2OXXA

Protein kinase ck2 in complex with tetrabromobenzoimidazole derivatives k17, k22 and k32
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
325
structure length
325
Chain Sequence
SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKILQNLCGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLYPTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMIDHELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVDLQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKIAKVLGTDGLNVYLNKYRIELDPQLEALVGRHSRKPWLKFMNADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQQVRAAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Casein kinase II subunit alpha
publication title The ATP-Binding Site of Protein Kinase CK2 Holds a Positive Electrostatic Area and Conserved Water Molecules.
pubmed doi rcsb
source organism Zea mays
molecule tags Transferase
total genus 98
structure length 325
sequence length 325
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2007-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2oxxA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2oxxA02
5CALA 4LMNA 4IVBA 4IX4A 3FZPA 4PDPA 4JDIA 1OKVA 3MH3A 3UVPA 1WBOA 1YXTA 4MVFA 4JOAA 4YJSA 4OAVB 2UVZA 2B0QA 4E6QA 3D0EA 2JLDA 3R9OA 3PVGA 4UYAA 2IG7A 2Z8CA 3VBTA 4BVUA 4LUDA 2Y4PA 4FUXA 3F5XA 2O5KA 5ANEA 2XKFA 4BCGA 5BYLA 1PJKA 3WI6A 3P7BA 3MJ1A 2G1TA 3R30A 3E5AA 5LVMA 2PZ5A 3VUMA 4MWIA 1UU8A 1WVYA 2C6LA 3GC7A 3KRWA 2WMQA 3MGYA 2EXCX 4IDVA 4QQJA 4EOLA 4BL1A 2YM8A 3FKOA 3HP5A 3IGOA 4RJ8A 3R8MA 3PA4A 5J7BA 2PVNA 3DJ5A 4H1JA 1H8FA 4UXQA 4WNMA 3QD0A 3QX4A 5IH4A 2WTKB 5E8UA 2PMNX 3FE3A 4L46A 4PUZA 5LMBA 3A7GA 5KMNA 4JX3A 3ORPA 3R9HA 5GZ8A 1PMNA 3IS5A 1A9UA 4YJOA 4AA0A 5K0XA 2XJ2A 3O8UA 3DDPA 3I5NA 4OBPA 1FGKA 2CPKE 3F7ZA 4YUQA 1PXMA 4PPBA 1W0XC 1J3HA 3ODZX 2ETKA 2WQBA 3POZA 5AADA 5JK3A 2R3NA 2W17A 3QRJA 2XKCA 4F6WA 5C4LA 4G31A 4BCQA 2A4LA 2O64A 4NW6A 3K5VA 5LWMA 4I6QA 3A8WA 2ZM4A 3CBLA 4ASEA 4F09A 4ACHA 1K9AA 3KF4A 4PL3A 4GEOA 4DGOA 2JFMA 4IZAA 4RFMA 4FL2A 5IQFA 5AUUA 2IZUA 3ZC5A 2HCKA 5IISA 3SOAA 2J0MB 4IM2A 4JBQA 4LM5A 1VZOA 5CEPA 3W18A 2HZIA 1HOWA 4NKAA 4YZ9A 3G5DA 1Z9XA 3RNIA 2VTIA 2BILB 1XH7A 3PA3A 2GNJA 3KXHA 4G3CA 3IW5A 3QHWA 4B6LA 2H96A 4BCOA 4RGJA 1RDQE 4HCTA 1M2QA 3OTVA 4QMNA 4MNEB 4BCPA 4BI0A 4FNYA 4P2KA 2XNBA 3R22A 3RK5A 4E26A 3AT4A 1PXKA 3QTSA 2OKRA 3ZBFA 3AG9A 1FGIA 3DK6A 3HUBA 3QTIA 2P4IA 5D7VA 2I40A 4ZP5A 3C7QA 4DFUA 3ZONA 3EYGA 4PQNA 3EQDA 4AQCA 3KK9A 3PWDA 5C03A 1O9UA 2R3KA 4Q9SA 5HG7A 3PY0A 4CFXA 3KK8A 5KCVA 2PMIA 4QMXA 4A9SA 3OS3A 2X7OA 3UBDA 3U9CA 4AFEA 2ETMA 4TPTA 4X2KA 2H34A 4NJ3A 4WG5A 3BEGA 3DB8A 4R8QA 2B9HA 3RPRA 3E3PA 2F7ZE 3L9NA 2PZRA 2B52A 2BRHA 5M44A 3FQSA 2GU8A 5CSXA 5C8NA 4PV0A 4ZSAA 3ENHA 2GCDA 2FSLX 4L3PA 3KB7A 4NJDA 3QGYA 4ZJIA 4DH5A 2JBPA 5CZIA 4DTKA 3V8TA 4A07A 4EH4A 5JQ5A 4XRLA 5CI7A 4TL0A 3EL7A 3R9RA 1IA9A 1PRYA 4K9YA 1CDKA 4O0TA 3DGKA 1JOWB 1GIHA 4K1BA 3OXTA 5HO7A 2OZOA 4X2NA 4USFA 3QRIA 5I0BA 2BRGA 2PY3A 1UVRA 3GNIB 3T3VA 3ZO3A 5FDXA 3D4QA 3LXKA 4QTCA 3LAUA 5CYIA 4C33A 3V5TA 4Y95A 5HTIA 5I3OA 2R7BA 4JXFA 2C0OA 2RGPA 4KNBA 4PMTA 4ZEGA 2PUIA 1ATPE 4ALVA 3ORMA 1ZZ2A 5AR5A 2BRBA 4IJPA 4NIFA 4B8MA 3QWKA 1URCA 4Z55A 4LGGA 3EN4A 4E5WA 1FQ1B 3TEIA 3GFWA 4U45A 3CY3A 3MFTA 5DMZA 3E7VA 3P08A 3ERKA 3UTOA 5AUYA 3WYXA 5C27A 4U41A 4CD0A 3TG1A 1Q62A 2C68A 2JKMA 3BQCA 3D2IA 3GFEA 5GNKA 1WCCA 2CNQA 4AUAA 1LEZA 3P86A 1YW2A 3MDYA 4ZJVA 4AZTA 5CAPA 5JGBA 1ZMUA 5HD7A 1OKYA 3F5PA 4R5SA 4AT4A 4DF3A 4XLIA 4F1TA 2P3GX 2VNYA 3IW8A 2O3PA 3C4ZA 3TT0A 3LFFA 5L3AA 4E5AX 1M7NA 3BYUA 3RZBA 4IQ6A 4PL5A 5E7RA 4ERWA 5HGIA 2J51A 5L2QA 4IFGA 3EOCA 2FGIA 1X8BA 5EW3A 2JIUA 2O65A 3NEWA 2PUUA 4FICA 4IM3A 2PVRA 2PVMA 2UW5A 2B9JA 5TE0A 4QMTA 4U8ZA 1ND4A 3D9VA 4RG0A 4GKHA 5FG8A 4KKHA 2ZV2A 3FY2A 3ET7A 4LUEA 4C62A 4PDYA 5JFSA 2W7XA 2C6MA 2RFSA 4DEAA 1LPUA 4EC9A 3UPXA 1NVSA 5ACKA 4FR4A 2QI8A 3PXKA 1Q8WA 3VF8A 2Y6OA 3O7LB 1XH6A 2YCQA 4AF3A 2BZHB 4RA5A 2WPAA 4FG8A 2IVVA 3V5LA 4CT2A 4E4LA 4F4PA 3BX5A 5HIEA 3PWYA 1FVTA 1IAJA 4K11A 1U54A 4QYEA 3OW3A 4XJ0A 2UV2A 4ZXTA 4C4JA 4CLJA 1JSVA 2UVXA 5T3QA 3DXNA 4BF2A 4L6QA 5LCJA 3G0FA 5IKWA 3UIMA 3QD2B 4FOBA 1JSTA 3NDMA 4L68A 4HVSA 3D94A 4DEHA 1XR1A 3EWHA 3QKLA 3QQFA 2QOHA 4YTHA 1WZYA 4BDIA 4ZIMA 4ZSEA 2XNPA 2W9ZB 5CX9A 2W99B 5DIAA 3LJ1A 3GCSA 4TRLA 3ZXTA 4EC8A 3BYVA 4FL1A 4A4XA 2WHBA 4RRVA 5J1VA 1RQQA 3EH9A 2BZKB 5EHLA 4C34A 4CYIA 4E4MA 5KMMA 3NAYA 4CQGA 4FSUA 4I23A 4IAKA 3RGFA 4YTIA 4F63A 3QRUA 1YHSA 4C2WA 2GS2A 5BVFA 4OW8A 4FV3A 4FT9A 4IAYA 4HPTE 3SD0A 4FOCA 2OJGA 3MN3A 2C3IB 2OIQA 2F2UA 3PPJA 3NUPA 3W33A 2C6OA 3DBEA 1JSUA 4XP0A 4A9TA 2YIWA 3FMNA 3MTFA 4QT1A 3N9XA 3DU8A 4LV5A 5IDNA 2OG8A 3QXPA 5KZ0A 3DDQA 2HWPA 4U81A 3UG2A 3VHEA 2XIYA 3K3JA 2F7EE 3ORTA 4CTCA 2Y8OA 2XKDA 3IG7A 3S1HA 1OMWA 1OPLA 4OR5A 4ZMEA 3TM0A 2X7GA 3RPYA 5E8ZA 5IH6A 3D7TA 1GZKA 4RJ4A 5HBJA 4DFNA 3FMJA 4ZTSA 2JAMA 2WMTA 4OTRA 3QTXA 3P4KA 1OITA 1WBVA 3DFCB 3GU6A 5HCYA 2JDRA 2PTKA 4L00A 3ZLSA 3PG3A 3QKKA 1AQ1A 4G5JA 4E73A 4FSYA 1B38A 2WTIA 3SOCA 5BMMA 3HMMA 3NNVA 4M84A 5IQCA 4HJOA 4JIKA 4O7TA 3FMKA 5DT4A 5EM5A 4E20A 3VS3A 5HHWA 2WTKC 4LMUA 5EHOA 4BFMA 4RWJA 4C58A 2OF4A 5L2TA 4YJRA 4AU8A 2VWXA 3PSDA 1GY3A 2JKOA 3KY2A 4QP3A 5ANGA 4YJNA 3B2WA 3R2YA 3PZHA 1R39A 3NX8A 4M7IA 4CNHA 4M8TA 4FKRA 4FV9A 4RBLA 2BRNA 3ATTA 3REPA 4GIHA 1JKSA 4XG8A 2W1EA 4IX6A 5E8YA 5EDPA 2GNFA 4FZFB 3FSKA 2Q0NA 2XF0A 2UZEA 4NFNA 3UZPA 4IAAA 5CXHA 1Y8GA 3MH1A 2ZB0A 2V62A 3UG1A 3M11A 4L43A 2QO9A 4YLLA 2XBJA 3WF8A 2NP8A 3HAVA 1H27A 3LFSA 4AOTA 5HBEA 5CU4A 4FUYA 2VWVA 3IW6A 4M15A 3MI9A 4UZHA 4O81A 5CQUA 4DT8A 4U3YA 3ZEPA 2UW9A 2YACA 3PXZA 2BTSA 3CY2A 4NCTA 5EKOA 3NLBA 1SVEA 4KBAA 2BDFA 3FQEA 5CU3A 4Q5EA 1XBAA 4FZ7A 3VS2A 3F5GA 4XCUA 4I0RA 4I93A 4YHFA 5M55A 4LL5A 4GT3A 4RMZA 2VNWA 2VTMA 5AMNA 4UEUA 2BIKB 4M3QA 4RZVA 2XK3A 2Q0BA 3QKMA 3Q5IA 2OZAA 3V8SA 3V5PA 3OXZA 2F9GA 4FV8A 4ORKA 4M69B 4O86A 5FTGA 1CSNA 2IVUA 2WIPA 3ANQA 4LG4A 2R3QA 3MA3A 3NWWA 3P1AA 2IZSA 1KOAA 1YKRA 2X2LA 4O7YA 4AW2A 1R0EA 4EK4A 4BHNA 4TW9A 5IQIA 3MTLA 4JX7A 4EI4A 3OY1A 4F0GA 5C26A 3UOLA 1H1PA 4XS2A 1JBPE 4C4HA 2XK8A 4MBLA 4YJVA 2W05A 4GFGA 3EB0A 4QP9A 3GCPA 3IK3A 3WOWA 2UW8A 4E5BA 5E90A 4XX9A 3ZDUA 4EWQA 3UNJA 4R3RA 2R3LA 5EI2A 2A1AB 3R73A 3I6UA 4EOJA 1WBTA 3HRBA 4BKJA 4DHFA 4S31A 3LHJA 3QCSA 3LQ8A 4WNKA 3UVQA 1OL2A 2E2BA 2YABA 4QQTA 2XNOA 2XCKA 4XBRA 5AFVA 2GDOA 3H0ZA 2YM4A 3VN9A 3IQ7A 4N6YA 5FTOA 3NR9A 3R63A 5J9ZA 4ONAA 3RK7A 2B7AA 3R02A 2RF9A 2XYNA 1XH5A 2QOCA 4W9XA 5IG1A 5C4KA 1G8SA 4YPDA 3LMHA 4YC6A 5CSWA 4F9CA 3LMIA 2PHKA 4FTJA 2ITOA 2WGJA 4L44A 4YNEA 4FIEA 4UWYA 3BE9A 4WOVA 1O6LA 2WO6A 3MVJA 2OFUA 4MTAA 4ACDA 4Z7HA 5JFXA 1ZAOA 4DN5A 1H07A 4QMLA 3R8PA 4M13A 1YDSE 2RSVA 2FB8A 3LFCA 5HTCA 3VVHA 5AR7A 4JG7A 3ITZA 2I7QA 2IW8A 4CV8A 2BFXA 2C3KA 1B6CB 2Y0AA 3DPKA 3F69A 4ITIA 4AT3A 4C3RA 3A62A 2PVLA 2WMXA 5CWZA 5GZ9A 3CLYA 4EKKA 5K5NA 2ERKA 3KF7A 2HOGA 4V04A 5AJQA 4DC2A 3NGAA 2W1DA 5HCXA 4ANOA 4KWPA 2PVKA 3EN5A 4Y46A 1P14A 3HVCA 2UUEA 5LVNA 4F0IA 3E88A 4J53A 4A9YA 2AUHA 2DS1A 5IUIA 4EBWA 5FM3A 2XMYA 2F7XE 3WE8A 5IA5A 4RFZA 3RALA 4AW1A 2CKPA 1YXXA 1R1WA 4KSPA 4KIKB 4BI1A 4BIDA 1G8AA 3PVBA 3TJDA 2BR1A 2VX0A 2V7OA 4XLVA 4EK3A 3ZRMA 1CMKE 1H0WA 3Q2JA 1SVHA 4BC6A 4GVJA 4IE9A 4NL0A 5D9HA 5HE2A 3R7YA 2CGWA 3RM6A 1IASA 3I6WA 1U46A 4D0WA 1OKWA 3MPTA 3BIZA 3KXGA 4MEDA 4ZTNA 4BDBA 1YI4A 2UVYA 4MCVA 3VBVA 4BZOA 3D5WA 1B39A 2PPQA 3WYYA 3Q9WA 5KE0A 1OPKA 4AE6A 5AP0A 2OK1A 4AGUA 5CANA 4OBQA 4FKUA 4GJ3A 4C0TA 3BGPA 2YCRA 3CQEA 3TJCA 3N4UA 1OIRA 2YHVA 2XK7A 4GIIA 2VRXA 3LIJA 4GRBA 2W5BA 3ACJA 4QYYA 5I9UA 4TWNA 3RHXA 3FUPA 2YM6A 3TV7A 4E6AA 4EWHA 2OW3A 5A6OA 5LJJA 4UN0C 1OIQA 4HGEA 4RC3A 4UBAA 4FKPA 4ITJA 5AP2A 4GL9A 2VWIA 1U54B 4W4VA 2XK9A 4C7TA 4F7LA 4KS7A 2C47A 3QTQA 4J8MA 4QYHA 4NFMA 4DG0E 4QMUA 3DFAA 3LFDA 4O0WA 2YDJA 4U40A 3D5XA 4JRVA 2C6KA 4DTAA 4BBMA 1GAGA 4WT6A 5FTQA 3R1QA 4ENXA 4HGSA 4Y73A 5BUJA 3FC1X 3NNUA 1YHWA 4DH1A 2PUPA 4AG8A 3HV4A 4FT7A 1FINA 3GENA 4L53A 4CRLA 2YIQA 3SG9A 4F65A 3QHRA 3ZM9A 4HNFA 3QALE 3S2PA 4BGGA 3OWLA 3UC3A 4AT5A 1IG1A 3QQJA 3VBXA 3A60A 4JDJA 1ZWSA 4WNPA 1TQPA 4F0FA 3VUHA 5DR9A 4U7ZA 2ITQA 3R7VA 2WZJA 2CN5A 3CPBA 4RQVA 1OL7A 4FNZA 1K2PA 3OUKA 4FX3A 2BAQA 4O2ZA 1MQ4A 4GJ2A 4UWCA 2RG5A 2YDKA 4PTCA 2YN8A 1Q4LA 3I0QA 3MS9A 4NKSA 2HZ0A 3TZMA 4U43A 3AC8A 4X3FC 2GHMA 2OIDA 3I7CA 3KVWA 2JDTA 5CAUA 3BBWA 3QC4A 3DB6A 4FSRA 4MH7A 4C38A 5L8KA 1KE9A 3EQPA 2PWLA 4RC2A 3DS6A 4NTSA 3A99A 3F3ZA 1YXVA 4CKJA 2ONLA 3G90X 4FV0A 5M06A 2GPHA 2JAVA 3ETAA 3RINA 3GP0A 3D7TB 3CIKA 4O7NA 2PZIA 4H39A 4N0SA 4DGMA 5CU0A 3SRVA 4IC7A 2QHMA 3UPZA 4S34A 4L7FA 1JNKA 1WMKA 4HZSA 4UWBA 4K18A 1OL1A 3PVUA 4GUBA 3FI2A 3VS1A 4BRXA 4HZRA 2QOLA 3FHRA 4YHTA 2FSTX 4EL9A 5E9EA 3Q32A 3R7EA 3UQGA 3ORKA 5FBNC 5HU3A 3SLSA 3F6XA 4IADA 4MXAA 3CKWA 5AR4A 5IQDA 3UNZA 3VS5A 3D14A 2VTTA 3CJFA 4J7BA 5EH0A 5GZAA 4FKSA 4AOIA 4HYSA 3ZDIA 4X7QA 2KTYA 3C1XA 3BV3A 1W7HA 2E9UA 2I0HA 5HX8A 2C1AA 4FSMA 3VW6A 2WTJA 3LFNA 4DG3E 5AV4A 1SVGA 4PMMA 1PYEA 4FIGA 4LRMA 4LYNA 4XG6A 4YZMA 3BYMA 5DFPA 2CCIA 5E8XA 1NXKA 4C4GA 4GU6A 1URWA 1FBNA 5E1EA 3G9LX 1KWPA 4CFNA 4U97A 2VWUA 3AMYA 3MSSA 3SV0A 3LFEA 4BCMA 1G3NA 3UOJA 3D15A 4AGDA 3BBTB 4FVQA 4NZWB 2QOIA 1UNHA 3HDMA 4H3QA 4D2PA 5FQDC 3W2OA 4X21A 3PXQA 4LOOA 2HYYA 2QHNA 4YZNA 1VJYA 4C2VA 2VX1A 2YERA 3C5UA 4BWPA 5KMLA 4JBVA 3R04A 2QOOA 4BTJA 4HVHA 3OCTA 4XEYA 3JUHA 4USEA 3ZSIA 5IQHA 2VN9A 3H30A 5CVHA 5E1SA 5K5XA 1ZOGA 2R0UA 3KXXA 3QLGA 4FKTA 3CEKA 3BRBA 2G2HA 2WOUA 2UZVA 2XP2A 4I20A 4G3FA 5AAGA 4NWMA 4DFYA 2F2CB 4S33A 3BE2A 3PJ3A 4GMYA 3HEGA 4G6OA 1KE7A 4RIWA 3UO4A 3BHHA 5BVWA 3IGGA 4B99A 4WG4A 4D1XA 4FGRA 5IMEA 3VNTA 4M67A 4OTPA 2VTHA 2JDVA 2XS0A 2AC3A 3W8LA 2EU9A 1FOTA 3HECA 3MY1A 1OIUA 1ZXEA 2OZAB 4O6LA 5HKMA 5EOLA 3ZFYA 3LOKA 4UMQA 5KO1A 4DT9A 3H9RA 3CJGA 2W9FB 3FLNC 4MWHA 3PXYA 5F1ZA 1Q5KA 1PKGA 2IN6A 1PW2A 5ANDA 3S3IA 1SYKA 1DI8A 4IMYA 5AP7A 3JY0A 1M2RA 3HP2A 4E1ZA 3LE6A 3FXXA 1U5RA 1MRYA 4RVLA 5EYDA 1BI7A 2C5YA 4YR8A 2OWBA 1UKHA 5FDPA 3FLSA 1PXIA 1JAMA 1Q61A 2ZMDA 4O96A 2YCFA 3EMGA 3FMHA 3QCYA 4RWKA 4TT7A 2J9MA 4BDJA 4ZSGA 1YDRE 4HYUA 4M0YA 3W2RA 3IDCA 5EQEA 3ZFXA 3QRKA 2X2MA 4LI5A 4QTAA 3UO5A 3GOKA 3NW6A 2QCSA 3NUYA 3DLSA 4F9AA 3R7GA 3NYNA 2GQGA 3VJNA 4F70A 5IQGA 3OMVA 2R3MA 3E8CA 4GSBA 5ACBC 5L8LA 3NYOA 3C4CA 1UNLA 4PL4A 2XVDA 3QQLA 1H1SA 4YC8A 2VD5A 2X9FA 3B8RA 5J8IA 1M17A 5HBHA 4D4RA 4EHVA 1KE8A 2WQMA 2ERZE 3GCQA 5AP5A 4G17A 4BWKA 5J9LA 4YZBA 5CEQA 5HCZA 5CI6A 3PZEA 3ULIA 4L45A 3QZHA 1KE5A 5TF9A 3K2LA 2B1PA 3LXPA 4C3PA 4XMOA 2QQ7A 5ANIA 2Y6MA 5LVPA 1NVRA 1U4DA 4FGBA 4JLCA 4KS8A 2BDWA 5FLFA 3I1AA 5ANOA 3K54A 5KKRB 2GNGA 4X2GA 4E93A 4O0YA 3P7AA 3VAPA 2YIYA 3VUTA 4BDGA 3PPKA 1Q8TA 3ZMMA 3PA5A 4EOIA 4FVPA 3HAMA 4XNEA 3WZJA 4RWIA 5A4EA 4N70A 3QAME 5F20A 3O8PA 3CKXA 4S2ZA 4D9TA 5LWNA 4F64A 2PZYA 4AN3A 3U6IA 5ETAA 3EQFA 2Y4IB 2BALA 4C36A 4ZTRA 4S30A 4I1ZA 3KL8A 4PPCA 2B4SB 3FPQA 4Z9LA 2EB3A 5LXMA 3OTUA 1QPEA 1H01A 2C5OA 3QQUA 4WRGA 5FEQA 4DE4A 5LMKC 5EYMA 4O7WA 3B2TA 3FHIA 3W2CA 4O6EA 4BCKA 4RT7A 4AX8A 4RJ7A 4H3BA 2VZ6A 4O1PA 4PPAA 4HVIA 2OXYA 3Q4CA 3SW7A 3EN7A 1LEWA 5GJGA 3KN5A 3Q52A 4FZ6A 3RCDA 5AUZA 1OUKA 3F7WA 4Y72A 4MXXA 3W55A 4TWPA 2C69A 4O21A 3WZKA 2J6MA 4CQEA 4D4VA 1JKKA 2R3FA 3ENMA 4YNOA 5EW8A 2BKZA 5AV3A 5IEYA 2ZM3A 2Q83A 3SGCA 4ALWA 4R7BA 3AC3A 5KMIA 4D4YA 4O82A 5JFVA 1XBBA 2CGUA 3F61A 5A6NA 3W16A 3OOMA 2E9PA 3NYXA 3ZUUA 3OC1A 5IA0A 2XIZA 3KXNA 3OT8A 3VBWA 3MB6A 4D5HA 3NCGA 4D1SA 1DAWA 4CFVA 3C0GA 4TYIA 3WF7A 3RAHA 4Y5QA 1VYZA 3ZRLA 2WEIA 4I94A 1M52A 4FE2A 2BMCA 1STCE 3LFBA 4O22A 3U6HA 2PSQA 3BWFA 3WF9A 4EH7A 2FA2A 4LRJA 3PJ2A 4JQEA 5A3XA 5T68A 3SXSA 4C02A 4BBFA 1PMEA 4RA4A 3BU5A 3FZ1A 3EQRA 3VRZA 1E1VA 3THBA 4FSZA 4GV1A 5L2IA 1L8TA 2P33A 5DEYA 4ZSLA 3WIGA 4EOOA 4F6SA 2GNLA 1RE8A 2YIXA 1YI6A 4G3EA 2R64A 2E9VA 1ZARA 5BX0A 3QA8A 3MH2A 4FKQA 4QP4A 4CZUA 4D0XA 5LARA 5ANKA 3QL8A 5KMKA 1R0PA 5DWRA 4IB3A 4J99A 4GK4A 2VTNA 4ZJJA 3CCNA 1R78A 3DQXA 4IH8A 5HICA 2BIYA 3O51A 3WBLA 3ZRKA 5IDPA 4P5QA 3ZLWA 5CF4A 2QO2A 3DAKA 3QCXA 4CZTA 4U80A 2WOTA 3PLSA 1MRUA 1M7QA 5A54A 3RKBA 2OLCA 3HZTA 3FZTA 3LJ0A 3KXMA 4DFXE 3PP0A 3ZLYA 1KE6A 2EWAA 5M07A 2XNEA 3TKHA 3ORLA 4FKGA 3U6JA 2C6IA 3F3TA 1ZZLA 4AZEA 4RX8A 4TYEA 2ITXA 4W4WA 4YO6A 1BKXA 3ZS5A 3TUCA 3KGAA 1Q97A 2QG7A 4YHJA 2XCHA 3C4WA 2XM8A 4XV2A 3C4EA 3I7BA 5CVFA 4IDTA 4AA5A 4BDFA 2NNWB 5HNGA 4G5PA 4FKLA 2VTPA 1F3MC 1YXSA 4UZDA 4WA9A 2YAKA 3NVMB 4CGAA 3NVKI 1WAKA 5L6WL 4JRNA 1PHKA 4Z7GA 3PE1A 3ANRA 5G6VA 2JGZA 5AV1A 5F4NA 2XIXA 3MH0A 4CG8A 2QOKA 5H3QA 1JKLA 5KNJA 4AZVA 2DQ7X 3DNEA 2XJ1A 4G9RA 3ZZWA 4WG3A 4RIYA 3W10A 2X39A 3PJ1A 4J97A 1NW1A 3A7FA 3FZOA 4XG3A 1Z5MA 4NK9A 2YWPA 5IPJA 2CLXA 2QR8A 3RPSA 5IZFA 3DQWA 1KV1A 4GFMA 4G1WA 5CEKA 2X2KA 4DCEA 4I4EA 4UMTA 3Q60A 4JT3A 4Q9ZA 5DT3A 5ETFA 3VBQA 4UX9A 2X9EA 3GU5A 3FXZA 3D5VA 3CPCA 1E9HA 4IANA 4JAIA 3TZ8A 1DS5A 4EK6A 1ZLTA 3PIZA 5DG5A 4ASDA 4H3PA 3HMOA 2RIOA 4KBKA 2G2IA 3CGOA 4JDHA 5ETCA 4LQMA 3AD5A 4JG6A 2X4FA 3TUDA 4ZTHA 5FRIA 4CFUA 4F99A 5J7HA 4DTBA 3HYHA 4R6VA 3CQUA 4X0MA 4K77A 5IA4A 4NYEA 1XHAA 1OKZA 4JNWA 3QQHA 2OU7A 4RX7A 4F08A 3UZTA 2EVAA 3MVMA 2R7IA 4BTKA 1Y8YA 2C5VA 3Q3BA 3QQKA 4GKIA 4QPMA 5D12A 1KUTA 4CKRA 3DBCA 2XBAA 2XRUA 3LM5A 2JIVA 4JR3A 4X6QC 4PMSA 5JEBA 1REJA 4QPSA 3DBFA 5DN3A 2R9SA 5BYZA 1A06A 4DH3A 1BMKA 2J0KA 3KXZA 3O8TA 2OI4X 4FKWA 4BGHA 4FTTA 2XKEA 2C30A 3EYHA 2W4OA 4JJRA 1ZYJA 4CFMA 2W0JA 2BPMA 4O7VA 2BRMA 4RVTA 3TWJA 3FPMA 3R2BA 3MB7A 4BZNA 4BYIA 2OJFE 4MXZA 5M4FA 3BU6A 4FTNA 4WO5A 5JN2A 4DCAA 1T46A 3L8XA 4HVDA 1V0BA 4EH2A 2C4GA 1Y6AA 5EDRA 3DCVA 3QWJA 4G6NA 4GK3A 3WZDA 3CP9A 1U5QA 1PXNA 4XBUA 1QPJA 3COMA 3IW4A 4IVDA 4UV0A 4NM5A 4X2FA 3ZUTA 1Y91A 3DKFA 4QP2A 3W2PA 5DNRA 3RM7A 3CD3A 4OT5A 4QO9A 1QPCA 3Q4UA 5JRQA 2B55A 4BCHA 3NUNA 3RCJA 4FTCA 3BELA 3PRIA 3QTWA 3KMWA 4WNOA 3VQUA 1Q8YA 4TNBA 2UW0A 4FZAB 5B7VA 3AXWA 3VBYA 4GG5A 3VHKA 4YZCA 4APCA 2UW7A 3M1SA 4J8NA 3RWQA 5JFWA 4TYHA 2OBJA 1BUHA 4DGNA 3UC4A 2P0CA 2JC6A 2WNTA 3MIYA 2YIRA 4PDSA 3ZYAA 4ZLZA 2Z7SA 3BHTA 3QD4A 4K8AA 5T6KA 4QTEA 4XYFA 2OJIA 3MY0A 1K3AA 2RKUA 4FV5A 4X2JA 3OOGA 3DXPA 5K9IA 3F2AA 3MESA 3G15A 2V22A 4F6UA 3ALNA 3D5UA 3O71A 4ZZNA 2XIKA 2OH4A 3EL8A 2G2FA 4XOYA 3EN6A 4FV4A 2UW6A 3UOHA 3UP2A 2YAAA 4YTCA 4FTKA 2ZMCA 5D1JA 3DBQA 3E62A 5HE3A 1HCLA 4HCUA 5KX8A 2XIRA 1E1XA 2FO0A 4FTMA 5E8WA 5FGKA 1NA7A 4G9CA 4LRKA 5KKRC 4GCJA 3PSBA 2C3LA 3KU2A 4FKVA 2WMBA 1A48A 2QR7A 3GEQA 4KD1A 1Q3DA 2R4BA 4MX9A 1SNUA 3FL5A 2CDZA 4TYJA 3MVHA 4LL0A 3SA0A 1XH4A 4L3JA 3QQGA 2CNUA 2BZJA 2B53A 2Y4IC 3RAIA 3EQBA 2ZV8A 4CCBA 4H05A 3LXLA 5E8TA 3EFWA 5HX6A 1W8CA 3GXLA 2PK9A 5HIDA 4QMYA 2C1BA 2GMXA 4R78A 2ITYA 1NY3A 3TIYA 3GQIA 4P7EA 4P5ZA 2JBOA 4C37A 2ITWA 3TV4A 3NNXA 1W98A 5FWKK 3PXFA 2WMWA 5J5TA 2PE2A 1F5QA 1ZYCA 4FV6A 4QMZA 2X6DA 4WRSA 5CAVA 3HMNA 2CSNA 4JG8A 4NT4A 2XK4A 1ZMVA 1MRVA 1VR2A 1ZOHA 3MBLA 3R71A 3I60A 3UIUA 3PLAE 3ZO2A 3EZRA 3F66A 3ORXA 4CVAA 5KMOA 2H9VA 2R3JA 4BDEA 3AC2A 3FI4A 3ZSGA 3HA6A 2BFYA 1OIYA 3C4XA 3GC0A 1XBCA 3LM0A 1BLXA 4RIXA 5DLSA 5KBRA 2WEVA 2HWOA 3F5UA 2BROA 3H9FA 4FKIA 4AS0A 3BHVA 5BNJA 5JSMA 5C01A 3KMMA 3COHA 2ACXA 3QZIA 5FXRA 1W84A 5E8SA 3TXOA 4DFBA 3HRFA 3QTZA 4HGLA 1CKJA 4JDKA 3NNWA 5E92A 1UU7A 1JQHA 2VTLA 4LGDA 4W8EA 4EHEA 3ZO1A 5F95A 5HVKA 4XOZA 1GOLA 4ENYA 3OWJA 1J7LA 2WIHA 2QONA 3OBJA 5FBOA 4H58A 2VGPA 2R3PA 4KKEA 2B54A 3CQWA 2IW9A 4V0GA 5EI6A 4FKOA 4FKJA 4D28A 4L67A 3FDNA 4GS6A 2J0LA 4D1ZA 2CKOA 4NM7A 2VO7A 3QF9A 4MBIA 3MFUA 4TZRA 5CNNA 3JS2A 3GCVA 4XV1A 3O0GA 4EKLA 3NYVA 2CN8A 3DBDA 1M14A 4O2PA 5AX3A 1ZMWA 3IDPA 3R9DA 3EQCA 2WQEA 3IW7A 4QTDA 3C5IA 3UYSA 1QCFA 3V5JA 4FEWA 1QMZA 3TNQB 4WBBB 3CR0A 2RFNA 4HYIA 1REKA 3PSCA 2C6DA 3BHUA 2Z60A 3AMAA 4BYJA 4UXLA 2F4JA 4RQKA 2W5AA 3ACKA 3TL8A 3E8DA 3Q6UA 5DYJA 4YU2A 2UW3A 2HZNA 2WTCA 4FIJA 1WVWA 5AA9A 4QP8A 4M66A 5TOZA 1YOLA 1MQBA 4XH6A 4BDAA 4BWXA 5I9WA 4JR7A 3WZEA 2YM3A 4XRJA 3COIA 4ERKA 5K0KA 3MW1A 1Q24A 4FEUA 5AUVA 3RJCA 4NIFB 1GIIA 4BBEA 4JS8A 2JKKA 2GQRA 2R3HA 3TUBA 3AGMA 1WBNA 3BGZA 5HVJA 3VF9A 4EQUA 3ZOSA 4D2VA 3QRTA 5DH3A 1FMKA 5LQFA 5FP6A 3ROCA 3FYKX 3TNIA 4FYNA 3EZVA 4I5MA 4XG7A 4D2SA 3G9NA 4XP3A 1Q3WA 1Q8ZA 2ONLC 4GYIA 4IIRA 2QD9A 4B7TA 2X1NA 5HD4A 2X6EA 3JPVA 2FSOX 4QRCA 3KC3A 3H4JA 3UIBA 1YI3A 4IBMA 2YISA 4I92A 5GJDA 5HLPA 4BR3A 3VS0A 3TN8A 4E6CA 2XZSA 4FTLA 5EM8A 3L9PA 1YOJA 3GC8A 5CSPA 4FSNA 1YHVA 2GHLA 2YM5A 3FC2A 2IZTA 3F9NA 3SX9A 2VWYA 3BLHA 5AP4A 4ZK5A 3VC4A 2KULA 2REIA 5HO8A 3M42A 3ZU7A 2FH9A 2HZ4A 3DJ6A 1QPDA 3KN6A 3GU4A 3ODYX 4DINA 3PIXA 3TCPA 4AOJA 5AIRA 5H8BA 4B4LA 4FL3A 3G51A 4GYGA 4ZLYA 3W8QA 4ACGA 4YC3A 3G6HA 3SQQA 1XJDA 3P79A 2G15A 2PL0A 4EK8A 3GI3A 3S0OA 4DBXA 4P90A 1XO2B 4GFOA 3EKNA 3WARA 5IQBA 3OZ6A 3BWJA 2CHLA 2DYLA 3RWPA 2QOQA 4FK6A 1Y57A 4QYFA 3U9NA 4ZZOA 1PY5A 2WMUA 2BAJA 4QQCA 2BUJA 1S9IA 2JDOA 3CXWA 2ITVA 3HV7A 3NZ0A 4Y85A 4YTFA 3UDBA 4NM3A 4GW8A 3RZFA 3W2QA 4CLIA 4FZDB 2E9OA 3H9OA 4MF1A 1YQJA 4G34A 5EI8A 3PDTA 3P7CA 5ITAA 4EOQA 1YWNA 3F2RA 4E4NA 1UU3A 1WBWA 1H26A 3P5KA 1PXOA 4HYHA 1XKKA 2W1ZA 3UODA 5HLNA 4EJ7A 5LMAA 3S00A 2V0DA 3LQ3A 3NSZA 2QKWB 4FTAA 4W9WA 3W1FA 3OD6X 3KULA 3GVUA 4EK5A 3NIZA 5E91A 4DEIA 1H4LA 3G0EA 4YLKA 3RNYA 3FLWA 2Z7QA 2AC5A 5AV2A 4ACMA 4XG9A 4QMVA 4BICA 5B0XA 5JRSA 3HKOA 4KA3A 3FQHA 1OI9A 5AEPA 3VRYA 3Q96A 2VTJA 3HA8A 3L8VA 3IPHA 4FYOA 4IB0A 5IU2A 3U54A 2Y9QA 2YFXA 1RW8A 3I5ZA 2VTAA 3BLQA 3ZTXA 2IZRA 2ITPA 1PXJA 3DZQA 4ZTQA 5HEZA 2Z02A 3QTRA 4IFCA 4XV9A 5M08A 2VO6A 4EYMA 3U87A 4GVAA 2QC6A 4YLJA 3VUDA 4D2RA 1I44A 3AC5A 5AM6A 5A4LA 3LCDA 5E4HA 5I9XA 2QO7A 4KAOA 3BYSA 3Q6WA 4IZYA 2X8EA 4A9RA 2ZM1A 4CKIA 4JQ7A 3T8OA 2GSFA 4NSTA 4EOMA 2C0TA 3LCTA 3MIAA 3UQCA 2C5NA 2P2IA 3A4PA 4FTRA 1H00A 3LCOA 4IEBA 1SMHA 4BGQA 3AQVA 4TYHB 4YJUA 2PVJA 3W2SA 3E87A 4NUSA 4UYNA 5D7AA 1ZYLA 5HG9A 5I9YA 2X81A 4PNKA 2ZV7A 4C4EA 4CXAA 5EYKA 5CF5A 3FL4A 1IR3A 2V55A 3QUEA 4L52A 5IMXA 1PXLA 4ZSJA 3SHEA 2BKKA 4FA2A 5CTPA 4GUEA 1J7UA 4U3ZA 4F7NA 4WSQA 5I4NA 3BHYA 3IKAA 4BCNA 3MPAA 4HPUE 1F0QA 2WKMA 4M14A 4GU9A 4K6ZA 5HNBA 1SM2A 4ACCA 4EH6A 2Y7JA 3G33A 4GG7A 4IM0A 2XA4A 2HELA 2XH5A 3OFMA 2PMOX 4I4FA 4G6LA 3HV3A 5AUXA 4TWOA 4FODA 4QOXA 3PP1A 3QCQA 4IB5A 3Q4ZA 5AUTA 1PF8A 5KHWA 2QNJA 4MYGA 4ZS0A 2VUWA 3UGCA 2HW7A 5EK7A 4L3LA 4A06A 3BKBA 2F49A 2YITA 4IC8A 3FY0A 4MNFA 4ZTLA 3U4WA 3TDVA 4BCJA 2GS6A 3JY9A 3WF6A 4DG2E 2I0VA 4EJNA 4JBPA 4RVKA 4PP9A 4QD6A 3D7ZA 5KMJA 1J1CA 2VO0A 1BI8A 1T45A 2J0JA 3EKKA 3GGFA 2JITA 4ZOGA 4QNYA 3UMWA 3RAWA 4CMTA 3CTJA 4QP7A 5FXQA 2GNHA 5DGZA 5DHJA 1OM1A 3R01A 4FNWA 5AM7A 3VIDA 4ZZMA 3NCZA 4IB1A 5HI2A 5C8MA 1IA8A 3VUIA 3DLZA 3KCFA 2IO6A 5EFQA 3V5QA 2OH0E 1UV5A 4RX9A 5E8VA 2BVAA 5GHVA 3POOA 2UW4A 2WU6A 3LCSA 3ZUVA 3ORNA 3ZSHA 2IVSA 4WUNA 5CZHA 1UWJA 4BI2A 4QPAA 5CASA 2FYSA 4DEBA 4HVGA 5JMSA 4ALUA 1OL6A 2O63A 5TR6A 1UWHA 4KBCA 2ZV9A 2ITZA 2J0IA 4G3GA 5JH6A 2A0CX 3LW0A 3UQFA 2WFYA 4FIIA 5BVKA 4I6BA 2BHHA 4ID7A 3NAXA 3R28A 3DJ7A 5JGAA 4OGRA 4EONA 2EXMA 4EUUA 3Q4TA 2W4JA 4O83A 2IW6A 4X3FA 2A27A 3IECA 4R7IA 3C0IA 3OXIA 3DK7A 3S95A 5C8KA 4LV8A 5C9CA 5DOSA 2JFLA 3RVGA 2G01A 4D4SA 4V0GB 2WQNA 4C8BA 4MXCA 4IWDA 5KZIA 1JLUE 4RLKA 2W1HA 3P9JA 2HW6A 5CXZA 2XEZA 3NRMA 3QYWA 4UALA 2AYPA 1WBSA 3MFRA 3KRLA 4YSMA 1IEPA 2UZBA 3FAAA 3RBWA 3R1YA 1DM2A 4IHPA 3UNKA 2R0IA 2OF2A 4RVMA 4TYGA 3UMXA 4F9YA 4EZ3A 3HV5A 1PKDA 3ORIA 1XQZA 4C59A 4HW7A 5L2SA 1FVRA 4I5PA 3VULA 4AGCA 4R77A 1GZNA 2J50A 3ZFMA 4II5A 4DLIA 5AA8A 3KCKA 3TZ7A 1JPAA 3QYZA 3BYOA 3JYAA 4IWOA 5CS6A 2XNGA 4PRJA 2PZPA 3WF5A 2WMSA 4KRDA 4DH8A 4RFYA 2C6TA 2P2HA 3KFAA 4BB4A 4LOQA 3D2KA 4EHZA 4JQ8A 3MA6A 4NH1A 3TNWA 4O84A 3FYJX 2VTOA 3RAKA 4AE9A 3WILA 4FMQA 2C6EA 1Q41A 5DT0A 1UNGA 3HNGA 5J9YA 3EQHA 2ZYBA 3Q2MA 4DH7A 3Q9XA 4XG4A 1GJOA 2J2IB 3PIYA 5D41A 4GT4A 2ZVAA 3FXWA 4PY1A 5D10A 2B9IA 5L2WA 5DE2A 2B9FA 3PPZA 3HDNA 4U44A 5CU2A 4DFZE 1P4OA 3OROA 4YPSA 1FVVA 5FUTA 1P4FA 3LXNA 1W83A 4HGTA 3EQIA 4FK3A 5GJFA 5HQ0A 1O6YA 4OTDA 2UZDA 4F1OA 2HY81 3DKGA 5EW9A 4S32A 4W4XA 3A7IA 3QZGA 4RJ6A 2W1FA 1PXPA 3OP5A 4MK0A 2EB2A 4M69A 4ZAUA 1V0PA 2GS7A 4PP7A 2QU5A 4YJPA 1H1RA 3LPBA 5J87A 2IJMA 3OG7A 2W1CA 4O7ZA 1DI9A 1YVJA 3OWKA 4OT6A 2X8DA 3ZCLA 3FSFA 4ZTMA 1BYGA 5J1WA 4FG9A 5A14A 2G9XA 4CSVA 3ELJA 4O0UA 4AAAA 3KRRA 3GB2A 4FF8A 4I0TA 4CMOA 5K4IA 2DWBA 2NRUA 2VAGA 3G6GA 3QU0A 2CMWA 2EXEA 4FIHA 3SKCA 5AR2A 2CKQA 4F1MA 2WXVA 4OTFA 5JT2A 4R7HA 3C50A 3ZZEA 3IO7A 4ZY6A 2XEYA 3HUCA 4IWPA 2BZIB 3FMEA 2C5XA 3AMBA 3GU7A 4MD7E 2JD5A 5FM2A 2RFEA 4USDA 4MXOA 3R8UA 4QMQA 2W06A 3B8QA 4MHAA 3UE4A 2IPXA 1Y6BA 4MAOA 3R7IA 4E8AA 4OAUC 3C9WA 5HIBA 3AC4A 2RFDA 3JR1A 3PTGA 4DEEA 4MQ2A 3TTIA 5CF8A 2QLUA 3LMGA 2VWBA 3JVSA 1R3CA 4AZSA 2QODA 3EFLA 1LP4A 3R00A 3O7LD 3TI1A 4DFLA 2XK6A 4OLIA 4MD8E 2VV9A 3F3UA 3HMPA 5EKNA 1ZY4A 3T9TA 3HMIA 3I81A 4FIFA 2HXLA 5IF1A 4KIPA 4N6ZA 5HZNA 4O7LA 4CG9A 1UA2A 3KULB 3FI3A 1J91A 4BCFA 2O0UA 3N51A 4U6RA 2X4ZA 3KKVA 4L9IA 5HG5A 1U59A 2IWIA 3FBVA 4KRCA 3R9NA 2J90A 3VQHA 2ETRA 1ZOEA 5TT7A 3E93A 4ANNA 3PYYA 3PVWA 1WVXA 3LCKA 3MY5A 4CZYB 4NTTA 3OCGA 3NW7A 4PWNA 4IAIA 3ZHPC 5AWMA 1SZMA 4AACA 4AXAA 5IEXA 3Q5ZA 2YDIA 4DAWA 4FV7A 4AA4A 5HNIX 1H25A 1PYXA 2HAKA 4N4SA 3TKIA 3GT8A 2YJSA 3SXFA 4AP7A 4BDHA 4I0SA 5JQ8A 5M4IA 3SRVB 3R1SA 4KIKA 3ZXZA 5IA3A 4FV2A 4XV3A 4GH2A 3IOPA 1J7IA 3GUBA 4EH3A 5L6PA 4U0IA 4RIOA 4RSSA 4X6RA 5HU9A 2WTWA 2VX3A 3OBGA 4RWLA 4OUCA 3PJCA 3DZOA 2OJ9A 3A2CA 4MBJA 1AGWA 2ZB1A 1M2PA 5LMKA 2BDJA 5H8GA 2YZAA 3HX4A 3LVPA 2CLQA 4I5HA 3IOKA 4IW0A 4R5YA 2PU8A 1KOBA 2Z7RA 1CKIA 3D83A 4D55A 1ERKA 4O0SA 3UP7A 4EUTA 4KKGA 5BVOA 5JZJA 4DLJA 4M0ZA 5AIKA 5J79A 2J7TA 4PF4A 3UYTA 4FEQA 3TV6A 2J5FA 4MF0A 4AN9A 4CYJA 1H28A 5M57A 2BHEA 2UZUE 3DV3A 3O2MA 2R3IA 3JXWA 4BKYA 5G1XA 4NCTC 4FVRA 5HE0A 5JZNA 4APPA 1H08A 4FTOA 2LGCA 4ZY4A 3P0MA 3CD8A 4KUJA 2CKEA 5CT0A 3CE3A 2XB7A 2UZOA 3TKUA 4QMMA 5FEDA 4L01A 5AV0A 2WMVA 5HLWA 4R3PA 3LFAA 4U5JA 3OW4A 3BU3A 4JAJA 4QMWA 4DITA 3CTQA 2V5QA 4DEGA 5ICPA 4K33A 4ZMFA 3R0TA 4DEDA 4Q5HA 2YZLA 3FKNA 3FEGA 4MD9E 3ORZA 2LAVA 3RMFA 2CGVA 1BL6A 3F3WA 4W4YA 3KREA 4A9UA 2PVHA 4RIWB 4EHGA 2ZJWA 3KA0A 3RI1A 4UY9A 2VTRA 5F94A 3SAYA 3V6RA 3RK9A 4AGWA 2XNMA 3UJGA 2WTDA 2I1MA 3NUSA 3MYGA 3O23A 2ZDUA 4QQ5A 3FI8A 1YXUA 5H2UA 3ZEWA 2ESMA 3AD6A 3V3VA 2OXXA 2GQSA 5IQAA 1CTPE 2GFSA 2OIBA 4PDOA 4ARKA 4FTIA 4I21A 3BPRA 5JKGA 4O7SA 3QUDA 5TKDA 3R7OA 3UOKA 2PE0A 4V05A 3V8WA 4EH8A 4FEXA 2I0YA 3TDWA 4ANBA 3NIEA 5CY3A 2JIIA 2ZAZA 5JGDA 2WQOA 2Z7LA 1HCKA 3OY3A 3A7HA 3S4QA 3KQ7A 3R8ZA 1OPJA 1I09A 1GZOA 4J1RA 3AGLA 4IZ5A 4K2RA 5DRBA 5TO8A 4BDCA 4BZDA 3NMUF 5FP5A 3U8WA 4LGHA 3L9LA 4KIQA 2OICA 3ZBXA 2ITUA 2O2UA 4UMRA 3PG1A 1W82A 5CAQA 1IRKA 3ZH8A 2C3JA 1H1WA 3BGQA 4X3FB 3LFQA 5HESA 4RX5A 4OTWA 3E92A 3K5UA 3AT2A 2W1GA 4OTQA 4C3FA 2JKQA 4KB8A 2GTMA 3QD3A 5IH5A 1VEBA 4EZ5A 5IQEA 4D58A 5DVRA 3I4BA 4H1MA 4C35A 1KSWA 5BMSA 2ITTA 2PMLX 2VWZA 3ATSA 1PMUA 1VYWA 3R8LA 3FV8A 2PE1A 4IZ7A 3EHAA 4JIAA 3LLAA 3NW5A 1YWRA 3GCUA 3NUXA 4O0VA 3DY7A 4GK2A 3RTPA 3QFVA 3LKMA 4F9BA 5FXSA 1J1BA 5I5ZA 4PTEA 4P4CA 1FMOE 4AWIA 4J98A 4KINA 4UMPA 4YMJA 4FI1A 4ASZA 1G5SA 3ZC6A 2XUUA 4E4XA 5M09A 2FSMX 4YBKA 3W32A 3Q9YA 2VGOA 4IAFA 3BQRA 3TNPC 2VO3A 3R7UA 2GNIA 4F9WA 4AW0A 2PVFA 3LQ5A 3OUNB 2QVSE 3RHKA 4YO4A 4YURA 1H1QA 4C57A 2HXQA 4R1VA 5IA1A 4Q2AA 3FMLA 3OT3A 5AP6A 2YA9A 2J4ZA 5M4CA 3QTUA 4TKSA 1L3RE 4EQMA 3PXRA 3E7OA 4C4IA 3V51A 2PUNA 3SXRA 1QL6A 3MV5A 3PUPA 3Q9ZA 3E64A 3G2FA 4CMUA 5KBQA 2W5HA 3E3BX 1OBGA 4ZLOA 1Q99A 4WKQA 3OF0A 5BUEA 1XH9A 4F7SA 1Q8UA 2CNVA 1PMVA 2ZDTA 2EUFB 3VO3A 3QXOA 5BVEA 3SVVA 2YJRA 4PNIA 4IVCA 4TN6A 3L8PA 4FNXA 3WZUA 2VTSA 4U42A 2X8IA 4EOKA 3ID6C 1JKTA 2JEDA 4FTUA 4XUFA 3AT3A 5HORA 5I9ZA 4Y8DA 4BTMA 5HE1A 3FLQA 3O17A 3U55A 5EHYA 3ROYA 3AOXA 1CM8A 2CGXA 4TTHB 4E3CA 4IWQA 3HL7A 1SNXA 4EZ7A 1UU9A 2F57A 3LZBA 3PFQA 1AD5A 4PX6A 4BY9E 4L42A 3KRXA 1H0VA 3EIDA 5M4UA 4MQ1A 5DEWA 4B8LA 3U4UA 2PULA 3CGFA 3OCSA 3V04A 3FMMA 4FSWA 2YLEA 5F9EA 4I22A 4EYJA 3BV2A 2QURA 3AC1A 3HV6A 3RPOA 3MJ2A 4YBJA 3PJ8A 5CENA 4Y5HA 3L9MA 5LVOA 1JVPP 2OXDA 3PE2A 4RZWA 2QKRA 3H3CA 4FBXA 4TNDA 4OTIA 5EM7A 5FD2A 2H6DA 3QX2A 3P78A 3WE4A 3OVVA 5A4CA 2R3RA 3A8XA 4QP1A 4LFIA 3R6XA 4YGAA 3DOGA 3C51A 4M97A 4IXPA 4QMOA 2NO3A 1LUFA 5BUIA 1CKPA 4DGLC 4IX3A 1ZY5A 2JDSA 2BTRA 5LOHA 5C1QB 2YCSA 4ANSA 4M68A 3V01A 4WD5A 3M2WA 1P5EA 3DXQA 3C13A 5BVNA 3COKA 4ANQA 5HTBA 2X0GA 3FKLA 4IVAA 4JBOA 4Y83A 5BQ0A 3I79A 1RJBA 2E9NA 4M12A 4QMPA 3SDJA 4FTQA 5CAOA 5M51A 3OHTA 1OZ1A 3A4OX 5ETIA 2OO8X 5EDQA 5K4JA 2VU3A 4PTGA 1DAYA 3GQLA 4XP2A 3H0YA 4W8DA 3T3UA 2WAJA 1APME 3OWPA 4NU1A 2VWWA 2RL5A 3VS7A 5I3RA 4ANLA 2XM9A 3EFKA 5CLPA 4AZFA 4A4LA 4I6FA 5A4QA 3OEZA 4HNIA 3F3VA 3LJ2A 3P23A 5H9BA 4UMUA 3A61A 3TZ9A 3GOPA 4I6HA 4G3DA 5I9VA 2HY0A 3MWUA 2VTQA 4QP6A 4EEVA 4NW5A 4E7WA 4ASXA 4EORA 2WMAA 4C61A 4DGGA 4YSJA 2ITNA 4D5KA 2QOFA 3R21A 4IX5A 1V0OA 4KABA 3E8NA 3BI6A 3I0OA 4RPVA 3H10A 3UO6A 4FT3A 4MNEA 4U9AA 4CFFA 4WUAA 3NPCA 2BCJA 4NM0A 5ANJA 3Q04A 4RIYB 2I0EA 2HENA 3L8SA 2QU6A 4TXCA 3PY3A 4FT0A 4YP8A 3O50A 4BDKA 2WB8A 4O91A 5KUPA 4YJQA 3ZO4A 2CJMA 4FV1A 4O27B 5HOAA 4N57A 2QG5A 5DR2A 2XRWA 4AFJA 3HLLA 4D2WA 3K3IA 4I5CA 3HRCA 4FT5A 4G16A 3GU8A 3Q53A 4X3JA 5BYYA 5AP3A 3VUKA 3UVRA 3UZRA 5CEOA 3T9IA 2O8YA 3DTCA 4ITHA 4R3CA 4BHZA 4KIOA 3QUPA 3IONA 3R1NA 5A9UA 2GTNA 2NRYA 3KVXA 4I41A 5EYCA 4J52A 5EG3A 5AUWA 4EBVA 1EH4A 3FLYA 3TNHA 4OTGA 3CC6A 5DPVA 3F82A 2SRCA 2CCHA 3OEFX 3BLRA 3VW8A 2UZTA 5LCKA 5L6OA 4NEUA 3II5A 4FSQA 4BIBA 3OCBA 5CSHA 3MPMA 4BKZA 4DBNA 1GZ8A 4ZY5A 2C0IA 3EN9A 5CEIA 4CT1A 5EQYA 3DTWA 3SC1A 3BEAA 2ZOQA 2RG6A 3VS6A 1P2AA 3FLZA 1JWHA 5L8JA 3QZFA 2R3OA 3AD4A 5CSVA 4EOSA 4CTBA 2XYUA 5B2KA 1YWVA 4EOPA 4DYMA 4YZDA 2UZLA 4O0RA 2HK5A 4V01A 3ZM4A 3VJOA 5IA2A 2R3GA 3CS9A 3GC9A 5IUGA 3MVLA 1NT2A 3NUUA 4O7RA 2FVDA 2UZNA 5GIPE 5DBXA 4UB7A 3DKOA 4FG7A 5DR6A 4CFWA 2OSCA 4I3ZA 3O96A 3VS4A 1S9JA 1XH8A 3FZSA 5CNOA 2PYWA 4B0GA 4WBOA 4FSTA 1TVOA 3V6SA 4BTFA 3PY1A 4EH9A 4BN1A 1XWSA 4XG2A 1KV2A 5FEEA 4AZWA 4BCIA 2W96B 5AP1A 4BDDA 3V5WA 4Z16A 3RP9A 4CV9A 3KEXA 4RJ5A 2WTVA 2BAKA 4G2FA 4JVGA 4EQCA 2XNNA 3VWAA 3E8EA 5HO6A 3A7JA 2J5EA 5CF6A 1WBPA 3RPVA 3PRFA 1GNGA 4AW5A 3QGWA 4Z3VA 5EQPA 4MKCA 4MXYA 4IACA 3VUGA 4L7SA 5EM6A 4PMPA 4IJ9A 5GIOE 2OJJA 5IEVA 4QYGA 3C0HA 3CTHA 3NUAA 3LLTA 4TWCA 3SW4A 2OGVA 2OFVA 1OGUA 1OVEA 4WIHA 1OUYA 3EJ1A 3QC9A 3QBNA 5HVYA 5K3YA 1O6KA 3TIZA 3BZ3A 1OECA 4GT5A 4C4FA 4A7CA 3FMDA 5HG8A 5LVLA 2QLQA 4WSYA 1GIJA 1NVQA 2WELA 5A4TA 1ZRZA 4RC4A 5EOBA 4QMSA 5AAEA 3ALOA 4OBOA 4ANMA 1IAHA 4OTHA 5D11A 4FC0A 5A46A 5CT7A 4EH5A 1OB3A 2A19B 1Z57A 3FZRA 4CRSA 3BCEA 3QA0A 5CEMA 1BL7A 1LR4A 2XJ0A 4R1YA 4A4OA 4E6DA 2W4KA 4J71A 4HCVA 2NPQA 1ZYDA 1OL5A 4O38A 3IDBA 2H8HA 4O1OA 1YOMA 3U51A 3DA6A 5M53A 3MFSA 4B9DA 3N4VA 2Z2WA 4L8MA 5GINE 4U79A 5AR8A 2X7FA 4DA5A 1UKIA 1V1KA 3HGKA 3NS9A 1H24A 4BIEA 3FJQE 4ZS4A 3R8VA 3KMUA 3L1SA 1MP8A 3E63A 5J5SA 4D9UA 3F2NA 3EFJA 3DKCA 4IAZA 4H36A 4YJTA 2YM7A 1YDTE 3ZLXA 3GBZA 2IVTA 2W1IA 3UIXA 2V7AA 2I6LA 3DT1A 3DAJA 5CQWA 5DRDA 2GHGA 1WFCA 3FWQA 4D2TA 2WMRA 3WIKA 2WD1A 3SG8A 5BPYA 4TY1A 5KHXA 4QNAA 5DI1A 4RIXB 5AR3A 5B2MA 2WU7A 1YRPA 2A2AA 3KRJA 3QLFA 4JI9A 4F7JA 5L4QA 5DA3A 5M56A 4CEGA 2UZWE 3CSVA 1MUOA 2YEXA 2P55A 2R2PA 3JVRA 4J96A 5AX9A 5B2LA 1OBDA 2QOBA 2HIWA 4XHKB 2YLFA 5H8EA 1TQIA 3F88A 4AN2A 5BVDA 2FUMA 3DNDA 1FPUA 4WHZA 5CU6A 5J95A 2GFCA 3TACA 4O0XA 4RJ3A 2DUVA 3DAEA 5CVGA 4FEVA 4KSQA 2PVYA 4RLLA 3R83A 5IUHA 1ZYSA 1TQMA 3N4TA 4HOKA 3C4FA 4QTBA 1TKIA 3ULZA 5AAFA 4CCUA 3DK3A 2R5TA 1BX6A 4JL9A 4LOPA 2YWVA 4K0YA 3EQGA 4I24A 3TTJA 4J95A
chains in the Genus database with same CATH superfamily
5CALA 4LMNA 4IVBA 4IX4A 3FZPA 4PDPA 4JDIA 1OKVA 3MH3A 3UVPA 1WBOA 1YXTA 4MVFA 4JOAA 4YJSA 4OAVB 2UVZA 2B0QA 4E6QA 3D0EA 2JLDA 3R9OA 3PVGA 4UYAA 2IG7A 2Z8CA 3VBTA 4BVUA 4LUDA 2Y4PA 4FUXA 3F5XA 2O5KA 5ANEA 2XKFA 4BCGA 5BYLA 1PJKA 3WI6A 3P7BA 3MJ1A 2G1TA 3R30A 3E5AA 5LVMA 2PZ5A 3VUMA 4MWIA 1UU8A 1WVYA 2C6LA 3GC7A 3KRWA 2WMQA 3MGYA 2EXCX 4IDVA 4QQJA 4EOLA 4BL1A 2YM8A 3FKOA 3HP5A 3IGOA 4RJ8A 3R8MA 1ST0A 3PA4A 5J7BA 2PVNA 3DJ5A 4H1JA 1H8FA 4UXQA 4WNMA 3QD0A 3QX4A 5IH4A 2WTKB 5E8UA 2PMNX 3FE3A 4L46A 4PUZA 5LMBA 3A7GA 5KMNA 4JX3A 3ORPA 3R9HA 5GZ8A 1PMNA 3IS5A 1A9UA 4YJOA 4AA0A 5K0XA 2XJ2A 3O8UA 3DDPA 3I5NA 4OBPA 1FGKA 2CPKE 3F7ZA 4YUQA 1PXMA 4PPBA 1W0XC 1J3HA 3ODZX 2ETKA 2WQBA 3POZA 4O4FA 5AADA 2R3NA 2W17A 5JK3A 3QRJA 2XKCA 4F6WA 5C4LA 4G31A 4BCQA 2A4LA 2O64A 4NW6A 3K5VA 5LWMA 4I6QA 3A8WA 2ZM4A 3CBLA 4ASEA 4F09A 4ACHA 1K9AA 3KF4A 4PL3A 4DHZA 4GEOA 4DGOA 2JFMA 4IZAA 4RFMA 4QDVA 4FL2A 5IQFA 5AUUA 2IZUA 3ZC5A 2HCKA 5IISA 3SOAA 2J0MB 4IM2A 4JBQA 4LM5A 1VZOA 5CEPA 3W18A 2HZIA 1HOWA 4NKAA 4YZ9A 3G5DA 1Z9XA 3RNIA 2VTIA 2BILB 1XH7A 3PA3A 2GNJA 3KXHA 4G3CA 3IW5A 3QHWA 4B6LA 2H96A 4BCOA 4RGJA 1RDQE 4HCTA 1M2QA 3OTVA 4QMNA 4MNEB 4BCPA 4BI0A 4FNYA 4P2KA 2XNBA 3R22A 3RK5A 4E26A 3AT4A 1PXKA 3QTSA 3BLAA 2OKRA 3ZBFA 3AG9A 1FGIA 3DK6A 3HUBA 3QTIA 2P4IA 5D7VA 2I40A 4ZP5A 3C7QA 4DFUA 3ZONA 3EYGA 4PQNA 3EQDA 4AQCA 3KK9A 3PWDA 5C03A 1O9UA 2R3KA 4Q9SA 5HG7A 3PY0A 4CFXA 3KK8A 5KCVA 2PMIA 4QMXA 4A9SA 3OS3A 2X7OA 3UBDA 3U9CA 4AFEA 2ETMA 4TPTA 4X2KA 2H34A 4NJ3A 4QEBA 4WG5A 3BEGA 3DB8A 4R8QA 2B9HA 3RPRA 3E3PA 2F7ZE 3L9NA 2PZRA 2B52A 2BRHA 5M44A 3FQSA 2GU8A 5CSXA 5C8NA 4PV0A 4ZSAA 3ENHA 2GCDA 2FSLX 4L3PA 3KB7A 4NJDA 3QGYA 4ZJIA 4DH5A 2JBPA 5CZIA 4DTKA 4QDEA 3V8TA 4A07A 4EH4A 5JQ5A 4XRLA 5CI7A 4TL0A 3EL7A 3R9RA 1IA9A 1PRYA 4K9YA 1CDKA 4O0TA 3DGKA 1JOWB 1GIHA 4K1BA 3OXTA 5HO7A 2OZOA 4X2NA 4USFA 3QRIA 5I0BA 2BRGA 2PY3A 1UVRA 3GNIB 3T3VA 3ZO3A 5FDXA 3D4QA 3LXKA 4QTCA 3LAUA 5CYIA 4C33A 3V5TA 4Y95A 5HTIA 5I3OA 2R7BA 4JXFA 2C0OA 2RGPA 4KNBA 4PMTA 4ZEGA 2PUIA 1ATPE 4ALVA 3ORMA 1ZZ2A 5AR5A 2BRBA 4IJPA 4NIFA 4B8MA 3QWKA 1URCA 4Z55A 4LGGA 3EN4A 4E5WA 1FQ1B 3TEIA 3GFWA 4U45A 3CY3A 3MFTA 5DMZA 3E7VA 3P08A 3ERKA 3UTOA 5AUYA 3WYXA 5C27A 4U41A 4CD0A 3TG1A 1Q62A 2C68A 2JKMA 3BQCA 3D2IA 3GFEA 5GNKA 1WCCA 2CNQA 4AUAA 1LEZA 3P86A 1YW2A 3MDYA 4ZJVA 4AZTA 5CAPA 2IF8A 5JGBA 1ZMUA 5HD7A 1OKYA 3F5PA 4R5SA 4AT4A 4DF3A 4XLIA 4F1TA 2P3GX 2VNYA 3IW8A 2O3PA 3C4ZA 3TT0A 3LFFA 5L3AA 4E5AX 1M7NA 3BYUA 3RZBA 4IQ6A 4PL5A 5E7RA 4ERWA 5HGIA 2J51A 5L2QA 4IFGA 3EOCA 2FGIA 1X8BA 5EW3A 2JIUA 2O65A 3NEWA 2PUUA 4FICA 4IM3A 2PVRA 2PVMA 2UW5A 2B9JA 5TE0A 4QMTA 4U8ZA 1ND4A 3D9VA 4RG0A 4GKHA 5FG8A 4KKHA 2ZV2A 3FY2A 3ET7A 4LUEA 4C62A 4PDYA 5JFSA 2W7XA 2C6MA 2RFSA 4DEAA 1LPUA 4EC9A 3UPXA 1NVSA 5ACKA 4FR4A 4AXCA 2QI8A 3PXKA 1Q8WA 3VF8A 2Y6OA 3O7LB 1XH6A 2YCQA 4AF3A 2BZHB 4RA5A 2WPAA 4FG8A 2IVVA 3V5LA 4CT2A 4E4LA 4F4PA 3BX5A 5HIEA 3PWYA 1FVTA 1IAJA 4K11A 1U54A 4QYEA 3OW3A 4XJ0A 2UV2A 4ZXTA 4C4JA 4CLJA 1JSVA 2UVXA 5T3QA 3DXNA 4BF2A 4AXDA 4L6QA 5LCJA 3G0FA 5IKWA 3UIMA 3QD2B 4FOBA 1JSTA 3NDMA 4L68A 4HVSA 3D94A 4DEHA 1XR1A 3EWHA 3QKLA 3QQFA 2QOHA 4YTHA 1WZYA 4BDIA 4ZIMA 4ZSEA 2XNPA 2W9ZB 5CX9A 2W99B 5DIAA 3LJ1A 3GCSA 4TRLA 3ZXTA 4EC8A 3BYVA 4FL1A 4A4XA 3NFFB 2WHBA 4RRVA 5J1VA 1RQQA 3EH9A 2BZKB 5EHLA 4C34A 4CYIA 4E4MA 5KMMA 3NAYA 4CQGA 4FSUA 4I23A 4IAKA 3RGFA 4YTIA 4F63A 3QRUA 1YHSA 4C2WA 2GS2A 5BVFA 4OW8A 4FV3A 4FT9A 4IAYA 4HPTE 3SD0A 4FOCA 2OJGA 3MN3A 2C3IB 2OIQA 2F2UA 3TYKA 3PPJA 3NUPA 3W33A 2C6OA 3DBEA 1JSUA 4XP0A 4A9TA 2YIWA 3FMNA 3MTFA 4QT1A 3N9XA 3DU8A 4LV5A 5IDNA 2OG8A 3QXPA 5KZ0A 3DDQA 2HWPA 4U81A 3UG2A 3VHEA 2XIYA 3K3JA 2F7EE 3ORTA 4CTCA 2Y8OA 2XKDA 3IG7A 3S1HA 1OMWA 1OPLA 1W2CA 4OR5A 3TM0A 2X7GA 3RPYA 5E8ZA 5IH6A 4ZMEA 3D7TA 1GZKA 4RJ4A 5HBJA 4DFNA 3FMJA 4ZTSA 2JAMA 2WMTA 4OTRA 3QTXA 3P4KA 1OITA 1WBVA 3DFCB 3GU6A 5HCYA 2JDRA 2PTKA 4L00A 3ZLSA 3PG3A 3QKKA 1AQ1A 4G5JA 4E73A 4FSYA 1B38A 2WTIA 3SOCA 5BMMA 3HMMA 3NNVA 4M84A 5IQCA 4HJOA 4JIKA 4O7TA 3FMKA 5DT4A 2XARA 5EM5A 4E20A 4MUQA 3VS3A 5HHWA 2WTKC 4LMUA 5EHOA 4BFMA 4RWJA 4C58A 2OF4A 5L2TA 4YJRA 4AU8A 2VWXA 3PSDA 1GY3A 2JKOA 3KY2A 4QP3A 5ANGA 4YJNA 3B2WA 3R2YA 3PZHA 1R39A 3NX8A 4M7IA 4CNHA 4M8TA 4FKRA 4FV9A 4RBLA 2BRNA 3ATTA 3REPA 4GIHA 1JKSA 4XG8A 2W1EA 4IX6A 5E8YA 5EDPA 2GNFA 4FZFB 3FSKA 2Q0NA 2XF0A 2UZEA 4NFNA 3UZPA 4IAAA 5CXHA 1Y8GA 3MH1A 2ZB0A 2V62A 3UG1A 3M11A 4L43A 2QO9A 4YLLA 2XBJA 3WF8A 2NP8A 3HAVA 1H27A 3LFSA 4AOTA 5HBEA 5CU4A 4FUYA 2VWVA 3IW6A 4M15A 3MI9A 4UZHA 4O81A 5CQUA 4DT8A 4U3YA 3ZEPA 2UW9A 2YACA 3PXZA 2BTSA 3CY2A 4NCTA 5EKOA 3NLBA 1SVEA 4KBAA 2BDFA 3FQEA 5CU3A 4Q5EA 1XBAA 4FZ7A 3VS2A 3F5GA 4XCUA 4I0RA 4I93A 4YHFA 5M55A 4LL5A 4GT3A 4RMZA 2VNWA 2VTMA 5AMNA 4UEUA 2BIKB 4M3QA 4RZVA 2XK3A 2Q0BA 3QKMA 3Q5IA 2OZAA 3V8SA 3V5PA 3OXZA 2F9GA 4FV8A 4ORKA 4M69B 4O86A 5FTGA 3O5AA 1CSNA 2IVUA 2WIPA 3ANQA 4LG4A 2R3QA 3MA3A 3NWWA 3P1AA 2IZSA 1KOAA 1YKRA 2X2LA 4O7YA 4AW2A 1R0EA 2XAMA 4EK4A 4BHNA 4TW9A 5IQIA 3MTLA 4JX7A 4EI4A 3OY1A 4F0GA 5C26A 3UOLA 1H1PA 4XS2A 1JBPE 2A98A 4C4HA 2XK8A 4MBLA 4YJVA 2W05A 4GFGA 3EB0A 4QP9A 3GCPA 3IK3A 3WOWA 2UW8A 4E5BA 5E90A 4XX9A 3ZDUA 4EWQA 3UNJA 4R3RA 2R3LA 5EI2A 2A1AB 3R73A 3I6UA 4EOJA 1WBTA 3HRBA 4BKJA 4DHFA 4S31A 3LHJA 3QCSA 3LQ8A 4WNKA 3UVQA 1OL2A 2E2BA 2YABA 4QQTA 2XNOA 2XCKA 4XBRA 5AFVA 2GDOA 3H0ZA 2YM4A 3VN9A 3IQ7A 4N6YA 5FTOA 3NR9A 3R63A 5J9ZA 4ONAA 3RK7A 2B7AA 3R02A 2RF9A 2XYNA 1XH5A 2QOCA 4W9XA 5IG1A 5C4KA 1G8SA 4YPDA 3LMHA 4YC6A 5CSWA 4F9CA 3LMIA 2PHKA 4FTJA 2ITOA 2WGJA 4L44A 4YNEA 4FIEA 4UWYA 3BE9A 4WOVA 1O6LA 2WO6A 3MVJA 2OFUA 4MTAA 4ACDA 4Z7HA 5JFXA 1ZAOA 4DN5A 1H07A 4QMLA 3R8PA 4M13A 1YDSE 2RSVA 2FB8A 3LFCA 5HTCA 3VVHA 5AR7A 4JG7A 3ITZA 2I7QA 2IW8A 4CV8A 2BFXA 2C3KA 1B6CB 2Y0AA 3DPKA 3F69A 4ITIA 4AT3A 4C3RA 3A62A 2PVLA 2WMXA 5CWZA 5GZ9A 3CLYA 4EKKA 5K5NA 3PUFC 2ERKA 3KF7A 2HOGA 4V04A 5AJQA 4DC2A 3NGAA 2W1DA 5HCXA 4ANOA 4KWPA 2PVKA 3EN5A 4Y46A 1P14A 3HVCA 2UUEA 5LVNA 4F0IA 3E88A 4J53A 4A9YA 2AUHA 2DS1A 5IUIA 4EBWA 5FM3A 2XMYA 2F7XE 3WE8A 5IA5A 4RFZA 3RALA 4AW1A 2CKPA 1YXXA 1R1WA 4KSPA 4KIKB 4BI1A 4BIDA 1G8AA 3PVBA 3TJDA 2BR1A 2VX0A 2V7OA 4XLVA 4EK3A 3ZRMA 1CMKE 1H0WA 3Q2JA 1SVHA 4BC6A 4GVJA 4IE9A 4NL0A 5D9HA 5HE2A 3R7YA 2CGWA 3RM6A 1IASA 3I6WA 1U46A 4D0WA 1OKWA 3MPTA 3BIZA 3KXGA 4MEDA 4ZTNA 4BDBA 3W0MA 1YI4A 2UVYA 4MCVA 3VBVA 4BZOA 3D5WA 1B39A 2PPQA 3WYYA 3Q9WA 5KE0A 1OPKA 4AE6A 5AP0A 2OK1A 4AGUA 5CANA 4OBQA 4FKUA 4GJ3A 4C0TA 3BGPA 2YCRA 3CQEA 3TJCA 3N4UA 1OIRA 2YHVA 2XK7A 4GIIA 2VRXA 3LIJA 4GRBA 2W5BA 3ACJA 4QYYA 5I9UA 4TWNA 3RHXA 3FUPA 2YM6A 3TV7A 4E6AA 4EWHA 2OW3A 5A6OA 5LJJA 4UN0C 1OIQA 4HGEA 4RC3A 4UBAA 4FKPA 4ITJA 5AP2A 4GL9A 2VWIA 1U54B 4W4VA 2XK9A 4C7TA 4F7LA 4KS7A 2C47A 3QTQA 4J8MA 4QYHA 4NFMA 4DG0E 4QMUA 3DFAA 3LFDA 4O0WA 2YDJA 4U40A 3D5XA 4JRVA 2C6KA 4DTAA 4BBMA 1GAGA 4WT6A 5FTQA 3R1QA 4ENXA 4HGSA 4Y73A 5BUJA 3FC1X 3NNUA 1YHWA 4DH1A 2PUPA 4AG8A 3HV4A 4FT7A 1FINA 3GENA 4L53A 4CRLA 2YIQA 3SG9A 4F65A 3QHRA 3ZM9A 4HNFA 3QALE 3S2PA 4BGGA 3OWLA 3UC3A 4AT5A 1IG1A 3QQJA 3VBXA 2XANA 3A60A 4JDJA 1ZWSA 4WNPA 1TQPA 4F0FA 3VUHA 5DR9A 4U7ZA 2ITQA 3R7VA 2WZJA 2CN5A 3CPBA 4RQVA 1OL7A 4FNZA 1K2PA 3OUKA 4FX3A 2BAQA 4O2ZA 1MQ4A 4GJ2A 4UWCA 2RG5A 2YDKA 4PTCA 2YN8A 1Q4LA 3I0QA 3MS9A 4NKSA 2HZ0A 3TZMA 4U43A 3AC8A 4X3FC 2GHMA 2OIDA 3I7CA 3KVWA 2JDTA 5CAUA 3BBWA 3QC4A 3DB6A 4FSRA 4MH7A 4C38A 5L8KA 1KE9A 3EQPA 2PWLA 4RC2A 3DS6A 4NTSA 3A99A 3F3ZA 1YXVA 4CKJA 2ONLA 3G90X 4FV0A 5M06A 2GPHA 2JAVA 3ETAA 3RINA 3GP0A 3D7TB 3CIKA 4O7NA 2PZIA 4H39A 4N0SA 4DGMA 5CU0A 3SRVA 4IC7A 2QHMA 3UPZA 4S34A 4L7FA 1JNKA 1WMKA 4HZSA 4UWBA 4K18A 1OL1A 3PVUA 4GUBA 3FI2A 3VS1A 4BRXA 4HZRA 2QOLA 3FHRA 4YHTA 2FSTX 4EL9A 5E9EA 3Q32A 3R7EA 3UQGA 3ORKA 5FBNC 5HU3A 3SLSA 3F6XA 4IADA 4MXAA 3CKWA 5AR4A 5IQDA 3UNZA 3VS5A 3D14A 2VTTA 3CJFA 4J7BA 5EH0A 5GZAA 4FKSA 4AOIA 4HYSA 3ZDIA 4X7QA 1XMMA 2KTYA 3C1XA 3BV3A 1W7HA 2E9UA 2I0HA 5HX8A 2C1AA 4FSMA 3VW6A 2WTJA 3LFNA 4DG3E 5AV4A 1SVGA 4PMMA 1PYEA 4FIGA 4LRMA 4LYNA 4XG6A 4YZMA 3BYMA 5DFPA 2CCIA 5E8XA 4DHJA 1NXKA 4C4GA 4GU6A 1URWA 1FBNA 5E1EA 3G9LX 1KWPA 4CFNA 4U97A 2VWUA 3AMYA 3MSSA 3SV0A 3LFEA 4BCMA 1G3NA 3UOJA 3D15A 4AGDA 3BBTB 4FVQA 4NZWB 2QOIA 1UNHA 3HDMA 4H3QA 4D2PA 5FQDC 3W2OA 4X21A 3PXQA 4LOOA 2HYYA 2QHNA 4YZNA 1VJYA 4C2VA 2VX1A 2YERA 3C5UA 4BWPA 5KMLA 4JBVA 3R04A 2QOOA 4BTJA 4HVHA 3OCTA 4XEYA 3JUHA 4USEA 3ZSIA 5IQHA 2VN9A 4F78A 3H30A 5CVHA 5E1SA 5K5XA 1ZOGA 2R0UA 3KXXA 3QLGA 4FKTA 3CEKA 3BRBA 2G2HA 2WOUA 2UZVA 2XP2A 4I20A 4G3FA 5AAGA 4NWMA 4DFYA 2F2CB 4S33A 3BE2A 3PJ3A 4GMYA 3HEGA 4G6OA 1KE7A 4RIWA 3UO4A 3BHHA 5BVWA 3IGGA 4B99A 4WG4A 4D1XA 4FGRA 5IMEA 3VNTA 4M67A 4OTPA 2VTHA 2JDVA 2XS0A 2AC3A 3W8LA 1W2DA 2EU9A 1FOTA 3HECA 3MY1A 1OIUA 1ZXEA 2OZAB 4O6LA 5HKMA 5EOLA 3ZFYA 3LOKA 4UMQA 5KO1A 4DT9A 3H9RA 3CJGA 2W9FB 3FLNC 4MWHA 3PXYA 5F1ZA 1Q5KA 1PKGA 2IN6A 1PW2A 5ANDA 3S3IA 1SYKA 1DI8A 4IMYA 5AP7A 3JY0A 1M2RA 3HP2A 4E1ZA 3LE6A 3FXXA 1U5RA 1MRYA 4RVLA 5EYDA 1BI7A 2C5YA 4YR8A 2OWBA 1UKHA 5FDPA 3FLSA 1PXIA 1JAMA 1Q61A 2ZMDA 4O96A 2YCFA 3EMGA 3FMHA 3QCYA 4RWKA 4TT7A 2J9MA 4BDJA 4ZSGA 1YDRE 4HYUA 4M0YA 3W2RA 3IDCA 5EQEA 3ZFXA 3QRKA 2X2MA 4LI5A 4QTAA 3UO5A 3GOKA 3NW6A 2QCSA 3NUYA 3DLSA 4F9AA 3W0NA 3R7GA 3NYNA 2GQGA 3VJNA 4F70A 5IQGA 3OMVA 2R3MA 3E8CA 4GSBA 5ACBC 5L8LA 3NYOA 3C4CA 1UNLA 4PL4A 2XVDA 3QQLA 1H1SA 4YC8A 2VD5A 2X9FA 3B8RA 5J8IA 1M17A 5HBHA 4D4RA 4EHVA 1KE8A 2WQMA 2ERZE 3GCQA 5AP5A 4G17A 4BWKA 5J9LA 4YZBA 5CEQA 5HCZA 5CI6A 3PZEA 3ULIA 4L45A 3QZHA 1KE5A 5TF9A 3K2LA 2B1PA 3LXPA 4C3PA 4XMOA 2QQ7A 5ANIA 2Y6MA 5LVPA 1NVRA 1U4DA 4FGBA 4JLCA 4KS8A 2BDWA 5FLFA 3I1AA 5ANOA 3K54A 5KKRB 2GNGA 4X2GA 4E93A 4O0YA 3P7AA 3VAPA 2YIYA 3VUTA 4BDGA 3PPKA 1Q8TA 3W0OA 3ZMMA 3PA5A 4EOIA 4FVPA 3HAMA 4XNEA 3WZJA 4RWIA 5A4EA 4N70A 3QAME 5F20A 3O8PA 3CKXA 4S2ZA 4D9TA 5LWNA 4F64A 2PZYA 4AN3A 3U6IA 5ETAA 3EQFA 2Y4IB 2BALA 4C36A 4ZTRA 4S30A 4I1ZA 3KL8A 4PPCA 2B4SB 3FPQA 4Z9LA 2EB3A 5LXMA 3OTUA 1QPEA 1H01A 2C5OA 3QQUA 4WRGA 5FEQA 4DE4A 5LMKC 5EYMA 4O7WA 3B2TA 3FHIA 3W2CA 4O6EA 4BCKA 4RT7A 4AX8A 4RJ7A 4H3BA 2VZ6A 4O1PA 4PPAA 4HVIA 4LDTA 2OXYA 3Q4CA 3SW7A 3EN7A 1LEWA 5GJGA 3KN5A 3Q52A 4FZ6A 3RCDA 5AUZA 1OUKA 3F7WA 4Y72A 4MXXA 3W55A 4TWPA 2C69A 4O21A 3WZKA 2J6MA 4CQEA 4D4VA 1JKKA 2R3FA 3ENMA 4YNOA 5EW8A 2BKZA 5AV3A 5IEYA 2ZM3A 2Q83A 3SGCA 4ALWA 4R7BA 3AC3A 5KMIA 4D4YA 4O82A 5JFVA 1XBBA 2CGUA 3F61A 5A6NA 3W16A 3OOMA 2E9PA 3NYXA 3ZUUA 3OC1A 5IA0A 2XIZA 3KXNA 3OT8A 3VBWA 3MB6A 4D5HA 3NCGA 4D1SA 1DAWA 4CFVA 3C0GA 4TYIA 3WF7A 3RAHA 4Y5QA 1VYZA 3ZRLA 2WEIA 4I94A 1M52A 4FE2A 2BMCA 1STCE 3LFBA 4O22A 3U6HA 2PSQA 3BWFA 3WF9A 4EH7A 2FA2A 4LRJA 3PJ2A 4JQEA 5A3XA 5T68A 3SXSA 4C02A 4BBFA 1PMEA 4RA4A 3BU5A 3FZ1A 3EQRA 3VRZA 1E1VA 3THBA 4FSZA 4GV1A 5L2IA 1L8TA 2P33A 5DEYA 4ZSLA 3WIGA 4EOOA 4F6SA 2GNLA 1RE8A 2YIXA 1YI6A 4G3EA 2R64A 2E9VA 1ZARA 5BX0A 3QA8A 3MH2A 4FKQA 4QP4A 4CZUA 4D0XA 5LARA 5ANKA 3QL8A 5KMKA 1R0PA 5DWRA 4IB3A 4J99A 4GK4A 2VTNA 4ZJJA 3CCNA 1R78A 3DQXA 4IH8A 5HICA 2BIYA 3O51A 3WBLA 3ZRKA 5IDPA 4P5QA 3ZLWA 5CF4A 2QO2A 3DAKA 3QCXA 4CZTA 4U80A 2WOTA 3PLSA 1MRUA 1M7QA 2X0QA 5A54A 3RKBA 2OLCA 3HZTA 3FZTA 3LJ0A 3KXMA 4DFXE 3PP0A 3ZLYA 1KE6A 2EWAA 5M07A 2XNEA 3TKHA 3ORLA 4FKGA 3U6JA 2NYAA 2C6IA 3F3TA 1ZZLA 4AZEA 4RX8A 4TYEA 2ITXA 4W4WA 4YO6A 1BKXA 3ZS5A 3TUCA 3KGAA 1Q97A 2QG7A 4YHJA 2XCHA 3C4WA 2XM8A 4XV2A 3C4EA 3I7BA 5CVFA 4IDTA 4AA5A 4BDFA 2NNWB 5HNGA 4G5PA 4FKLA 2VTPA 1F3MC 1YXSA 4UZDA 4WA9A 2YAKA 3NVMB 4CGAA 3NVKI 1WAKA 5L6WL 4JRNA 1PHKA 4Z7GA 3PE1A 3ANRA 5G6VA 2JGZA 5AV1A 5F4NA 2XIXA 3MH0A 4CG8A 2QOKA 5H3QA 1JKLA 5KNJA 4AZVA 2DQ7X 3DNEA 2XJ1A 4G9RA 3ZZWA 4WG3A 4RIYA 3W10A 2X39A 3PJ1A 4J97A 1NW1A 3A7FA 3FZOA 4XG3A 1Z5MA 4NK9A 2YWPA 5IPJA 2CLXA 2QR8A 3RPSA 5IZFA 3DQWA 3W0RA 1KV1A 4GFMA 4G1WA 5CEKA 2X2KA 4DCEA 4I4EA 4UMTA 3Q60A 4JT3A 4Q9ZA 5DT3A 5ETFA 3VBQA 4UX9A 2X9EA 3GU5A 4O4BB 3FXZA 3D5VA 3CPCA 1E9HA 4IANA 4JAIA 3TZ8A 1DS5A 4EK6A 1ZLTA 3PIZA 5DG5A 4ASDA 4H3PA 3HMOA 2RIOA 4KBKA 2G2IA 3CGOA 4JDHA 5ETCA 4LQMA 3AD5A 4JG6A 2X4FA 3TUDA 4ZTHA 5FRIA 4CFUA 4F99A 5J7HA 4DTBA 3HYHA 4R6VA 3CQUA 4X0MA 4K77A 5IA4A 4NYEA 1XHAA 1OKZA 4JNWA 3QQHA 2OU7A 4RX7A 4F08A 3UZTA 2EVAA 3MVMA 2R7IA 4BTKA 1Y8YA 2C5VA 3Q3BA 3QQKA 4GKIA 4QPMA 5D12A 1KUTA 4CKRA 3DBCA 2XBAA 2XRUA 3LM5A 2JIVA 4JR3A 4X6QC 4PMSA 5JEBA 1REJA 4QPSA 3DBFA 5DN3A 2R9SA 5BYZA 1A06A 4DH3A 1BMKA 2J0KA 3KXZA 3O8TA 2OI4X 4FKWA 4BGHA 4FTTA 2XKEA 2C30A 3EYHA 2W4OA 4JJRA 1ZYJA 4CFMA 2W0JA 2BPMA 4O7VA 2BRMA 4RVTA 3TWJA 3FPMA 3R2BA 3MB7A 4BZNA 4BYIA 2OJFE 4MXZA 5M4FA 3BU6A 4FTNA 4WO5A 5JN2A 4DCAA 1T46A 3L8XA 4HVDA 1V0BA 4EH2A 2C4GA 1Y6AA 5EDRA 3DCVA 3QWJA 4G6NA 4GK3A 3WZDA 3CP9A 1U5QA 1PXNA 4XBUA 1QPJA 3COMA 3IW4A 4IVDA 4UV0A 4NM5A 4X2FA 3ZUTA 1Y91A 3DKFA 4QP2A 3W2PA 5DNRA 3RM7A 3CD3A 4OT5A 4QO9A 1QPCA 3Q4UA 5JRQA 2B55A 4BCHA 3NUNA 3RCJA 4FTCA 3BELA 3PRIA 3QTWA 3KMWA 4WNOA 3VQUA 1Q8YA 4TNBA 2UW0A 4FZAB 5B7VA 3AXWA 3VBYA 4GG5A 3VHKA 4YZCA 4APCA 2UW7A 3M1SA 4J8NA 3RWQA 5JFWA 4TYHA 2OBJA 1BUHA 4DGNA 3UC4A 2P0CA 2JC6A 2WNTA 3MIYA 2YIRA 4PDSA 3ZYAA 4ZLZA 2Z7SA 3BHTA 3QD4A 4K8AA 5T6KA 4QTEA 4XYFA 2OJIA 3MY0A 1K3AA 2RKUA 4FV5A 4X2JA 3OOGA 3DXPA 3VONA 5K9IA 3F2AA 3MESA 3G15A 2V22A 4F6UA 3ALNA 3D5UA 3O71A 4ZZNA 2XIKA 2OH4A 3EL8A 2G2FA 4XOYA 3EN6A 4FV4A 2UW6A 3UOHA 3UP2A 2YAAA 4YTCA 4FTKA 2ZMCA 5D1JA 3DBQA 3E62A 5HE3A 1HCLA 4HCUA 5KX8A 2XIRA 1E1XA 2FO0A 4FTMA 5E8WA 5FGKA 1NA7A 4G9CA 4LRKA 5KKRC 4GCJA 3PSBA 2C3LA 3KU2A 4FKVA 2WMBA 1A48A 2QR7A 3GEQA 4KD1A 1Q3DA 2R4BA 4MX9A 1SNUA 3FL5A 2CDZA 4TYJA 3MVHA 4LL0A 3SA0A 1XH4A 4L3JA 3QQGA 2CNUA 2XALA 2BZJA 2B53A 2Y4IC 3UDTA 3RAIA 3EQBA 2ZV8A 4CCBA 4H05A 3LXLA