3OS3A

Mitogen-activated protein kinase kinase 1 (mek1) in complex with ch4858061 and mgatp
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
285
structure length
272
Chain Sequence
ELKDDDFEKISELGAGNGGVVFKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPMAIFELLDYIVNEPPPKLPVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDAEEVDFAGWLCST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dual specificity mitogen-activated protein kinase kinase 1
publication title Design and synthesis of novel allosteric MEK inhibitor CH4987655 as an orally available anticancer agent.
pubmed doi rcsb
source organism Homo sapiens
total genus 63
structure length 272
sequence length 285
ec nomenclature ec 2.7.12.2: Mitogen-activated protein kinase kinase.
pdb deposition date 2010-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3os3A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3os3A01
3GCQA 3RALA 3V5PA 2C6IA 4AGDA 5E91A 1KE7A 3OROA 4K11A 3GI3A 3PJ3A 4EOLA 4FIIA 3TN8A 4UX9A 3DBQA 2WIPA 4E5BA 3DY7A 2I40A 3WE8A 1UKIA 5IDNA 2CNQA 5M07A 3TV4A 1JKSA 3QQGA 4PPCA 5CQWA 1A06A 3FL5A 4YNOA 3HV6A 5J8IA 4HYIA 2VGOA 5GINE 2OJ9A 2IZUA 2J51A 4TKSA 4K1BA 4Z9LA 3VS3A 2VTHA 2VO7A 3DXNA 5AA9A 2I7QA 3V5WA 4IVBA 4ZTSA 3QFVA 3FLYA 4XMOA 4QRCA 4DGGA 3P1AA 5DEYA 3CCNA 4RIOA 4RC3A 4G16A 1J1BA 1R0PA 3DKCA 5L2QA 1P5EA 3V5TA 3QBNA 2PZ5A 3FJQE 4PP9A 3RHXA 1G3NA 4Y85A 3VC4A 1GZKA 3GCVA 2ITVA 2ZJWA 3F3TA 2XM9A 3U9CA 5CSPA 4NWMA 2PTKA 3V01A 4CGAA 3NIEA 4BI1A 4CFVA 4APPA 3KREA 4XLVA 3PIXA 4YZ9A 5HKMA 2XNOA 4UYAA 3D9VA 4BHNA 2CGXA 4EEVA 1AGWA 3FY2A 2G01A 5D9HA 5CALA 4X2KA 2R3IA 1RDQE 4QYGA 3I5ZA 4O1PA 2IPXA 2VTIA 1JBPE 5HBJA 1ZYSA 5D1JA 3GGFA 4DT9A 3F2AA 2XKCA 3BE2A 1FPUA 3FQSA 2ITYA 5I5ZA 4USFA 5GIPE 4NM3A 3T9TA 3GCPA 3KB7A 4JDIA 4YZMA 3HA6A 4BDHA 4E4XA 1YVJA 3O7LB 3R1YA 3W33A 3RWPA 1ZYJA 4CNHA 3SA0A 1G8AA 1F0QA 4A4LA 4G6OA 2BRNA 4KKHA 2P55A 3VRZA 1VR2A 2OSCA 2QKWB 4MKCA 5KMOA 3CS9A 2AC5A 4FG7A 4ZJJA 3F82A 4ALWA 3DKGA 2ERZE 4KWPA 1Q62A 3F69A 5LARA 2Z8CA 3KMUA 3BHHA 3EQDA 4O0YA 5IQGA 4MXOA 2OXDA 3COKA 3UBDA 4R7IA 3I0OA 4G2FA 5HE3A 4DF3A 5AAGA 2BPMA 1YDSE 3TCPA 4UN0C 5I9VA 3BHUA 4ZTNA 3GU4A 4QP3A 2XK3A 3ZUTA 2C0TA 4UMTA 3LFEA 2UV2A 2O3PA 3Q3BA 3D5XA 2GHLA 4AUAA 2PWLA 4NTSA 4A07A 3AMYA 2V62A 3EFKA 4EH3A 2BDJA 3FZPA 3OWKA 2PMOX 4F1MA 5AV1A 5JGAA 5IQFA 1QPEA 5FEDA 4OLIA 5I4NA 1Q99A 4WKQA 5CU2A 5AJQA 2UVZA 3TV6A 4F09A 4M15A 4BBMA 5I9ZA 2BTRA 3NW7A 3VVHA 2YIRA 4JBQA 4M3QA 5EM5A 4EK3A 1Q8WA 3NZ0A 4FSNA 3CTHA 4WG3A 3SHEA 5CAPA 2I0EA 4IIRA 4OTIA 4QMZA 3TZ9A 3GB2A 4D1XA 3F66A 3E8CA 5CS6A 5KMLA 2O0UA 3ZUVA 5M51A 2BCJA 5GHVA 1UV5A 2C0OA 4L43A 3SAYA 1FOTA 2A27A 3HV4A 4JAJA 2HY81 3ZUUA 2JAMA 4OTQA 3ZLYA 5HTCA 4RA4A 5IPJA 5HNIX 3R1NA 1J3HA 1E9HA 2NPQA 2Z7RA 3EL8A 3E62A 2O64A 5CAUA 2ZDUA 3GVUA 3II5A 4NM5A 2BHHA 5G1XA 1JSTA 2YAKA 3W18A 4FIGA 5JRSA 2R3LA 2XKDA 5D7VA 3BYSA 4IZ5A 4BKYA 4X7QA 3R8PA 1B39A 1FVTA 3ZDUA 4QQ5A 5KZ0A 5G6VA 4Y46A 4ALVA 2A1AB 4JNWA 2PU8A 2QG5A 4MF1A 5K0KA 3LXNA 5HTIA 2YABA 3QTWA 3FMLA 5E8UA 4FKWA 2IZRA 4QTDA 3R7UA 3VS4A 3QQKA 5ETAA 5EW3A 1CTPE 4EQMA 4QMNA 4ZSAA 3V3VA 3D15A 3D14A 3FUPA 4OTWA 4V04A 4PP7A 3CLYA 5E90A 5IEXA 1O6KA 2OH4A 1NY3A 4U7ZA 2ZAZA 1Z9XA 3TI1A 3TNHA 5AP5A 2NO3A 1XKKA 1ZY5A 2FA2A 3DAEA 4F08A 5L8LA 2CGUA 4EYJA 4ACGA 2C1AA 3E3BX 4C38A 2CKOA 1JWHA 2YISA 4O82A 4DBXA 1W7HA 1Q3WA 1KSWA 2ETKA 3ZLXA 2QOHA 3FMDA 3RPOA 3RAIA 2WMXA 2IW8A 3V5QA 3QLFA 3PWDA 1ZY4A 4BKZA 3LW0A 3WARA 4DEIA 4NK9A 2VWYA 3I7BA 1FBNA 3VWAA 1H28A 1VYZA 5DGZA 3QUDA 4WO5A 2VWXA 2R3FA 3BWFA 4YZCA 5AEPA 2BZHB 1H1QA 4OT5A 1LP4A 2ZM3A 1FGIA 1BI8A 4RIYA 4AW5A 4UWYA 5K9IA 4LL0A 5JQ5A 4ID7A 4FTCA 3QGYA 2DWBA 3KQ7A 4AW2A 3KFAA 2B9JA 4J96A 4HYUA 4H39A 5FP6A 2B55A 2F7ZE 1XH7A 2HWOA 3ZBXA 4BYJA 4U9AA 2X2KA 1HCKA 4M14A 4QP7A 4JG6A 4GVJA 3RJCA 4IM0A 4FKVA 3WZDA 4YGAA 2QOFA 4J52A 3PTGA 3M11A 3OT8A 1WBNA 3VF8A 3AXWA 5HD4A 2JIVA 3VJOA 4DH8A 2C6EA 1UA2A 3W2RA 2JDTA 4JX7A 2PZYA 4PMPA 2P2HA 3QXOA 3OY3A 5DLSA 5AV3A 4FNZA 2GQGA 1YQJA 2PL0A 2XA4A 3LXLA 1PJKA 5BMMA 3R9OA 4D4VA 4DGOA 2F2CB 3MB6A 2G2FA 3CC6A 3QD3A 1CDKA 4ERWA 5JFXA 3LMIA 3U6IA 1SNUA 2RSVA 4JBPA 4WUAA 1KWPA 3DJ7A 3MA6A 3OXZA 4GIHA 5AX9A 5DT3A 5HCYA 3Q32A 4XOZA 3B8QA 4PUZA 3G9LX 3Q9ZA 4BDKA 3CP9A 3UDBA 3ZM4A 4BRXA 2RFEA 1U46A 4D4SA 3DDPA 5LOHA 1JPAA 2IJMA 3P5KA 4U45A 2E9OA 3O8UA 2PY3A 1W83A 3O71A 1ZOHA 3FKLA 3G33A 3PY1A 4MEDA 4MNFA 4TY1A 3RNYA 1WBOA 3HVCA 4H3QA 4AXAA 2YWVA 5IQCA 5DI1A 1OKZA 2XK4A 4DEGA 4IC7A 4KBCA 2IN6A 3PJ1A 4IVAA 4F7LA 4CQGA 4UB7A 2CPKE 4F6SA 1U4DA 2J2IB 2VWUA 2XUUA 4D2WA 2DYLA 3VUGA 5IEYA 4Z3VA 4V01A 2YACA 5FXQA 4IWPA 3V6SA 3A7IA 4FT0A 3E88A 4IVDA 4WA9A 1KE5A 4BCOA 4O7VA 3LFSA 5C26A 2DQ7X 5HD7A 2HZIA 2XK7A 2IVUA 3JVSA 4IX6A 2BZKB 4D1SA 3QXPA 3M1SA 4F4PA 3NUSA 2WKMA 4DFLA 3U4WA 4KINA 2VTSA 2OZAB 1Q8ZA 4I23A 4FKSA 3CE3A 2WMTA 3I7CA 2OO8X 4ZIMA 1XWSA 2HOGA 3G6GA 3O0GA 4GKIA 3E8EA 4E6QA 4I92A 5BVOA 3S95A 4HGLA 3ZU7A 4WNMA 3O8PA 2RFNA 1PMEA 4J97A 4HNFA 4B99A 3P9JA 3IDPA 3LXPA 2UZEA 3T8OA 4AGWA 4M66A 4XP0A 2UUEA 1PKDA 4BVUA 2WB8A 3H9OA 4EUUA 4Z16A 4YHTA 4O21A 4JBOA 3HYHA 3Q6WA 5BNJA 4GVAA 2VTPA 4FK6A 4YO6A 1U54A 4CFXA 2BMCA 4IAYA 3EYHA 4AZVA 1OBGA 2FO0A 4M69B 4PMSA 5AUWA 4RWLA 4IB1A 5KNJA 4G6NA 3FLQA 2BUJA 4LG4A 4D9TA 4IVCA 4G3CA 4YJQA 4CKIA 4GRBA 4FR4A 5FDXA 4O2PA 2B0QA 4TYGA 1NA7A 4GK2A 3UYTA 3E92A 4E7WA 4FTRA 2C69A 1J7UA 2WQEA 3Q52A 4QP8A 3TIZA 5F20A 4DA5A 1UU3A 5JZJA 3GEQA 4GG5A 5GZAA 5DNRA 4MF0A 4NT4A 3OUKA 4AE6A 4DLJA 4E6AA 1R1WA 2R3PA 2BTSA 4PDSA 4X6RA 5F4NA 5HLWA 4W4XA 3D83A 4FI1A 4QP9A 5AR4A 3QYZA 2ITOA 4IB3A 1YHVA 5TR6A 4BBEA 4C59A 4DH7A 1PW2A 4L00A 2WU7A 1H00A 3U51A 4UZDA 1PXPA 3FZ1A 2R0IA 3A60A 1OL2A 3EN9A 1MRYA 1G5SA 3H4JA 4P4CA 4R1VA 4FG9A 4EH6A 4DCEA 5KKRB 4DTAA 2VWVA 1YXXA 4AGUA 4HCUA 4UALA 5M4IA 2C5VA 2QVSE 4YHFA 3LE6A 4IJPA 5HG9A 4QMQA 2UW8A 4I5MA 2WAJA 2EB3A 3BWJA 3QC9A 2G9XA 4RVLA 3JVRA 4LL5A 5GJFA 3QHRA 1UU9A 3PFQA 3TKHA 4AX8A 5IUGA 4CTBA 3W32A 2IVTA 4EBWA 3HAVA 4S32A 3QA8A 5C4LA 2E2BA 3NUNA 5AAEA 4O0TA 2YDJA 4U40A 4BCNA 3O17A 2VWWA 2YIXA 3ZO3A 5I9XA 4RJ7A 1Q61A 5D7AA 4L42A 3I79A 2OBJA 3QX4A 3BEAA 4FZAB 1TKIA 3FYJX 3MA3A 3LFNA 4Q5HA 3UVPA 4AT4A 3QTUA 2JKKA 4AU8A 1V0OA 4TTHB 4BGHA 3MJ1A 2C1BA 3U87A 1KE9A 4WG5A 2OXYA 4X3FC 2BRMA 3KKVA 3ELJA 4M68A 5CEQA 3ZHPC 3ZRLA 3HA8A 3KL8A 5CASA 5HVKA 5CT7A 2W1GA 4YO4A 2JDVA 4YTCA 1PXLA 2GCDA 1H1PA 3DZQA 4RX8A 4ZSEA 1OUKA 4TYHB 4C35A 5EYKA 2ZM4A 3RM7A 4ZY6A 5IU2A 4MXCA 2HENA 4CG9A 2YCFA 3SXFA 4BGGA 1R3CA 2FUMA 4O7YA 3DNEA 3LCSA 2ITQA 3D94A 3U9NA 3OCTA 4E1ZA 1I09A 4IACA 4TXCA 4M97A 2PVFA 3HKOA 1H08A 2CNUA 2P33A 1YOLA 3ORIA 3R1QA 4ZTHA 4DEHA 4EZ7A 4YZBA 4UMPA 3S3IA 2HYYA 2VTQA 3HRBA 3FXXA 2VNYA 4QD6A 3THBA 3MVJA 4NCTC 1RE8A 2V7AA 3DGKA 3W2CA 5KMJA 1R0EA 3KEXA 5CNNA 4RX9A 3WIKA 5JSMA 4BTFA 4KBKA 5T3QA 3WZJA 3TUCA 4GUEA 3AT3A 2YCQA 2O8YA 4Y72A 3AMAA 2ZDTA 3F5UA 4HNIA 1M52A 3UODA 4E73A 5A46A 3LFDA 2CMWA 4IX3A 3TIYA 2IO6A 3LAUA 3OW4A 3CIKA 4LMUA 3UZTA 1PYXA 1PY5A 1YOJA 3QCYA 3HUCA 4TW9A 3PVUA 4C8BA 4CFWA 5HCXA 4PX6A 3LCDA 3LHJA 4YJSA 2J0IA 5DYJA 2WMRA 5HU3A 4U8ZA 4KKGA 4EZ3A 5M57A 3AC4A 2RG5A 1AQ1A 4ACCA 3FHIA 1PF8A 4B7TA 5K4IA 4NW5A 3OY1A 4B0GA 1OPLA 2X4ZA 5FBOA 4O7ZA 3COIA 4RWIA 4EK6A 4CMOA 3QUEA 1DS5A 3ALNA 2YM8A 4E4LA 2CSNA 3SXRA 4RIWB 4FTJA 1H1SA 2J0JA 3MGYA 4AOIA 3ZLSA 2YM4A 5EFQA 1BKXA 5CF5A 2JBPA 2OFUA 5HCZA 4J8NA 2XK6A 3PXRA 5CF6A 3QQHA 5EYDA 4OTFA 5HU9A 3LM0A 4USDA 1ZOGA 2VU3A 4W4VA 4ZTLA 5TE0A 4IWOA 4BTJA 4J1RA 2ZB1A 3FKNA 4X2JA 3A99A 5CYIA 3TJDA 3R7IA 2OZOA 3ORNA 3LVPA 4KS7A 5L6PA 3PY0A 4IHPA 5GZ9A 5HNGA 2A4LA 4AE9A 5KBQA 2QU6A 2CKEA 3OT3A 5L2IA 5AP1A 5I9YA 4L45A 1SVEA 3CR0A 3BHTA 3QRKA 2BAQA 4FEUA 4XYFA 4V0GB 2YM6A 4YJRA 4FV2A 2UZTA 1M7NA 4IB5A 5IA2A 4OBQA 4QO9A 1SYKA 2NNWB 4Q2AA 4LGGA 4GIIA 5EDRA 4IAKA 3COHA 4HCTA 1P4OA 3ETAA 3NAYA 4XOYA 5CSXA 3KRJA 2PMIA 4FNYA 4W4WA 2W9ZB 3EN6A 4CD0A 3WI6A 4MX9A 4YC8A 1YI4A 2VTRA 3ZBFA 4RVKA 3IDCA 3C1XA 3ATTA 2R4BA 4L3JA 5DOSA 5E92A 3HL7A 1M2RA 1WBPA 3LOKA 4KAOA 4I4FA 5CVHA 3S0OA 3EQHA 4II5A 4O6EA 4FA2A 4ITHA 2BKZA 2PK9A 1Y8GA 3Q6UA 5F9EA 3SRVA 1Q4LA 1CKJA 2YLFA 4P5QA 4X3FB 5BVWA 4D2VA 3R8LA 1CKIA 5L4QA 3KY2A 2ONLA 3GENA 3KRWA 1XBCA 1Q8UA 4AOTA 3L8PA 5M44A 3W16A 1OIRA 3M2WA 1UKHA 3CJGA 3R7OA 1W98A 3E3PA 4N57A 3UPXA 2BFXA 3AC5A 4JX3A 1W82A 4L46A 3K54A 3ROCA 2IVVA 4I5CA 2UZUE 3UE4A 3FHRA 2ITWA 3HNGA 3NYVA 4NZWB 3PRFA 1E1VA 2H8HA 4C58A 2CN5A 2W17A 3EWHA 4IB0A 2FGIA 3PVBA 2C3KA 3R04A 5LMBA 3ANQA 3H10A 2CJMA 3L9MA 4P90A 4TL0A 3L8SA 4E5AX 3D2IA 3FSKA 4FKRA 4MXYA 3SVVA 1YWRA 1PRYA 4O7WA 3C13A 3EL7A 5AR5A 2P3GX 4WSQA 1J1CA 1H01A 1LEZA 4DEBA 2HY0A 3SV0A 3FI4A 4O22A 5HIEA 3EQCA 3WOWA 3F88A 4DFYA 3LCKA 4F65A 4F1OA 3Q9WA 4FE2A 4QQTA 4I1ZA 4S2ZA 3LJ2A 3R0TA 5HTBA 3V04A 4OT6A 2WZJA 3UMWA 2EB2A 2XKFA 3MWUA 4ANSA 3QKKA 4GJ2A 4APCA 3A8XA 4K2RA 2B4SB 3EB0A 4J53A 4R5SA 4EJNA 3WE4A 2R3OA 2X4FA 3BX5A 1BUHA 3QCXA 4NIFB 3DQWA 2Z60A 4PV0A 4YJVA 4RX7A 2BIKB 4C57A 4EORA 3QLGA 3RWQA 5AP6A 2QNJA 4MTAA 5FDPA 2QR8A 1DAWA 3VBQA 2WMVA 1UNHA 3A7GA 4JG8A 1PMUA 4DBNA 1BI7A 3EQPA 4O83A 3TNWA 3MIAA 3FXWA 3SOAA 5AR3A 4L3PA 3PYYA 4V05A 5IQEA 4GYGA 4MXXA 4CFMA 1IRKA 4C3PA 3DKFA 4FSWA 1ZAOA 5AUYA 3IOKA 4AFEA 5IQAA 2Y0AA 4GV1A 3RCJA 2W1FA 4K18A 5IISA 4F7NA 1GIHA 3KN6A 3M42A 4C33A 2XM8A 3FL4A 3C4EA 4GMYA 3LMGA 2XRWA 2XYUA 5HOAA 2R3KA 3SLSA 2JGZA 2C47A 2OIQA 4O0RA 4WBBB 4QTEA 4I22A 4CFFA 3F3WA 2BZJA 3CGFA 4AA5A 4EH5A 3HMNA 1H24A 3I81A 3N9XA 3Q2MA 3QTZA 4XG3A 2R0UA 5ANKA 4EHEA 4RJ5A 1PXKA 4EC9A 4FSMA 4GT3A 3DV3A 4ZJIA 3LFFA 3G9NA 3VBVA 3NUYA 2YZAA 2W1DA 3PJ8A 4KIOA 5E1SA 1OIUA 3R9HA 2F4JA 4DG0E 3IG7A 2GS7A 2UW0A 4WT6A 3Q2JA 4L53A 4JQ8A 1REKA 3Q9YA 5JZNA 4A4OA 2RL5A 3RPRA 1XH4A 4XX9A 2YM5A 3BGPA 4IAIA 3FYKX 2RG6A 3E87A 3HZTA 5FGKA 5FG8A 3LFAA 3FE3A 5AP2A 4OBOA 2JITA 4CLJA 1TQPA 3AT2A 3R71A 5JFWA 4D4RA 3R30A 2ESMA 2CDZA 3R7GA 4D2SA 4DCAA 2I0VA 2FB8A 2QOCA 4JAIA 3U55A 2RKUA 4WOVA 4I21A 4GK3A 3VHKA 3WILA 4ZOGA 4HPUE 3MV5A 3TACA 4CV8A 3IW7A 4HZSA 3GNIB 4FV5A 1PMVA 5LWNA 4FTLA 4MNEA 1E1XA 2QONA 4UXQA 2WD1A 2XH5A 4MYGA 4ZSJA 4UV0A 2HELA 1SVGA 2QOQA 4XJ0A 4EUTA 2QOLA 4L67A 4O84A 1TVOA 4J71A 1F3MC 1WAKA 4BDEA 4JDKA 3VS7A 3PG3A 2VV9A 3DJ6A 1YKRA 4O2ZA 4ENXA 4JQEA 5DE2A 3HDNA 5JGBA 5HLPA 3NIZA 3VNTA 3CQWA 4RFYA 1WBTA 4FIFA 2V7OA 2WOUA 2QODA 3FSFA 3HV7A 4YTHA 3POOA 5IZFA 4YUQA 2EWAA 4G5JA 2A2AA 4ASXA 4BWXA 5E1EA 3ZSGA 2PZPA 2OF4A 3ODZX 1OITA 2B53A 2ZMCA 4FZ7A 3VO3A 3C5IA 2W1ZA 1XHAA 3FC2A 3KGAA 4O6LA 4RX5A 4BCPA 1CKPA 3LFBA 2BVAA 2XCKA 3QD0A 4IH8A 4MD7E 2QLQA 4RC2A 5E8VA 5ACBC 4BKJA 3ZO2A 4N6YA 2W4KA 3I5NA 4N4SA 4AF3A 3O23A 4I20A 4KB8A 3ZDIA 1R39A 1Q41A 4WRSA 3DJ5A 3NSZA 3F9NA 3Q5IA 4FGBA 4FIHA 4MBIA 5ANGA 4BDDA 2OF2A 3GU7A 3KCFA 3R02A 3ORPA 4O0XA 4X2NA 4Y5QA 5FTOA 2JLDA 5JMSA 3ENHA 4IX4A 3LIJA 3RPYA 5J95A 3BPRA 2IW6A 3RAWA 1I44A 3F2RA 2JIIA 5DEWA 2RFDA 4BWKA 4ZLYA 2C0IA 5BUJA 3GT8A 3HP2A 3TKUA 2GU8A 2J5FA 2OICA 1ZMWA 2YA9A 3ACKA 1ZWSA 5H8GA 3UIBA 4AWIA 4E4MA 4F70A 4YURA 4ANLA 4F0GA 3N4UA 5CU0A 3DB8A 5JRQA 4MXAA 4R3PA 3MFSA 4MQ1A 4UY9A 4BCMA 3SGCA 3VBXA 2R3GA 3GP0A 3MY0A 3I6WA 4AT3A 3ORLA 4U44A 5HIDA 3UMXA 4BIEA 4L7SA 4KBAA 3CD3A 2PULA 5AIKA 2OFVA 4YBKA 2GNIA 4XG2A 2PE1A 3NLBA 3PXQA 5CSVA 4A9UA 4EBVA 2EU9A 2XNNA 1QPCA 3UOJA 4CV9A 1OGUA 2GDOA 4D2PA 4YMJA 5E4HA 3W8QA 4IANA 2AYPA 4G1WA 3OVVA 2BHEA 3HMIA 4EOOA 3PG1A 4XNEA 3ACJA 3IKAA 3ZM9A 4BDAA 2YFXA 3ZTXA 3PWYA 4TRLA 1OL7A 3H0ZA 4YNEA 4BCFA 5HX6A 5CZIA 2H34A 3RBWA 4JI9A 5BUEA 3QRTA 1DI9A 5EM8A 5BVEA 5IH4A 2VN9A 5EQEA 5EHYA 5DH3A 1WBWA 3EQRA 2CGWA 2EXEA 5AUUA 1LR4A 2QR7A 4HCVA 3V51A 4D55A 3KRXA 2CCHA 4ZEGA 5EH0A 3UOLA 3PA4A 5FTQA 2FH9A 3PUPA 4U79A 3MYGA 1ATPE 4XG6A 4TNDA 4WNOA 4BF2A 3NX8A 2W4JA 3QRIA 4AOJA 4D28A 5AR2A 3KK9A 4I3ZA 2PVLA 3RCDA 2W5BA 3ZXZA 4CCUA 2Y7JA 3R28A 3UG1A 5KX8A 2WTJA 2CKPA 3B2TA 3U6HA 2H9VA 4FKTA 2BROA 4GW8A 4IX5A 5BYZA 3KF7A 4P5ZA 5CT0A 2OI4X 1Q3DA 2W1HA 4UEUA 4EOSA 2VTOA 3DQXA 1WZYA 3JYAA 2WTIA 3UP7A 4Y8DA 5K4JA 4WG4A 4FIEA 1IAHA 3P08A 5HO6A 3SG9A 5C03A 3FMEA 4BIDA 5EQPA 3R22A 2F9GA 3NW6A 5CX9A 3T3UA 1Q8TA 3I0QA 1KOAA 5HX8A 4MWHA 2PVHA 3NYNA 3ZZEA 4HOKA 3HUBA 3FLSA 4EZ5A 4DH1A 4XHKB 3HECA 4OUCA 5AV2A 2YIYA 3F3VA 4FVPA 4QPMA 3RNIA 4JRVA 2W05A 2YJSA 3FZRA 1PMNA 4ACMA 2VTJA 4KNBA 4HVGA 3WZUA 3QZHA 4FNXA 3F5XA 4QMWA 5HVYA 3WBLA 4XV2A 5DA3A 2QURA 2YIWA 3CKXA 1MRVA 3C4ZA 5KMKA 3C4FA 3GFEA 3JPVA 5CEIA 4BCHA 2C3LA 3MFTA 4O38A 3IS5A 3ZRMA 5HG7A 5KKRC 4X0MA 2C6TA 1TQIA 4FT5A 1YI3A 5CY3A 5FQDC 5IMXA 4AZSA 2HZ4A 1H1WA 4ORKA 4S30A 4M12A 4WHZA 1MP8A 2OIDA 3BRBA 3HLLA 3LLTA 3WYYA 1BL7A 2X0GA 3F3UA 5CEMA 4NJDA 3LJ1A 5FM3A 4C3RA 2HIWA 2QU5A 2Q83A 4GH2A 5M09A 3KMMA 1O6YA 4Y83A 5FUTA 2F49A 4FF8A 4PPAA 4E3CA 2BRHA 4HGTA 2X6EA 4J98A 2ITTA 4MHAA 2CLQA 1TQMA 3QX2A 4PL3A 5DIAA 2JD5A 3G15A 3DT1A 5HZNA 3BV2A 3NVKI 2SRCA 3QAME 4KSQA 5CF8A 3KULB 4CEGA 3I60A 4RLLA 3DKOA 4EK5A 2GNLA 3ZRKA 1GZOA 4YC6A 4RPVA 4FX3A 3TKIA 3QQFA 3ET7A 4DLIA 3BIZA 3TT0A 3E63A 3BELA 4YJNA 4QMPA 1KE6A 2J0KA 2Y8OA 3AMBA 4OTDA 4FKPA 4H3PA 4TWOA 3GCSA 1K9AA 2HAKA 2PZIA 4C61A 4L52A 3FI8A 2VUWA 3QWJA 4L6QA 4RMZA 3N4VA 4EHZA 2FSMX 3PVGA 4IFCA 5FEQA 2X7OA 4Z7GA 5ANDA 4U80A 3W1FA 3RPVA 2IVSA 3AGLA 1Y91A 3VUIA 3BYMA 4FKUA 1NT2A 3ORTA 5A4LA 4I0SA 1XQZA 2OJGA 2X81A 2X2LA 3MTLA 3S4QA 1ZMUA 4YR8A 4ERKA 2B1PA 3PA5A 5JQ8A 3D7TB 2JDSA 2O63A 3V6RA 3UO4A 4F6WA 1OI9A 4FT9A 4O86A 3DXPA 1DAYA 1KV1A 3NR9A 4L8MA 5IUIA 5K3YA 1H0VA 1PXNA 4YZDA 3DOGA 5H8EA 2ZOQA 2UZDA 4LOOA 4CG8A 2XNPA 3BI6A 3GC9A 3E7OA 3MDYA 3RVGA 3V5JA 5IKWA 3RZFA 4FEWA 3CEKA 3Q96A 2PUPA 5IQIA 2WU6A 2PUIA 2YLEA 3FWQA 1FMOE 2OU7A 3F6XA 4G17A 3NVMB 4C4JA 4FC0A 2GNHA 3NCGA 5B0XA 4O7SA 3LPBA 5EK7A 2JFLA 4Z7HA 4X21A 4U3ZA 3MFRA 4L9IA 4NSTA 4AT5A 4I6FA 5LWMA 4S31A 3REPA 5A6OA 4O1OA 4RGJA 2HK5A 4JVGA 4KA3A 3VQUA 1H07A 5IMEA 4U41A 1WMKA 2W1CA 2FVDA 3MI9A 1XH5A 4MD8E 5EM6A 3TG1A 4BN1A 5FP5A 2BZIB 2W7XA 4JIAA 4X6QC 3TTIA 3OOGA 3E8DA 3FXZA 4XEYA 3AD5A 4S34A 3OTUA 4OBPA 3R00A 2QO2A 2PVYA 3DDQA 2HXQA 4H58A 3LZBA 4RJ3A 2BAJA 3F5GA 3MTFA 4XCUA 2Z02A 4YLKA 5A54A 3GQIA 3VQHA 4BC6A 3QTRA 3OC1A 3ID6C 2OW3A 3P4KA 3AC8A 1ZRZA 3KVXA 5GZ8A 3U54A 1DI8A 2WMBA 3QQLA 2O65A 3KF4A 4IAZA 3HMPA 5T6KA 3EH9A 2OZAA 3EHAA 4AG8A 4AW1A 4HW7A 4X2GA 3DS6A 4LOPA 2ZV2A 4I24A 2PPQA 5AUZA 2H6DA 4ZS4A 2QI8A 1NVSA 4C62A 2W06A 1OIYA 5HG8A 3I1AA 2WTKC 4U3YA 2C4GA 4FKOA 2ITNA 4TN6A 4YPSA 4FYOA 5GNKA 3WIGA 5M4CA 4JIKA 3HAMA 4YSMA 3R8UA 4GU6A 1ZYLA 2VTTA 1SM2A 2J6MA 2F2UA 4X3JA 4YJUA 4C0TA 4R78A 4IADA 5AR8A 5EDPA 1H0WA 1V0BA 5LMKA 2PZRA 3DZOA 3BEGA 2VD5A 3EZVA 3MVHA 3U4UA 1JVPP 4XV9A 4FSQA 3KC3A 3R83A 4M0YA 2UW7A 3PLSA 5L8JA 5BVFA 4FOCA 4FTTA 3UTOA 2PVKA 1FGKA 4F0IA 2XBAA 3UYSA 4M69A 4IQ6A 1FVVA 3IW5A 3JY9A 4MCVA 4RWKA 4C02A 1OPJA 4GEOA 4M84A 2WFYA 4IXPA 2JC6A 3OBJA 3IQ7A 4KRCA 4GUBA 3GU5A 4QMXA 5J5SA 3VS6A 2JKOA 4FL2A 5BUIA 2PUNA 1OIQA 3A7FA 2H96A 5HBHA 4CFUA 2UZOA 3NPCA 1GIJA 3QWKA 4NKAA 2EXCX 4R5YA 3G90X 3MW1A 4GYIA 5D41A 2CNVA 3RM6A 5GIOE 3BYUA 2WTVA 3Q9XA 5KO1A 1OBDA 2QCSA 5KCVA 3G6HA 5AP0A 4FL3A 3EMGA 5J7BA 2YIQA 3H3CA 3PLAE 4BTMA 3C4WA 3R6XA 5ACKA 1ZARA 2RFSA 2Z7LA 1XO2B 5DBXA 4EH8A 1WBVA 2UZNA 4B8LA 5HEZA 3C4XA 3QTSA 3TDVA 1ZZ2A 3Q4TA 4QMLA 2VGPA 4GU9A 3JXWA 2QLUA 5I9WA 4DTKA 2WMQA 5CXHA 1Q5KA 4H3BA 1Y57A 3AOXA 3BCEA 3UNKA 3LMHA 4DFZE 2QOOA 3IOPA 1URWA 4LQMA 3QD2B 4R7HA 2PYWA 5A14A 4FTKA 5TOZA 1JLUE 5CF4A 2XCHA 4FTUA 4NTTA 4JJRA 4W9XA 1IAJA 1O6LA 4QYEA 2FSOX 4ZP5A 4ANNA 1GIIA 2HXLA 3R01A 3NUAA 2R5TA 3SDJA 5DRDA 4R1YA 4IW0A 1ND4A 1OMWA 4RZWA 4KD1A 4TYIA 4DINA 5M08A 4LM5A 2A19B 5AM6A 4U97A 2E9UA 5KE0A 5E8TA 3EFWA 3PPZA 2GQSA 2I0HA 3RI1A 2I0YA 2I1MA 2R3HA 2W5HA 3EQGA 1FQ1B 5HBEA 1OVEA 5B7VA 2ZB0A 3GOKA 2X8IA 4I93A 4BDBA 2JKMA 3LCTA 3Q04A 4G6LA 4ZZNA 2VTLA 2CLXA 4ZZOA 4FMQA 3LFQA 4FBXA 4K33A 5BVDA 4AFJA 2B9IA 4IZ7A 4RC4A 4AZFA 1Q97A 4JL9A 4TYHA 4FEVA 5DFPA 4CRSA 4J95A 4U5JA 3WZKA 2UZBA 3FDNA 4HVHA 2UVXA 4QMYA 4EOKA 2W9FB 4IC8A 2RF9A 2GHGA 2XIRA 3MVMA 4BI2A 4PNKA 2YWPA 4CYIA 2XJ1A 3HP5A 5J9ZA 3UNZA 3DU8A 4C4EA 4O7TA 3DBCA 3C7QA 3P86A 4OGRA 4BBFA 4EYMA 5LVMA 4BL1A 4RIXB 4LMNA 4ZS0A 3DTWA 3UO6A 2BDWA 3H30A 1GZ8A 2W1IA 4KIKB 4RVMA 3CKWA 4PF4A 3IDBA 2WTKB 1YRPA 2G1TA 2PE0A 3QYWA 4NEUA 4C2WA 3R73A 3A2CA 3O8TA 3RK7A 3NCZA 2XBJA 3F61A 4QP4A 3U8WA 4ZY5A 4GG7A 5KMIA 2YZLA 1SNXA 3IGGA 2ERKA 4KIPA 4CYJA 2XVDA 4B8MA 2R64A 5AADA 4KIQA 4I4EA 3PPKA 2B54A 4EWHA 3ZO1A 5M06A 1BL6A 2W99B 1VJYA 3HGKA 4FZDB 4CLIA 4FG8A 3QGWA 4JBVA 3EIDA 5H3QA 4DFXE 3NW5A 2WTCA 5IUHA 5L2TA 5LCJA 4CRLA 4GSBA 3FZOA 3WF9A 4FODA 3SD0A 3EQFA 3BGZA 3LXKA 4XP3A 4FGRA 3ZS5A 4FV4A 4FV9A 4LI5A 4C7TA 4A9SA 4BTKA 3QZIA 4NM7A 1ZYDA 2OXXA 3TZ8A 3RHKA 4EKLA 2R7IA 3PIYA 3Q4CA 5EI8A 3SKCA 4QP2A 4R6VA 2XS0A 4WNPA 1SVHA 3PDTA 3DBFA 3DFCB 2AUHA 3NYOA 5AIRA 4XUFA 4U6RA 3V5LA 2PMNX 3C51A 2VX3A 4RIWA 1G8SA 4RLKA 5CVFA 1Y6AA 2YJRA 3W10A 4WSYA 3TUDA 5LXMA 4YJOA 1JSUA 3F3ZA 4RA5A 2VO0A 1IG1A 1OZ1A 4GS6A 4OW8A 2HCKA 4LRJA 5GJGA 5CEPA 3W55A 1UU8A 4EOIA 4AAAA 4PTEA 5CEKA 3GBZA 3OZ6A 4BGQA 2QOBA 4A7CA 3KXGA 3G2FA 3KK8A 1JSVA 1YDRE 4E26A 3BYVA 4EI4A 2G2HA 5IQHA 3IW6A 3BYOA 3P78A 4J7BA 5E8SA 5AP3A 3UOKA 3OD6X 4MD9E 5DWRA 5E9EA 3MBLA 2WTWA 3H0YA 3EN5A 2XZSA 3IPHA 1ERKA 1GJOA 2WMSA 4V0GA 2GTMA 4U42A 5DR6A 4I94A 2WEVA 1YDTE 4QPAA 3SW7A 5IA5A 4TYJA 5EKOA 3ZSHA 4E6CA 3S00A 1W84A 3FLNC 4ANMA 1A48A 2J0LA 5CWZA 4I41A 4KSPA 1DM2A 3EQIA 1XH9A 5IH5A 4BI0A 3L9NA 4BR3A 3ZXTA 2F7EE 2ZVAA 5B2KA 2OLCA 4KABA 2WQBA 3TWJA 2EVAA 3MY1A 3NGAA 3VIDA 4F9BA 5CAVA 3BGQA 5CU6A 5BX0A 1H26A 2JEDA 3VS1A 3FLZA 3PPJA 4XRLA 2GMXA 4QMMA 4X3FA 3NAXA 4BWPA 1M17A 1XJDA 2HZNA 4JQ7A 4FSTA 3W8LA 5F94A 3O7LD 2J4ZA 2REIA 4QMSA 3AC3A 3UVQA 4M67A 4MBJA 4F64A 3DXQA 1FVRA 1PYEA 3LCOA 3QALE 4EQUA 3MFUA 2PVRA 2VTAA 3SX9A 4XV1A 4TYEA 4G3EA 2LGCA 2GNFA 1Z5MA 3ORXA 3QF9A 4ANBA 2VO3A 1SZMA 2V55A 3LJ0A 4U0IA 4YTIA 3FI2A 4ACDA 3NUPA 4AW0A 4BFMA 4BCQA 1YHWA 2UW3A 3QL8A 5IG1A 4OAUC 4IJ9A 4ZMFA 3QRUA 5E7RA 2G15A 4O0UA 3ZH8A 5BYLA 2C68A 4B4LA 5FRIA 4UYNA 3DK6A 3MN3A 3PP0A 4N0SA 3FAAA 2OJIA 4ACHA 5CSWA 3VN9A 3PP1A 4E6DA 3OWLA 2Q0NA 4G3GA 4RWJA 5M4FA 3BLRA 1M7QA 2QC6A 3RGFA 3UIUA 3PRIA 4DHFA 5EKNA 4W8DA 2C6OA 3FMHA 2GS2A 5L8KA 5EM7A 4S33A 2V0DA 3TNPC 4QYHA 2I6LA 4NCTA 4FTNA 5CI7A 2WTDA 2CGVA 2YAAA 4BDJA 3QHWA 4NJ3A 5J87A 3RK9A 4FKQA 4NM0A 3IONA 3UZRA 1REJA 3ATSA 4QTBA 5EW8A 2BDFA 4XRJA 4ASZA 4U43A 4A06A 3BV3A 3Q4ZA 4NIFA 4P2KA 4JDJA 4NYEA 3WF8A 2GFSA 3RAKA 5D12A 2GFCA 2VO6A 3FPQA 3OCGA 3TL8A 2XNBA 4R3CA 4B9DA 3ROYA 2PE2A 5F95A 4FZFB 4G9RA 4ONAA 3QKMA 2WQNA 2F7XE 4L7FA 5FM2A 3SOCA 2WQOA 3ZC5A 2R3QA 3F7ZA 5E8XA 5JFVA 3TNQB 3GC7A 2JFMA 3VUKA 4BZDA 4IBMA 4DFNA 4AN2A 4FSZA 4DGMA 4M7IA 4RG0A 4FV0A 3ZEWA 3BQCA 3TZ7A 3VW6A 4DYMA 3ZONA 4RVTA 2RGPA 2C5XA 2WMWA 3CTJA 5HHWA 3KXHA 2W1EA 3PSDA 4XP2A 3UQFA 2OK1A 4LV5A 1SMHA 4M8TA 4CXAA 3W2QA 4QQCA 2JKQA 2YITA 4WUNA 2XNEA 3MIYA 1P2AA 4QTAA 1HOWA 1U5RA 3SXSA 3C50A 1U5QA 3OBGA 4MAOA 3EKNA 4ANOA 2Y6MA 5FXRA 3A7JA 3BU3A 1BMKA 1J7IA 4Q9SA 3JY0A 5KMMA 4FTQA 4JS8A 4IM3A 3L8XA 3HRFA 4ASDA 4F9AA 4EWQA 2YM3A 4DH3A 4F1TA 3WYXA 4BICA 4CKJA 3NNUA 2J5EA 5JGDA 2BKKA 1H1RA 3Q5ZA 3BBWA 4R3RA 4R77A 4DFBA 5C27A 1JKLA 2C5NA 4TT7A 4C4FA 1EH4A 4DG2E 1GZNA 2P4IA 3KRLA 4C36A 4IFGA 1M2QA 1QMZA 2HWPA 1BX6A 3FMNA 1JOWB 5L6WL 4I0TA 3GOPA 3TTJA 3DAKA 2JDOA 4IDTA 5EHLA 3QZFA 5DRBA 4XBUA 2VNWA 3R21A 4MQ2A 4FKGA 3ZO4A 3EQBA 3FEGA 4ZJVA 5LVNA 4PDYA 1MRUA 3ALOA 3DBEA 2DS1A 5B2MA 3CSVA 4BIBA 3EKKA 4G34A 2C6KA 4K77A 2OWBA 4MWIA 4EC8A 2O2UA 3FMMA 4CZUA 2X9EA 3C0GA 3AG9A 4FYNA 4GK4A 1XR1A 4ITJA 3DTCA 3E93A 5E8YA 2Z7QA 3QUPA 4ZK5A 4AN3A 2X2MA 3F7WA 3IO7A 4XG7A 4IWQA 5AWMA 4BDCA 4XBRA 4ZSLA 2EUFB 4FTOA 3EOCA 3ZOSA 2QKRA 3PSCA 4XG9A 1AD5A 3ZEPA 1OL6A 4ITIA 3R7VA 1L8TA 3DLSA 5KBRA 3FY0A 2X8EA 1UWJA 2QD9A 4RRVA 3OCSA 3N51A 1K3AA 3ZCLA 4HGSA 2VAGA 3KA0A 5AP7A 3A4OX 4LRKA 5TKDA 5CU3A 3RINA 1JKTA 3CJFA 5A4QA 4TNBA 4MXZA 4EOMA 5J5TA 1WVWA 2ZV8A 4UWCA 1W8CA 5CENA 3KRRA 3W2OA 4TZRA 5EW9A 2XK9A 1OM1A 1VZOA 5FD2A 4C34A 1YWVA 2WEIA 3PY3A 2XEYA 2R3JA 3WF5A 2GNJA 3BLHA 5EDQA 4JR7A 4O0VA 4USEA 3B2WA 3WF6A 5EQYA 2A0CX 5C9CA 1PKGA 1ZYCA 4DEDA 5HIBA 4RBLA 2NP8A 2Y4IC 3QQUA 4IAAA 4EHGA 4UMQA 5CAQA 3AGMA 4EH9A 4ALUA 1JAMA 2NRUA 4ZTRA 4BDGA 4EOJA 2ZV7A 3FBVA 4DFUA 3MY5A 3MSSA 5TF9A 3ZMMA 4O0SA 1JKKA 3F2NA 4PDOA 4YP8A 3R9RA 3CPBA 3VS0A 2P0CA 1FMKA 3D5VA 5T68A 5I3RA 4O7NA 4D1ZA 4ASEA 4HVDA 3ERKA 1WVXA 1H27A 3EFJA 2J7TA 3OTVA 5L2WA 3RKBA 5CSHA 3VULA 5HORA 4Y95A 4YBJA 3IGOA 1IASA 3FLWA 4CT1A 3OEZA 2OJFE 2X8DA 2QG7A 1WFCA 5LCKA 2WOTA 4FV6A 4FTAA 5D11A 4IZAA 2Q0BA 4EONA 4PRJA 4D0XA 4P7EA 4LUEA 3TDWA 5K5XA 4ZY4A 5AAFA 1NXKA 3O96A 5F1ZA 2IWIA 2VZ6A 3RP9A 4QTCA 3OG7A 3D0EA 1ZLTA 2ZM1A 4RIYB 3UOHA 5DMZA 2B9HA 3L9LA 3AQVA 4F7JA 5M4UA 4MVFA 2PSQA 3MPTA 3P0MA 5CU4A 3TUBA 1UWHA 4AZEA 5C8KA 5KHXA 3LM5A 1M2PA 4C4GA 3R8VA 1GY3A 3B8RA 4IWDA 5CLPA 3R63A 5LMKC 4FNWA 4E4NA 3R8ZA 2HW7A 3UIMA 5M53A 2FSLX 3CGOA 4JG7A 2WHBA 5DG5A 3UZPA 3VBWA 4F9WA 2XNGA 4QMTA 1L3RE 4FZ6A 3UQCA 4PNIA 4MH7A 1QPDA 3NNWA 3ANRA 4CFNA 3QTQA 4GFGA 5J9YA 3KMWA 3ZFMA 1P14A 4A9TA 4DITA 4F9YA 4IMYA 2OGVA 2IG7A 3L1SA 4UMRA 4ARKA 5BVKA 3VJNA 5HESA 5D10A 5KMNA 5FTGA 5BPYA 2YDIA 3FQEA 4WBOA 4FVRA 4FUXA 4DTBA 2BIYA 2BRBA 3W2SA 1YHSA 5EI6A 5L3AA 4JT3A 4BCKA 2XF0A 2JAVA 2C3IB 1WCCA 2KULA 4H1MA 4NFNA 2G2IA 4G31A 3NRMA 5CI6A 2BRGA 4HPTE 5J1VA 2BILB 3P7BA 3LQ5A 3R7EA 4F6UA 2PVJA 3QZGA 4G5PA 5AUXA 5KZIA 5B2LA 3LQ3A 4H36A 2ETRA 2R3NA 2BR1A 2VWIA 4Q9ZA 3MH2A 5ETCA 3N4TA 1XBAA 2W5AA 1ZZLA 3DB6A 4QP1A 5HI2A 3JR1A 3VUDA 2PVMA 4OTGA 3C4CA 2YDKA 3TV7A 4QP6A 1GOLA 4PTCA 3ZSIA 4HVSA 3NEWA 4DN5A 3NYXA 5HLNA 4O96A 1ZMVA 3HEGA 4KS8A 4X2FA 3TZMA 1JQHA 4FSUA 3ORKA 4MBLA 4A9RA 3BZ3A 3HV5A 4QNYA 4DAWA 4ENYA 3OMVA 2XK8A 4EJ7A 4BCGA 4AN9A 5L6OA 2Z7SA 1Q8YA 4FVQA 4D5KA 3CY3A 2X6DA 5EOLA 1WVYA 3K2LA 2ITXA 3QCQA 4DT8A 2E9VA 3KXMA 2C5OA 4GFOA 3COMA 2Y4IB 4EQCA 1H8FA 3KXXA 3NDMA 4O7RA 3K5UA 4D2TA 3LFCA 3FC1X 3K3JA 4D5HA 4DEEA 3AT4A 3PZHA 3VUTA 5CNOA 1YXTA 4RJ4A 1H25A 5HQ0A 4JDHA 4BHZA 2B52A 3K3IA 4BY9E 3L9PA 3OXIA 3ORZA 2J9MA 2PHKA 4FEQA 3UC4A 4EK8A 1X8BA 2WXVA 4CT2A 4FSRA 5CZHA 4AACA 1RJBA 5CQUA 4EH4A 1U54B 4CQEA 4DG3E 4ZTMA 3FPMA 4NH1A 3AC1A 5C01A 2X7GA 2XYNA 3NNXA 4D9UA 1CSNA 1OPKA 2ZYBA 1F5QA 1M14A 3KXNA 2VWBA 1OKWA 3DA6A 5J7HA 1B38A 1IA9A 3BLQA 3RAHA 4XH6A 3POZA 5E8ZA 3W2PA 2XP2A 1T45A 4LV8A 5ANIA 3GQLA 3BE9A 3FV8A 1PHKA 3CD8A 3PXYA 4C4IA 4YJPA 4DEAA 3DBDA 3OFMA 3GC0A 3QU0A 2R2PA 4IZYA 4RFZA 2JDRA 4E5WA 4ZMEA 3DAJA 4OTRA 5AA8A 3ULZA 3MS9A 4JRNA 2Y4PA 4FKLA 3KULA 1H4LA 2AC3A 4QMUA 4I5PA 2V22A 2W4OA 2ACXA 4PL4A 5IH6A 5C1QB 3MESA 2R7BA 4RJ6A 5IA4A 4JR3A 5ETFA 2BALA 3OOMA 3VAPA 4YLLA 4YZNA 5EHOA 4C2VA 4EHVA 4K6ZA 2YEXA 4LYNA 1GAGA 1KV2A 3P7CA 4AP7A 4E20A 5CANA 5ITAA 1O9UA 3IW4A 3DCVA 5ICPA 4C37A 5A3XA 2GPHA 4W4YA 2GS6A 4CCBA 4FV3A 4FTMA 5AX3A 2B7AA 3PE1A 4AZTA 4EOQA 2ZV9A 4YU2A 3SG8A 5DT0A 2XRUA 2C6DA 3RK5A 4O7LA 3FQHA 3BBTB 5A4TA 3MPAA 1B6CB 1VEBA 3CQUA 3D7TA 4Y5HA 3TEIA 4LFIA 3JS2A 5A4EA 3E8NA 5HVJA 2PMLX 4FK3A 3TM0A 4Y73A 3MH0A 3HX4A 4FT3A 2RIOA 4GT5A 4TWNA 2O5KA 5FLFA 3NNVA 3O2MA 4C3FA 5A4CA 4XS2A 2YHVA 3UQGA 3LQ8A 2WGJA 3HMMA 5M55A 3TXOA 2P2IA 3RPSA 3D5UA 3KXZA 3OEFX 3EZRA 4K0YA 3PXKA 2J0MB 4JXFA 4HJOA 3PE2A 5E8WA 4O27B 2GTNA 2UZLA 4KUJA 3PXFA 4FTIA 4ANQA 5J79A 2R9SA 2CHLA 5AMNA 5EG3A 3E7VA 4FEXA 2ONLC 4F0FA 4TWCA 4I6BA 5IA0A 2ITUA 5HICA 2GHMA 4J99A 4BDIA 4M13A 2OG8A 4JLCA 4KKEA 3D2KA 2VWZA 3G0EA 3UP2A 2XIXA 4WIHA 4ZXTA 1OKYA 4OTPA 3PVWA 2C30A 4RJ8A 3IECA 4HGEA 4XG8A 2XMYA 5A6NA 2ZMDA 4FIJA 4XLIA 4EKKA 4FICA 5BMSA 5JK3A 3E5AA 2IZTA 1YW2A 4LOQA 5EYMA 4ZLZA 4PMTA 3HDMA 3K5VA 3S1HA 3CPCA 3OF0A 3LLAA 4ZSGA 3VRYA 3UO5A 4AS0A 3UGCA 4BZOA 5EOBA 3A62A 3OHTA 5DR2A 4M0ZA 1STCE 4CMTA 5LQFA 1PXOA 4UXLA 4PTGA 4IEBA 4G3FA 5I9UA 4PL5A 3MVLA 1LUFA 3NUXA 4W8EA 4W9WA 5I3OA 3VS5A 2X1NA 5JKGA 3PZEA 1JNKA 5M56A 1IR3A 1XH6A 3QTXA 3ZLWA 2XB7A 3UC3A 1ZOEA 4CKRA 3BU6A 1K2PA 5TO8A 4GFMA 4LGHA 3BHYA 5HNBA 4BCIA 2VRXA 1CM8A 3HV3A 3R2BA 2WO6A 3AD4A 4LUDA 1S9JA 3ODYX 3P7AA 5ANJA 4E8AA 2YM7A 4F9CA 3LKMA 1XH8A 5JEBA 2C5YA 4AA0A 3O51A 4XV3A 3CY2A 3L8VA 3CQEA 2WPAA 2PUUA 2LAVA 3GCUA 3MH3A 4KRDA 4MK0A 4IDVA 3FI3A 1OL5A 3IK3A 2XKEA 4O81A 5IQDA 2C6LA 3VS2A 3QA0A 3ZFYA 3I4BA 4H05A 4RZVA 4DH5A 3A61A 3DNDA 3MB7A 4DE4A 4FV8A 2DUVA 3QRJA 3RMFA 1KUTA 4O0WA 3T9IA 3VF9A 4YHJA 4F63A 3C9WA 4CTCA 3NWWA 5CVGA 3GXLA 4I5HA 3JUHA 4J8MA 5DN3A 2XIZA 4R7BA 3EFLA 4ZLOA 4AQCA 3O50A 2FSTX 2QHMA 3ULIA 5JH6A 4GT4A 3OS3A 5DT4A 4YC3A 5H8BA 5EYCA 3F5PA 3BQRA 4UBAA 3FZTA 3VUHA 1W0XC 3RZBA 1QCFA 5ANEA 4NL0A 3EJ1A 4PWNA 3U6JA 4NW6A 3E64A 1UNLA 3GU8A 3PJCA 3R9NA 4YJTA 5AP4A 3R7YA 2UW6A 1QL6A 3ITZA 4GCJA 1YWNA 4NFMA 1T46A 4ZTQA 3PJ2A 2FYSA 4XG4A 2QO9A 4NUSA 5GJDA 4FV1A 5FEEA 3H9FA 3RTPA 3TJCA 1Y8YA 3FKOA 4PQNA 2CKQA 4RFMA 3ZFXA 1MQBA 1YXVA 2WELA 2B9FA 2ETMA 2BFYA 1IA8A 2GSFA 2XJ2A 4NKSA 5DR9A 4NU1A 5H2UA 4CSVA 4YSJA 4CZTA 1XBBA 2OH0E 3FMJA 1PXIA 1YXUA 2VX1A 3R8MA 5DVRA 5C8MA 5AV4A 1V0PA 2Y6OA 3Q4UA 5HE2A 3D5WA 4BDFA 3SRVB 4EH2A 1KE8A 2UZVA 3PIZA 3WF7A 5FBNC 4D4YA 4A4XA 3I6UA 4OAVB 3V8WA 5LVPA 3PXZA 2E9PA 5BYYA 3BHVA 4ZAUA 1HCLA 1QPJA 4YTFA 5AFVA 3VBYA 3KN5A 3P23A 4RSSA 4O91A 4AA4A 1MQ4A 1RQQA 4EK4A 3UVRA 1J91A 4C4HA 3IW8A 2UW9A 3C5UA 3KVWA 4RQKA 2R3MA 4EL9A 4PDPA 3FZSA 5H9BA 3QC4A 4CMUA 2WIHA 4PY1A 3CXWA 3FMKA 3MPMA 3OWJA 3EN4A 1NVRA 3AD6A 3EN7A 3ZZWA 5JFSA 4FT7A 4GL9A 4I0RA 1BYGA 5TT7A 2Y9QA 5L2SA 2XIKA 4A9YA 2IW9A 3ORMA 3QCSA 5K5NA 4D2RA 3GC8A 3H9RA 3OW3A 4FOBA 4N70A 5DPVA 3PA3A 2YN8A 2QO7A 4QPSA 5AV0A 3NUUA 4EOPA 3SW4A 4CVAA 3UPZA 3OUNB 3R1SA 4UWBA 2JIUA 5ETIA 5J9LA 4RIXA 5JN2A 2C6MA 4GJ3A 3PSBA 4KIKA 4B6LA 4WNKA 4K8AA 4CZYB 3C0IA 3G0FA 4UMUA 4FKIA 3KCKA 4I6HA 4G9CA 2QOIA 3VW8A 2R3RA 3NS9A 3SC1A 1GNGA 5IF1A 3MH1A 4N6ZA 5IQBA 4WRGA 3DLZA 4EH7A 1ZXEA 3R2YA 4QMVA 2J50A 4IM2A 4LRMA 1S9IA 5AM7A 2UVYA 4IAFA 1WBSA 4WD5A 4Q5EA 4L01A 3KU2A 3A8WA 4Z55A 4QQJA 2W0JA 3QTIA 5IA3A 2CCIA 4QOXA 3DFAA 3MJ2A 5LVLA 3P79A 4FKJA 5FXSA 4BCJA 2X9FA 4RT7A 3OP5A 1YXSA 2X39A 5AUTA 5KHWA 4TWPA 4D58A 1YOMA 2XEZA 4QMOA 3OXTA 4R8QA 3OCBA 5ANOA 5I0BA 2X7FA 3BKBA 4AZWA 4QNAA 4L3LA 3VHEA 1OB3A 4BYIA 4F7SA 3S2PA 3ENMA 3Q53A 1P4FA 5DHJA 4PMMA 3CBLA 4PPBA 2BAKA 3ZC6A 2CN8A 2QQ7A 5C8NA 4LGDA 3GUBA 3SQQA 3DPKA 4DGNA 1APME 2UW5A 2J90A 4JOAA 5IEVA 4RQVA 4F99A 2YERA 1Q24A 2NRYA 2W96B 2WMUA 2OJJA 2VTNA 4AGCA 1LEWA 3T3VA 4BB4A 1NW1A 1LPUA 1UU7A 2ITZA 4L68A 5LMAA 3V8SA 5IA1A 5JT2A 1U59A 5BVNA 2C3JA 3EYGA 1YI6A 2EXMA 4I6QA 4DC2A 1VYWA 2HW6A 2YCSA 2E9NA 2PVNA 4TPTA 3NMUF 3GU6A 4DGLC 2WMAA 3BU5A 2QHNA 4FUYA 3VUMA 3G51A 5CEOA 3UG2A 5K0XA 1R78A 4HYHA 5EI2A 2GQRA 4HYSA 4K9YA 3VBTA 5CXZA 5HO8A 1NVQA 1V1KA 5HE0A 2WNTA 3QQJA 4FL1A 4FV7A 2QOKA 3OWPA 4HZRA 4L44A 3ZYAA 3AC2A 2XIYA 4HVIA 3DK7A 2Z2WA 4YLJA 3A4PA 5AUVA 1OECA 1A9UA 1PXJA 2F57A 2JBOA 2XNMA 3D7ZA 3HRCA 1J7LA 3DK3A 1UVRA 1OUYA 4YPDA 3R9DA 4GKHA 3UIXA 5CAOA 1OKVA 4QYYA 3TNIA 5BQ0A 1KOBA 4UZHA 2VX0A 3GFWA 4BZNA 5LJJA 3QD4A 4H1JA 1IEPA 3D4QA 5C4KA 2OKRA 5HGIA 3V8TA 1FINA 2HZ0A 1CMKE 3UJGA 4E93A 2GNGA 2UW4A 2WQMA 3HMOA 4MNEB 4D0WA 5LVOA 2OIBA 1UNGA 3QKLA 4OR5A 4ZZMA 1URCA 3G5DA 4QT1A 1OL1A 2IZSA 3CTQA 1PXMA 3Q60A 4G3DA 4QYFA 3A7HA 5HE1A 2XJ0A 4OTHA 5CTPA 3WZEA 5A9UA 1RW8A 5J1WA 4FSYA 4U81A 1Z57A 3UNJA 3C0HA 2VTMA 4IE9A 2YCRA 1Y6BA 2V5QA 1BLXA 5HO7A 5IDPA 5HG5A 2ITPA 2KTYA 5KUPA 5AR7A 1MUOA 2UZWE 5FWKK
chains in the Genus database with same CATH superfamily
3GCQA 3RALA 3V5PA 2C6IA 4AGDA 5E91A 1KE7A 3OROA 4K11A 3GI3A 3PJ3A 4EOLA 4FIIA 3TN8A 4UX9A 3DBQA 2WIPA 4E5BA 3DY7A 2I40A 3WE8A 1UKIA 5IDNA 2CNQA 5M07A 3TV4A 1JKSA 3QQGA 4PPCA 5CQWA 1A06A 3FL5A 4YNOA 3HV6A 5J8IA 4HYIA 2VGOA 5GINE 2OJ9A 2IZUA 2J51A 4TKSA 4K1BA 4Z9LA 3VS3A 2VTHA 2VO7A 3DXNA 5AA9A 2I7QA 3V5WA 4IVBA 4ZTSA 3QFVA 3FLYA 4XMOA 4QRCA 4DGGA 3P1AA 5DEYA 3CCNA 4RIOA 4RC3A 4G16A 1J1BA 1R0PA 3DKCA 5L2QA 1P5EA 3V5TA 3QBNA 2PZ5A 3FJQE 4PP9A 3RHXA 1G3NA 4Y85A 3VC4A 1GZKA 3GCVA 2ITVA 2ZJWA 3F3TA 2XM9A 3U9CA 5CSPA 4NWMA 2PTKA 3V01A 4CGAA 3NIEA 4BI1A 4CFVA 4APPA 3KREA 4XLVA 3PIXA 4YZ9A 5HKMA 2XNOA 4UYAA 3D9VA 4BHNA 2CGXA 4EEVA 1AGWA 3FY2A 2G01A 5D9HA 5CALA 4X2KA 2R3IA 1RDQE 4QYGA 3I5ZA 4O1PA 2IPXA 2VTIA 1JBPE 5HBJA 1ZYSA 5D1JA 3GGFA 4DT9A 3F2AA 2XKCA 3BE2A 1FPUA 3FQSA 2ITYA 5I5ZA 4USFA 5GIPE 4NM3A 3T9TA 3GCPA 3KB7A 4JDIA 2IF8A 4YZMA 3HA6A 4BDHA 4E4XA 1YVJA 3O7LB 3R1YA 1OGYA 3W33A 3RWPA 1ZYJA 4CNHA 3SA0A 1G8AA 3BL9A 1F0QA 4A4LA 4G6OA 2BRNA 4KKHA 2P55A 3VRZA 1VR2A 2OSCA 2QKWB 3W0MA 4MKCA 5KMOA 3CS9A 2AC5A 4FG7A 4ZJJA 3F82A 4ALWA 3DKGA 2ERZE 4KWPA 1Q62A 3F69A 5LARA 2Z8CA 3KMUA 3BHHA 3EQDA 4O0YA 5IQGA 4MXOA 2OXDA 3COKA 3UBDA 4R7IA 3I0OA 4G2FA 5HE3A 4DF3A 5AAGA 2BPMA 1YDSE 3TCPA 4UN0C 5I9VA 3BHUA 4ZTNA 3GU4A 4QP3A 2XK3A 3ZUTA 2C0TA 4UMTA 3LFEA 2UV2A 2O3PA 3Q3BA 3D5XA 2GHLA 4AUAA 2PWLA 4NTSA 4A07A 3PUFC 3AMYA 2V62A 3EFKA 4EH3A 2BDJA 3FZPA 3OWKA 2PMOX 4F1MA 5AV1A 5JGAA 5IQFA 1QPEA 5FEDA 4OLIA 5I4NA 1Q99A 4WKQA 5CU2A 5AJQA 2UVZA 3TV6A 4F09A 4M15A 4BBMA 5I9ZA 2BTRA 3NW7A 3VVHA 2YIRA 4JBQA 4M3QA 5EM5A 4EK3A 1Q8WA 3NZ0A 4FSNA 3CTHA 4WG3A 3SHEA 5CAPA 2I0EA 4IIRA 4OTIA 4QMZA 3TZ9A 3GB2A 4D1XA 3F66A 3E8CA 5CS6A 5KMLA 2O0UA 3ZUVA 5M51A 2BCJA 5GHVA 1UV5A 2C0OA 4L43A 3SAYA 1FOTA 2A27A 3HV4A 4JAJA 2HY81 3ZUUA 2JAMA 4OTQA 3ZLYA 5HTCA 4RA4A 5IPJA 5HNIX 3R1NA 1J3HA 1E9HA 2NPQA 2Z7RA 3EL8A 3E62A 2O64A 5CAUA 2ZDUA 3GVUA 3II5A 4NM5A 2BHHA 5G1XA 1JSTA 2YAKA 3W18A 1ST4A 4FIGA 5JRSA 2R3LA 2XKDA 5D7VA 3BYSA 4IZ5A 4BKYA 4X7QA 3R8PA 1B39A 1FVTA 3ZDUA 4QQ5A 5KZ0A 5G6VA 4Y46A 4ALVA 2A1AB 4JNWA 2PU8A 2QG5A 4MF1A 5K0KA 3LXNA 5HTIA 2YABA 3QTWA 3FMLA 5E8UA 4FKWA 2IZRA 4QTDA 3R7UA 3VS4A 3QQKA 5ETAA 5EW3A 1CTPE 4EQMA 4QMNA 4ZSAA 3V3VA 3D15A 3D14A 3FUPA 4OTWA 4V04A 4PP7A 3CLYA 5E90A 5IEXA 1O6KA 2OH4A 1NY3A 4U7ZA 2ZAZA 1Z9XA 3TI1A 3TNHA 5AP5A 2NO3A 1XKKA 1ZY5A 2FA2A 3DAEA 4F08A 5L8LA 2CGUA 4EYJA 4ACGA 2C1AA 3E3BX 4C38A 2CKOA 1JWHA 2YISA 4O82A 4DBXA 1W7HA 1Q3WA 1KSWA 2ETKA 3ZLXA 2QOHA 3FMDA 3RPOA 3RAIA 2WMXA 2IW8A 3V5QA 3QLFA 3PWDA 1ZY4A 4BKZA 3LW0A 3WARA 4DEIA 4NK9A 2VWYA 3I7BA 1FBNA 3VWAA 1H28A 1VYZA 5DGZA 3QUDA 4WO5A 2ZFYA 2VWXA 2R3FA 3BWFA 4YZCA 5AEPA 2BZHB 1H1QA 4OT5A 1LP4A 2ZM3A 1FGIA 1BI8A 4RIYA 4AW5A 4UWYA 5K9IA 4LL0A 5JQ5A 4ID7A 4FTCA 2X0PA 3QGYA 2DWBA 3KQ7A 4AW2A 3KFAA 2B9JA 4J96A 4HYUA 4H39A 5FP6A 2B55A 2F7ZE 1XH7A 2HWOA 3ZBXA 4BYJA 4U9AA 2XALA 2X2KA 1HCKA 4M14A 4QP7A 4JG6A 4GVJA 3RJCA 4IM0A 4FKVA 3WZDA 4YGAA 2QOFA 4J52A 3PTGA 3M11A 3OT8A 1WBNA 3VF8A 3AXWA 5HD4A 2JIVA 2NYAA 3VJOA 3W0SA 4DH8A 2C6EA 1UA2A 3W2RA 2JDTA 4JX7A 2PZYA 4PMPA 3TMOA 2P2HA 3QXOA 3OY3A 5DLSA 5AV3A 4FNZA 2GQGA 1YQJA 2PL0A 2XA4A 3LXLA 1PJKA 5BMMA 3R9OA 4D4VA 4DGOA 2F2CB 3MB6A 2G2FA 3CC6A 3QD3A 1CDKA 4ERWA 5JFXA 3LMIA 1XMLA 3W0QA 3U6IA 1SNUA 2RSVA 4JBPA 4WUAA 1KWPA 3DJ7A 3MA6A 3OXZA 4GIHA 5AX9A 5DT3A 5HCYA 3Q32A 4XOZA 3B8QA 4PUZA 3G9LX 3Q9ZA 4BDKA 3CP9A 3UDBA 3ZM4A 4BRXA 2RFEA 1U46A 4D4SA 3DDPA 5LOHA 1JPAA 2IJMA 3P5KA 4U45A 2E9OA 3O8UA 2PY3A 1W83A 3O71A 1ZOHA 3FKLA 3G33A 3PY1A 4MEDA 4MNFA 4TY1A 3RNYA 1WBOA 3HVCA 4H3QA 4AXAA 2YWVA 5IQCA 5DI1A 1OKZA 2XK4A 4DEGA 4IC7A 4KBCA 2IN6A 3PJ1A 4IVAA 4F7LA 4CQGA 4UB7A 2CPKE 4F6SA 1U4DA 2J2IB 2VWUA 2XUUA 4D2WA 2DYLA 3VUGA 5IEYA 4Z3VA 4V01A 2YACA 5FXQA 4IWPA 3V6SA 3A7IA 4FT0A 3E88A 4IVDA 4WA9A 1KE5A 4BCOA 4O7VA 3LFSA 5C26A 2DQ7X 5HD7A 2HZIA 2XK7A 2IVUA 3JVSA 4IX6A 2BZKB 4D1SA 3QXPA 3M1SA 4F4PA 3NUSA 2WKMA 4DFLA 3U4WA 4KINA 2VTSA 2OZAB 1Q8ZA 4I23A 2XANA 4FKSA 3CE3A 2WMTA 3I7CA 2OO8X 4ZIMA 1XWSA 2HOGA 3G6GA 3O0GA 4GKIA 3E8EA 4E6QA 4I92A 5BVOA 3S95A 4HGLA 3ZU7A 4WNMA 3O8PA 2RFNA 1PMEA 4J97A 4HNFA 4B99A 3P9JA 3IDPA 3LXPA 2UZEA 3T8OA 4AGWA 3P5JC 4M66A 4XP0A 2UUEA 1PKDA 4BVUA 2WB8A 3H9OA 4EUUA 4Z16A 4YHTA 4O21A 4JBOA 3HYHA 3Q6WA 5BNJA 4GVAA 2VTPA 4FK6A 4YO6A 1U54A 4CFXA 2BMCA 4IAYA 3EYHA 4AZVA 1OBGA 2FO0A 4M69B 4PMSA 5AUWA 4RWLA 4IB1A 5KNJA 4G6NA 3FLQA 2BUJA 4LG4A 4D9TA 4IVCA 4G3CA 4YJQA 4CKIA 4GRBA 4FR4A 5FDXA 4O2PA 2B0QA 4TYGA 1NA7A 4GK2A 3UYTA 3E92A 4E7WA 4FTRA 2C69A 1J7UA 2WQEA 3Q52A 4QP8A 3TIZA 5F20A 4DA5A 1UU3A 5JZJA 3GEQA 4GG5A 5GZAA 5DNRA 4MF0A 4NT4A 3OUKA 4AE6A 4DLJA 4E6AA 1R1WA 2R3PA 2BTSA 4PDSA 4X6RA 5F4NA 5HLWA 4W4XA 3D83A 4FI1A 4QP9A 5AR4A 3QYZA 2ITOA 4IB3A 1YHVA 5TR6A 4BBEA 4C59A 4DH7A 1PW2A 4L00A 2WU7A 1H00A 3U51A 4UZDA 1PXPA 3FZ1A 2R0IA 3A60A 1OL2A 3EN9A 1MRYA 1G5SA 3H4JA 4P4CA 4R1VA 4FG9A 4EH6A 4DCEA 5KKRB 4DTAA 2VWVA 1YXXA 4AGUA 4HCUA 4UALA 5M4IA 2C5VA 2QVSE 4YHFA 3LE6A 4IJPA 5HG9A 4QMQA 2XAMA 2UW8A 4JMQA 4I5MA 2WAJA 2EB3A 3BWJA 3QC9A 4DHIB 2G9XA 4RVLA 3JVRA 4LL5A 5GJFA 3QHRA 1UU9A 3PFQA 3TKHA 4AX8A 5IUGA 4CTBA 3W32A 2IVTA 4EBWA 3HAVA 4S32A 3QA8A 5C4LA 2E2BA 3NUNA 5AAEA 4O0TA 2YDJA 4U40A 4BCNA 3O17A 2VWWA 2YIXA 3ZO3A 5I9XA 4RJ7A 1Q61A 5D7AA 4L42A 3I79A 2OBJA 3QX4A 3BEAA 4FZAB 1TKIA 3FYJX 3MA3A 3LFNA 4Q5HA 3UVPA 4AT4A 3QTUA 2JKKA 4AU8A 1V0OA 4TTHB 4BGHA 3MJ1A 2C1BA 3U87A 1KE9A 4WG5A 2OXYA 4X3FC 2BRMA 3KKVA 3ELJA 4M68A 5CEQA 3ZHPC 3ZRLA 3HA8A 3KL8A 5CASA 5HVKA 5CT7A 2W1GA 4YO4A 2JDVA 4YTCA 1PXLA 2GCDA 1H1PA 3DZQA 4RX8A 4ZSEA 1OUKA 4TYHB 4C35A 5EYKA 2ZM4A 3RM7A 4ZY6A 5IU2A 4MXCA 2HENA 4CG9A 2YCFA 3SXFA 4BGGA 1R3CA 2FUMA 4O7YA 3DNEA 3LCSA 2ITQA 3D94A 3U9NA 3OCTA 4E1ZA 1I09A 4IACA 4TXCA 4M97A 2PVFA 3HKOA 1H08A 2CNUA 2P33A 1YOLA 3ORIA 3R1QA 4ZTHA 4DEHA 4EZ7A 4YZBA 4UMPA 3S3IA 2HYYA 2VTQA 3HRBA 3FXXA 2VNYA 4QD6A 3THBA 4MUQA 3MVJA 4NCTC 1RE8A 2V7AA 3DGKA 3W2CA 5KMJA 1R0EA 3KEXA 5CNNA 4RX9A 3WIKA 5JSMA 4BTFA 4KBKA 5T3QA 3WZJA 3TUCA 4GUEA 3AT3A 2YCQA 2O8YA 4Y72A 3AMAA 2ZDTA 3F5UA 4HNIA 1M52A 3UODA 4E73A 5A46A 3LFDA 2CMWA 4IX3A 3TIYA 2IO6A 3LAUA 3OW4A 3CIKA 4LMUA 3UZTA 1PYXA 1PY5A 1YOJA 3QCYA 3HUCA 1G8JA 4TW9A 3PVUA 4C8BA 4CFWA 5HCXA 4PX6A 3LCDA 3LHJA 4YJSA 2J0IA 5DYJA 2WMRA 5HU3A 4U8ZA 4KKGA 4EZ3A 5M57A 3AC4A 2RG5A 1AQ1A 4ACCA 3FHIA 1PF8A 4B7TA 5K4IA 4NW5A 3OY1A 4B0GA 1OPLA 2X4ZA 5FBOA 4O7ZA 3COIA 4RWIA 4EK6A 3W0NA 4CMOA 3QUEA 1DS5A 3ALNA 2YM8A 4E4LA 2CSNA 3SXRA 4RIWB 4FTJA 1H1SA 2J0JA 3MGYA 4AOIA 3ZLSA 4QEBA 2YM4A 5EFQA 1BKXA 5CF5A 2JBPA 2OFUA 5HCZA 4J8NA 2XK6A 3PXRA 5CF6A 3QQHA 5EYDA 4OTFA 5HU9A 3LM0A 4USDA 1ZOGA 2VU3A 4W4VA 4ZTLA 5TE0A 4IWOA 4BTJA 4J1RA 2ZB1A 3FKNA 4X2JA 3A99A 5CYIA 3TJDA 3R7IA 2OZOA 3ORNA 3LVPA 5BV3A 4KS7A 5L6PA 3PY0A 4IHPA 5GZ9A 5HNGA 2A4LA 4AE9A 5KBQA 2QU6A 2CKEA 3OT3A 5L2IA 5AP1A 5I9YA 4L45A 1SVEA 3CR0A 3BHTA 3QRKA 2BAQA 4FEUA 4XYFA 4V0GB 2YM6A 3KIOC 4YJRA 4FV2A 2UZTA 1M7NA 4IB5A 5IA2A 4OBQA 4QO9A 1SYKA 2NNWB 3W0OA 4Q2AA 4LGGA 4GIIA 5EDRA 4IAKA 3COHA 4HCTA 1P4OA 3ETAA 3NAYA 4XOYA 5CSXA 3KRJA 2PMIA 4FNYA 4W4WA 2W9ZB 3EN6A 4CD0A 3WI6A 4MX9A 4YC8A 1YI4A 2VTRA 3ZBFA 4RVKA 3IDCA 3C1XA 3ATTA 2R4BA 4L3JA 5DOSA 5E92A 3HL7A 1M2RA 1WBPA 3LOKA 4KAOA 4I4FA 5CVHA 3S0OA 3EQHA 4II5A 4O6EA 4FA2A 4ITHA 2BKZA 2PK9A 1Y8GA 3Q6UA 5F9EA 3SRVA 1Q4LA 1CKJA 2YLFA 4P5QA 4X3FB 5BVWA 4D2VA 3R8LA 1CKIA 5L4QA 3KY2A 2ONLA 3GENA 3KRWA 1XBCA 1Q8UA 4AOTA 3L8PA 5M44A 3W0PA 3W16A 1OIRA 3M2WA 1UKHA 3CJGA 3R7OA 1W98A 3E3PA 4N57A 3UPXA 2BFXA 3AC5A 4JX3A 1W82A 4L46A 3K54A 3ROCA 2IVVA 4I5CA 2UZUE 3UE4A 3FHRA 2ITWA 3HNGA 3NYVA 3AKKA 4NZWB 3PRFA 1E1VA 2H8HA 4C58A 2CN5A 2W17A 3EWHA 4IB0A 2FGIA 3PVBA 2C3KA 3W0RA 3R04A 5LMBA 3ANQA 3H10A 2CJMA 3L9MA 4P90A 4TL0A 3L8SA 4E5AX 3D2IA 3FSKA 4FKRA 4MXYA 3SVVA 1YWRA 1PRYA 4O7WA 3C13A 3EL7A 5AR5A 2P3GX 4WSQA 1J1CA 1H01A 1LEZA 4DEBA 2HY0A 3SV0A 3FI4A 4O22A 5HIEA 3EQCA 3WOWA 3F88A 4DFYA 3LCKA 4F65A 4F1OA 3Q9WA 4FE2A 4QQTA 4I1ZA 4S2ZA 3LJ2A 3R0TA 5HTBA 3V04A 4OT6A 2WZJA 3UMWA 2EB2A 2XKFA 3MWUA 4ANSA 3QKKA 4GJ2A 4APCA 3A8XA 4K2RA 2B4SB 3EB0A 4J53A 4R5SA 4EJNA 3WE4A 2R3OA 2X4FA 3BX5A 1BUHA 3QCXA 4NIFB 3DQWA 2Z60A 4PV0A 4YJVA 4RX7A 2BIKB 4C57A 4EORA 3QLGA 3RWQA 5AP6A 2QNJA 4MTAA 5FDPA 2QR8A 1DAWA 3VBQA 2WMVA 1UNHA 3A7GA 4JG8A 1PMUA 4DBNA 1BI7A 3EQPA 4O83A 3TNWA 3MIAA 3FXWA 3SOAA 5AR3A 4L3PA 3PYYA 4V05A 5IQEA 4GYGA 4MXXA 4CFMA 1IRKA 4C3PA 3DKFA 4FSWA 1ZAOA 5AUYA 3IOKA 4AFEA 5IQAA 2Y0AA 4GV1A 3RCJA 2W1FA 4K18A 5IISA 4F7NA 1GIHA 3KN6A 3M42A 4C33A 2XM8A 3FL4A 3C4EA 4GMYA 3LMGA 2XRWA 2XYUA 5HOAA 2R3KA 3SLSA 2JGZA 2C47A 2OIQA 4O0RA 4WBBB 4QTEA 4I22A 3ML1A 4CFFA 3F3WA 2BZJA 3CGFA 4AA5A 4EH5A 3HMNA 1H24A 3I81A 3N9XA 3Q2MA 3QTZA 4XG3A 2R0UA 5ANKA 4EHEA 4RJ5A 3UDZA 1PXKA 4EC9A 4FSMA 4GT3A 3DV3A 4ZJIA 3LFFA 3G9NA 3VBVA 3NUYA 2YZAA 2W1DA 3PJ8A 4KIOA 5E1SA 1OIUA 3R9HA 2F4JA 4DG0E 3IG7A 2GS7A 2UW0A 4WT6A 3Q2JA 4L53A 4JQ8A 1REKA 3Q9YA 5JZNA 4A4OA 2RL5A 3RPRA 1XH4A 4XX9A 2YM5A 3BGPA 4IAIA 3FYKX 2RG6A 3E87A 3HZTA 5FGKA 5FG8A 3LFAA 3FE3A 5AP2A 4OBOA 2JITA 4CLJA 1TQPA 3AT2A 3R71A 5JFWA 4D4RA 3R30A 2ESMA 2CDZA 3R7GA 4D2SA 4DCAA 2I0VA 2FB8A 2QOCA 4JAIA 3U55A 2RKUA 4WOVA 4I21A 4GK3A 3VHKA 3WILA 4BJJA 4ZOGA 4HPUE 2X0QA 3MV5A 3TACA 3IW7A 4CV8A 4HZSA 3GNIB 4FV5A 1PMVA 5LWNA 4FTLA 4MNEA 1E1XA 2QONA 4UXQA 2WD1A 2XH5A 4MYGA 4ZSJA 4UV0A 3PFYA 2HELA 1SVGA 2QOQA 4XJ0A 4EUTA 2QOLA 4L67A 4O84A 1TVOA 4J71A 1F3MC 1WAKA 4BDEA 4JDKA 3VS7A 3PG3A 2VV9A 3DJ6A 1YKRA 4O2ZA 4ENXA 4JQEA 5DE2A 3HDNA 5JGBA 5HLPA 3NIZA 3VNTA 3CQWA 4RFYA 1WBTA 4FIFA 2V7OA 2WOUA 2QODA 3FSFA 3HV7A 4YTHA 3POOA 5IZFA 4YUQA 2EWAA 4G5JA 2A2AA 4ASXA 4BWXA 1W2FA 5E1EA 2PZPA 2OF4A 3ZSGA 3ODZX 1OITA 2B53A 2ZMCA 4FZ7A 3VO3A 3C5IA 2W1ZA 1XHAA 3FC2A 3KGAA 4O6LA 4RX5A 4BCPA 1CKPA 3LFBA 2BVAA 2XCKA 3QD0A 4IH8A 4MD7E 2QLQA 4RC2A 5E8VA 5ACBC 4BKJA 3ZO2A 4N6YA 2W4KA 3I5NA 4N4SA 4AF3A 3O23A 4I20A 4KB8A 3ZDIA 4AXCA 1R39A 1Q41A 4WRSA 3DJ5A 3NSZA 3F9NA 3Q5IA 4FGBA 4FIHA 4MBIA 5ANGA 4BDDA 2OF2A 3GU7A 3KCFA 3R02A 3ORPA 4O0XA 4X2NA 4Y5QA 5FTOA 2JLDA 5JMSA 3ENHA 4IX4A 3LIJA 3RPYA 5J95A 3BPRA 2IW6A 3RAWA 1I44A 3F2RA 2JIIA 5DEWA 2RFDA 4BWKA 4ZLYA 2C0IA 5BUJA 3GT8A 3NFGB 3HP2A 3TKUA 2GU8A 2J5FA 2OICA 1ZMWA 2YA9A 3ACKA 1ZWSA 5H8GA 3UIBA 4AWIA 4E4MA 4F70A 4YURA 4ANLA 4F0GA 3N4UA 5CU0A 3DB8A 5JRQA 4MXAA 4R3PA 3MFSA 4MQ1A 4UY9A 4BCMA 3SGCA 3VBXA 2R3GA 3GP0A 3MY0A 3I6WA 4AT3A 3ORLA 4U44A 5HIDA 3UMXA 4BIEA 4L7SA 4KBAA 3CD3A 2PULA 5AIKA 2OFVA 4YBKA 2GNIA 4XG2A 3BLAA 2PE1A 3NLBA 3PXQA 5CSVA 4A9UA 4EBVA 2EU9A 2XNNA 1QPCA 3UOJA 4CV9A 1OGUA 2GDOA 4D2PA 4YMJA 5E4HA 3W8QA 4IANA 2AYPA 4G1WA 3OVVA 2BHEA 3HMIA 4EOOA 3PG1A 4XNEA 3ACJA 3IKAA 3ZM9A 4BDAA 2YFXA 3ZTXA 3PWYA 4TRLA 1OL7A 3H0ZA 4YNEA 4BCFA 5HX6A 5CZIA 2H34A 3RBWA 4JI9A 5BUEA 3QRTA 1DI9A 5EM8A 5BVEA 5IH4A 2VN9A 5EQEA 5EHYA 5DH3A 1WBWA 3EQRA 2CGWA 2EXEA 5AUUA 1LR4A 2QR7A 4HCVA 3V51A 4D55A 3KRXA 2CCHA 4ZEGA 5EH0A 3UOLA 3PA4A 5FTQA 2FH9A 3PUPA 4U79A 3MYGA 1ATPE 4XG6A 4TNDA 4WNOA 4BF2A 3NX8A 2W4JA 3QRIA 4AOJA 4D28A 5AR2A 3KK9A 4I3ZA 2PVLA 3RCDA 2W5BA 3ZXZA 4CCUA 2Y7JA 3R28A 3UG1A 5KX8A 2WTJA 2CKPA 3B2TA 3U6HA 2H9VA 4FKTA 2BROA 4GW8A 4IX5A 5BYZA 3KF7A 4P5ZA 5CT0A 2OI4X 1Q3DA 2W1HA 4UEUA 4EOSA 2VTOA 3DQXA 1WZYA 3JYAA 2WTIA 3UP7A 4Y8DA 5K4JA 4WG4A 4FIEA 1IAHA 3P08A 5HO6A 4LV7A 3SG9A 5C03A 3FMEA 4BIDA 5EQPA 3R22A 2F9GA 3NW6A 5CX9A 3T3UA 1Q8TA 3I0QA 1KOAA 5HX8A 4MWHA 2PVHA 3NYNA 3ZZEA 4HOKA 3HUBA 3FLSA 4EZ5A 4DH1A 4XHKB 2IEWA 3HECA 4OUCA 2YIYA 3F3VA 4FVPA 4QPMA 5AV2A 3RNIA 4JRVA 2W05A 2YJSA 3FZRA 1PMNA 4ACMA 2VTJA 4KNBA 4HVGA 3WZUA 3QZHA 4FNXA 3F5XA 4QMWA 5HVYA 3WBLA 4XV2A 5DA3A 4LDTA 2QURA 2YIWA 3CKXA 1MRVA 3C4ZA 5KMKA 3C4FA 3GFEA 3JPVA 5CEIA 4BCHA 2C3LA 3MFTA 4O38A 3IS5A 3ZRMA 5HG7A 5KKRC 4X0MA 2C6TA 1TQIA 4FT5A 1YI3A 5CY3A 5FQDC 5IMXA 4AZSA 2HZ4A 1H1WA 4ORKA 4S30A 4M12A 4WHZA 1MP8A 2OIDA 3BRBA 3HLLA 3LLTA 3WYYA 1BL7A 4AQKA 2X0GA 3F3UA 5CEMA 4NJDA 3LJ1A 5FM3A 4C3RA 2HIWA 2QU5A 2Q83A 4GH2A 5M09A 3KMMA 1O6YA 4Y83A 5FUTA 2F49A 4FF8A 4PPAA 4E3CA 2BRHA 4HGTA 2X6EA 4J98A 2ITTA 4MHAA 2CLQA 1TQMA 3QX2A 4PL3A 5DIAA 2JD5A 3VONA 3G15A 3DT1A 5HZNA 3BV2A 3NVKI 2SRCA 3QAME 4KSQA 5CF8A 3KULB 4CEGA 3I60A 4RLLA 3DKOA 1TFFA 4EK5A 2GNLA 3ZRKA 1GZOA 4YC6A 4RPVA 4FX3A 3TKIA 3QQFA 3ET7A 4DLIA 3BIZA 3TT0A 3E63A 3BELA 4YJNA 4QMPA 1KE6A 2J0KA 2Y8OA 3AMBA 4OTDA 4FKPA 4H3PA 4TWOA 3GCSA 1K9AA 2HAKA 2PZIA 4C61A 4L52A 3FI8A 2VUWA 3QWJA 4L6QA 4RMZA 3N4VA 4EHZA 2FSMX 3PVGA 4IFCA 5FEQA 2X7OA 4Z7GA 5ANDA 4U80A 3W1FA 3RPVA 2IVSA 3AGLA 1Y91A 3VUIA 3BYMA 4FKUA 1NT2A 3ORTA 5A4LA 4I0SA 1XQZA 2OJGA 2X81A 2X2LA 3MTLA 3S4QA 1ZMUA 4YR8A 4ERKA 2B1PA 3PA5A 5JQ8A 3D7TB 2JDSA 2O63A 3V6RA 3UO4A 4F6WA 1OI9A 4FT9A 4O86A 3DXPA 1DAYA 1KV1A 3NR9A 4L8MA 5IUIA 5K3YA 1H0VA 1PXNA 4YZDA 3DOGA 5H8EA 2ZOQA 2UZDA 4LOOA 4CG8A 2XNPA 3BI6A 3GC9A 4AXFA 3E7OA 3MDYA 3RVGA 4O4EA 3V5JA 5IKWA 3RZFA 4FEWA 3CEKA 3Q96A 2PUPA 5IQIA 2WU6A 2PUIA 2YLEA 3FWQA 1FMOE 2OU7A 3F6XA 4G17A 3NVMB 4C4JA 4FC0A 2GNHA 3NCGA 5B0XA 4O7SA 3LPBA 5EK7A 2JFLA 4Z7HA 4X21A 4U3ZA 3MFRA 4L9IA 4NSTA 4AT5A 4I6FA 5LWMA 4S31A 3REPA 5A6OA 4O1OA 4RGJA 2HK5A 4JVGA 4KA3A 3VQUA 1H07A 5IMEA 1W2DA 4U41A 1WMKA 2W1CA 2FVDA 3MI9A 1XH5A 4MD8E 5EM6A 3TG1A 4BN1A 5FP5A 2BZIB 2W7XA 4JIAA 4X6QC 3TTIA 3OOGA 3E8DA 3FXZA 4XEYA 3AD5A 4S34A 1XMMA 3OTUA 4OBPA 3R00A 2QO2A 2PVYA 3DDQA 2HXQA 4H58A 3LZBA 4RJ3A 2BAJA 3F5GA 3MTFA 4XCUA 2Z02A 4YLKA 5A54A 3GQIA 3VQHA 4BC6A 3QTRA 3OC1A 3ID6C 2OW3A 3P4KA 3AC8A 1ZRZA 3KVXA 5GZ8A 3U54A 1DI8A 2WMBA 3QQLA 2O65A 3KF4A 4IAZA 3HMPA 5T6KA 3EH9A 2OZAA 3EHAA 4AG8A 4AW1A 4HW7A 2AEGA 4X2GA 3DS6A 4LOPA 2ZV2A 4I24A 2PPQA 5AUZA 2H6DA 4ZS4A 2QI8A 1NVSA 4C62A 2W06A 1OIYA 5HG8A