2OXXA

Protein kinase ck2 in complex with tetrabromobenzoimidazole derivatives k17, k22 and k32
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
325
structure length
325
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Casein kinase II subunit alpha
publication title The ATP-Binding Site of Protein Kinase CK2 Holds a Positive Electrostatic Area and Conserved Water Molecules.
pubmed doi rcsb
source organism Zea mays
total genus 98
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2oxxA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2oxxA02
2UW3A 3FHRA 4XS2A 5HBHA 2DYLA 4L7SA 4O86A 5IQGA 3DCVA 3N51A 5DT3A 4AACA 5GZ8A 3P7BA 3QX2A 4QMZA 3HDNA 4A9TA 3BHUA 3MV5A 3R1SA 5J95A 4CRLA 4DGOA 3ROCA 4O2PA 4EL9A 5FD2A 2YCFA 4D1XA 3SRVA 5E9EA 1O6LA 3UYTA 3FQHA 4HNIA 4RIXA 5BYYA 4ANNA 2IZUA 3QTQA 2WD1A 1H01A 4BDCA 3D83A 3V6RA 4DGNA 3L8PA 2VTLA 3OVVA 4C4GA 5C8NA 2R3IA 2BZJA 1GY3A 1GZOA 5K9IA 3NVKI 3VF8A 4L9IA 3OTUA 4G9CA 4I5HA 5HEZA 2BPMA 2BRNA 3GENA 4O0SA 1UU8A 4AQCA 5CAUA 2BDJA 4E4NA 4LGDA 3GNIB 3PG1A 5ANEA 3L9MA 4JBPA 3PRFA 4KABA 2P2HA 3D5XA 2ZV9A 5KMJA 4OTGA 4UX9A 3QTIA 5JZJA 1VZOA 4IM0A 2C6LA 2X8IA 5HD7A 5BUEA 2XK3A 3ATSA 4HOKA 3A99A 1FVRA 5ETIA 3RK5A 3TDWA 4E26A 5LOHA 4KIKA 3AMAA 4J53A 4RLKA 2BZIB 3I0OA 1PRYA 4FEQA 3W33A 5D41A 2PZRA 4I0RA 4GIHA 4FSWA 4FTRA 4O0UA 4O84A 3PXQA 2WHBA 3VRYA 2A1AB 5E92A 2YA9A 2C1BA 3KB7A 4BCNA 1IAJA 3HKOA 2YWPA 2C5YA 3H9OA 4MXAA 4XRJA 4EQMA 3C7QA 2WQBA 3OOMA 4RWLA 3ZRLA 2YM8A 5IF1A 3DNDA 3HRCA 1XHAA 4PPBA 2GHMA 3VS7A 2PPQA 3EH9A 3TKUA 4FOBA 1J91A 2BR1A 4M66A 4RFZA 4OBQA 3VUGA 3CSVA 5I9VA 3UP2A 4D9UA 5CQWA 5F20A 2BMCA 4KBKA 5FXSA 4EYJA 3KMWA 4TYIA 1ZLTA 2F49A 5AUWA 2CKQA 2WELA 3QCYA 3Q53A 4BICA 3MH0A 1JKLA 4DH5A 4DYMA 2G15A 4R7HA 4U9AA 3HECA 4XJ0A 3NCZA 3D7TB 4QMNA 3ZUUA 4GEOA 2EWAA 1URCA 2HZ4A 3LFBA 4FV3A 3ZYAA 5CAOA 4R77A 4PX6A 4U7ZA 4L42A 4ANMA 2BFYA 2B52A 3BE2A 4WG4A 1XO2B 1XKKA 4AX8A 3VHKA 4DCEA 4A9UA 3KK8A 4FZ6A 2VWZA 4XG8A 4JXFA 1XJDA 3OEZA 4JDHA 2C6OA 2OZAB 5GJGA 3V8WA 3V5PA 3C13A 5K3YA 4CNHA 4IANA 4QQJA 2BZKB 4FSTA 3O8TA 1OL7A 4BDEA 3TNWA 1ZMUA 4WT6A 4ANLA 3ZM9A 4TYHA 2WB8A 3BU6A 3EJ1A 3HZTA 4FTMA 4ZSLA 5T6KA 4QMOA 4QMTA 4O82A 3E8DA 3RAWA 1PMNA 2PMNX 4NW6A 3BYUA 1OM1A 3PPZA 4MQ1A 2C6IA 3NIZA 4OTWA 4A4LA 1REJA 4M0ZA 4BCKA 4FT7A 4EKLA 3B2WA 2VU3A 1SNXA 4S34A 5IA1A 4ZXTA 3LCKA 3R2BA 4EORA 4USFA 2WGJA 2JDSA 4IBMA 4RGJA 3F2RA 3DBEA 1R78A 2P2IA 2XCHA 3Q3BA 5M4FA 1WFCA 2ZM1A 3R8VA 4AGUA 2E9UA 3HUCA 3HV5A 4FZFB 5AAGA 4LUEA 2RGPA 1S9IA 4S33A 2KULA 4YO4A 5EG3A 4RIWA 3SKCA 3W10A 1KE9A 2AC5A 5BVOA 1VR2A 4MKCA 1DAYA 4U44A 3F7ZA 2ZV7A 5BVDA 2YCRA 2YITA 4H3BA 4B8LA 4F0IA 3GU8A 4GKIA 3PZEA 1BLXA 1TQPA 2C30A 4IH8A 4CEGA 1VYZA 3SRVB 2J0IA 2PE0A 2QR8A 4RLLA 4I6FA 4UV0A 3BCEA 3FMJA 4RIXB 5CWZA 4BCJA 4MF0A 4EOMA 4ZMEA 3ZZWA 4GV1A 4XP3A 4CFVA 4I6BA 2GTMA 3ORMA 4MNEA 4GCJA 4QTEA 5J9ZA 2VWBA 2CMWA 3WIKA 3A8WA 3OUNB 4HNFA 4JDJA 4EKKA 2PVJA 1QPDA 3FMEA 4O1PA 3O51A 2VAGA 2WTKB 4LOPA 4Z9LA 3A4PA 5HG7A 2X7FA 3SXSA 2NPQA 1SZMA 2EUFB 5FTQA 4QPSA 4IADA 5CSVA 2QVSE 4FMQA 4QMPA 2BAJA 2OH4A 3C4ZA 4G6NA 3SC1A 2V62A 3QZHA 4FKRA 1M2PA 1RJBA 4U45A 4V0GA 2REIA 4S32A 1F3MC 3FMDA 4AZSA 5CAPA 2CGVA 4L45A 3OFMA 3PSBA 4TWCA 3JUHA 5DT4A 3E3BX 5BVEA 4EOIA 2YZLA 4DFNA 4QD6A 4KIKB 4I4FA 5HBEA 4AT3A 3EOCA 4L3JA 3F3ZA 4M7IA 4Y72A 4P2KA 4FEUA 3ZHPC 4AOTA 2BIKB 3DKCA 2JBPA 5FTGA 4D5HA 4FG8A 2J7TA 2IPXA 4GK4A 1FGIA 1V1KA 2H6DA 3EN7A 2YJSA 3ORLA 3IK3A 4RQVA 4RVMA 1OL2A 4DG3E 2R0UA 4AA4A 5A46A 2YDKA 4OAUC 2X9EA 4AA0A 1B38A 1OGUA 3BX5A 3FZOA 4IACA 4M84A 4TT7A 4GT5A 2GNIA 2WTWA 5HE3A 5I9YA 5ITAA 4U40A 3FI8A 3NUAA 2R7BA 3SV0A 4JDIA 3MBLA 4DG0E 3LE6A 3PVBA 2QO2A 3GEQA 4J98A 3MH3A 4QT1A 4XH6A 2GQGA 2OU7A 4TYEA 4CSVA 4C0TA 3PDTA 4ZTLA 2X6DA 3DJ6A 2WFYA 1U54A 2O8YA 3OBJA 4X2NA 4O96A 3HX4A 3PIZA 4W9XA 5AP2A 3R7OA 3ZBFA 2JLDA 3FXWA 4UMTA 2IVTA 4F7NA 2YIXA 3UMXA 2PULA 2BRHA 5F4NA 1FOTA 3HRFA 3VBXA 1ERKA 5AUUA 2R4BA 2WTCA 4IAZA 3VBWA 5CAVA 3UVQA 2ITZA 1KE7A 2GMXA 4IM3A 2XP2A 5AP3A 5IDNA 2E9PA 3ACJA 3CD8A 4NTTA 4U6RA 4FEWA 4XV9A 3WF7A 2OSCA 1ZXEA 2W1HA 3ALOA 3L9NA 4K9YA 5L6WL 4O22A 2Y6OA 3LM0A 4IAKA 3IG7A 3TUBA 3AGLA 3FSFA 2H9VA 1BKXA 2P4IA 3QQHA 4JIKA 2CGXA 4YTFA 3R7YA 2IG7A 1NY3A 3KCFA 3O8UA 2OJGA 3U87A 5KMNA 2G2HA 3QTUA 5KCVA 3R8MA 4K0YA 4KD1A 4FKQA 3EYGA 4TTHB 3ORIA 3QBNA 3ZEWA 2ITUA 1M2QA 2ITWA 3LCSA 5FM2A 4YBKA 4TYHB 4EK4A 4YHJA 2EXCX 1CKPA 3COMA 4RX7A 3D4QA 4XG9A 4ZJIA 5M53A 4L01A 4LG4A 2HIWA 3KCKA 4J8NA 5AIRA 4O0WA 2JFMA 5H9BA 3SXFA 4FZ7A 4KAOA 4QP7A 4EZ5A 3R9NA 2PL0A 4N6YA 4IHPA 4QRCA 5KKRC 3LQ5A 2XNEA 3B8RA 3FBVA 1P2AA 4XLIA 4QTDA 3ALNA 5J9YA 3TV7A 4PDOA 4A4OA 2XM9A 1DI9A 5FBNC 1RW8A 1JSTA 2Z2WA 3EQDA 3QHRA 4FIGA 4ZTHA 4BHZA 3KXNA 2G2FA 3G0FA 3M2WA 3OOGA 3K5VA 3Q32A 5A9UA 5BMSA 1GZ8A 2GNJA 2ZOQA 3G0EA 2PU8A 1QL6A 2ZV2A 4RIWB 2OF2A 4FKUA 4CCBA 2Y7JA 4CLJA 2YM5A 1YXTA 2VUWA 2JBOA 2XBAA 1SNUA 1CDKA 3MPTA 3QRKA 5CT0A 4EC9A 3UNKA 1ZRZA 3DB8A 3FPMA 2X4FA 1H1WA 3KVWA 4FKLA 3EL8A 4FV7A 2UUEA 5EW8A 3VS0A 3DNEA 4OW8A 3FYKX 5I4NA 1U5QA 4UYNA 2XZSA 4ZSAA 3GU7A 1KE6A 3LCDA 5EM6A 2Z7LA 4ZLOA 4J8MA 1BUHA 1KV2A 2RL5A 3PXRA 4FSNA 5DBXA 3RHKA 3T9TA 4DG2E 4IB1A 4G2FA 2F57A 2XEZA 2BKZA 4LMUA 2PMOX 3A60A 4J1RA 4MNEB 5ACBC 4FIEA 3F66A 3UIMA 3PE1A 4BFMA 3GQLA 2G1TA 4NM0A 2QU5A 5EFQA 3ZFXA 3V8TA 2RFEA 3N9XA 4JR7A 4DH1A 3F3TA 1MRVA 1YI4A 2ZM3A 3Q9XA 4ITJA 2H34A 2QD9A 1K9AA 5M4CA 2PHKA 4JVGA 3TJCA 5CSHA 2Y4IB 4HCUA 5LARA 1H00A 3MJ2A 2XYNA 4MXZA 4HGTA 5AADA 1UNLA 4BI0A 2BAKA 3TIYA 3WZUA 2Z7SA 3C4XA 3IW4A 4G3DA 4D4VA 3I0QA 3OEFX 2BROA 5J7HA 4QP9A 1E1VA 4ERKA 2AYPA 3K5UA 3PY1A 2ITNA 4FYNA 2EXEA 4UALA 1YOLA 4XRLA 4U80A 2QLUA 4IEBA 4RVTA 2XJ2A 5C4KA 2J0JA 2GU8A 3LFNA 3RBWA 1P14A 2B54A 3MIAA 3NWWA 3R83A 3BI6A 3FE3A 3PWYA 5A6OA 5HU9A 5IQIA 3IQ7A 3HVCA 2HZ0A 3NAYA 4GU9A 5IA3A 1OVEA 3S4QA 2ONLC 3E88A 3W16A 4YGAA 2QG5A 4M0YA 4GFOA 4QMWA 5EYCA 4BGGA 3UQCA 1NVSA 3QHWA 3RK9A 4DGLC 1KE8A 5AA8A 2V7OA 2HENA 2E9OA 1U54B 5L8JA 5CF6A 2B4SB 4GFGA 2C3IB 3NDMA 3JPVA 4IE9A 3UG2A 2R3PA 5I9WA 4FTAA 3ZTXA 5J5TA 3CCNA 3QQGA 4PDPA 3I1AA 1BL7A 2XK8A 1OBDA 3EHAA 2H96A 4CG9A 4EH2A 4FV9A 3EQBA 3R7VA 4FG7A 3KGAA 3ACKA 1XH5A 3TNHA 2W99B 1WMKA 1HOWA 2J5EA 4C4HA 2WTJA 3AQVA 1ZYCA 4NM7A 3RPYA 3R9RA 4ACHA 3FY0A 4O0TA 3HGKA 3EN9A 5BVWA 4YSJA 4EOJA 4FTJA 2IW9A 3UNJA 5TF9A 4CFUA 1OUKA 3PYYA 3PY0A 3CEKA 3ODYX 3Q52A 3HA6A 5EI6A 1M7QA 2QOIA 2WQMA 3GP0A 2P0CA 2UW0A 4CKIA 4QNYA 2BRMA 3EZVA 2OXDA 5KE0A 3ELJA 3KL8A 3LLAA 4N0SA 2ZYBA 4QMUA 4QP2A 2RFSA 5CU4A 5EM8A 4JLCA 3M11A 5ANOA 3Q04A 5AAFA 5CAQA 4KUJA 3FMNA 2R3KA 1J3HA 3DLSA 2X2KA 2EB3A 5FRIA 1TQIA 3C50A 1JVPP 2YLEA 3EN5A 4JL9A 4AAAA 4E20A 2QI8A 5BVNA 4IM2A 4RWJA 4ERWA 3H9FA 2QG7A 2XNOA 3G15A 5CU0A 4E4MA 1ZY4A 2ZVAA 2YCQA 4Y8DA 1M52A 1ZZ2A 4A9SA 2I7QA 5IQHA 4ZTQA 1BI7A 1CM8A 4IZ5A 4WBBB 1GIIA 4A06A 3QQUA 4TW9A 4U0IA 5HBJA 5K5NA 4DT8A 3ZS5A 2YHVA 3UZRA 4FT9A 2ITVA 5DFPA 4DFYA 5DIAA 4GRBA 1R0EA 2J6MA 5HVYA 5TR6A 1STCE 2FSTX 2WMWA 4F6UA 4RBLA 4F09A 4JI9A 2R64A 2B9HA 3I79A 5DR9A 2PMIA 5ETFA 3C1XA 5HIDA 4F9CA 1REKA 3VAPA 3UPXA 3KC3A 4QP3A 3H9RA 5EHYA 4EH9A 2ZMDA 2CSNA 1H28A 4RWKA 1SYKA 5ETCA 3HEGA 5AP7A 4IAYA 2CCIA 2VWWA 2W5HA 2PZ5A 2UVXA 4DH8A 4BY9E 2GFCA 2C0IA 2X8EA 4YJNA 3NYNA 3IW5A 2VTNA 2WQEA 4YTCA 4LV5A 1WBSA 3QYWA 2XJ0A 3L8XA 1FBNA 3ZH8A 2ITXA 2UZDA 4FUXA 4NFNA 4QMXA 3TG1A 1WBTA 4AGWA 3VS3A 3WBLA 1H1QA 1NVQA 4G9RA 4BZDA 3FI3A 4BGQA 5CNOA 5FEQA 4LRMA 4EYMA 4PMPA 4QYFA 1H26A 2WMAA 1HCLA 5AV3A 3ZLXA 2PTKA 3BGZA 2IWIA 3NNUA 1IEPA 4HCTA 4OTPA 4ACMA 4I0TA 2GCDA 2C47A 2F4JA 4K18A 5KMLA 1PMVA 4MXXA 5FWKK 3ZONA 3OWJA 4DEHA 4F0FA 3BV3A 3FZRA 2WNTA 3VNTA 3R6XA 3JYAA 4D2RA 2VNYA 4C02A 5AA9A 3QUEA 3IKAA 5JRSA 3Q9ZA 3JR1A 2GNHA 5IQDA 2XK9A 4EZ3A 4AN9A 3PTGA 4WA9A 2YDJA 3Q9YA 4X2GA 4TZRA 5JGAA 4YNEA 3O0GA 4MVFA 5CF5A 3KFAA 4OAVB 2VO7A 1FGKA 2QR7A 2ZM4A 2YCSA 5FLFA 4UZHA 4HVDA 2YABA 4U5JA 4ALWA 4BIDA 4YU2A 4BBEA 2I0HA 1PMUA 1YDRE 4WNMA 2UZWE 2HZIA 1PXOA 2R7IA 4FNZA 5I3OA 2I0YA 4JG6A 2ZDUA 2RSVA 4ANBA 1Y8GA 3PIYA 3CC6A 4CQGA 4ZTMA 4FTLA 3HP2A 2OZOA 5C8KA 4YJOA 5J8IA 5KZ0A 4L52A 5CASA 3ZRMA 5HCZA 2A0CX 5BYZA 2J90A 3QKLA 3P0MA 4KKHA 3CS9A 4O6LA 1SVGA 2B55A 2YAKA 5C27A 4AOIA 3FKOA 4J52A 2HWPA 4O0RA 3D2IA 3DK6A 5M57A 4UMQA 3JY9A 4PWNA 5TO8A 4CV9A 3OTVA 4G3CA 1IAHA 2B9IA 2BFXA 1YWNA 5IQFA 3AC4A 3QLGA 4I93A 3CY3A 4FVPA 4KWPA 1ZMVA 4BCIA 5JFXA 4C8BA 4J71A 2HXQA 4YC3A 2VX1A 4MHAA 2UZNA 4EBVA 4FL3A 3PLAE 1UA2A 3EFKA 4G3EA 1L3RE 2QURA 1GZKA 3R1YA 3UOKA 4UB7A 3TXOA 3WILA 1H1SA 4AN2A 3DB6A 3W2CA 4EK8A 4F1OA 4K33A 5AR5A 1Y6AA 4EUTA 2ZB0A 5BQ0A 1ND4A 4OTFA 1OI9A 2VWUA 4ZSEA 1XH7A 2BVAA 3DT1A 4L00A 3PIXA 4B8MA 4KKGA 2BCJA 1Q61A 3SW7A 4GL9A 1M2RA 3KXXA 3QD3A 1SVHA 3IDBA 4MD7E 3P86A 5LWMA 4JT3A 4R3CA 4BN1A 1JKKA 2BUJA 4Q5HA 3QRUA 2F2UA 3F5PA 4CMUA 3WI6A 5IU2A 1Q8TA 4CFWA 5HKMA 5D9HA 2UW7A 4YJUA 1OKWA 4YMJA 3BYSA 1Q4LA 1XBAA 2OI4X 2O65A 4RMZA 2WOTA 4OLIA 5AV1A 3LZBA 3CE3A 4PDSA 1OIYA 4WG5A 2R3HA 3VO3A 2PWLA 4JOAA 4KBCA 5EQYA 2RG6A 1ZYDA 5FDPA 4AG8A 4CXAA 2VV9A 3MYGA 2XS0A 4IIRA 5IPJA 3FWQA 2YERA 3EKNA 4C2VA 4RIOA 3BWFA 4BWXA 3MSSA 5DI1A 1W7HA 1ZOGA 3RZBA 2PZYA 3I7BA 1OPJA 2QODA 5IQEA 5KMKA 4KNBA 3MY0A 3VUHA 4EHGA 3QTXA 3ZCLA 3NZ0A 4FV0A 4GVAA 1G8AA 3R0TA 5I9UA 4CFMA 4FKTA 3WYXA 4BTKA 5L4QA 4FVQA 4G34A 2OJJA 3SA0A 3F5XA 2CHLA 3UO5A 3LMGA 5A4LA 4C62A 1OIQA 3IPHA 3QGYA 4G17A 4FI1A 4UZDA 4YZBA 1WAKA 5AV2A 4GIIA 4NT4A 2W7XA 4FK6A 4Y73A 2OIQA 1RQQA 3PXKA 4NCTC 3FKNA 4O6EA 3UP7A 3VW6A 5CLPA 3PWDA 3ODZX 3VF9A 2YM6A 2HOGA 1YHWA 2GS6A 4PPAA 4PP9A 5IUHA 3UGCA 4PV0A 3ZSGA 3ITZA 3MVLA 4AT5A 4P5ZA 4I92A 4BDIA 2C68A 3Q5IA 3R73A 1BI8A 5IQAA 2VX3A 4HJOA 4F63A 4QP1A 2YIYA 1JKSA 3MVJA 3HL7A 3RVGA 4CZYB 3COKA 4UMRA 1W98A 4IVCA 4YBJA 4FKPA 3R8ZA 3V3VA 4BTMA 2QOQA 3EFJA 3NAXA 4IFGA 2QOBA 3G33A 1PMEA 2O3PA 4PY1A 4Y5HA 4ACGA 4LV8A 1B6CB 4HVSA 5FBOA 2FYSA 3R22A 3E92A 4D4SA 2Y6MA 3KF7A 1KOBA 2WMRA 2PK9A 3G90X 3E8CA 3RPRA 5EH0A 4U79A 3VJNA 5K0XA 1BYGA 1FVVA 3PJ1A 1ATPE 4C3RA 3R00A 4AE9A 5C01A 4BZOA 3LOKA 4FTNA 3FPQA 2JEDA 3KQ7A 3RAHA 5CT7A 2IW6A 5AJQA 4DBXA 2W1FA 1XH4A 4DN5A 2GQSA 3ZRKA 2OBJA 3ZDIA 3ZZEA 4TRLA 5LWNA 3OMVA 4EWHA 3I5NA 5G1XA 4AXAA 4WUNA 4HYUA 4FSQA 5DGZA 3W55A 3NW6A 3OG7A 2PMLX 3F7WA 1XR1A 5AR7A 4G31A 4YLJA 3Q4UA 4RQKA 2XBJA 4AW0A 4BZNA 5C03A 1H4LA 2QONA 3G6HA 3O17A 3KXZA 4XCUA 4H3PA 1X8BA 2EB2A 3CD3A 4NIFA 2UW4A 3DKOA 2OFVA 2ZMCA 2X81A 3QTSA 4I24A 4DEIA 4CYJA 3CTHA 1YQJA 3KEXA 3LXKA 3PPKA 4TKSA 4IX5A 4R5SA 4WIHA 5EK7A 5H3QA 4PTCA 3FSKA 2VTHA 3BBTB 4QOXA 4F9YA 2CCHA 4DH7A 2W9ZB 5IEXA 4DTAA 3VUKA 5IQCA 3R7UA 5EI2A 4ZY5A 3QXOA 4X21A 1XH9A 5HO7A 4D1ZA 1H07A 2W4OA 1YVJA 2A2AA 3KRXA 3OP5A 5AM7A 1QCFA 3BPRA 4E93A 3REPA 3FEGA 3R71A 3R8UA 4CFFA 4FKOA 5J87A 2J5FA 4I6QA 4S30A 3NYOA 5JEBA 4O0XA 4XP0A 3BQRA 2W96B 4NU1A 1ZYSA 4MXYA 4CLIA 3OXZA 4FV5A 4NJDA 3V5QA 3EQFA 3EMGA 5L2WA 1R1WA 2IVSA 3GC7A 3MVMA 3Q2MA 1IA8A 2IW8A 3RALA 5DA3A 3KRJA 2YDIA 2C5OA 2R3RA 3LAUA 3LM5A 4K11A 4Y46A 4RX8A 1M7NA 3EB0A 4FTUA 5IH4A 4O7WA 3QKMA 3G9NA 3OC1A 2UVZA 2WTIA 3U9CA 4BR3A 4DF3A 2XIRA 2ITPA 3NMUF 4GVJA 3K2LA 2RFNA 3CTQA 3TACA 1M14A 4B4LA 4I5CA 3D5WA 4UWCA 3OCTA 4ZP5A 4RWIA 4GU6A 4JRVA 4QP8A 4QYHA 3HMMA 4O91A 3SX9A 4RFYA 4NK9A 2C3KA 3P7CA 3FI2A 4IB0A 2J0MB 3GBZA 2VTTA 5J9LA 4M68A 4GKHA 3VW8A 4C61A 4CT1A 4DTBA 3NYVA 4U3ZA 3PVWA 5J5SA 2UW5A 5CVFA 4TY1A 1NW1A 4DEDA 3VN9A 3VBQA 3P5KA 5E8YA 4RJ5A 5CEKA 5CF4A 2UW8A 3NVMB 4OGRA 2ACXA 2X7OA 3A62A 3NUXA 4R7IA 4UWBA 3ORNA 4GJ3A 2C6EA 4IVAA 3BE9A 3W8QA 1ZYLA 3F88A 1GJOA 4H1MA 1MRUA 4IW0A 2RIOA 2VGOA 3GGFA 3EFLA 4EH8A 3IW6A 4FIFA 4C4EA 5K4JA 4LOOA 5HNIX 3AC2A 3ZOSA 2PVKA 5I9XA 3OZ6A 2ETRA 4E5WA 4KB8A 4F4PA 3HV4A 4ARKA 4DITA 4J7BA 1AQ1A 4JX3A 4NZWB 3KVXA 3EQGA 1J7UA 2O63A 2QLQA 3A7HA 1I44A 3RHXA 2KTYA 4APCA 4E73A 3P08A 4D4YA 4FNXA 4FSUA 2OKRA 1VEBA 3QRTA 4FNWA 3BLQA 1Y8YA 3V5LA 5HD4A 3QXPA 4I5MA 3OWKA 4TPTA 5CVHA 2WZJA 4FODA 4HPUE 3FZSA 4PRJA 2E2BA 5LVOA 1P5EA 3II5A 3P23A 3QTWA 3H0ZA 3WF6A 1Y91A 1VYWA 4G5PA 1K2PA 5HVKA 3CPCA 2BZHB 1UWHA 2ITYA 2OO8X 2WIPA 4GMYA 5M55A 1R0PA 3PG3A 4FKJA 2GSFA 4W8DA 2OGVA 1Q8ZA 2PZPA 3A61A 4X3FC 4EJ7A 4KINA 5AP5A 2PVFA 4MWHA 1OL5A 3O7LD 3F3VA 4XYFA 1JOWB 3PE2A 2PVRA 4RJ6A 5G6VA 2QNJA 4YP8A 4RJ4A 3H4JA 3PPJA 4RA5A 4ZY4A 3LW0A 3NUSA 3BQCA 4M97A 2VD5A 3ZSHA 5FXRA 3C5UA 4XP2A 4PP7A 4IZ7A 5LMKA 5T68A 2G01A 2XIYA 2HCKA 4IZYA 5FEDA 2JC6A 3KN5A 3MIYA 5AUZA 3U4UA 4NIFB 3IOPA 3H30A 4PTEA 3NNVA 4EWQA 5KZIA 1PXLA 2FSOX 4FC0A 1OBGA 4MWIA 3CKXA 3KK9A 2FSLX 2HZNA 4O7SA 3NSZA 5HG9A 4EHVA 1AGWA 1YXVA 4IWOA 2J50A 2UZOA 1U4DA 2WMSA 3R1QA 4RG0A 5B0XA 5M09A 1W82A 4B99A 3P1AA 2I6LA 4HVIA 5AV4A 3EQRA 5EDPA 3KXHA 1TKIA 4G6OA 3ULZA 3QWKA 4O7NA 3LVPA 2X7GA 4II5A 4UBAA 2HELA 3VBYA 4F9WA 3WZJA 1OKZA 3FV8A 3FI4A 4M3QA 4YR8A 2B9FA 4XHKB 2HYYA 3HYHA 3JVRA 5DH3A 4UEUA 3SOAA 2PVLA 4QYGA 5AWMA 3VULA 4EOSA 2NO3A 5KKRB 3ATTA 3NEWA 3EQHA 2YIQA 3QZIA 3GC8A 4ZK5A 3GCUA 2XIXA 4I3ZA 2GS7A 3CQWA 3PA4A 5CY3A 2BKKA 2FGIA 2W5AA 3S00A 4W4VA 2R3GA 3RAKA 2R0IA 3RKBA 3ORZA 4D2TA 4DFLA 2JKQA 4W9WA 3CLYA 4DEEA 4DHFA 2QOHA 2YEXA 3MPAA 3NNXA 4V01A 3I7CA 2P33A 3ZBXA 4XV1A 3VS1A 4MF1A 3C4CA 4ZAUA 4HYSA 2IO6A 3TNQB 1PXNA 3BHVA 2OJ9A 1DAWA 3ANRA 4FZAB 1PW2A 4F7LA 2YISA 1PYEA 1UU9A 3WIGA 3UOJA 4EUUA 2G2IA 4BVUA 2J51A 3CXWA 4JJRA 2AUHA 3A7FA 3GXLA 4TN6A 5KBQA 4JQEA 3UQGA 4FICA 3W2PA 4JS8A 4PNKA 3OD6X 3AMYA 4FTQA 3FMHA 4BCMA 4FV8A 4MXCA 2ETMA 2WKMA 4C4IA 4ZSJA 4OUCA 5FM3A 3TI1A 3LFCA 2CGUA 3NW7A 3BV2A 3ZLYA 1MRYA 5HE0A 4AA5A 2HW6A 1VJYA 1ZZLA 4E4XA 4ASXA 4PF4A 5CZIA 2JFLA 4CVAA 2ERKA 5EW9A 4C4FA 2W1ZA 2YN8A 3QUDA 1BL6A 2XMYA 5EYDA 3QL8A 5HLWA 1OIRA 4GK2A 4FT0A 3CGFA 4Y85A 5TT7A 1ZAOA 1GNGA 2I40A 2Y9QA 4YPDA 4NUSA 5ANIA 2W1IA 2C3JA 5CXZA 4LGHA 1UKIA 1A9UA 2A19B 2PVNA 3GCPA 4FL1A 5A14A 5HX8A 5HG5A 4D55A 4IB5A 3HMIA 4QTAA 5F9EA 4J96A 4JBQA 5EOLA 4M8TA 5K4IA 2PYWA 4PMMA 4WKQA 2QOLA 4FT5A 5AIKA 3FLYA 3BHHA 3BYVA 5FTOA 4YC6A 4H39A 3V6SA 5DT0A 5JSMA 4YSMA 3DBCA 4BIBA 4RFMA 1J7LA 4PL3A 2WQOA 4EI4A 2WOUA 3MY5A 5EDRA 3CKWA 2UZUE 3F5GA 2NRUA 3SG9A 3DTWA 3LCTA 3VRZA 1XH8A 4JG8A 4E6DA 4Z55A 5GIPE 3RM6A 5CF8A 4I21A 4IXPA 4FF8A 4HZSA 3FKLA 5AR3A 4N6ZA 3K3IA 3UPZA 4BL1A 4BCPA 3GI3A 3EIDA 3RPSA 4DGMA 1OB3A 3R63A 4TWOA 4NM3A 3G9LX 5E7RA 4BDGA 4ZZNA 3U54A 1XBBA 4LOQA 4EC8A 3MI9A 3MS9A 3D0EA 5E8ZA 3RINA 5DYJA 1YXXA 2OWBA 3GU4A 1YI6A 3JXWA 4XV2A 5KX8A 4CKRA 3NW5A 4QMMA 5H8BA 4PUZA 4EH4A 1MP8A 3N4UA 2C0OA 3D5UA 5JFVA 4YJTA 5JQ8A 3QCQA 4AF3A 3TCPA 3FL4A 2ZAZA 3FZTA 5HESA 3L1SA 5EKNA 4B9DA 5EI8A 2W5BA 3DOGA 4TWNA 4APPA 1GOLA 2IVUA 4AOJA 3O2MA 4D0WA 3ETAA 3F6XA 4GG5A 3E7VA 3MFUA 3OY1A 3W2SA 4AE6A 1P4FA 3M1SA 3ZO3A 5HE1A 4NFMA 4HVHA 2R3OA 5KHXA 4C59A 2CKOA 4BBFA 4IX3A 2WQNA 5DNRA 3RK7A 4AUAA 3IGGA 2JKOA 5KUPA 2BHHA 4OTRA 2XKFA 4FBXA 1CTPE 3GOPA 4WHZA 4JNWA 4I41A 4BYIA 1F5QA 1E9HA 3GVUA 3LFEA 3R9OA 3KY2A 4C38A 5HO8A 5M4UA 4I4EA 3DTCA 4BYJA 5IH5A 4KIQA 1Q8YA 5B2MA 4BTFA 3QD4A 5HLNA 4QYEA 1E1XA 3O7LB 3EZRA 4IVBA 5IA5A 2YFXA 4C34A 4K8AA 5AP1A 3AT3A 4QMSA 5BVFA 3WE4A 2X0GA 4C3FA 5HU3A 1OITA 1LUFA 5HICA 2QQ7A 3QFVA 5ACKA 1GAGA 5ANJA 5HVJA 4AS0A 3U6IA 1PXJA 2R3QA 3OS3A 4CRSA 5F94A 3R9HA 3PVUA 4L8MA 4CYIA 5DG5A 2QU6A 3AT2A 4BKYA 3HAMA 4AW1A 3BU3A 1JWHA 4RA4A 4P5QA 5IA4A 5CEQA 4S2ZA 3BYOA 5JRQA 4IAFA 4G3GA 3BLRA 4AFEA 5C9CA 3RJCA 3DBFA 4QTBA 1MQBA 1YHVA 4JRNA 4ZTNA 2VTPA 5CEIA 2PUIA 4LFIA 4AW5A 2JDRA 3AD4A 2XF0A 3ORKA 3Q6UA 4LYNA 4LL0A 1UNHA 3AXWA 1I09A 4XG4A 2GNLA 4K6ZA 3EL7A 1FMKA 2BDFA 3COHA 4AGCA 2VNWA 3RPVA 3U6JA 3TNIA 3F2AA 4OT5A 3WZDA 4EOQA 2B9JA 4FV1A 3F2NA 5D10A 5AUXA 2V5QA 3AGMA 2X39A 4U8ZA 1CKIA 2X8DA 2XUUA 4MXOA 4BGHA 4XG2A 3B8QA 3QU0A 1FPUA 3OBGA 3H10A 4FKWA 1JAMA 3I81A 4YO6A 5B2LA 4F1MA 5AX3A 4EOOA 3ZU7A 3DFCB 3COIA 4JX7A 4XEYA 4IAIA 2BHEA 3EQPA 1OECA 2JDOA 2FB8A 4RPVA 4ANSA 4EZ7A 5IEYA 3QGWA 3R30A 3RCDA 4DFBA 3C0HA 2OIBA 4FTCA 3AC8A 4FL2A 5IZFA 4YJSA 3V8SA 3HUBA 1WBVA 4YTHA 4BDHA 2J4ZA 4A4XA 1JSVA 4LUDA 4ASZA 5CEMA 3KREA 4B7TA 2O5KA 2NP8A 2UV2A 4RVKA 3ZC5A 3PVGA 1JNKA 4DT9A 3HMOA 3LFQA 3LPBA 4P90A 3SDJA 4F0GA 3QQLA 4BKJA 5A4QA 5HTCA 5M44A 1YWRA 4BI1A 3HRBA 1URWA 4BDAA 5L3AA 4BCHA 2CN8A 5LCKA 2IVVA 3HMNA 4IWQA 4EBWA 3C51A 4L3LA 2R3FA 3BKBA 4Q5EA 4BI2A 3EQCA 5J1VA 4QYYA 4P4CA 3C4WA 4CFNA 3BIZA 3LJ1A 4C4JA 5JGDA 5EQPA 3T3UA 3TUDA 3PFQA 3PP1A 4G16A 1W0XC 5HGIA 2XK7A 2Z7QA 4MK0A 3UVPA 4G6LA 2RFDA 3V04A 2YM4A 4P7EA 1Q97A 2V22A 3TEIA 3FLWA 2PVHA 3WE8A 4OTDA 4E1ZA 2VGPA 3QWJA 4KS8A 4RZVA 5L6PA 3E8EA 4RX9A 3HMPA 5EOBA 5J7BA 3QD2B 4GT4A 3V5JA 3VQHA 4C35A 4FTTA 4XG3A 4EHZA 3FC1X 4AFJA 3I4BA 3LXPA 1ZMWA 3P7AA 3QQFA 4KS7A 4Z3VA 5LVNA 2UW6A 4QO9A 4PNIA 3PZHA 3VS4A 3SGCA 4TL0A 2A4LA 3P79A 2VWXA 4ZEGA 3VUMA 2OJFE 4HZRA 4XG6A 4BIEA 2Q0BA 5T3QA 4C3PA 4AZEA 4IC8A 4E4LA 4PDYA 3OW3A 2CKPA 4C36A 4EOPA 2BDWA 1M17A 2ZB1A 4MBJA 1LEWA 3CJGA 3OUKA 4PL5A 3Q60A 4QPAA 3RPOA 4TNBA 4BCOA 5JH6A 3UO6A 5J1WA 3MB7A 2JITA 1K3AA 2O2UA 1HCKA 3ZUVA 1W84A 5HZNA 4AWIA 2B0QA 4I20A 5D12A 3R04A 4ZSGA 4A9RA 3IDPA 5DPVA 3QZFA 4D2SA 4DE4A 2JAMA 3LFAA 1XQZA 3CP9A 2GDOA 2PSQA 2RKUA 3KN6A 3UG1A 4DAWA 4MNFA 5H2UA 3QQKA 4FZDB 3KULA 4F9AA 5EM7A 2JIVA 3KA0A 4MYGA 4X7QA 5DHJA 5M51A 4LRJA 4MEDA 4O7LA 4RJ8A 3ORPA 4EJNA 2I0EA 1YXSA 1MUOA 3ZSIA 5KHWA 2QOFA 1TQMA 3VBVA 3K54A 3TWJA 5BUJA 5CS6A 3FLQA 3NUPA 1O6KA 2BRBA 3D2KA 2IN6A 4FIIA 4WSQA 5M07A 3QC4A 3LIJA 4FGRA 5KMOA 1NA7A 4MX9A 1Q99A 4MBIA 5I3RA 2WMQA 3MW1A 2C1AA 3I5ZA 2F7XE 1P4OA 4YLLA 2QKRA 4E5BA 4BBMA 5DRBA 3FLZA 2R5TA 3ZMMA 1IG1A 3FAAA 3P78A 2VO6A 4C37A 4FYOA 4BF2A 2CN5A 4XX9A 2JIIA 3KXGA 5E8VA 3Q4TA 4PPCA 3CY2A 2RG5A 1XBCA 3E63A 2W1GA 4AT4A 4DINA 4ONAA 4LI5A 4F08A 3O23A 2XH5A 1QPCA 3BWJA 3V5TA 2IZTA 3VWAA 3W2RA 2GHLA 2PZIA 4Y83A 2ITQA 3EN6A 4DFZE 2RF9A 3TJDA 2WPAA 3VVHA 3L8VA 4H58A 2QHNA 4E5AX 4CG8A 4RIYB 5AM6A 4FEXA 3DU8A 4I23A 4DTKA 3TUCA 4BB4A 3U55A 3G2FA 4AW2A 5IMXA 2PUUA 3VJOA 3OT8A 3ZXTA 2OF4A 4ZJVA 3S0OA 3E7OA 3OWLA 4ID7A 4YPSA 4O7VA 2CLQA 3B2TA 2YIRA 3D14A 4BC6A 4U43A 5GIOE 1OKYA 4UXLA 5EKOA 4DBNA 4KRCA 3GB2A 1PKGA 3S2PA 5BPYA 2PUPA 5HX6A 5F95A 3FZ1A 3F82A 2FVDA 3EYHA 3C5IA 2E9VA 3Q5ZA 4QQCA 2X2MA 3NR9A 1OZ1A 2ETKA 2SRCA 3MN3A 3OXIA 4ITHA 4UYAA 4X3FA 4X0MA 4EQCA 2R3LA 4O7RA 5CVGA 4USDA 3PXZA 4YZDA 4LMNA 1FVTA 3DDPA 3PA3A 2VTAA 3GFEA 4U81A 3NLBA 5LQFA 4NW5A 3GCVA 1OIUA 1Z57A 3MA6A 5TKDA 2HXLA 3AMBA 3IW7A 4FOCA 5AR2A 4IX4A 1BMKA 4GUEA 1NXKA 3E64A 3U4WA 1WBWA 3AD5A 4N70A 1PF8A 2I1MA 5EM5A 3RCJA 4BKZA 2R3JA 2EVAA 3R7EA 1Q62A 1LR4A 4Q9ZA 5J79A 1TVOA 1QMZA 4XBRA 5GNKA 5H8GA 2W0JA 3UJGA 5FUTA 5CSXA 3KRLA 4I1ZA 3UIBA 1WCCA 3WF5A 3IO7A 4AZVA 5A6NA 2VO0A 3E62A 3R7GA 4KSQA 2GTNA 5JGBA 2XM8A 4R3PA 1U46A 3E3PA 3I6WA 1PYXA 4ZY6A 5L2QA 5CSPA 2BRGA 3MTLA 4U41A 3IECA 4C58A 3FJQE 3ZC6A 2VZ6A 2BTSA 2F7ZE 3BGQA 3F3WA 1UKHA 4Y5QA 4GSBA 3DLZA 2YLFA 2UZLA 3OF0A 4GT3A 4ALUA 4XNEA 1OMWA 4EH7A 4LRKA 3T3VA 4O7YA 3LXLA 1WBOA 5CALA 1LPUA 4ACCA 5HLPA 5IUGA 1GZNA 3FMLA 4FTKA 3OXTA 4HYHA 4ZZOA 2BTRA 4XBUA 3PP0A 3T8OA 2C3LA 1U59A 5EQEA 4DEAA 2JDVA 2WAJA 3EFWA 3KULB 3TT0A 5TOZA 1J1CA 3MFSA 4QNAA 3OT3A 3I60A 2WMBA 5CSWA 4YTIA 4L3PA 1YRPA 4ORKA 4PTGA 2VTRA 3P9JA 3A4OX 2J0KA 2JIUA 2C6MA 3Q96A 2UZVA 3FLNC 4D2WA 2XA4A 3ZM4A 2OXXA 4YJQA 4L7FA 5CYIA 1WVYA 2NRYA 4R7BA 4W4XA 4PMTA 5E1EA 4ZS4A 4M12A 4O21A 1U5RA 4FIHA 3GC0A 4N4SA 4ZTRA 4I6HA 4JDKA 4YC8A 5TE0A 3SXRA 3U51A 4RRVA 4CFXA 4CMTA 3QC9A 4E7WA 5HI2A 3PRIA 1NVRA 4OBOA 4EQUA 3TTJA 3C0IA 1ZARA 2J0LA 3LXNA 4IC7A 4M14A 4DFUA 3TDVA 3DZOA 3BBWA 4MQ2A 5AX9A 3PJ8A 1WBNA 1YKRA 3LFDA 3LFSA 4X6QC 3F69A 4JIAA 4BCFA 5HQ0A 3ORTA 4R5YA 2OW3A 4NKSA 3JVSA 4D58A 2A27A 3LFFA 4FSRA 3NX8A 4HW7A 4CV8A 2IZSA 2ZV8A 1PXPA 3MPMA 4FV6A 4Z7GA 2F7EE 1GIJA 4IQ6A 4OTHA 3F3UA 2DS1A 5E8XA 1PXIA 3UOHA 5GINE 1W8CA 3RI1A 2CNVA 5KBRA 4QQTA 3PLSA 2VTMA 3G6GA 4MCVA 5IDPA 4FSMA 5IA2A 2C6DA 4YHFA 1Y57A 4NEUA 4EH5A 2LAVA 4PL4A 4MBLA 5C1QB 4USEA 3KRRA 3S95A 4BDDA 2XNMA 3NNWA 3C0GA 3TZ7A 4LM5A 2UW9A 1SVEA 1CKJA 4FSYA 4L68A 4W4YA 5E8WA 3DQWA 4M69A 5H8EA 3TIZA 4BHNA 2CPKE 2F2CB 3DK7A 3PJ2A 2UZBA 3FZPA 3QUPA 4XUFA 5CTPA 4FIJA 3GCSA 4NL0A 3VUIA 3NUNA 5CU6A 2V55A 4FT3A 4HPTE 3GCQA 5FG8A 3IOKA 4D4RA 4FA2A 4F70A 3DY7A 5ANKA 4TWPA 3S1HA 3DQXA 5DVRA 3RWPA 3ET7A 1UVRA 3AG9A 4X3FB 5DOSA 2FO0A 4NSTA 3WZKA 5A4EA 3TNPC 1SMHA 2I0VA 1QPJA 1H8FA 3FC2A 3NRMA 3UODA 2XKCA 3R9DA 1IR3A 2OICA 2UZEA 4N57A 2Y4PA 3DFAA 1Q24A 3G5DA 3Q4ZA 3UTOA 4G5JA 5LXMA 4GUBA 1B39A 2PE1A 3KMUA 4R1YA 1J1BA 5E4HA 3R01A 4FKIA 3GU6A 1ZOEA 1ZWSA 2WO6A 4AU8A 4RC2A 4YJRA 4JR3A 5ETAA 3KF4A 4R6VA 4AZWA 4WNOA 4ENXA 4F6WA 3MY1A 4ZJJA 3EN4A 4IZAA 2C0TA 5HIBA 5GJFA 3RNIA 3G51A 5ANGA 4O0YA 5E1SA 4D28A 5LCJA 3SLSA 5E8SA 4ANOA 2XB7A 3EQIA 3BHTA 4V04A 5IQBA 2ONLA 3PUPA 2O64A 4DCAA 4XV3A 4IWDA 3DBQA 2GQRA 3H3CA 3ZFMA 2CLXA 3MH2A 5HORA 5HHWA 5DE2A 5DMZA 2WMTA 2ZJWA 5B2KA 5JMSA 3BHYA 3MTFA 4ZMFA 5KMIA 3A2CA 2WMXA 3NCGA 5DEYA 2Z8CA 3ZFYA 2WTDA 4RC3A 2V7AA 3W2QA 4UMPA 2QO9A 2C5NA 4HCVA 2E9NA 3O8PA 4ASDA 1H27A 5CXHA 4L46A 3UC4A 5FP5A 5CI6A 3E8NA 3ZLWA 1Z9XA 2C4GA 3L9LA 3UO4A 5BX0A 2GPHA 1J7IA 5IH6A 3ERKA 4ZZMA 4MD8E 5AUYA 1A06A 4FR4A 2XYUA 4FTOA 5K5XA 2P3GX 2PVYA 1YOMA 3DGKA 2IJMA 3QD0A 4MH7A 4KSPA 4MD9E 5EYMA 3KRWA 2VN9A 1AD5A 2W1DA 2XKEA 3R21A 1Q8WA 4CKJA 5DWRA 4WOVA 2Z02A 4B6LA 2R9SA 2WEIA 3TTIA 5A4CA 3GFWA 5L8KA 3AT4A 4DEGA 1PXMA 3QZGA 3RP9A 2LGCA 4GK3A 1DS5A 2ERZE 3AC1A 2W1EA 5KMMA 3UC3A 4FX3A 2WTVA 4F7SA 3OROA 1JLUE 3Q4CA 3QA8A 4NWMA 4Q2AA 4X2KA 5I9ZA 4KBAA 3C4EA 4DFXE 2YWVA 3QTRA 4S31A 4L6QA 1R39A 4YUQA 3Q2JA 5JFSA 4QTCA 4ANQA 3U6HA 5LMBA 1OPLA 4CTCA 4RX5A 5I5ZA 1JSUA 5BMMA 2QKWB 4GJ2A 5DEWA 2WTKC 5ICPA 2W17A 5GHVA 3OHTA 4D2PA 1OL1A 1PHKA 2XJ1A 4X2JA 5ANDA 4B0GA 2VWVA 3QTZA 3FY2A 4C7TA 4FE2A 4WSYA 2CNQA 4EH6A 3F9NA 3OW4A 3DAJA 4OBPA 3DV3A 1QPEA 4YJPA 4F1TA 5M4IA 2GNFA 4DLIA 3RTPA 5E8TA 3QAME 2J2IB 5D11A 1OL6A 4BDKA 3SG8A 4M69B 3THBA 4CZUA 3SVVA 5HOAA 2B53A 1H1RA 4K1BA 2UVYA 4CTBA 2W4JA 1PKDA 3U9NA 4EOLA 3UNZA 3DZQA 5HO6A 2ZDTA 1YOJA 5A4TA 1CSNA 3E87A 4XMOA 4IDTA 2JKKA 3QA0A 4M15A 1WBPA 3O50A 4YLKA 1UNGA 2CJMA 3LQ8A 1RDQE 2JDTA 3WYYA 3W32A 3VQUA 4FGBA 5HNBA 4WRGA 1SM2A 2VTSA 2PVMA 5L6OA 2PUNA 4ZIMA 3HLLA 3TV4A 3P4KA 1R3CA 3RZFA 5LVMA 4UN0C 3SHEA 2OIDA 2YAAA 3KMMA 4ZTSA 4NTSA 1L8TA 4BCQA 4O7TA 1JQHA 3DJ7A 1YDSE 5CI7A 4A9YA 3NUYA 4BRXA 4X6RA 5AUTA 3DXPA 2W06A 3DDQA 4FEVA 3AOXA 3QLFA 5FXQA 2HAKA 4Q9SA 3K3JA 5HG8A 2X6EA 2WMVA 4KIPA 5I0BA 5AAEA 5KNJA 2BAQA 3GQIA 4BCGA 4GH2A 3D5VA 1UU7A 4I22A 3VC4A 3LKMA 3ENHA 2IZRA 4FNYA 2BALA 3QF9A 1PJKA 1Y6BA 3LHJA 3RWQA 3T9IA 3FLSA 3NS9A 4E6QA 3HP5A 1OKVA 4AN3A 3BYMA 5E91A 2W9FB 4TYJA 4YZ9A 3ROYA 4AZTA 4F99A 1UU3A 2P55A 3HV7A 2XK6A 1OUYA 3BEAA 4G3FA 4LL5A 2X2LA 1LP4A 4GYIA 4WBOA 3HV6A 4MTAA 4BDJA 5D7VA 5AEPA 5EYKA 2VTOA 4M67A 1YI3A 3QALE 2QOOA 1A48A 3FYJX 2O0UA 4IVDA 2JKMA 1V0BA 2VWYA 4BDBA 1PXKA 1V0PA 2VX0A 3DKGA 3R02A 3R8LA 3VUTA 5AP6A 2PY3A 3LJ2A 2AC3A 2XNGA 1APME 2CKEA 3VS2A 2HWOA 1H24A 5JZNA 3ORXA 4WNPA 3TZ9A 4D0XA 2Y0AA 5DLSA 5HNGA 5FGKA 2FH9A 5CQUA 3PJ3A 5D1JA 4D2VA 3AC3A 2G9XA 4JBVA 4V0GB 5FP6A 2XRWA 3ULIA 4ENYA 2Q83A 3A7JA 4O83A 4C2WA 3PY3A 3R7IA 5LJJA 3LCOA 3QQJA 2YACA 3ZO4A 4D9TA 2FUMA 5EHLA 4IDVA 4JAJA 4BDFA 5BNJA 2XNBA 3WZEA 3FXXA 3QX4A 5CU3A 5AR8A 3UIUA 4YJVA 2W4KA 2ITTA 3N4VA 2QO7A 2Q0NA 3ZO1A 3LQ3A 4O38A 3FXZA 3DXQA 2XNPA 4EK5A 4E3CA 2JD5A 4JAIA 5BVKA 1ZY5A 4O7ZA 2R3MA 2VRXA 4H36A 2GFSA 3LMIA 4F65A 3U8WA 4QQ5A 3GU5A 2XRUA 3DAKA 3UQFA 3MFRA 1WVXA 1V0OA 4W4WA 1YHSA 2GS2A 4IJ9A 4IFCA 4PMSA 2XNNA 4RZWA 4NYEA 1YW2A 1KE5A 2C5VA 3TKHA 1KV1A 3DK3A 3DKFA 5EHOA 4F6SA 5JN2A 5FQDC 5HTIA 3PSDA 4JG7A 4A07A 2FA2A 2V0DA 2Y4IC 3CR0A 4KIOA 4K2RA 4FUYA 5BYLA 2QOCA 1KWPA 5LMKC 2BIYA 4FKVA 3V51A 4TXCA 3WARA 3M42A 4EH3A 3DAEA 3OCSA 2YM7A 5AFVA 5HCXA 3F61A 3QYZA 4Y95A 1Q3WA 2R3NA 2VTIA 3DXNA 5F1ZA 3UDBA 5HIEA 5JFWA 4MAOA 3UIXA 3MESA 1Q3DA 4WO5A 4F7JA 3W18A 3UOLA 3C9WA 5M08A 4UWYA 5E8UA 3Q6WA 2QC6A 3ZDUA 1DM2A 4WD5A 5L2TA 1CMKE 3E93A 1OPKA 3BELA 4ZLZA 4IMYA 2H8HA 3HAVA 3VHEA 4V05A 3UE4A 4GYGA 3A8XA 2WXVA 4I0SA 4E8AA 4O27B 4E6CA 2XIKA 2WEVA 3HDMA 4U42A 3S3IA 3SOCA 5CX9A 2YJRA 2WIHA 3F5UA 3AD6A 4F64A 5M56A 3RM7A 4U3YA 4HVGA 1YWVA 2OG8A 5AUVA 2C5XA 3V5WA 1YDTE 4NCTA 4OTIA 2VTQA 5C8MA 4CMOA 5JQ5A 4IB3A 3ID6C 4TYGA 5IKWA 3ZUTA 2X9FA 3HA8A 3MJ1A 4HYIA 1Q5KA 3SD0A 3CQUA 4OT6A 3N4TA 3JY0A 5KO1A 3TM0A 4YZNA 4RC4A 1IASA 2OK1A 3TZ8A 4W8EA 4HGSA 4EONA 4Z7HA 4RIYA 4EOKA 4R78A 4WRSA 4L44A 3IDCA 1Q8UA 3OY3A 4QMVA 3VS5A 3BEGA 4GW8A 4HGEA 4ZOGA 2JAVA 3DBDA 1MQ4A 4QMLA 4YHTA 5JT2A 3O71A 1JKTA 4OTQA 3MB6A 2XK4A 2DWBA 3CTJA 3CPBA 1UV5A 4FK3A 4UMUA 3MFTA 3UZTA 3C4FA 3MDYA 1H0WA 3IS5A 2CGWA 3R1NA 5GZ9A 5CENA 1O6YA 5L2IA 2PE2A 3FDNA 4LGGA 3VUDA 3QRIA 1XH6A 2OH0E 1GIHA 3A7GA 3ENMA 2VWIA 3POZA 4IX6A 2W1CA 4KA3A 2OJIA 3MGYA 4NJ3A 3Q9WA 2BILB 4FG9A 3HNGA 5DR2A 4WNKA 3MWUA 5AP4A 3PXFA 5DR6A 4R8QA 3FHIA 4DA5A 3ZXZA 4I94A 4L67A 5E90A 3CQEA 3I6UA 1KUTA 4U97A 2C69A 4EEVA 2YM3A 5IMEA 4CT2A 5CEOA 4NKAA 3BLHA 3IW8A 3CBLA 1O9UA 3FMMA 4BTJA 3R2YA 3GC9A 4J99A 2QCSA 2XKDA 1ZOHA 3TZMA 3IONA 4AGDA 1JPAA 5L8LA 1W83A 1FQ1B 4IWPA 4L43A 1H08A 3WF9A 5AP0A 2EXMA 3H0YA 4NH1A 3DJ5A 1G5SA 1XWSA 4DC2A 3KXMA 4O2ZA 4YNOA 4IJPA 3QCXA 3PA5A 4CQEA 4J97A 3D15A 4C57A 1WZYA 1UWJA 2VO3A 4H3QA 3D94A 3SQQA 5BUIA 4O81A 4LQMA 5AR4A 3ZO2A 4IAAA 2FSMX 2WMUA 3FUPA 3LLTA 2Y8OA 4JQ7A 4J95A 3EWHA 3KU2A 1G8SA 4FVRA 4GS6A 4O1OA 5B7VA 4YZMA 3CGOA 3ZLSA 4QMQA 2OFUA 4UY9A 4ALVA 5M06A 3KKVA 3VBTA 2ESMA 5DN3A 2X1NA 3EKKA 5L2SA 4AZFA 2WU6A 3FMKA 3AC5A 2GHGA 1DI8A 2HK5A 3W2OA 1NT2A 1BX6A 4C33A 3R8PA 1T46A 4FV4A 4ZS0A 2CDZA 2F9GA 2C6KA 5EDQA 3BGPA 4KRDA 4D1SA 3RNYA 2J9MA 3RMFA 5JKGA 4FTIA 3PXYA 5EW3A 1KSWA 3D9VA 5K0KA 2Z7RA 3UZPA 1T45A 5AV0A 2HW7A 4X3JA 4XOZA 5LVLA 3TV6A 5CEPA 4DLJA 4L53A 3VIDA 2JGZA 5A54A 2QHMA 3FQEA 3PSCA 2R2PA 1ZYJA 4EK6A 3A7IA 1Q41A 4YZCA 5GJDA 3E5AA 1FMOE 4KKEA 3DS6A 2OXYA 1JBPE 3DPKA 3FL5A 3BZ3A 3BRBA 4QMYA 5FEEA 4XG7A 4F9BA 4JQ8A 4YURA 4FKGA 2UZTA 1H25A 4OR5A 2OLCA 4R1VA 4FV2A 3GOKA 1G3NA 2VTJA 3W1FA 2NNWB 4ACDA 5AMNA 5CANA 4CD0A 2XCKA 3IGOA 4UXQA 3UVRA 2XIZA 4TNDA 3W8LA 1FINA 2YZAA 3MH1A 5LVPA 4I5PA 3CIKA 4PQNA 4Z16A 3NIEA 3NUUA 3NYXA 2ITOA 4H1JA 5A3XA 4AP7A 3O96A 4GFMA 4EK3A 4RVLA 4BWKA 1IRKA 1WVWA 1KOAA 3RGFA 2Z60A 4XLVA 3HV3A 3POOA 4QP6A 4ASEA 4BWPA 4RSSA 5GZAA 2DQ7X 4WG3A 4O0VA 3GT8A 3UYSA 5HE2A 4ITIA 3UBDA 3QRJA 2HY81 1YXUA 3L9PA 2XVDA 5C4LA 3OWPA 3TKIA 3TL8A 3TN8A 5IISA 5CNNA 1H1PA 1S9JA 2WU7A 2YIWA 3WOWA 3MVHA 4CZTA 3D7TA 1IA9A 1H0VA 4K77A 4FKSA 3ANQA 2B7AA 3PJCA 3MA3A 4XOYA 5HCYA 3CJFA 4CCUA 3D7ZA 2GNGA 4RT7A 4R3RA 1F0QA 2C6TA 5IEVA 3SAYA 3OCBA 5FDXA 4G1WA 4RJ3A 2OZAA 3OCGA 5IG1A 4H05A 4JBOA 2W05A 5CZHA 4CGAA 3ZEPA 4DEBA 5HTBA 4X2FA 3SW4A 3V01A 4DH3A 3LMHA 2B1PA 1RE8A 4E6AA 4QP4A 4ZLYA 4RJ7A 1PY5A 5C26A 3BU5A 3JS2A 1LEZA 2HY0A 5D7AA 4D5KA 3GUBA 4NM5A 4A7CA 1EH4A 4EHEA 3R28A 1Z5MA 3VS6A 2DUVA 3L8SA 3UMWA 2XEYA 5LMAA 3LJ0A 4FSZA 3NPCA 4M13A 5CU2A 3RAIA 2QOKA 4QPMA 5DRDA 4DGGA 3NGAA 5IUIA 3DA6A 4GG7A 3FQSA 2CNUA 5IA0A 2EU9A 4HGLA 5JK3A 3QKKA 2X4ZA 3QCSA 4WUAA 3WF8A
chains in the Genus database with same CATH superfamily
2UW3A 3FHRA 4XS2A 5HBHA 2DYLA 4L7SA 4O86A 5IQGA 3DCVA 3N51A 5DT3A 4AACA 5GZ8A 3P7BA 3QX2A 3W0MA 4QMZA 1XMLA 3HDNA 4A9TA 3BHUA 3MV5A 3R1SA 5J95A 4CRLA 4DGOA 3ROCA 4O2PA 4EL9A 5FD2A 2YCFA 4D1XA 3SRVA 5E9EA 1O6LA 3UYTA 3FQHA 4HNIA 4RIXA 5BYYA 4ANNA 2IZUA 3QTQA 2WD1A 1H01A 4BDCA 3D83A 3V6RA 4DGNA 3L8PA 2VTLA 3OVVA 4C4GA 5C8NA 2R3IA 2BZJA 1GY3A 1GZOA 5K9IA 3NVKI 3VF8A 4L9IA 3OTUA 4G9CA 4I5HA 5HEZA 2BPMA 2BRNA 3GENA 4O0SA 1UU8A 4AQCA 5CAUA 2BDJA 3W0OA 4E4NA 4LGDA 3GNIB 3PG1A 5ANEA 3L9MA 4JBPA 3PRFA 4KABA 2P2HA 3D5XA 2ZV9A 5KMJA 4OTGA 4UX9A 3QTIA 5JZJA 1VZOA 4IM0A 2C6LA 2X8IA 5HD7A 5BUEA 2XK3A 3ATSA 4HOKA 3A99A 1FVRA 5ETIA 3RK5A 3TDWA 4E26A 5LOHA 4KIKA 3AMAA 4J53A 4RLKA 2BZIB 3I0OA 1PRYA 4FEQA 3W33A 5D41A 2PZRA 4I0RA 4GIHA 4FSWA 4FTRA 4O0UA 4O84A 3PXQA 2WHBA 3VRYA 2A1AB 5E92A 2YA9A 2C1BA 3KB7A 4BCNA 1IAJA 3HKOA 2YWPA 2C5YA 3H9OA 4MXAA 4XRJA 4EQMA 3C7QA 4O4EA 2WQBA 3OOMA 4RWLA 3ZRLA 2YM8A 5IF1A 3DNDA 3HRCA 1XHAA 4PPBA 2GHMA 3VS7A 2PPQA 3EH9A 3TKUA 4FOBA 1J91A 2BR1A 4M66A 4RFZA 3UDSA 4OBQA 3VUGA 3CSVA 5I9VA 3UP2A 4D9UA 5CQWA 5F20A 2BMCA 4KBKA 5FXSA 4EYJA 3KMWA 4TYIA 1ZLTA 2F49A 5AUWA 2CKQA 2WELA 3QCYA 3Q53A 4BICA 3MH0A 1JKLA 4DH5A 4DYMA 2G15A 4R7HA 4U9AA 3HECA 4XJ0A 3NCZA 3D7TB 4QMNA 3ZUUA 4GEOA 2EWAA 1URCA 2HZ4A 3LFBA 4FV3A 3ZYAA 5CAOA 4R77A 4PX6A 4U7ZA 4L42A 4ANMA 2BFYA 2B52A 3BE2A 4WG4A 1XO2B 1XKKA 4AX8A 3VHKA 4DCEA 4A9UA 3KK8A 4FZ6A 2VWZA 4XG8A 4JXFA 1XJDA 3OEZA 4JDHA 2C6OA 2OZAB 5GJGA 3V8WA 3V5PA 3C13A 5K3YA 4CNHA 4IANA 4QQJA 2BZKB 4FSTA 3O8TA 1OL7A 4BDEA 3TNWA 1ZMUA 4WT6A 4ANLA 3ZM9A 4TYHA 2WB8A 3BU6A 3EJ1A 3HZTA 4FTMA 4ZSLA 5T6KA 4QMOA 4QMTA 4O82A 3E8DA 3RAWA 1PMNA 2PMNX 4NW6A 3BYUA 1OM1A 3PPZA 4MQ1A 2C6IA 3NIZA 4OTWA 4A4LA 1REJA 4M0ZA 4BCKA 4FT7A 4EKLA 3B2WA 2VU3A 1SNXA 4S34A 5IA1A 4ZXTA 3LCKA 3R2BA 4EORA 4USFA 2WGJA 2JDSA 4IBMA 4RGJA 3F2RA 3DBEA 1R78A 2P2IA 2XCHA 3Q3BA 5M4FA 1WFCA 2ZM1A 3R8VA 4AGUA 2E9UA 3HUCA 3HV5A 4FZFB 5AAGA 4LUEA 2RGPA 1S9IA 4S33A 2KULA 4YO4A 5EG3A 4RIWA 3SKCA 3W10A 1KE9A 2AC5A 5BVOA 1VR2A 4MKCA 1DAYA 4U44A 3F7ZA 2ZV7A 5BVDA 2YCRA 2YITA 4H3BA 4DHJA 4B8LA 4F0IA 3GU8A 4GKIA 3PZEA 1BLXA 1TQPA 2C30A 4IH8A 4CEGA 1VYZA 3SRVB 2J0IA 2PE0A 2QR8A 4RLLA 4I6FA 4UV0A 3BCEA 3FMJA 4RIXB 5CWZA 4BCJA 4MF0A 4EOMA 4ZMEA 3ZZWA 4GV1A 4XP3A 4CFVA 4I6BA 2GTMA 3ORMA 4MNEA 4GCJA 4QTEA 5J9ZA 2VWBA 2CMWA 3WIKA 3A8WA 3OUNB 4HNFA 4JDJA 4EKKA 2PVJA 1QPDA 3FMEA 4O1PA 3O51A 2VAGA 2WTKB 4LOPA 4Z9LA 3A4PA 5HG7A 2X7FA 3SXSA 2NPQA 1SZMA 2EUFB 5FTQA 4QPSA 4IADA 5CSVA 2QVSE 4FMQA 4QMPA 2BAJA 2OH4A 3C4ZA 4G6NA 3SC1A 2V62A 3QZHA 4FKRA 1M2PA 1RJBA 4U45A 4V0GA 2REIA 4S32A 1F3MC 3FMDA 4AZSA 5CAPA 2CGVA 4L45A 3OFMA 4LDTA 3PSBA 4TWCA 3JUHA 5DT4A 3E3BX 5BVEA 4EOIA 2YZLA 4DFNA 4QD6A 4KIKB 4I4FA 5HBEA 4AT3A 3EOCA 4L3JA 3F3ZA 4M7IA 4Y72A 4P2KA 4FEUA 3ZHPC 4AOTA 2BIKB 3DKCA 2JBPA 5FTGA 4D5HA 4FG8A 2J7TA 2IPXA 4GK4A 1FGIA 1V1KA 2H6DA 3EN7A 2YJSA 3ORLA 3IK3A 4RQVA 4RVMA 1OL2A 4DG3E 2R0UA 4AA4A 5A46A 2YDKA 4OAUC 2X9EA 4AA0A 1B38A 1OGUA 3BX5A 3FZOA 4IACA 4M84A 4TT7A 4GT5A 2GNIA 2WTWA 5HE3A 5I9YA 5ITAA 4U40A 3FI8A 3NUAA 2R7BA 3SV0A 4JDIA 3MBLA 4DG0E 3LE6A 3PVBA 2QO2A 3GEQA 4J98A 3MH3A 4QT1A 4XH6A 2GQGA 2OU7A 4TYEA 4CSVA 4C0TA 3PDTA 4ZTLA 2X6DA 3DJ6A 2WFYA 1U54A 2O8YA 3OBJA 4X2NA 4O96A 3HX4A 3PIZA 4W9XA 5AP2A 3R7OA 3ZBFA 2JLDA 3FXWA 4UMTA 2IVTA 4F7NA 2YIXA 3UMXA 2PULA 2BRHA 5F4NA 1FOTA 3HRFA 3VBXA 1ERKA 5AUUA 2R4BA 2WTCA 4IAZA 3VBWA 5CAVA 3UVQA 2ITZA 1KE7A 2GMXA 4IM3A 2XP2A 5AP3A 5IDNA 2E9PA 3ACJA 2XAMA 3CD8A 4NTTA 4U6RA 4FEWA 4XV9A 3WF7A 2OSCA 1ZXEA 2W1HA 3ALOA 3L9NA 4K9YA 5L6WL 4O22A 2Y6OA 3LM0A 4IAKA 3IG7A 3TUBA 3AGLA 3FSFA 2H9VA 1BKXA 2P4IA 3QQHA 4JIKA 2CGXA 4YTFA 3R7YA 2IG7A 1NY3A 3KCFA 3O8UA 2OJGA 3U87A 5KMNA 2G2HA 3QTUA 5KCVA 3R8MA 4K0YA 4KD1A 4FKQA 3EYGA 4TTHB 3ORIA 3QBNA 3ZEWA 3W0SA 2ITUA 1M2QA 2ITWA 3LCSA 5FM2A 4YBKA 4TYHB 4EK4A 4YHJA 2EXCX 1CKPA 3COMA 4RX7A 3D4QA 4XG9A 4ZJIA 5M53A 3BL7A 4L01A 4LG4A 2HIWA 3KCKA 4J8NA 5AIRA 4O0WA 2JFMA 5H9BA 3SXFA 4FZ7A 4KAOA 4QP7A 4EZ5A 3R9NA 2PL0A 4N6YA 4IHPA 4QRCA 5KKRC 3LQ5A 2XNEA 3B8RA 3FBVA 1P2AA 4XLIA 4QTDA 3ALNA 5J9YA 3TV7A 4PDOA 4A4OA 2XM9A 1DI9A 5FBNC 1RW8A 1JSTA 2Z2WA 3EQDA 3QHRA 4FIGA 4ZTHA 4BHZA 3KXNA 3BLAA 2G2FA 3G0FA 3M2WA 3OOGA 3K5VA 3Q32A 5A9UA 5BMSA 1GZ8A 2GNJA 2ZOQA 3G0EA 2PU8A 1QL6A 2ZV2A 4RIWB 2OF2A 4FKUA 4CCBA 2Y7JA 4CLJA 2YM5A 1YXTA 2VUWA 2JBOA 2XBAA 1SNUA 1CDKA 3MPTA 3QRKA 4O4DA 5CT0A 4EC9A 1ZRZA 3DB8A 3FPMA 2X4FA 1H1WA 3KVWA 4FKLA 3EL8A 4FV7A 2UUEA 5EW8A 3VS0A 3DNEA 4OW8A 3FYKX 5I4NA 1U5QA 4UYNA 2XZSA 4ZSAA 3GU7A 1KE6A 3LCDA 5EM6A 2Z7LA 4ZLOA 4J8MA 1BUHA 1KV2A 2RL5A 3PXRA 4FSNA 5DBXA 3RHKA 3T9TA 4DG2E 4IB1A 4G2FA 2F57A 2XEZA 2BKZA 4LMUA 2PMOX 3A60A 4J1RA 4MNEB 5ACBC 4FIEA 4BJJA 3F66A 3UIMA 3PE1A 4BFMA 3GQLA 2G1TA 4NM0A 2QU5A 5EFQA 3ZFXA 3V8TA 2RFEA 3N9XA 4JR7A 4DH1A 3F3TA 1MRVA 1YI4A 2ZM3A 3Q9XA 4ITJA 2H34A 2QD9A 1K9AA 5M4CA 2PHKA 4JVGA 3TJCA 5CSHA 2Y4IB 4HCUA 5LARA 1H00A 3MJ2A 2XYNA 4MXZA 4HGTA 5AADA 1UNLA 4BI0A 2BAKA 3TIYA 1G8JA 3WZUA 2Z7SA 3C4XA 3IW4A 4G3DA 4D4VA 3I0QA 3OEFX 2BROA 5J7HA 4QP9A 1E1VA 4LV7A 4ERKA 2AYPA 3K5UA 3PY1A 2ITNA 4FYNA 2EXEA 4UALA 1YOLA 4XRLA 4U80A 2QLUA 4IEBA 4RVTA 2XJ2A 5C4KA 2J0JA 2GU8A 3LFNA 3RBWA 1P14A 2B54A 3MIAA 3NWWA 3R83A 3BI6A 3FE3A 3PWYA 5A6OA 5HU9A 5IQIA 3IQ7A 3HVCA 2HZ0A 3NAYA 4GU9A 5IA3A 1OVEA 3S4QA 2ONLC 3E88A 3W16A 4YGAA 2QG5A 4M0YA 4GFOA 4QMWA 5EYCA 4BGGA 3UQCA 1NVSA 3QHWA 3RK9A 4DGLC 1KE8A 5AA8A 2V7OA 2HENA 2E9OA 1U54B 5L8JA 5CF6A 2B4SB 4GFGA 2C3IB 3W0NA 3NDMA 3JPVA 4IE9A 3UG2A 2R3PA 5I9WA 4FTAA 3ZTXA 5J5TA 3CCNA 3QQGA 4PDPA 3I1AA 1BL7A 2XK8A 1OBDA 3EHAA 4O4BB 2H96A 4CG9A 4EH2A 4FV9A 3EQBA 3R7VA 4FG7A 3KGAA 3ACKA 1XH5A 3TNHA 2W99B 1WMKA 1HOWA 2J5EA 4C4HA 2WTJA 3AQVA 1ZYCA 2X0QA 4NM7A 3RPYA 3R9RA 4ACHA 3FY0A 4O0TA 3HGKA 3EN9A 5BVWA 4YSJA 4EOJA 4FTJA 2IW9A 3UNJA 5TF9A 4CFUA 1OUKA 3PYYA 3PY0A 3CEKA 3ODYX 3Q52A 3HA6A 5EI6A 2XANA 1M7QA 2QOIA 2WQMA 3GP0A 2P0CA 2UW0A 4CKIA 4QNYA 2BRMA 3EZVA 2OXDA 5KE0A 3ELJA 1ST0A 3KL8A 3LLAA 4N0SA 2ZYBA 4QMUA 4QP2A 2RFSA 5CU4A 5EM8A 4JLCA 3M11A 5ANOA 3Q04A 5AAFA 5CAQA 4KUJA 3FMNA 2R3KA 1J3HA 3DLSA 2X2KA 2EB3A 5FRIA 1TQIA 3C50A 1JVPP 2YLEA 3EN5A 4JL9A 4AAAA 4E20A 2QI8A 5BVNA 4IM2A 4RWJA 4ERWA 3H9FA 2QG7A 2XNOA 3G15A 5CU0A 4E4MA 1ZY4A 2ZVAA 2YCQA 4Y8DA 1M52A 1ZZ2A 4A9SA 2I7QA 5IQHA 4ZTQA 1BI7A 1CM8A 2IEWA 4IZ5A 4WBBB 1GIIA 4A06A 3QQUA 4TW9A 4U0IA 5HBJA 5K5NA 4DT8A 3ZS5A 2YHVA 3UZRA 4FT9A 2ITVA 5DFPA 4DFYA 5DIAA 4GRBA 1R0EA 2J6MA 5HVYA 5TR6A 1STCE 2FSTX 2WMWA 4F6UA 4RBLA 4F09A 4JI9A 2R64A 2B9HA 3I79A 5DR9A 2PMIA 5ETFA 3C1XA 5HIDA 4F9CA 1REKA 3VAPA 3UPXA 3KC3A 4QP3A 3H9RA 5EHYA 4EH9A 2ZMDA 2CSNA 1H28A 4RWKA 1SYKA 5ETCA 3HEGA 5AP7A 4IAYA 2CCIA 2VWWA 2W5HA 2PZ5A 2UVXA 4DH8A 4BY9E 2GFCA 2C0IA 2X8EA 4YJNA 3NYNA 3IW5A 2VTNA 2WQEA 4YTCA 4LV5A 1WBSA 3QYWA 2XJ0A 3L8XA 1FBNA 3ZH8A 2ITXA 2UZDA 4FUXA 4NFNA 4QMXA 3TG1A 1WBTA 4AGWA 3VS3A 3WBLA 1H1QA 1NVQA 4G9RA 4BZDA 3FI3A 4BGQA 5CNOA 5FEQA 4LRMA 4EYMA 4PMPA 4QYFA 1H26A 2WMAA 1HCLA 5AV3A 3ZLXA 2PTKA 3BGZA 2IWIA 3NNUA 1IEPA 4HCTA 4OTPA 4ACMA 4I0TA 2GCDA 2C47A 2F4JA 4K18A 5KMLA 1PMVA 4MXXA 4O4FA 5FWKK 3OWJA 3ZONA 4DEHA 3BV3A 3FZRA 4F0FA 2WNTA 3VNTA 3R6XA 3JYAA 4D2RA 2VNYA 4C02A 5AA9A 4DHIB 3QUEA 3IKAA 5JRSA 3Q9ZA 3JR1A 2GNHA 5IQDA 2XK9A 4EZ3A 4AN9A 3PTGA 4WA9A 2YDJA 3Q9YA 4X2GA 4TZRA 5JGAA 4YNEA 3O0GA 4MVFA 5CF5A 3KFAA 4OAVB 2VO7A 1FGKA 2QR7A 2ZM4A 2YCSA 5FLFA 4UZHA 4HVDA 3UDTA 2YABA 4U5JA 4ALWA 4BIDA 4YU2A 4BBEA 2I0HA 1PMUA 1YDRE 4WNMA 2UZWE 2HZIA 1PXOA 2R7IA 4MUQA 4FNZA 5I3OA 2I0YA 4JG6A 2ZDUA 2RSVA 4ANBA 1Y8GA 3PIYA 3CC6A 4CQGA 4ZTMA 4FTLA 3HP2A 2OZOA 5C8KA 4YJOA 5J8IA 5KZ0A 4L52A 5CASA 3ZRMA 5HCZA 2A0CX 5BYZA 2J90A 3QKLA 4AXCA 3P0MA 4KKHA 3CS9A 1TFFA 4O6LA 1SVGA 2B55A 2YAKA 5C27A 4AOIA 3FKOA 4J52A 2HWPA 4O0RA 3D2IA 3DK6A 5M57A 4UMQA 3JY9A 4PWNA 5TO8A 4CV9A 3OTVA 4G3CA 1IAHA 2B9IA 2BFXA 1YWNA 5IQFA 3AC4A 3QLGA 4I93A 3CY3A 4FVPA 4KWPA 1ZMVA 4BCIA 5JFXA 4C8BA 4J71A 2HXQA 4YC3A 2VX1A 4MHAA 2UZNA 4EBVA 4FL3A 3PLAE 1UA2A 3EFKA 4G3EA 1L3RE 2QURA 1GZKA 3R1YA 3UOKA 4UB7A 3TXOA 3WILA 1H1SA 4AN2A 3DB6A 3W2CA 2AQXA 4EK8A 4F1OA 4K33A 5AR5A 1Y6AA 4EUTA 2ZB0A 5BQ0A 1ND4A 4OTFA 1OI9A 2VWUA 4ZSEA 4AXDA 1XH7A 2BVAA 3DT1A 4L00A 3PIXA 4B8MA 4KKGA 2BCJA 1Q61A 3SW7A 4GL9A 1M2RA 3KXXA 3QD3A 3O5AA 1SVHA 3IDBA 4MD7E 3P86A 5LWMA 4JT3A 4R3CA 4BN1A 1JKKA 2BUJA 4Q5HA 3QRUA 2F2UA 3F5PA 4CMUA 3WI6A 5IU2A 1Q8TA 4CFWA 5HKMA 5D9HA 2UW7A 4YJUA 1OKWA 4YMJA 3BYSA 1Q4LA 1XBAA 2OI4X 2O65A 4RMZA 2WOTA 4OLIA 5AV1A 3LZBA 3CE3A 4PDSA 1OIYA 4WG5A 2R3HA 3VO3A 2PWLA 4JOAA 4KBCA 5EQYA 2RG6A 1ZYDA 5FDPA 4AG8A 4CXAA 2VV9A 3MYGA 2XS0A 4IIRA 5IPJA 3FWQA 2YERA 3EKNA 4C2VA 4RIOA 3BWFA 4BWXA 3MSSA 5DI1A 1W7HA 1ZOGA 3RZBA 2PZYA 3I7BA 1OPJA 2QODA 5IQEA 5KMKA 4KNBA 3MY0A 3VUHA 4EHGA 3QTXA 3ZCLA 3NZ0A 4FV0A 4GVAA 1G8AA 3R0TA 5I9UA 4CFMA 4FKTA 3WYXA 4BTKA 5L4QA 4FVQA 4G34A 2OJJA 3SA0A 3F5XA 2CHLA 3UO5A 3LMGA 5A4LA 4C62A 1OIQA 3IPHA 3QGYA 4G17A 4FI1A 4UZDA 4YZBA 1WAKA 5AV2A 4GIIA 4NT4A 2W7XA 4FK6A 4Y73A 2OIQA 1RQQA 3PXKA 4NCTC 3FKNA 4O6EA 3UP7A 3VW6A 5CLPA 3PWDA 3ODZX 3VF9A 2YM6A 2HOGA 1YHWA 2GS6A 4PPAA 4PP9A 5IUHA 3UGCA 4PV0A 3ZSGA 3ITZA 3MVLA 4AT5A 4P5ZA 4I92A 4BDIA 2C68A 3Q5IA 3R73A 1BI8A 3KIOC 2VX3A 5IQAA 4HJOA 4F63A 4QP1A 2YIYA 1JKSA 3MVJA 3HL7A 2XAOA 3RVGA 4CZYB 3COKA 4UMRA 1W98A 4IVCA 4YBJA 4FKPA 4JMQA 3R8ZA 3V3VA 4BTMA 2QOQA 3EFJA 3NAXA 4IFGA 2QOBA 3G33A 1PMEA 2O3PA 4PY1A 4Y5HA 4ACGA 4LV8A 1B6CB 4HVSA 5FBOA 2FYSA 3R22A 3E92A 4D4SA 2Y6MA 3KF7A 1KOBA 2WMRA 2PK9A 3G90X 3E8CA 3RPRA 5EH0A 4U79A 3VJNA 5K0XA 1BYGA 1FVVA 3PJ1A 1ATPE 4C3RA 3R00A 4AE9A 5C01A 4BZOA 3LOKA 4FTNA 3FPQA 2JEDA 3KQ7A 3RAHA 5CT7A 2IW6A 5AJQA 4DBXA 2W1FA 1XH4A 4DN5A 2GQSA 3ZRKA 2OBJA 3ZDIA 3ZZEA 4TRLA 5LWNA 3OMVA 4EWHA 3I5NA 5G1XA 4AXAA 4WUNA 4HYUA 4FSQA 5DGZA 3W55A 3NW6A 1G8KA 3OG7A 2PMLX 3F7WA 1XR1A 5AR7A 4G31A 4YLJA 3Q4UA 4RQKA 2XBJA 4AW0A 4BZNA 5C03A 1H4LA 2QONA 3G6HA 3O17A 3KXZA 4XCUA 4H3PA 1X8BA 2EB2A 3CD3A 4NIFA 2UW4A 3DKOA 2OFVA 2ZMCA 2X81A 3QTSA 4I24A 4DEIA 4CYJA 3CTHA 1YQJA 3KEXA 3LXKA 3PPKA 4TKSA 4IX5A 4R5SA 4WIHA 5EK7A 5H3QA 4PTCA 3FSKA 2VTHA 3BBTB 4QOXA 4F9YA 2CCHA 4DH7A 2W9ZB 5IEXA 4DTAA 3VUKA 5IQCA 3R7UA 2XARA 5EI2A 4ZY5A 3QXOA 4X21A 1XH9A 5HO7A 4D1ZA 1H07A 2W4OA 1YVJA 2A2AA 3KRXA 3OP5A 5AM7A 1QCFA 3BPRA 4E93A 3REPA 3FEGA 3R71A 3R8UA 4CFFA 4FKOA 5J87A 2J5FA 2XALA 4I6QA 4S30A 3NYOA 5JEBA 4O0XA 4XP0A 3BQRA 2W96B 4NU1A 1ST4A 1ZYSA 4MXYA 4CLIA 3OXZA 4FV5A 4NJDA 3V5QA 3EQFA 3EMGA 5L2WA 1R1WA 2IVSA 3GC7A 3MVMA 3Q2MA 1IA8A 2IW8A 3RALA 5DA3A 3KRJA 2YDIA 2C5OA 2R3RA 3LAUA 3LM5A 4K11A 4Y46A 4RX8A 1M7NA 3EB0A 4FTUA 5IH4A 4O7WA 3QKMA 3G9NA 3OC1A 2UVZA 2WTIA 3U9CA 4BR3A 4DF3A 2XIRA 2ITPA 3NMUF 4GVJA 3K2LA 2RFNA 3CTQA 3TACA 1M14A 4B4LA 4I5CA 3D5WA 4UWCA 3OCTA 4ZP5A 4RWIA 4GU6A 4JRVA 4QP8A 4QYHA 3HMMA 4O91A 3SX9A 4RFYA 4NK9A 2C3KA 3P7CA 3FI2A 4AXEA 4IB0A 2J0MB 3GBZA 2VTTA 5J9LA 4M68A 4GKHA 3VW8A 4C61A 4CT1A 4DTBA 3NYVA 4U3ZA 3PVWA 5J5SA 2UW5A 5CVFA 4TY1A 1NW1A 4DEDA 3VN9A 3VBQA 3P5KA 5E8YA 4RJ5A 5CEKA 5CF4A 2UW8A 3NVMB 4OGRA 2ACXA 2X7OA 3A62A 3NUXA 4R7IA 4UWBA 3ORNA 4GJ3A 2C6EA 4IVAA 3BE9A 3W8QA 1ZYLA 3F88A 1GJOA 4H1MA 1MRUA 4IW0A 2RIOA 2VGOA 3GGFA 3EFLA 4EH8A 3IW6A 4FIFA 2X0PA 4C4EA 5K4JA 4LOOA 5HNIX 3AC2A 3ZOSA 2PVKA 5I9XA 2NYAA 3OZ6A 2ETRA 4E5WA 4KB8A 4F4PA 3HV4A 4ARKA 4DITA 4J7BA 1AQ1A 4JX3A 4NZWB 3KVXA 3EQGA 1J7UA 2O63A 2QLQA 3A7HA 1I44A 3RHXA 2KTYA 4APCA 4E73A 3P08A 4D4YA 4FNXA 4FSUA 2OKRA 1VEBA 3QRTA 4FNWA 3BLQA 1Y8YA 3V5LA 5HD4A 3QXPA 4I5MA 3OWKA 4TPTA 5CVHA 2WZJA 4FODA 4HPUE 3FZSA 4PRJA 2E2BA 5LVOA 1P5EA 3II5A 3P23A 3QTWA 3H0ZA 3WF6A 1Y91A 1VYWA 4G5PA 1K2PA 5HVKA 3CPCA 2BZHB 1UWHA 2ITYA 2OO8X 2WIPA 4GMYA 5M55A 1R0PA 3PG3A 4FKJA 2GSFA 4W8DA 2OGVA 1Q8ZA 2PZPA 3A61A 4X3FC 4EJ7A 4KINA 5AP5A 2PVFA 4MWHA 1OL5A 3O7LD 3F3VA 4XYFA 1JOWB 3PE2A 2PVRA 4RJ6A 5G6VA 2QNJA 4YP8A 4RJ4A 3H4JA 3PPJA 4RA5A 4ZY4A 3LW0A 3NUSA 3BQCA 4M97A 2VD5A 3ZSHA 5FXRA 3C5UA 4XP2A 4PP7A 4IZ7A 5LMKA 5T68A 2G01A 2XIYA 2HCKA 4IZYA 5FEDA 2JC6A 3KN5A 3MIYA 5AUZA 3U4UA 4NIFB 3IOPA 3W0QA 3H30A 4PTEA 3NNVA 4EWQA 5KZIA 1PXLA 2FSOX 4FC0A 1OBGA 4MWIA 3CKXA 3KK9A 2FSLX 2HZNA 4O7SA 3NSZA 5HG9A 4EHVA 1AGWA 1YXVA 4IWOA 2J50A 2UZOA 1U4DA 2WMSA 3R1QA 4RG0A 5B0XA 5M09A 1W82A 4B99A 3P1AA 2I6LA 4HVIA 5AV4A 3EQRA 5EDPA 3KXHA 1TKIA 2IF8A 4G6OA 3ULZA 3QWKA 4O7NA 3LVPA 2X7GA 4II5A 4UBAA 2HELA 3VBYA 4F9WA 3PFYA 3WZJA 1OKZA 3FV8A 3FI4A 4M3QA 4YR8A 2B9FA 4XHKB 2HYYA 3HYHA 3JVRA 5DH3A 4UEUA 3SOAA 2PVLA 4QYGA 5AWMA 3VULA 4EOSA 2NO3A 5KKRB 3ATTA 3NEWA 3EQHA 2YIQA 3QZIA 3GC8A 4ZK5A 3GCUA 2XIXA 4I3ZA 2GS7A 3CQWA 3PA4A 5CY3A 2BKKA 2FGIA 2W5AA 3S00A 4W4VA 2R3GA 3RAKA 2R0IA 3RKBA 3ORZA 4D2TA 4DFLA 2JKQA 4W9WA 3CLYA 4DEEA 4DHFA 2QOHA 2YEXA 3MPAA 3NNXA 4V01A 3I7CA 2P33A 3ZBXA 4XV1A 3VS1A 4MF1A 3C4CA 4ZAUA 4HYSA 2IO6A 3TNQB 1PXNA 3BHVA 2OJ9A 1DAWA 3ANRA 4FZAB 1PW2A 4F7LA 2YISA 1PYEA 1UU9A 3WIGA 3UOJA 4EUUA 2G2IA 4BVUA 2J51A 3CXWA 4JJRA 2AUHA 3A7FA 3GXLA 4TN6A 5KBQA 4JQEA 3UQGA 4FICA 3W2PA 4JS8A 4PNKA 3OD6X 3AMYA 4FTQA 3FMHA 4BCMA 4FV8A 4MXCA 2ETMA 2WKMA 4C4IA 4ZSJA 4OUCA 5FM3A 3TI1A 3LFCA 2CGUA 3NW7A 3BV2A 3ZLYA 1MRYA 5HE0A 4AA5A 2HW6A 1VJYA 1ZZLA 4E4XA 4ASXA 4PF4A 5CZIA 2JFLA 4CVAA 2ERKA 5EW9A 4C4FA 2W1ZA 2YN8A 3QUDA 1BL6A 2XMYA 5EYDA 3QL8A 5HLWA 1OIRA 4GK2A 4FT0A 3CGFA 4Y85A 5TT7A 1ZAOA 1GNGA 2I40A 2Y9QA 4YPDA 4NUSA 5ANIA 2W1IA 2C3JA 5CXZA 4LGHA 1UKIA 1A9UA 2A19B 2PVNA 3GCPA 4FL1A 5A14A 5HX8A 5HG5A 4D55A 4IB5A 3HMIA 4QTAA 5F9EA 4J96A 4JBQA 5EOLA 4M8TA 5K4IA 2PYWA 4PMMA 4WKQA 2QOLA 4FT5A 5AIKA 3FLYA 3BHHA 3BYVA 5FTOA 4YC6A 4H39A 3V6SA 5DT0A 5JSMA 4YSMA 3DBCA 4BIBA 4RFMA 1J7LA 4PL3A 2WQOA 4EI4A 2WOUA 3MY5A 5EDRA 3CKWA