4TW9A 2XIXA 3WZEA 2OXDA 5IA3A 3KY2A 3NR9A 3I0QA 4FKPA 5A4TA 4MD7E 3PY3A 4FTTA 1Q8UA 3FLWA 3F5UA 4QYGA 4O7YA 4CVAA 4PTGA 4HGLA 2R3RA 4I6BA 3TM0A 1IRKA 2J0MB 2OZAA 2FSMX 4DH1A 2QO2A 3VBYA 3L8XA 3TL8A 4QP9A 4ZTLA 1NA7A 3VUHA 1JBPE 3DTCA 4F0FA 5JEBA 3BYSA 3EQIA 3DB6A 1W8CA 4QMUA 3RAWA 5AP7A 3RM7A 3ZFXA 4CMOA 5JK3A 3M11A 4IVAA 4BWPA 2C0OA 1JVPP 3EFJA 4QP2A 4XNEA 4Q5EA 3CKWA 4HVDA 2VAGA 5AUXA 3B8QA 3QCXA 1CKJA 2PE2A 3TJCA 1OIQA 5TKDA 2LGCA 3FYJX 3LFNA 2VO0A 2V7AA 3O7LB 4BVUA 4ZLYA 3RZBA 3IW5A 2C0TA 4UZHA 2ITZA 1YXXA 4FTNA 5AP5A 4Z7HA 3SG9A 3LXPA 4K18A 4D9TA 5GIOE 5DT4A 1H25A 4X2KA 4LMNA 4E93A 5BMMA 4RIWA 3FY2A 3GCUA 4FE2A 4PUZA 4CZYB 5HHWA 4B99A 3FPMA 1ZOEA 4BWKA 2OXXA 2YCSA 3E64A 3EQBA 5IUGA 4GH2A 4O7VA 4LOPA 4L3LA 5EOBA 4R6VA 4QMVA 4LUDA 4FNWA 1WAKA 2UZUE 4H3PA 4W4VA 3RHXA 3AG9A 3F2RA 3F2AA 3FMEA 4TPTA 4E6DA 1OMWA 2F2CB 5C27A 5E91A 2QLQA 4JBPA 3R2BA 2YDIA 2YIWA 2WOUA 3R01A 5AIKA 5AR8A 3EN5A 3MVLA 3AT3A 3DNDA 1EH4A 4DFNA 5FDPA 1TVOA 3D9VA 4CKRA 2CCHA 4UMRA 5AR7A 5F20A 3QQGA 2CSNA 4U45A 4W4XA 1YW2A 4L45A 5HTCA 1Z57A 1MRYA 3GFWA 4IDTA 4JBOA 3CSVA 3LFSA 3IDPA 2QOCA 1DS5A 4QYEA 2BDWA 4RJ8A 5LVLA 5BPYA 4G6NA 2IVUA 4O7WA 4V0GA 2ERKA 4ZZMA 4QPMA 3R1YA 4LRJA 3VBQA 2WNTA 4EQCA 4C4HA 3HRCA 4RIXB 4ALVA 2WMXA 3QTIA 5E8UA 2BAJA 3DLZA 5EKNA 2F2UA 3WZDA 4C4EA 4X2NA 2CKQA 2E9UA 3W16A 3DAJA 1Q8ZA 3FI8A 4NTSA 2W9FB 4MYGA 4TYGA 4BB4A 5E92A 4M3QA 2UZNA 3DBCA 1IAHA 1REJA 4OLIA 4NU1A 4UWBA 5I4NA 4XUFA 1XKKA 1PXNA 4DEAA 1SMHA 4IX4A 3G9NA 4LV8A 4AU8A 2Z2WA 1WBNA 4GMYA 3ORKA 3BELA 3ZMMA 4CD0A 4ZTMA 1FGKA 2OJ9A 3OROA 3LFQA 3NW6A 2R3PA 3G90X 4X21A 4DBXA 4FV1A 3RAHA 4FIEA 4CFXA 2R5TA 3UIUA 3AMAA 3R21A 3RWPA 3ZFMA 4G3EA 4N0SA 3VHEA 4CKJA 4XRJA 4H1JA 3MWUA 3SC1A 4J52A 2GTNA 2C6IA 2HZ0A 5J8IA 5DOSA 1J91A 4NT4A 3O2MA 3KA0A 4O2ZA 4U6RA 1E1VA 5HCZA 3VC4A 4UMUA 4JNWA 3LAUA 4K9YA 4BYJA 4YJRA 4W8EA 5L2TA 4BF2A 2I7QA 2R3FA 4DTAA 4D5HA 3QA8A 3MI9A 3DAKA 3A62A 1YXVA 3OMVA 4E8AA 2X1NA 4PV0A 3GFEA 1ATPE 2Y0AA 4G31A 3VULA 4A4XA 2W06A 1Z9XA 2W0JA 3CY3A 4JXFA 4N57A 1XH8A 4FVPA 4NM7A 4YJVA 4ZJVA 3FYKX 2BIKB 5M55A 4DTKA 1JSVA 4FT5A 2JKOA 2X8DA 4ONAA 4R77A 4JAJA 1SVGA 3BV2A 4J98A 2C3JA 3IW7A 4JG6A 4O0RA 3W2RA 4MF0A 1Y91A 3ERKA 3LIJA 4BN1A 3MFTA 2JKQA 3E8EA 2C1AA 2XYUA 3D0EA 3DCVA 2R3HA 4CT1A 4HZSA 4WUNA 3W10A 2X2LA 3HAMA 4I5HA 5DE2A 5HO6A 5IH5A 3G15A 3PP1A 4BCGA 3PPZA 2DS1A 2O5KA 5AM7A 3UYSA 4CFVA 1J1CA 3R7IA 4C58A 4EZ5A 3V5WA 4AN2A 2IW9A 1Q62A 1H1PA 4JG8A 4G6LA 4F09A 1KV2A 2O64A 5IEXA 4TYJA 2J9MA 1OECA 4EORA 4R3RA 4FT3A 4E4NA 5FD2A 2C6EA 2P4IA 3TKIA 3HAVA 2JIIA 4FICA 2VWZA 5E90A 5FM3A 2H6DA 4USEA 4KIKB 2QOQA 5KZIA 4ZY6A 3LMGA 3ID6C 4DTBA 2UW0A 1A06A 2YDJA 4X6QC 4F08A 5M56A 5D7AA 3ORXA 4LGDA 4BGQA 4GKIA 2QG5A 4OUCA 5HBHA 5M4IA 5AA8A 2QOHA 3RK9A 3PIZA 4I92A 3PXYA 2HXLA 5HVJA 3FL5A 4MEDA 4FYNA 3DAEA 4GK3A 4O22A 1URWA 4HOKA 4FNYA 5EW3A 3JR1A 3QL8A 2NRUA 4PMTA 2Z02A 2RGPA 5AAEA 2WMVA 2X2KA 3LM5A 2OF4A 5AWMA 4BHNA 1UV5A 4MK0A 3OTUA 4IM3A 3ZSGA 5JSMA 2XEYA 4RWLA 2GNHA 2YEXA 3I6WA 3E93A 3F7WA 1W82A 3RP9A 3U51A 2CNQA 3I5NA 4L68A 2X8IA 1BL6A 3R63A 4ASEA 3FL4A 3KK8A 4RJ4A 3EQGA 2VWVA 4EQUA 3AGMA 3Q96A 1UNHA 5IISA 1ZMVA 2VGPA 5HEZA 2W1DA 3BE2A 3O51A 5EW9A 4GK4A 3RAKA 3R9DA 3MW1A 4FV9A 4DH3A 4EBVA 2RSVA 4J97A 2UW6A 2JDOA 2C6MA 4AA5A 4U8ZA 4CYJA 4I6HA 2IZTA 1M52A 5B0XA 3TV6A 3UIMA 4C57A 1GJOA 5AJQA 1WFCA 4ZS0A 5JQ5A 2WTDA 4RZVA 2JDTA 3FQHA 3WE8A 4KKHA 4O84A 4M12A 1FPUA 2QNJA 5AV0A 2JKMA 1GNGA 2GS2A 4K33A 3CXWA 3DKCA 4NYEA 2QODA 5LCJA 4KIOA 4MVFA 3Q9ZA 4QNYA 5HD4A 4DFUA 3WF5A 1YRPA 3AC4A 3DDQA 2C6KA 3MS9A 2IW8A 4YTFA 5C9CA 4UWYA 4KD1A 1AGWA 3D14A 2C3KA 2WMUA 3DK3A 3E7OA 3OXIA 4XEYA 5M53A 3LMHA 2Q83A 5TR6A 3QZHA 3R00A 4IADA 3OUNB 2YCRA 4I6FA 4A9YA 5K5NA 2XKEA 4DE4A 1YWNA 3I81A 3AMYA 5E8VA 4BTFA 2OKRA 1OKVA 2J6MA 3MYGA 5T6KA 3AC1A 1KV1A 3GUBA 4L3PA 3OCSA 4CXAA 4F1TA 5J9LA 5M4FA 5DYJA 5FEEA 1PYXA 1XH4A 2NPQA 3DJ5A 4FTCA 4XP0A 5AUZA 5DN3A 2UUEA 3ZO4A 3SGCA 4FIJA 3KL8A 3R8PA 4FL1A 2OH4A 3ZXZA 4U80A 5HG9A 1F0QA 3PA4A 1OBGA 4DT8A 4G1WA 3A99A 3S0OA 4QYHA 5K9IA 5ANEA 4FVRA 3NX8A 1APME 3FMMA 4TNDA 3GQIA 5EH0A 4PMSA 4HGTA 2BCJA 2YWPA 2ITNA 3QHRA 4JL9A 3SV0A 1NW1A 5I9VA 3SW4A 2VX3A 4GCJA 4WG5A 1ZRZA 3DK6A 2QU6A 3D7TB 5FG8A 3IOPA 2O63A 2G9XA 4U5JA 5CASA 3TN8A 4AP7A 4WKQA 1K3AA 3LCOA 4CMTA 4YUQA 4MWHA 4FG8A 1YHSA 2B9FA 3U87A 2YFXA 5A9UA 2UVZA 4XP3A 3R1NA 4I22A 3UIXA 1M7QA 4EOQA 1B6CB 3BEAA 4TYHA 3NVMB 1ZMWA 1WVXA 2QCSA 3CBLA 2IVVA 5HI2A 3QUDA 2Y9QA 2PYWA 3CS9A 4YNEA 1BX6A 3PZHA 3KULA 3UVPA 5J1WA 1J1BA 3JXWA 4ZLZA 3UVRA 4CFMA 4EWHA 3OXZA 2J4ZA 4XLIA 4ITIA 4WSQA 2IJMA 3ZLWA 3OOGA 5IDPA 3DKFA 2OBJA 5I9UA 4I1ZA 1TQIA 5GZAA 3BEGA 2GHGA 3COMA 3MA3A 5EHLA 1JNKA 3TTIA 4FKTA 2R3GA 5EI8A 4Y5HA 2A19B 2YERA 3Q2JA 2YIYA 3EMGA 3GOPA 3Q5ZA 2BPMA 3VS1A 3GC0A 4DGGA 2ITYA 3O71A 4DH7A 4IANA 3JVSA 3PJCA 4IVCA 3LHJA 4ACGA 3FC1X 3SQQA 3SG8A 1RDQE 2I0EA 1ZXEA 3HYHA 4NM3A 3R8ZA 3RMFA 3NW7A 3EQPA 2P3GX 4TYIA 4RC2A 2XUUA 2FA2A 4JAIA 2YN8A 5BVEA 4JBQA 3UPXA 4BCOA 4UMTA 3HMNA 2BALA 2X4FA 1KSWA 5CU3A 4ZAUA 5I9YA 3MVHA 4MBIA 4C4FA 4AT5A 4E7WA 4IH8A 2CJMA 5EYKA 2PVMA 4IAFA 1PMNA 2VNWA 1OPLA 2IVSA 3BBWA 2DWBA 4ZMFA 5DIAA 5CF5A 3FZRA 4YR8A 2O65A 5E8XA 3FKNA 2OXYA 2YM7A 4K6ZA 5H8GA 4KAOA 3V6SA 2W5AA 4F7LA 2OJFE 5FEQA 3UOLA 2PZRA 3W2OA 2R3NA 3DJ7A 4QMXA 3MN3A 1UNGA 3NUNA 4ZSJA 5HICA 4D0WA 1YDRE 3FI4A 3MFUA 3PUPA 3PVWA 4FKRA 3UQFA 5IQFA 5CSPA 4QPSA 3BHVA 3O50A 5GINE 4K0YA 5D9HA 4DYMA 2WMTA 5CALA 5H8BA 4UXQA 4XHKB 5ANIA 5BUIA 2YJSA 5EDRA 4I5MA 3OD6X 4FTRA 4D9UA 3A4PA 5H9BA 4OAVB 3QXPA 5G1XA 4YP8A 3COHA 4UYNA 3Q32A 4IVDA 2R3KA 3C0GA 3HMPA 3KQ7A 3P7AA 5J95A 5I0BA 5JZJA 1H24A 3SLSA 2W1IA 3P23A 4UB7A 4BHZA 3ZLYA 3OVVA 3KEXA 4DG3E 3TZMA 4OW8A 4E6AA 4BCFA 3DXNA 2EUFB 4MQ2A 2X8EA 3W2CA 3MFRA 4IZYA 4V01A 3G2FA 3F6XA 4GIHA 4ORKA 4EJ7A 3N4TA 3QCYA 4FT9A 2OSCA 4M68A 2WMWA 3MJ1A 4C62A 4ENXA 2W96B 3W8QA 4QMSA 3WZUA 4ZSGA 2G01A 2BFXA 4J8MA 4IMYA 3VUDA 4EK8A 2B7AA 4C35A 3QTRA 3TUDA 3IKAA 3RNYA 5LWMA 3MB6A 3ODYX 4LGGA 4AN3A 3H10A 2OLCA 4E26A 2PK9A 2PUNA 3FUPA 5DVRA 3D2KA 2QVSE 3UZPA 3UMWA 4I94A 3WIKA 5EDQA 3F3VA 4FI1A 2JC6A 4HYIA 3OBGA 4IE9A 3VUTA 5T68A 3KRXA 3ACJA 3C4XA 5IMXA 4D5KA 4E6CA 5TF9A 3T9TA 3QXOA 5I3RA 5EDPA 2X9EA 2QD9A 3T3VA 2ZV8A 4X3FB 2C3IB 1YWVA 4RWIA 3ORPA 2QQ7A 5EOLA 4NW5A 3CP9A 4M14A 3BWFA 3I60A 3LQ5A 4ANOA 4OTPA 2Y6OA 1JSTA 2W1HA 2YM8A 5EQEA 4O82A 5CWZA 5CSVA 1RQQA 4I5PA 5K0XA 3QTXA 2YITA 3HMIA 4KSQA 4XRLA 4AUAA 2GNIA 1KE7A 2YHVA 4BC6A 4CRSA 1R0EA 2PE0A 3TDWA 4IZ5A 1ND4A 2WTJA 4FV6A 4PTEA 1UVRA 3VNTA 4JR7A 1URCA 1HCKA 3LCTA 5A4QA 3KCKA 4FTOA 3QKMA 4O7ZA 4C2VA 3KN6A 3ZYAA 3IK3A 5D11A 4FKQA 2HWPA 3K5VA 4P90A 1S9JA 1QPDA 1ZYCA 2XNOA 2R2PA 1SVEA 3FQEA 3VN9A 4RBLA 2GQGA 4PRJA 2Y4PA 2QR7A 3QTUA 3OCGA 4QTAA 1Z5MA 4NIFA 4PDOA 4OBQA 5GNKA 3SW7A 4GW8A 1KE5A 2BTSA 3ET7A 3UBDA 3VS0A 4E5AX 2P2HA 2ZMCA 4FYOA 3W2QA 3I7CA 4L6QA 1SNXA 4LOOA 1OL6A 4RRVA 5LMBA 5FTGA 4D2SA 2CLQA 5AP4A 3PPJA 4DEHA 3VW8A 4RG0A 5HO7A 2CNUA 2XM9A 3GNIB 3VBTA 2VWBA 3S3IA 2RF9A 5BYZA 1BL7A 5C01A 2W1CA 2PMLX 2OG8A 1A48A 3D15A 4M69A 3QQUA 4AF3A 4K77A 3PY1A 5HTBA 5BUJA 2UZTA 3G6GA 4FSRA 4QRCA 2C6DA 5CVGA 4F1OA 5TO8A 1OL2A 3DB8A 4PMPA 2RFNA 2AUHA 1XH9A 1XH5A 2OW3A 2GNGA 3K3JA 3QCSA 5IA2A 1IA9A 2PUPA 2OF2A 4JVGA 3IS5A 5EYCA 3V5JA 2XJ1A 5E7RA 5A54A 5HX8A 3UO6A 2X81A 3SRVA 4RJ3A 5I5ZA 4UBAA 4ANNA 1QL6A 2HOGA 1MQBA 2I1MA 2XIYA 3EKNA 2ONLC 3KF7A 3LFCA 3LLTA 3NCGA 4FTUA 4I20A 3C9WA 3MPMA 4KBCA 3RBWA 4FTAA 2BFYA 3QZIA 2BZKB 4S34A 4Y83A 1WVYA 4K1BA 3WARA 2JIVA 3BU5A 2CGUA 5EKOA 1YVJA 3NUAA 2ZOQA 3QALE 3TV7A 4EZ7A 5HLNA 3GCVA 4RGJA 4IB0A 4ARKA 5KMMA 4F7NA 3E63A 3VS4A 3F5PA 4JDJA 4XBUA 4U40A 4BTMA 4AZWA 3A8XA 3QD3A 5CQUA 4F64A 1E9HA 2PUUA 4QMQA 5BVFA 1JAMA 3I79A 2QKWB 2UZOA 3ORNA 3KMMA 3NIEA 4G34A 1KOBA 5AP6A 4QMMA 1DM2A 3AD5A 4MXAA 4APPA 2FH9A 4FIGA 4AGDA 4AW0A 4GG7A 5C8KA 4TWOA 5EHYA 2A4LA 3I4BA 3REPA 3FSKA 2XK4A 2ZDTA 4X0MA 4G3FA 1XJDA 5KCVA 3HA6A 2WU7A 3E3PA 3V3VA 4ALWA 4EHZA 2WEIA 2C6OA 4A9TA 1OPKA 4LRKA 3SA0A 5C4KA 3HV4A 2UZEA 2VTRA 3ZO3A 4CKIA 2OH0E 2OJGA 3R2YA 4ZXTA 2UZDA 3KXZA 3S1HA 3ATSA 2XIKA 1VZOA 3BGQA 4ID7A 1U54A 2BRGA 3GC9A 2XRWA 4QT1A 4FK3A 1FVRA 2R3IA 2Z8CA 4U43A 3R71A 4FKJA 4EZ3A 5IKWA 4PP9A 4PF4A 1Y8YA 3U9CA 3QQFA 3F3WA 4WSYA 3V51A 3H0ZA 4E5BA 5JN2A 1H1RA 1Q8TA 5CSWA 2W4OA 3QU0A 2VD5A 2EXEA 3V6RA 4DHFA 4EOSA 2F57A 3EFWA 3FMHA 4IFGA 3JY9A 4DGOA 5IQAA 5CI7A 5CI6A 2XKDA 2PVLA 3HRBA 3NIZA 2BDFA 2X4ZA 4YNOA 3F88A 2ITOA 4IJPA 1WBOA 4U3ZA 4XJ0A 3U55A 3PZEA 4LUEA 5J7BA 5KHWA 2QG7A 1KWPA 2ONLA 2UVYA 4YLJA 3FZOA 5FXRA 3ZEWA 3CQWA 5IEYA 4QQ5A 4W4YA 4RWKA 3HX4A 4I21A 2C0IA 4LM5A 5IA5A 1JKSA 1ZY5A 1OPJA 1FOTA 3QLGA 2WGJA 4JX3A 4S31A 1ZARA 2J0KA 2VTQA 4D55A 2J2IB 4MH7A 4E6QA 2C3LA 3DLSA 3GQLA 3OBJA 4PL5A 3L9NA 4TZRA 1JQHA 1YHWA 3A60A 3HDNA 5CEPA 2W05A 2VO6A 2WD1A 3MH0A 4C3FA 4EOIA 3ANQA 4KABA 3U54A 3DZQA 2QOIA 3VS6A 4G9CA 4KIQA 3H0YA 2IZRA 3LCKA 2YM5A 3OW3A 3PYYA 2J51A 5DH3A 2QOFA 3WZKA 5KMJA 1Q24A 2PVYA 3HL7A 2C4GA 4YTHA 3SHEA 3HEGA 2WIPA 5AUWA 3ZZEA 4IWOA 4YO6A 3DA6A 4IX6A 5HCXA 4HVSA 2XP2A 3HLLA 3A7GA 3DKOA 4BDKA 5JT2A 2X6EA 4FIIA 1WBWA 2GS7A 3RHKA 4NH1A 2HCKA 3IDBA 2J90A 2XEZA 3SKCA 5JMSA 3QCQA 4A9RA 4RPVA 2PVHA 3RCDA 3TNQB 3A7JA 3OXTA 5ANKA 5TE0A 2OK1A 3VBXA 5KZ0A 4WBOA 1GZ8A 3M42A 2QI8A 2WPAA 3TI1A 3F66A 4MNEB 5HKMA 2PZYA 2UV2A 3KN5A 1YOMA 4JBVA 4QTDA 4BYIA 3E92A 3EN7A 3VO3A 4CZUA 2JIUA 4ERKA 3GOKA 3KRJA 4Q2AA 5LCKA 3IOKA 3ROYA 3TKUA 3HECA 3WF9A 4JG7A 3NNWA 1R1WA 2PUIA 2YACA 4RIXA 5CF8A 3ORIA 3PXRA 4B9DA 5IA1A 1YOLA 2Z7SA 4R1VA 2YJRA 3FXZA 4TYEA 3ELJA 2RIOA 3ANRA 3AXWA 3I7BA 2I0HA 4HYSA 1QCFA 2AYPA 2WTCA 5HE2A 3KK9A 4H58A 3O8UA 4TWCA 3NUPA 4L44A 2UVXA 4XG8A 3NYNA 1XBAA 3EH9A 2WQMA 3OY3A 4EUUA 3LOKA 4LOQA 2C5XA 2VNYA 1KOAA 4XOZA 4EYMA 3BZ3A 4PWNA 3AC2A 3UYTA 5HZNA 4EEVA 4FV3A 4RVLA 2Y4IB 4MF1A 2XK9A 2ZYBA 3WF8A 2WXVA 2WHBA 3O7LD 5C4LA 4JS8A 2GS6A 4YZ9A 5F95A 4GU6A 5HIBA 3R1QA 4E4LA 5JGBA 4XG3A 5HNIX 5L8KA 5ETIA 4K11A 4X2GA 4EHVA 3ZBXA 4L8MA 3EFKA 3F3ZA 4YC3A 4BDGA 3FKOA 3NS9A 5JZNA 3ZCLA 3DKGA 4IWPA 5CAQA 4PDSA 4DT9A 3LXLA 4O91A 4TXCA 5BVDA 2OJIA 2PPQA 5CXHA 1U5QA 3SAYA 3ZO2A 4DG0E 4IC8A 3UOJA 4GG5A 1WMKA 4J71A 4YJSA 4AGCA 1CSNA 4M66A 4JX7A 4O7SA 3PSDA 3EQHA 1KE9A 4BCKA 3OS3A 1ZY4A 2QR8A 3O23A 1NXKA 4PX6A 3S2PA 4C36A 2BZHB 4KINA 3RCJA 5FLFA 2HXQA 2JDVA 4BKYA 4Z9LA 4IX3A 4CZTA 4U97A 1O6KA 4QQCA 5DWRA 2NNWB 2WTWA 4FK6A 4BCJA 4AX8A 3U6HA 2B53A 3V04A 5K4IA 5CS6A 4DA5A 1ZYJA 2VWXA 3FMJA 4I23A 5EFQA 4GV1A 3V8SA 4FGRA 3ITZA 5G6VA 2WOTA 3BBTB 2XB7A 4IAYA 4U79A 3R8VA 3D5WA 2YM6A 4R5SA 3VS3A 2JLDA 4PNKA 3DJ6A 4FUXA 3ZUUA 1HOWA 5ANGA 2WMRA 4WBBB 2PVKA 3GEQA 1XBBA 2W5HA 2IZSA 1LEZA 4HPTE 4JDHA 3D7ZA 4EH8A 1O6LA 3R73A 3L8VA 3LLAA 4IAAA 2BDJA 2I40A 2XCKA 4FMQA 4AS0A 1G8AA 1H27A 2FGIA 4FTIA 3OOMA 3IDCA 4G2FA 2PMNX 4KIKA 3POOA 4USDA 2YAAA 4ZOGA 3KMWA 1Q8YA 5CU4A 1P14A 4HCUA 5HE1A 1V0PA 2J0LA 2JDSA 4F7SA 4ZY4A 2OJJA 3IO7A 3F61A 4ITHA 2WELA 4IFCA 4BTKA 3GGFA 2QHMA 3SDJA 3Q4ZA 5C26A 4DFLA 4NK9A 2OIDA 4YJTA 2V55A 4BWXA 2ETRA 4JOAA 4XCUA 3A8WA 1OM1A 4R78A 4F9BA 4YBJA 1TQMA 4R3PA 3O17A 3CTHA 5HG5A 1IASA 1WBPA 2VTHA 1PHKA 3C7QA 3IGGA 4FTJA 5DBXA 3ZLSA 4CG8A 3QYZA 3EB0A 1CTPE 3T3UA 1UU7A 1SVHA 1PF8A 2Z60A 4BZDA 5HU3A 1UKHA 3I1AA 3VBWA 3G6HA 1P2AA 2XIRA 4WOVA 3EQFA 4F6UA 3C51A 5BX0A 2JAMA 4JDIA 4D2TA 5CEKA 4C4JA 4OAUC 1RE8A 4IAKA 3KREA 2VO3A 4J96A 4QMOA 5DG5A 3MY1A 3DXPA 5AADA 3FI3A 3FSFA 3IW8A 4TRLA 1X8BA 3FZ1A 4TTHB 4QP1A 5C1QB 1CDKA 4QMNA 3FMNA 2HYYA 1H0VA 4NZWB 1H01A 4RX8A 1PXLA 4X3JA 5KNJA 3GENA 2RKUA 4KRDA 2PU8A 4XH6A 5E1EA 2XK3A 1E1XA 4OT6A 1W84A 3CGFA 3ZS5A 4U3YA 2WMBA 3HV6A 3TT0A 1CKPA 5E8SA 5AV1A 2HELA 4BZNA 5HBJA 2B9IA 2VGOA 2NRYA 2XNGA 3RINA 3NDMA 4MD8E 4BCNA 4RJ7A 3NNXA 3OEZA 5FWKK 4JJRA 4FKWA 5GJDA 2O8YA 5AP1A 3PLAE 3EQDA 3E62A 4E4MA 3LJ2A 5J9ZA 1R39A 2BRHA 4FTLA 5CXZA 4FSMA 2QOKA 4IJ9A 3SVVA 1H8FA 2BHHA 5HORA 3ZDUA 3TIZA 4WNPA 2YIXA 5F1ZA 4DG2E 2ERZE 2V7OA 3EZVA 3Q9YA 2UW9A 3E8CA 3QHWA 4YTIA 5AV4A 5KMNA 3QFVA 4WHZA 4LYNA 3R02A 5CX9A 3T8OA 1PRYA 4HVIA 5K0KA 1PXPA 4WNOA 4X2FA 5BYLA 4RC3A 5L6WL 4F0GA 3WYXA 2XNEA 1GIHA 1IEPA 1GZOA 1JPAA 3RALA 2ZM4A 1YI4A 2YDKA 1Q4LA 1G8SA 4TY1A 5AEPA 2BHEA 4BZOA 4EYJA 5J1VA 3UNJA 4TKSA 2W4KA 4HYUA 4IC7A 3I0OA 1OKZA 4YJOA 3QF9A 5H3QA 2HZ4A 4EH7A 4O83A 1NT2A 3P7BA 3RKBA 4FC0A 3FY0A 4FV5A 5DHJA 3VUKA 2HY81 2B54A 2XZSA 3EFLA 4QP7A 4E1ZA 4F7JA 4IB5A 4KKGA 2GHLA 2YCFA 4S33A 2WB8A 3BGPA 4YMJA 3D7TA 2ZB0A 1IR3A 4XG2A 2VX0A 2IWIA 2VWIA 3PRFA 2P2IA 3UDBA 1SYKA 4A9SA 4A06A 4DLIA 3TDVA 4FEXA 2XNBA 4IWQA 5EW8A 4EH6A 4BDDA 5M08A 1SNUA 4XYFA 2DUVA 3H4JA 3MDYA 3NUUA 4F6WA 3ORMA 2VRXA 3QLFA 3R8MA 3MESA 5A4CA 3U6JA 2OI4X 5D7VA 5JGAA 4YC8A 4ANSA 3TUBA 1OIRA 3DQWA 3IGOA 1P5EA 2VV9A 4A07A 3EN4A 5C8MA 4AACA 4O7NA 4B7TA 5JH6A 4BBFA 1MUOA 3Q5IA 2X7OA 5L2QA 4U0IA 3TKHA 3RZFA 4Q9SA 3COKA 3CQUA 1OIUA 4ERWA 4F4PA 4WNKA 3D83A 5B2MA 5M4CA 1V0BA 1PJKA 2CN5A 4JQ7A 1FINA 3UGCA 4BDIA 1WZYA 3DOGA 3I5ZA 3UC3A 4C4IA 3CJFA 4CLIA 3CD3A 3NLBA 5IG1A 3KXNA 5IQCA 3VS2A 1UA2A 5M07A 4S30A 4EOJA 4ZIMA 4A4LA 3V8WA 2PVJA 5EK7A 4BDAA 4D1SA 4F99A 4NFMA 5EM8A 4YJUA 3KXMA 4HGSA 4HNIA 4V04A 1Y57A 3UQGA 1FVTA 5FGKA 5FQDC 3QRJA 2ITVA 5GZ9A 4N6ZA 3ZFYA 3LW0A 1U59A 3H9FA 5HX6A 3KVWA 4PTCA 4ZJIA 3R7YA 4KUJA 4I6QA 4TL0A 3VWAA 2J0JA 4D28A 2SRCA 4XG7A 4K8AA 4HVGA 3IW6A 2WO6A 2R3OA 3QX4A 4KIPA 4MQ1A 4XP2A 1ZZ2A 4FV8A 5FEDA 4B8MA 2C5VA 2CDZA 2JBPA 4BDCA 3FKLA 4IIRA 2CGXA 3P1AA 4AAAA 4IB1A 2XBJA 3P78A 4AW2A 1PKDA 1W7HA 4FBXA 4IX5A 4KS8A 4YSJA 4X3FC 3Q4TA 4RVKA 3R7GA 5HG8A 5E9EA 3HDMA 2CLXA 3VUMA 3ZLXA 3ZC5A 4C3PA 3LCSA 4FOBA 4LQMA 3ZH8A 3GXLA 3V5PA 5L8JA 3G0EA 2X7GA 4AE9A 4QTCA 4O0VA 3GCSA 4C37A 5M44A 2ITQA 4WG4A 2F7ZE 4O7TA 3DT1A 1UU3A 2C69A 4MXCA 3FE3A 4MXXA 3UODA 3M1SA 5CEQA 4AOJA 4ZSLA 2W1EA 4OR5A 1ZOGA 4GRBA 5KBRA 4BICA 2E9NA 2BTRA 4IZAA 3CC6A 1DI8A 5AR4A 4RVMA 1O6YA 2XVDA 3PJ8A 3U4WA 3MH3A 3KC3A 4O1PA 4HGEA 4KNBA 2YM4A 3OEFX 4MXOA 3FWQA 5ETCA 5DGZA 3NAYA 2P55A 2FB8A 3UC4A 1Y6BA 1OB3A 4X7QA 1BI7A 2BKZA 2WQOA 3GB2A 3POZA 3R04A 4FSUA 4KBKA 3PJ3A 4L67A 5BNJA 4DAWA 1M17A 4FZDB 1OUKA 2B4SB 3HV3A 4B8LA 2R4BA 2KULA 3F5XA 1W83A 2F7XE 4O27B 4F9AA 3D5UA 4RFMA 4Y85A 2FVDA 3VIDA 3BI6A 5L6OA 3DBQA 4O6LA 4DGMA 3BHUA 3JYAA 5KMOA 4O7RA 3MIAA 4BBEA 3NNUA 3FHIA 3AT4A 3MV5A 4DFXE 2QLUA 2R0UA 5ACBC 4EI4A 3OTVA 3DFCB 3L1SA 5BUEA 3TNHA 1NVRA 3WIGA 4C61A 1OL1A 4GS6A 1T45A 4YLKA 2YIRA 3F82A 4D2WA 3AT2A 3DQXA 3W32A 4I3ZA 3CTJA 4LL0A 5CU2A 3PPKA 1OL5A 3CGOA 4EK4A 4FEQA 4R7BA 2EXMA 5AA9A 4FNXA 4X3FA 3S00A 3OWKA 3R8LA 5AP0A 3MTFA 4CG9A 5IPJA 3AQVA 2EB2A 3DNEA 5BVOA 4MKCA 4EWQA 5D10A 4MTAA 4WT6A 3P4KA 5AAGA 4IACA 2C68A 4TN6A 3LKMA 4GU9A 4D2PA 2BMCA 5AUUA 3BX5A 4BIDA 5BMSA 3A7HA 4GT3A 3NMUF 4XG6A 4YO4A 3OCBA 3FC2A 2OICA 5DLSA 3IG7A 3TIYA 2UZVA 3C4ZA 1H1QA 5LVPA 5K3YA 3FMDA 3HP2A 5LQFA 4O0SA 2WTVA 4QNAA 4TWNA 2J50A 4NSTA 5BVWA 5T3QA 3VS5A 1H0WA 4ENYA 4AQCA 2R3MA 5IU2A 3D94A 5L3AA 4FEVA 3EYHA 4YTCA 3ZDIA 1A9UA 4FZ6A 4PMMA 4PDYA 2NP8A 3C4CA 4ASDA 4E3CA 1IAJA 5DT0A 1HCLA 1VYWA 2CKEA 2YABA 4QQJA 3QD0A 4YZDA 5F4NA 1M14A 3G33A 2ZM3A 1VR2A 4MWIA 4FX3A 3HNGA 3KRLA 2E9OA 5IH4A 1FMOE 1ZAOA 5KE0A 3TXOA 2REIA 2QURA 4RLKA 5AV2A 4DH5A 4NL0A 5LVNA 3LE6A 2FO0A 4PL4A 1XH6A 2OWBA 5FXSA 2C6LA 2E9VA 4NJDA 4HW7A 3O8PA 4XOYA 5EM5A 4P2KA 4AZSA 4H39A 2XNMA 4IQ6A 4OBOA 2ETKA 2H8HA 2QKRA 3UZRA 3N4UA 2PZIA 3F5GA 1UU9A 2GSFA 5HQ0A 4ZK5A 1UWJA 3MPAA 4CFNA 2CGVA 4DEIA 2W1ZA 5HOAA 4YHTA 2XKCA 5A46A 2J7TA 2C5NA 5C03A 3P7CA 5E8YA 4ZTRA 3THBA 3NSZA 2GTMA 4NEUA 5ETFA 1H07A 5J9YA 3EL7A 5B7VA 4FNZA 4WO5A 5EI6A 3BQCA 4O0WA 4ZTQA 4OTDA 5CF6A 2YA9A 3R30A 3QKLA 4AGUA 2VTNA 4RIYB 2VTIA 4D2RA 2EVAA 1G3NA 2VN9A 3LJ1A 4AZEA 2XS0A 3VQUA 4PQNA 1JKKA 4YZBA 3K2LA 3KXXA 1PMVA 4H05A 2GDOA 4JIAA 3Q3BA 4LI5A 4EK5A 3BYMA 4LL5A 1W98A 3OCTA 3SXFA 2YAKA 2W7XA 5JFVA 3QYWA 3CEKA 3MY5A 4YPDA 3VUIA 2C47A 3B8RA 4NWMA 2XNNA 4RFZA 4CQEA 5FBNC 1L8TA 2QU5A 3ENMA 4GJ2A 3KF4A 4O21A 4GL9A 3A4OX 2B1PA 2CKOA 5EYMA 4FEWA 2FUMA 4L7FA 3PY0A 3TV4A 5FUTA 1H1SA 1OUYA 4BCQA 5HNBA 4BTJA 1O9UA 3R83A 3ENHA 1XHAA 3BWJA 3GBZA 4GYGA 4AFEA 2C6TA 4IBMA 3PXKA 2XF0A 3FZSA 3QZFA 3BU6A 4ZTHA 3OFMA 3IQ7A 4Y5QA 1BMKA 3P5KA 4C7TA 4XV9A 1DI9A 4XV3A 1H00A 4L9IA 2QOOA 1MRUA 3WI6A 2BRMA 2WKMA 3WOWA 3TUCA 3QUPA 4AOIA 4DEBA 3DFAA 2WZJA 4D1XA 1MQ4A 3W1FA 3KXGA 4ZSEA 3HV7A 3TCPA 1FMKA 1QPCA 1R0PA 1R78A 3V01A 4FSTA 4H3BA 5AX3A 2A1AB 4FKLA 4GFMA 3EYGA 3IW4A 4L52A 4J8NA 5LVOA 5IQIA 4TNBA 3WE4A 3UMXA 5IQHA 5AR3A 3EJ1A 4A9UA 5F9EA 2CN8A 2UW3A 4FUYA 4ACCA 4FSNA 4EOKA 3D4QA 1T46A 2X39A 3BV3A 3R9HA 5CSXA 3MPTA 4OTRA 4EOLA 4FKIA 3PWDA 5HD7A 3MFSA 5AUYA 5HU9A 2G2IA 4ACHA 3KFAA 1YI6A 4HCVA 3QGYA 4II5A 4M97A 4ASXA 5J5SA 1Q97A 3DS6A 3R28A 5CAVA 3QWKA 5D41A 2CPKE 4HCTA 4BCMA 5FDXA 4D58A 2B55A 2PSQA 3FMLA 2O0UA 3KMUA 1YXUA 3CQEA 3LZBA 5CEOA 4EONA 3PE2A 1G5SA 2QO7A 2YLEA 3O0GA 4R7IA 4YGAA 4AN9A 4E73A 2IO6A 2ZAZA 4W8DA 4AA0A 3F69A 3LFBA 2JEDA 4DEGA 4J7BA 2Y4IC 5IF1A 4CNHA 2VWYA 3L9MA 1FQ1B 3JY0A 1JWHA 2ZV2A 4JDKA 4U41A 4IWDA 5CEIA 4O86A 1OITA 4XMOA 5ANOA 4DFZE 4RQVA 2BILB 3CJGA 4HYHA 5CENA 4FG7A 2A0CX 2V5QA 3ZEPA 3FPQA 3ORLA 4IVBA 4OTGA 4KBAA 1DAYA 3NUSA 2HIWA 2XA4A 1Y8GA 3QWJA 3FDNA 3DY7A 3U4UA 4QMYA 2WAJA 3ZOSA 3GC7A 3PIXA 3ZUVA 2XK6A 2AC3A 2VWWA 3RK5A 3SOCA 3VF9A 3CTQA 3OWPA 5ACKA 3KGAA 4IHPA 4XS2A 3QGWA 5C8NA 2I0VA 3VW6A 2PVNA 3QRTA 3CPBA 3V8TA 2CCIA 2FSLX 2HW6A 3OWJA 2VU3A 3OUKA 1AD5A 5L2SA 3PLSA 4A7CA 2F7EE 1H08A 4GKHA 4M15A 4GFGA 3MTLA 5JRSA 1H1WA 1TKIA 2E2BA 2R3JA 3LXKA 2VZ6A 3S95A 3PDTA 1QPEA 2ZMDA 5IQDA 3BQRA 4ZTSA 4C3RA 4MNEA 4FV0A 4BKZA 2V0DA 5J79A 4FV7A 4CTCA 4GT4A 3OWLA 4A4OA 1LEWA 4W4WA 4BL1A 1PKGA 3B2TA 4CSVA 5CNOA 5E1SA 4AT3A 3HUBA 5DI1A 4D4VA 4CCBA 2P33A 3Q4CA 4YBKA 3FAAA 3ODZX 4OTIA 1SM2A 4QYFA 4DF3A 2OO8X 5L6PA 5KBQA 3RM6A 3PXFA 3QTZA 4OTWA 1ERKA 5K5XA 4FKVA 4RA4A 2EU9A 2X7FA 3TTJA 3WYYA 5CQWA 3BU3A 3PG3A 5HIDA 1J3HA 4I0RA 5I9WA 4LRMA 3VUGA 3ALOA 5IUHA 3Q52A 3L8SA 4F0IA 2H34A 4FSQA 2BR1A 4AFJA 3MY0A 3NYVA 4EJNA 3DDPA 1S9IA 4ASZA 5IMEA 3BHYA 4EOMA 5M09A 3Q9XA 4BIEA 5HLPA 2F49A 3BLRA 2G2FA 5CF4A 3CD8A 4N6YA 3HZTA 3G9LX 2HZNA 2KTYA 5JRQA 2OZAB 4BDFA 4FV4A 1V0OA 4FR4A 4U7ZA 5EM7A 4QP3A 2IVTA 5GJGA 4ZEGA 3MB7A 2XJ2A 3RPOA 3ZM9A 5IA0A 4YPSA 2WMQA 3MA6A 1Q5KA 4FSWA 4IEBA 3VS7A 2X9FA 3PE1A 4RLLA 4QMPA 2JFLA 2X0GA 5DR6A 4RJ6A 3ORZA 4L43A 3HMMA 2PL0A 4YURA 1VEBA 3KB7A 4HPUE 3PXQA 5KUPA 3HGKA 3ZM4A 2C30A 1DAWA 4KRCA 3OW4A 3Q6WA 2QHNA 5A4EA 4MX9A 2OFUA 3VQHA 3P0MA 1GZKA 2BVAA 3NWWA 3N9XA 3PG1A 4QMTA 4QO9A 5H2UA 3F3UA 3TJDA 3AD6A 3C4FA 3G51A 3N51A 3FXXA 2ZM1A 3A7IA 1ZYDA 5A14A 3BIZA 4G16A 2JBOA 2JDRA 4ACMA 2Z7RA 4RIWB 5CSHA 4CGAA 5AAFA 2XYNA 4W9WA 2PMIA 2OU7A 5JFWA 3UP2A 2YM3A 4GUBA 5K4JA 4D4RA 3LQ8A 5J5TA 3C1XA 4U44A 4DEDA 4L7SA 2WTKB 2VTPA 3GCPA 4AA4A 3ZRLA 3K5UA 3LFEA 2PY3A 5EYDA 5AP3A 5GZ8A 4YC6A 2XK7A 5AIRA 2R7BA 4RC4A 4AWIA 2R0IA 3JPVA 1IA8A 3Q04A 1J7UA 3GU5A 3AGLA 4RT7A 4BKJA 3C0HA 4DN5A 4AE6A 5FM2A 3R9OA 1H28A 3HVCA 1WBSA 5A4LA 2ITPA 5LOHA 5IQGA 4AW5A 3R7UA 4C33A 4FGBA 4FOCA 3VHKA 4I0SA 3I6UA 3QC9A 3DGKA 2V62A 3AMBA 3GC8A 5EG3A 3DTWA 1BUHA 3W33A 3LFDA 2PULA 3TNIA 3ULIA 4HVHA 3ZSHA 4ZMEA 2WEVA 3OG7A 2BAKA 3Q9WA 4QP4A 1YI3A 2RFEA 3II5A 2ITTA 4RVTA 2IZUA 4QP8A 4V0GB 5HGIA 4F63A 4GEOA 4BR3A 2VTMA 3R7VA 1J7IA 1Y6AA 2R64A 3D5XA 1ZOHA 2UZBA 5FTOA 3RVGA 2XKFA 4FA2A 4CLJA 4DC2A 5IA4A 2QOLA 1WBVA 4BDBA 1YDSE 5E4HA 2RG6A 5EI2A 3TNPC 4BI2A 1PXOA 4L53A 5DNRA 5A6NA 3UO5A 4FTMA 5AX9A 2XH5A 3W18A 5AP2A 4ANBA 5ICPA 3SXSA 5AV3A 5EQYA 4NUSA 2W99B 4R1YA 3TNWA 4Y46A 2C1BA 3BLHA 2X6DA 5CEMA 3PFQA 4PPAA 4EH4A 4B0GA 3QX2A 1PXIA 1PXKA 2CHLA 2VTSA 2VTTA 3QUEA 3ORTA 5KKRC 3UZTA 4FTKA 2R3LA 4I24A 3PXZA 5A6OA 5CAPA 3CR0A 2ZJWA 3UNZA 2NO3A 2GCDA 4BDJA 3LVPA 4MBJA 4QTBA 3KRWA 3U6IA 3PSBA 2B0QA 4N70A 4CV9A 4FKUA 3TACA 1M2QA 3AC5A 4G3GA 1PYEA 4RWJA 3RPSA 4RX5A 5I3OA 4ACDA 4GK2A 4KKEA 5HTIA 4K2RA 2ZDUA 4O0YA 4IAZA 5IUIA 4I93A 4D2VA 1GZNA 5JQ8A 4BGHA 4YZCA 3G0FA 2YWVA 1V1KA 3ZBFA 3SXRA 3WBLA 4EHGA 4FV2A 3FBVA 2BKKA 1Q41A 1MP8A 1Q99A 2BUJA 2VX1A 5KMKA 3GT8A 5EM6A 4XBRA 4B4LA 5LVMA 4M13A 3GU7A 3M2WA 4YJPA 4EK3A 3S4QA 5E8WA 2VTAA 4H1MA 3PTGA 4EH5A 2C5OA 4C0TA 3FZTA 3F9NA 3FHRA 3JS2A 2DQ7X 4J99A 4B6LA 4C34A 5HE0A 4FSZA 3DV3A 1K9AA 2P0CA 4MXZA 3ULZA 2GNJA 4M7IA 4IM2A 3DBEA 2HENA 4QQTA 3QTWA 5FRIA 3R0TA 3GP0A 4Q5HA 2XNPA 3SD0A 4E4XA 4CMUA 3C5UA 1FVVA 5LXMA 4JT3A 3JUHA 4DFYA 3R7EA 4GJ3A 4KB8A 1I44A 1NVQA 3WF7A 1BLXA 4AZFA 4YSMA 5JGDA 1OKWA 4JIKA 2GHMA 3FZPA 4QMZA 4IB3A 3AC3A 4UALA 1FGIA 4JQ8A 4FEUA 4BFMA 2O3PA 2XCHA 4ZP5A 4IM0A 4EC9A 4NJ3A 5HNGA 1OKYA 3QAME 3BKBA 4F70A 1PMEA 2H9VA 2VUWA 1YWRA 4O1OA 3U8WA 2UZWE 3LPBA 4FT0A 1JKLA 3WZJA 3CCNA 4BRXA 4DITA 3U9NA 3LMIA 5HE3A 1QPJA 4I41A 5AM6A 5M4UA 5I9ZA 2YISA 3DBFA 3R1SA 2BZJA 4FIHA 4U42A 3EQCA 5CU0A 3HRFA 3PVBA 3CY2A 5GIPE 3D5VA 5IQEA 1JOWB 3V5QA 3MGYA 4L00A 5L8LA 4YZNA 1OGUA 3A61A 5HO8A 5CLPA 2F4JA 3RNIA 4EH9A 3A7FA 4L3JA 2PWLA 5IEVA 3NW5A 2GFSA 4J95A 3RPVA 3DK7A 3ZONA 2XIZA 4TT7A 2GPHA 3EWHA 3Q2MA 4RX7A 3QRUA 3KKVA 4BDEA 3EL8A 5I9XA 4XLVA 2VWUA 4C59A 4H36A 3IPHA 4AZVA 1YXSA 4QP6A 3Q6UA 5E8TA 4EL9A 2I0YA 4G6OA 3ROCA 2YLFA 5KKRB 3O96A 4UV0A 3C50A 5ETAA 3RAIA 4EUTA 2BAQA 1UU8A 1VJYA 2R3QA 3E7VA 4G3CA 4BCIA 3GVUA 3G5DA 4ANLA 5CTPA 3OZ6A 3VJOA 3QQLA 3BYUA 4O0UA 4AW1A 2YIQA 4CRLA 4UMPA 3GI3A 4R3CA 5TOZA 4WNMA 4MBLA 1LR4A 4ZLOA 4BY9E 4M67A 1W0XC 4GYIA 3QQKA 3QBNA 4FKSA 5LWNA 1I09A 3Q53A 2J5FA 3KVXA 4FVQA 5ITAA 2VTLA 2OFVA 3PVUA 4BCPA 4WD5A 3BYOA 4UXLA 5CT7A 3UP7A 2WQNA 3H3CA 4JR3A 5D1JA 3FMKA 3H9RA 2YZAA 4N4SA 3R8UA 4PPCA 3R7OA 5L2IA 4AZTA 3B2WA 4JI9A 4JRNA 3HV5A 2VO7A 4ANQA 3BCEA 4YU2A 4WG3A 1GIJA 4R5YA 5LJJA 4AT4A 2XK8A 3QKKA 2WFYA 3TZ7A 2WTIA
chains in the Genus database with same CATH superfamily
5M51A 1UNLA 1ZZLA 2Y6MA 5CVFA 2WU6A 3L9LA 4OT5A 2GQRA 1BI8A 4JLCA 4PP7A 3KU2A 4KSPA 4WRSA 4PL3A 4W9XA 3BPRA 4C4GA 4DCEA 3EOCA 2IN6A 3F7ZA 4DINA 2HK5A 4F1MA 3ACKA 5KMLA 1M7NA 4G5JA 4XG4A 3BYVA 5CNNA 5L4QA 4NFNA 2QO9A 4PNIA 1XH7A 3A2CA 3QD2B 4RX9A 2WMAA 1QMZA 2Q0NA 3TWJA 3WF6A 1BKXA 2OZOA 3BRBA 1YQJA 1U5RA 2IW6A 3ZRMA 4WUAA 3QA0A 5LMAA 3FLQA 4FT7A 1ST4A 4XX9A 4ZY5A 2W5BA 3W0NA 5DR9A 4EH3A 3IECA 3DU8A 4EK6A 4FTQA 2PHKA 3EHAA 4BDHA 4EH2A 5KX8A 4UN0C 5CAOA 4ZJJA 4R7HA 5LARA 3ZRKA 1XO2B 3C13A 4MAOA 4PPBA 4CTBA 5HVKA 3BLQA 2JAVA 3LCDA 4M0YA 3C4EA 4RSSA 5ANDA 1ZWSA 4PY1A 5ANJA 2YCQA 3V5TA 5HCYA 3E8DA 4CFUA 4M8TA 4UZDA 5CZHA 4F9YA 2UW7A 2PE1A 4DGNA 4DH8A 5L2WA 3LJ0A 4APCA 4Y95A 2CGWA 4YJNA 3AD4A 3PRIA 4XV1A 3UVQA 4ZSAA 2B52A 2PVFA 1RJBA 3SX9A 3FEGA 4QDEA 4BR3A 4ITJA 1OIYA 4G17A 4D4SA 3UIBA 4CFWA 3LFFA 4LV5A 2IG7A 3TZ9A 3NZ0A 2CMWA 3EZRA 3MJ2A 4QOXA 4TYHB 1ZYLA 5DT3A 4AOTA 3ATTA 2WQEA 4OBPA 4GT5A 3ZSIA 3IONA 2FSOX 4GVJA 5HIEA 4KWPA 4U9AA 2X0PA 3KULB 5GHVA 2JKKA 2RL5A 1LPUA 3UPZA 4WA9A 5A3XA 3W55A 3NCZA 1OZ1A 3R22A 3N4VA 3ALNA 4RZWA 3RI1A 3PFYA 3OC1A 5JFSA 5D12A 5B2KA 5CZIA 3UO4A 3NYXA 1P4OA 3PP0A 4P5QA 3BE9A 2GNLA 4P7EA 3FJQE 1B38A 4ZZOA 2ETMA 4V05A 3BHTA 4D4YA 5IQBA 4X6RA 3QZGA 2PVRA 1F5QA 3H9OA 3KCFA 1WVWA 3RJCA 2JITA 3R9RA 1STCE 4EOOA 2HWOA 3LXNA 3MVJA 4Z3VA 5J87A 3OT8A 3PJ1A 3QD4A 4AGWA 3DPKA 3PJ2A 4LGHA 3W8LA 3EIDA 1Q61A 5LMKC 1CM8A 4I4FA 3P79A 3W0SA 4BI0A 1BYGA 3MSSA 3BGZA 1PW2A 3UOKA 1U46A 1LUFA 2XMYA 5H8EA 2XBAA 4RQKA 5GJFA 3FV8A 3EKKA 4EHEA 4ANMA 1R3CA 2GFCA 3ZXTA 3ZZWA 3E87A 4O0XA 5BVKA 3PIYA 2UW8A 1YOJA 1WCCA 1K2PA 3MBLA 3SOAA 4DEEA 3LQ3A 1GY3A 5JKGA 4WIHA 1GAGA 4HJOA 4CFFA 4LFIA 4UYAA 3QTQA 2XM8A 2R7IA 2ZB1A 3RGFA 2GNFA 1AQ1A 3OY1A 1YHVA 4IZ7A 4C8BA 4XV2A 3D2IA 3CLYA 5DRBA 2LAVA 3R9NA 3DXQA 3MVMA 2PZPA 4QTEA 4LMUA 5KHXA 3P86A 4FODA 3ZHPC 5M06A 3UQCA 2W1GA 3Q4UA 4CEGA 4FL2A 3P08A 3C0IA 2B9HA 1JLUE 2GMXA 2PZ5A 3AC8A 2XRUA 3NYOA 3OHTA 4U81A 1YXTA 5DRDA 5E8ZA 4QPAA 2W9ZB 4NM0A 1TQPA 3ZO1A 2CKPA 2W4JA 3E8NA 4DDGA 3DZOA 4R8QA 4GUEA 3NAXA 3P9JA 3C5IA 5F94A 4Q9ZA 2Y8OA 3NRMA 4C02A 1OBDA 2ZV7A 4NCTC 2Q0BA 4QMLA 1MRVA 4FZAB 3RWQA 2HY0A 2W17A 3FLYA 4NTTA 4P5ZA 3HA8A 4D0XA 1B39A 3VAPA 4IDVA 2JFMA 1ZMUA 1UKIA 4GSBA 4EQMA 3DBDA 4NW6A 1IG1A 5BYYA 2X2MA 3TYKA 2EXCX 1FBNA 3GU8A 5CU6A 3UE4A 3UNKA 1Q8WA 5FXQA 3K3IA 4YHFA 1WBTA 4FF8A 4UY9A 3PVGA 4EKLA 2OGVA 4RIYA 4MHAA 3UDTA 3K54A 3HP5A 4F6SA 3WILA 2UW5A 2E9PA 2ZV9A 4FIFA 1OI9A 2PMOX 4L42A 4HNFA 4O0TA 4F9CA 2HW7A 1PY5A 3FXWA 4BIBA 1H4LA 2G15A 4OTQA 4QMWA 3FQSA 3PWYA 5CT0A 5LMKA 2Z7LA 2EWAA 5M57A 4BBMA 4BCHA 1P4FA 5FTQA 1JKTA 2ESMA 3HMOA 2B9JA 4DGLC 4DFBA 4YJQA 4G3DA 5FP5A 3O8TA 1ST0A 2I6LA 2WQBA 4EBWA 5B2LA 3W2PA 2BZIB 2A27A 5AMNA 5CYIA 4ALUA 2BRNA 2ITXA 4RJ5A 3W2SA 4O81A 3ZU7A 3L8PA 5EQPA 2UZLA 1GIIA 3HKOA 3LFAA 3EQRA 3VRYA 2W1FA 4QYYA 2CNVA 1CMKE 1ZLTA 4OTFA 5IH6A 1NY3A 3E88A 4FZFB 2H96A 1XWSA 4IAIA 4RFYA 4E20A 1YDTE 4MD9E 1XQZA 4Z7GA 3OP5A 4CT2A 3QTSA 4G5PA 2WMSA 4Z55A 4NKSA 4H3QA 1OL7A 3RPRA 4Z16A 3AOXA 4O96A 2V22A 1ZYSA 4HZRA 2RFDA 2VTOA 5DEWA 3ZUTA 4EC8A 4L01A 4RMZA 2QOBA 3TG1A 2X0QA 4AXAA 3NUXA 4PDPA 2QONA 3Q60A 2XJ0A 3VJNA 4MXYA 2EB3A 3ZTXA 4KS7A 2ZVAA 4FKGA 4XG9A 4MNFA 3KRRA 1NVSA 4Y73A 3FI2A 2G2HA 4M84A 3UG2A 2ACXA 4NCTA 1JSUA 2J5EA 2HZIA 2Z7QA 3NUYA 3QC4A 4G9RA 3L9PA 4GVAA 2J0IA 5CY3A 5HG7A 1YKRA 4CQGA 4D1ZA 3H30A 5TT7A 5DR2A 3OF0A 4JRVA 4UX9A 4FZ7A 5DA3A 5HBEA 1PMUA 1REKA 1GOLA 3VRZA 4TWPA 1XR1A 4NIFB 4C2WA 2C5YA 4FG9A 1U4DA 1W2DA 3T9IA 2IPXA 3CPCA 3QRKA 3UJGA 3NEWA 1SZMA 4CYIA 4CCUA 3FLZA 3UOHA 2JGZA 3PA5A 4X2JA 3F3TA 3NNVA 5J7HA 3QQJA 3NFFB 3E3BX 2DYLA 4EOPA 3PA3A 1Q3WA 2Y7JA 4UEUA 3QRIA 2BROA 5AR5A 4NM5A 3V5LA 4E5WA 4USFA 2WIHA 3EN6A 2O2UA 3TZ8A 5KMIA 4I4EA 4GIIA 4CV8A 3CIKA 2A2AA 4FL3A 4OGRA 1RW8A 1M2PA 4ZTNA 4M69B 2YZLA 3ZC6A 2OIBA 3QQHA 4L46A 5DFPA 3ETAA 3PSCA 3TEIA 1H26A 4WRGA 3GU4A 3UTOA 4F65A 4RA5A 5AFVA 5CVHA 5BQ0A 3OT3A 4S32A 4M0ZA 5AUVA 4I5CA 1L3RE 1OVEA 4AAYA 3NFGB 4O38A 4UWCA 5HVYA 4EKKA 3C4WA 2RFSA 5IZFA 1PXJA 2FSTX 5HESA 3SRVB 3VF8A 3KXHA 3E5AA 4DLJA 3MH1A 4J1RA 2GQSA 1UWHA 5FP6A 4DCAA 3RTPA 1Q3DA 4YZMA 1M2RA 1KE8A 1PXMA 4MCVA 1XBCA 2UW4A 4GFOA 3RPYA 4KA3A 3VBVA 4C38A 5CAUA 5KO1A 3FLNC 3GCQA 4FKOA 4JQEA 4LG4A 4BGGA 2HAKA 5JFXA 5DEYA 4O6EA 3BHHA 4I0TA 3MIYA 5DPVA 4Y8DA 3JVRA 2F9GA 3LM0A 3NPCA 1CKIA 2QC6A 4IW0A 4BI1A 5IDNA 2FYSA 4NKAA 4YLLA 1F3MC 1KE6A 3MH2A 4FSYA 2AC5A 5EHOA 4AG8A 1KUTA 4QD6A 2ITUA 3CE3A 3CKXA 2R9SA 4O7LA 2WTKC 1J7LA 2BRBA 2VTJA 3COIA 3GU6A 5AUTA 5FBOA 4J53A 4DBNA 3FLSA 2BIYA 3NGAA 4S2ZA 3UG1A 4RIOA 4F9WA 5BVNA 4AXCA 3NVKI 2G1TA 2JD5A 4OTHA 1XMMA 1VYZA 5HLWA 2RG5A 4YHJA 4Y72A 4UMQA 4ZZNA 3VVHA 3HUCA 2OIQA 1U54B 4IXPA 5AR2A 5DMZA 4ZS4A 3F2NA 4P4CA 3R6XA 3RK7A 2PTKA 4O2PA 3EN9A 1LP4A 2GU8A 5CANA 2ITWA 4TW9A 2XIXA 3WZEA 2OXDA 5IA3A 3KY2A 3NR9A 3I0QA 4FKPA 5A4TA 4MD7E 3PY3A 4FTTA 1Q8UA 3KIOC 3FLWA 3F5UA 4QYGA 4O7YA 4CVAA 4PTGA 4HGLA 2R3RA 4I6BA 3TM0A 1IRKA 2J0MB 2OZAA 2FSMX 4DH1A 2QO2A 3VBYA 3L8XA 3TL8A 4QP9A 4ZTLA 1NA7A 3VUHA 1JBPE 3DTCA 4F0FA 5JEBA 3BYSA 3EQIA 3DB6A 1W8CA 4QMUA 3RAWA 5AP7A 3RM7A 3ZFXA 4CMOA 5JK3A 3M11A 4IVAA 4BWPA 2C0OA 1JVPP 3EFJA 4QP2A 4XNEA 3W0PA 4Q5EA 3CKWA 4HVDA 2VAGA 5AUXA 3B8QA 3QCXA 1CKJA 2PE2A 3TJCA 1OIQA 1W2FA 5TKDA 3PUFC 2LGCA 3FYJX 3LFNA 2VO0A 2V7AA 3O7LB 4BVUA 4ZLYA 3RZBA 3IW5A 2C0TA 4UZHA 2ITZA 1YXXA 4FTNA 5AP5A 4Z7HA 3SG9A 3LXPA 4K18A 4D9TA 5GIOE 5DT4A 1H25A 4X2KA 4LMNA 4E93A 5BMMA 4RIWA 3FY2A 3GCUA 4FE2A 4PUZA 4CZYB 5HHWA 4B99A 3FPMA 1ZOEA 4BWKA 2OXXA 2YCSA 3E64A 3EQBA 5IUGA 4GH2A 4O7VA 4LOPA 4L3LA 4AQKA 5EOBA 4R6VA 4QMVA 4LUDA 4FNWA 1WAKA 2UZUE 4H3PA 4W4VA 3RHXA 3UDZA 3AG9A 3F2RA 3F2AA 3FMEA 4TPTA 4E6DA 3W0OA 1OMWA 2F2CB 5C27A 5E91A 2QLQA 4JBPA 3R2BA 2YDIA 2YIWA 2WOUA 3R01A 5AIKA 5AR8A 3EN5A 3MVLA 3AT3A 3DNDA 1EH4A 4DFNA 5FDPA 1TVOA 3D9VA 4CKRA 2CCHA 4UMRA 5AR7A 5F20A 3QQGA 2CSNA 4U45A 4W4XA 1YW2A 4L45A 5HTCA 1Z57A 1MRYA 3GFWA 4IDTA 4JBOA 3CSVA 3W0QA 3LFSA 3IDPA 2QOCA 1DS5A 4QYEA 2BDWA 4RJ8A 5LVLA 5BPYA 4G6NA 2IVUA 4O7WA 4V0GA 2ERKA 4ZZMA 4QPMA 3R1YA 4LRJA 3VBQA 2WNTA 4EQCA 4C4HA 3HRCA 4RIXB 4ALVA 2WMXA 3QTIA 5E8UA 2BAJA 3DLZA 5EKNA 2F2UA 3WZDA 4C4EA 4X2NA 2CKQA 2E9UA 3W16A 3DAJA 1Q8ZA 3FI8A 4NTSA 2W9FB 4MYGA 4TYGA 4BB4A 5E92A 4M3QA 2UZNA 3DBCA 1IAHA 1REJA 4OLIA 4NU1A 4UWBA 5I4NA 4XUFA 1XKKA 1PXNA 4DEAA 1SMHA 4IX4A 3G9NA 4LV8A 4AU8A 2Z2WA 1WBNA 4GMYA 3ORKA 3BELA 3ZMMA 4CD0A 4ZTMA 1FGKA 2OJ9A 3OROA 3LFQA 3NW6A 2R3PA 3G90X 4X21A 4DBXA 4FV1A 3RAHA 4FIEA 4CFXA 2R5TA 3UIUA 3AMAA 3R21A 3RWPA 3ZFMA 4G3EA 4QEBA 4N0SA 3VHEA 4CKJA 4XRJA 4H1JA 3MWUA 3SC1A 4J52A 2GTNA 2C6IA 2HZ0A 5J8IA 5DOSA 1J91A 4NT4A 3O2MA 3KA0A 4O2ZA 4U6RA 1E1VA 5HCZA 3VC4A 4UMUA 4JNWA 4O4FA 3LAUA 4K9YA 4BYJA 4YJRA 4W8EA 5L2TA 4BF2A 2I7QA 2R3FA 4DTAA 4D5HA 3QA8A 3MI9A 3DAKA 3A62A 1YXVA 3OMVA 4E8AA 2X1NA 4PV0A 3GFEA 1ATPE 2Y0AA 4G31A 3VULA 4A4XA 2W06A 1Z9XA 2W0JA 3CY3A 4JXFA 4N57A 1XH8A 4FVPA 4NM7A 4YJVA 4ZJVA 3FYKX 2BIKB 5M55A 4DTKA 1JSVA 4FT5A 2JKOA 2X8DA 4ONAA 4R77A 4JAJA 1SVGA 3BV2A 4J98A 2C3JA 3IW7A 4JG6A 4O0RA 3W2RA 4MF0A 1Y91A 3ERKA 3LIJA 4BN1A 3MFTA 2JKQA 3E8EA 2C1AA 2XYUA 3D0EA 3DCVA 2R3HA 4CT1A 4HZSA 4WUNA 3W10A 2X2LA 3HAMA 4I5HA 5DE2A 5HO6A 5IH5A 3G15A 4AXDA 3PP1A 4BCGA 3PPZA 4O4CA 2DS1A 2O5KA 5AM7A 3UYSA 4CFVA 1J1CA 3R7IA 4C58A 4EZ5A 3V5WA 4AN2A 2IW9A 1Q62A 1H1PA 4JG8A 4G6LA 4F09A 1KV2A 2O64A 5IEXA 4TYJA 2J9MA 1OECA 4EORA 4R3RA 4FT3A 4E4NA 5FD2A 2C6EA 2P4IA 3TKIA 3HAVA 2JIIA 4FICA 2VWZA 5E90A 5FM3A 2H6DA 4USEA 4KIKB 2QOQA 5KZIA 4ZY6A 3LMGA 3ID6C 4DTBA 2UW0A 1A06A 2YDJA 4X6QC 4F08A 5M56A 5D7AA 3ORXA 4LGDA 4BGQA 4GKIA 2QG5A 4OUCA 5HBHA 5M4IA 5AA8A 2QOHA 3RK9A 3PIZA 4I92A 3PXYA 2HXLA 5HVJA 3FL5A 4MEDA 4FYNA 3DAEA 4GK3A 4O22A 1URWA 4HOKA 4FNYA 5EW3A 3JR1A 3QL8A 2NRUA 4PMTA 2Z02A 4O4BB 2RGPA 5AAEA 2WMVA 2X2KA 3LM5A 2OF4A 5AWMA 4BHNA 1UV5A 4MK0A 3OTUA 4IM3A 3ZSGA 5JSMA 2XEYA 4RWLA 2GNHA 2YEXA 3I6WA 3E93A 3F7WA 1W82A 3RP9A 3U51A 2CNQA 3I5NA 4L68A 2X8IA 1BL6A 3R63A 4ASEA 3FL4A 3KK8A 4RJ4A 3EQGA 2VWVA 4EQUA 3AGMA 3Q96A 1UNHA 5IISA 1ZMVA 2VGPA 5HEZA 2W1DA 3BE2A 3O51A 5EW9A 4GK4A 3RAKA 3R9DA 3MW1A 4FV9A 4DH3A 4EBVA 2RSVA 4J97A 2UW6A 2JDOA 2C6MA 4AA5A 4U8ZA 4CYJA 4I6HA 2IZTA 1M52A 5B0XA 3TV6A 4DDIA 3UIMA 4C57A 1GJOA 5AJQA 1WFCA 4ZS0A 5JQ5A 2WTDA 4RZVA 2JDTA 3FQHA 3WE8A 4KKHA 4O84A 4M12A 1FPUA 2QNJA 5AV0A 2JKMA 1GNGA 2GS2A 4K33A 3CXWA 3DKCA 4NYEA 2QODA 5LCJA 4KIOA 4MVFA 3Q9ZA 4QNYA 5HD4A 4DFUA 3WF5A 1YRPA 3AC4A 3DDQA 2C6KA 3MS9A 2IW8A 4YTFA 4QDVA 5C9CA 4UWYA 4KD1A 1AGWA 3D14A 2C3KA 2WMUA 3DK3A 3E7OA 3OXIA 4XEYA 5M53A 3LMHA 2Q83A 5TR6A 3QZHA 3R00A 4IADA 3OUNB 2YCRA 4I6FA 4A9YA 5K5NA 2XKEA 4DE4A 1YWNA 3I81A 3AMYA 5E8VA 4BTFA 2OKRA 1OKVA 2J6MA 3MYGA 5T6KA 3AC1A 1KV1A 3GUBA 4LV7A 4L3PA 3OCSA 4CXAA 4F1TA 5J9LA 5M4FA 5DYJA 5FEEA 1PYXA 1XH4A 2NPQA 3DJ5A 4FTCA 4XP0A 5AUZA 5DN3A 2UUEA 3ZO4A 3SGCA 4FIJA 3KL8A 3R8PA 4FL1A 2OH4A 3ZXZA 4U80A 3P5JC 5HG9A 1F0QA 3PA4A 1OBGA 4DT8A 4G1WA 3A99A 3S0OA 4QYHA 5K9IA 5ANEA 4FVRA 3NX8A 1APME 3FMMA 4TNDA 3GQIA 5EH0A 4PMSA 4HGTA 2BCJA 2YWPA 2ITNA 3QHRA 4JL9A 3SV0A 1NW1A 5I9VA 3SW4A 2VX3A 4GCJA 4WG5A 1ZRZA 3DK6A 2QU6A 3D7TB 5FG8A 3IOPA 2O63A 2G9XA 4U5JA 5CASA 3TN8A 4AP7A 4WKQA 1K3AA 3LCOA 4CMTA 2ZFYA 4YUQA 4MWHA 4FG8A 1YHSA 2B9FA 3U87A 2YFXA 5A9UA 2UVZA 4XP3A 3R1NA 4I22A 3UIXA 1M7QA 4EOQA 1B6CB 3BEAA 4TYHA 3NVMB 1ZMWA 1WVXA 2QCSA 3CBLA 2IVVA 5HI2A 3QUDA 2Y9QA 2PYWA 3CS9A 4YNEA 1BX6A 3PZHA 3KULA 3UVPA 5J1WA 1J1BA 3JXWA 4ZLZA 3UVRA 4CFMA 4EWHA 3OXZA 2J4ZA 4XLIA 4ITIA 4WSQA 2IJMA 3ZLWA 3OOGA 5IDPA 3DKFA 2OBJA 5I9UA 4I1ZA 1TQIA 5GZAA 3BEGA 2GHGA 3COMA 3MA3A 5EHLA 1JNKA 3TTIA 4FKTA 4O4DA 2R3GA 5EI8A 4Y5HA 2A19B 2YERA 3Q2JA 2YIYA 3EMGA 3GOPA 3Q5ZA 2BPMA 3VS1A 3GC0A 4DGGA 2ITYA 3O71A 4DH7A 4IANA 3JVSA 3PJCA 4IVCA 3LHJA 4ACGA 3FC1X 3SQQA 3SG8A 1RDQE 2I0EA 1ZXEA 3HYHA 4NM3A 3R8ZA 3RMFA 3NW7A 3EQPA 2P3GX 4TYIA 4RC2A 2XUUA 2FA2A 4JAIA 2YN8A 5BVEA 4JBQA 3UPXA 4BCOA 4UMTA 3HMNA 2BALA 2X4FA 1KSWA 5CU3A 4ZAUA 5I9YA 3MVHA 4MBIA 4C4FA 4AT5A 4E7WA 4IH8A 2CJMA 5EYKA 2PVMA 4IAFA 1PMNA 2VNWA 1OPLA 2IVSA 3BBWA 2DWBA 4ZMFA 5DIAA 5CF5A 3FZRA 4YR8A 2O65A 5E8XA 3FKNA 2OXYA 2YM7A 4K6ZA 5H8GA 4KAOA 3V6SA 2W5AA 4F7LA 2OJFE 5FEQA 3UOLA 2PZRA 3W2OA 2R3NA 3DJ7A 4QMXA 3MN3A 1UNGA 3NUNA 4ZSJA 5HICA 4D0WA 1YDRE 3FI4A 3MFUA 3PUPA 3PVWA 4FKRA 3UQFA 5IQFA 5CSPA 4QPSA 3BHVA 3O50A 5GINE 4K0YA 5D9HA 4DYMA 2WMTA 5CALA 5H8BA 4UXQA 4XHKB 5ANIA 5BUIA 2YJSA 5EDRA 4I5MA 3OD6X 4FTRA 3BL7A 4D9UA 3A4PA 5H9BA 4OAVB 3QXPA 5G1XA 4YP8A 3COHA 4UYNA 3Q32A 4IVDA 2R3KA 3C0GA 3HMPA 3KQ7A 3P7AA 5J95A 5I0BA 5JZJA 1H24A 3SLSA 2W1IA 3P23A 4UB7A 4BHZA 3ZLYA 3OVVA 3KEXA 4DG3E 3TZMA 4OW8A 4E6AA 4BCFA 3DXNA 2EUFB 4MQ2A 2X8EA 3W2CA 3MFRA 4IZYA 4V01A 3G2FA 3F6XA 4GIHA 4ORKA 4EJ7A 3N4TA 3QCYA 4FT9A 2OSCA 4M68A 2WMWA 3MJ1A 4C62A 4ENXA 2W96B 3W8QA 4QMSA 3WZUA 4ZSGA 2G01A 2BFXA 4J8MA 4IMYA 3VUDA 4EK8A 2B7AA 4C35A 3QTRA 3TUDA 3IKAA 3RNYA 5LWMA 3MB6A 3ODYX 4LGGA 4AN3A 3H10A 2OLCA 4E26A 2PK9A 2PUNA 3FUPA 5DVRA 3D2KA 2QVSE 3UZPA 3UMWA 4I94A 3WIKA 1W2CA 5EDQA 3F3VA 4FI1A 2JC6A 4HYIA 3OBGA 4IE9A 3VUTA 5T68A 3KRXA 3ACJA 3C4XA 1TFFA 5IMXA 4D5KA 4E6CA 5TF9A 3T9TA 3QXOA 5I3RA 5EDPA 2X9EA 2QD9A 3T3VA 2ZV8A 4X3FB 2C3IB 1YWVA 4RWIA 3ORPA 2QQ7A 5EOLA 4NW5A 3CP9A 4M14A 3BWFA 3I60A 3LQ5A 4ANOA 4OTPA 2Y6OA 1JSTA 2W1HA 2YM8A 5EQEA 4O82A 5CWZA 5CSVA 1RQQA 4I5PA 5K0XA 3QTXA 2YITA 3HMIA 4KSQA 4XRLA 4AUAA 2GNIA 1KE7A 2YHVA 4BC6A 4CRSA 1R0EA 2PE0A 3TDWA 4IZ5A 1ND4A 2WTJA 4FV6A 4PTEA 1UVRA 3VNTA 4JR7A 1URCA 1HCKA 3LCTA 5A4QA 3KCKA 4FTOA 3QKMA 4O7ZA 4C2VA 3KN6A 3ZYAA 3IK3A 5D11A 4FKQA 2HWPA 3K5VA 4P90A 1S9JA 1QPDA 1ZYCA 2XNOA 2R2PA 1SVEA 3FQEA 3VN9A 4RBLA 2GQGA 4PRJA 2Y4PA 2QR7A 3QTUA 3OCGA 4QTAA 1Z5MA 4NIFA 4PDOA 4OBQA 5GNKA 3SW7A 4GW8A 1KE5A 2BTSA 3ET7A 3UBDA 3VS0A 4E5AX 2P2HA 2ZMCA 4FYOA 3W2QA 3I7CA 2XANA 4L6QA 1SNXA 4LOOA 1OL6A 4RRVA 5LMBA 5FTGA 4D2SA 2CLQA 5AP4A 3PPJA 4DEHA 3VW8A 4RG0A 5HO7A 1OGYA 2CNUA 2XM9A 3GNIB 3VBTA 2VWBA 3AKKA 3S3IA 2RF9A 5BYZA 1BL7A 5C01A 2W1CA 2PMLX 2OG8A 1A48A 3D15A 4M69A 3QQUA 4AF3A 4K77A 3PY1A 5HTBA 5BUJA 2UZTA 3G6GA 4FSRA 4QRCA 2C6DA 5CVGA 4F1OA 5TO8A 1OL2A 3DB8A 4PMPA 2RFNA 2AUHA 1XH9A 1XH5A 2OW3A 2GNGA 3K3JA 3QCSA 5IA2A 1IA9A 2PUPA 2OF2A 4JVGA 3IS5A 5EYCA 3V5JA 2XJ1A 5E7RA 5A54A 5HX8A 3UO6A 2X81A 3SRVA 2A98A 4RJ3A 1XMLA 5I5ZA 4UBAA 4ANNA 1QL6A 2HOGA 1MQBA 2I1MA 2XIYA 3EKNA 2ONLC 3KF7A 3LFCA 3LLTA 3NCGA 4FTUA 4I20A 3C9WA 3MPMA 4KBCA 3RBWA 4FTAA 2BFYA 3QZIA 2BZKB 4S34A 4Y83A 1WVYA 4K1BA 3WARA 2JIVA 3BU5A 2CGUA 5EKOA 1YVJA 3NUAA 4MUQA 2ZOQA 3QALE 3TV7A 4EZ7A 5HLNA 3GCVA 4RGJA 4IB0A 4ARKA 5KMMA 4F7NA 3E63A 3VS4A 3F5PA 4JDJA 4XBUA 4U40A 4BTMA 4AZWA 3A8XA 3QD3A 5CQUA 4F64A 1E9HA 2PUUA 4QMQA 1VLRA 5BVFA 1JAMA 3I79A 2QKWB 2UZOA 3ORNA 3KMMA 3NIEA 4G34A 1KOBA 5AP6A 4AXEA 4QMMA 1DM2A 3AD5A 4MXAA 4APPA 2FH9A 4FIGA 4AGDA 4AW0A 4GG7A 5C8KA 4TWOA 5EHYA 2A4LA 3I4BA 3REPA 3FSKA 2XK4A 2X0OA 2ZDTA 4X0MA 4G3FA 1XJDA 5KCVA 3HA6A 2WU7A 3E3PA 3V3VA 4ALWA 4EHZA 2WEIA 2C6OA 4A9TA 1OPKA 4LRKA 3SA0A 5C4KA 3HV4A 2UZEA 2VTRA 3ZO3A 4CKIA 2OH0E 2OJGA 3R2YA 4ZXTA 2UZDA 3KXZA 3S1HA 3ATSA 2XIKA 1VZOA 3BGQA 4ID7A 1U54A 2XAMA 2BRGA 3GC9A 2XRWA 4QT1A 4FK3A 1FVRA 2R3IA 2Z8CA 4U43A 3R71A 4FKJA 4EZ3A 5IKWA 4PP9A 4PF4A 1Y8YA 3U9CA 3QQFA 3F3WA 4WSYA 3V51A 3H0ZA 4E5BA 5JN2A 1H1RA 1Q8TA 5CSWA 2W4OA 3QU0A 2VD5A 2EXEA 3V6RA 4DHFA 3W0RA 4EOSA 2F57A 3EFWA 3FMHA 4IFGA 3JY9A 4DGOA 5IQAA 5CI7A 5CI6A 2XKDA 2PVLA 3HRBA 3NIZA 2BDFA 2X4ZA 4YNOA 3F88A 2ITOA 4IJPA 1WBOA 4U3ZA 4XJ0A 3U55A 3PZEA 4LUEA 5J7BA 5KHWA 2QG7A 1KWPA 2ONLA 2UVYA 4YLJA 3FZOA 5FXRA 3ZEWA 3CQWA 4FJVA 5IEYA 4QQ5A 4W4YA 4RWKA 3HX4A 4I21A 2C0IA 4LM5A 5IA5A 1JKSA 1ZY5A 1OPJA 1FOTA 3QLGA 2WGJA 4JX3A 4S31A 1ZARA 2J0KA 2VTQA 4D55A 2J2IB 4MH7A 4E6QA 2C3LA