3KRRA

Crystal structure of jak2 complexed with a potent quinoxaline atp site inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
293
structure length
291
Chain Sequence
SDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Potent and Selective Inhibition of Polycythemia by the Quinoxaline JAK2 Inhibitor NVP-BSK805
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 291
sequence length 293
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3krrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3krrA01
2OLCA 2PHKA 4C36A 4O0TA 2VTQA 3I60A 5L6WL 1M52A 3WZEA 4CFFA 4ID7A 4GK3A 3VC4A 4FTKA 3SG9A 3I7CA 4MK0A 4FT5A 5FXQA 3DTWA 3LFFA 1PMNA 4BICA 4A7CA 3G6GA 5AJQA 5HTIA 3LZBA 1WVYA 2A27A 2VWBA 2PVYA 1BKXA 4ITJA 1REKA 3IW5A 1WAKA 3BWJA 1UU8A 3OY3A 4QTAA 5AAGA 5HLNA 2BIYA 2OH0E 3DJ7A 2VTPA 3U51A 3NYVA 4A06A 5HX8A 2C5YA 3A4PA 3NW6A 2BAKA 4FV6A 4MD8E 1DM2A 5TOZA 1XH7A 3H0ZA 4IC7A 4IC8A 3P4KA 3VS2A 3HP5A 3COMA 4TWCA 2WTKB 2WTDA 3DU8A 4FOCA 2UW9A 3R30A 3MFUA 3QQGA 4KABA 3W1FA 2X6EA 3DBEA 5DVRA 3R9DA 4U45A 5CT0A 5FDXA 3L8XA 3TIYA 4ZY5A 4HYIA 4IB0A 1YWVA 3C4EA 4ANOA 2IW8A 3TV7A 3W2RA 3HLLA 2BALA 2BKZA 4I0SA 4IWDA 3LKMA 3HMMA 3ATSA 2PTKA 4CKJA 2VTJA 4NM7A 3G9NA 3PXQA 2PMIA 5DMZA 2QOBA 2VGOA 4U5JA 5A9UA 3FQSA 3QYZA 3ZO2A 1CSNA 3I0QA 4U42A 4CTBA 3LHJA 4O91A 3TUDA 4QP4A 2Q0BA 3ACKA 1XH5A 1U4DA 3MPAA 3P0MA 2PVLA 5H8EA 5AM7A 1O6KA 2R3PA 3GFEA 5KUPA 4FKIA 5LCJA 3PLSA 3DJ6A 3ROYA 3TNQB 4ZY6A 2BZJA 5EYDA 4RT7A 2XZSA 3PLAE 5E8VA 2F7EE 2IZUA 1UWJA 4D2TA 2V62A 4ACGA 3GOPA 2X2LA 4MD7E 3ZRMA 4EK3A 3TUBA 3SVVA 2C5NA 4EK6A 3FUPA 1ZAOA 3I5NA 3KRXA 4M69A 5HKMA 4D58A 4BDIA 3KXZA 3GP0A 4A9RA 3ULIA 4WNKA 3C5IA 1PXJA 5AV2A 3TCPA 3D7ZA 4FC0A 4EKLA 2J90A 3Q6WA 2ETKA 4L45A 3EKNA 3QTUA 4JDJA 4CZYB 2ITYA 4U8ZA 1ERKA 3VS4A 1XJDA 2OZOA 4MNEB 2JKOA 4F9BA 4W8DA 2HW7A 3LJ0A 4QPMA 4N70A 4D1XA 3Q9YA 4AW0A 4RX8A 4Z9LA 3CJFA 4K18A 4ORKA 4L00A 4DFZE 4O0UA 5CNOA 4QYHA 5IZFA 2GS7A 4ZLOA 4RIYB 4NCTA 3RAKA 2PPQA 4PNIA 5AA8A 5AP3A 5A3XA 1PXNA 2HZ0A 3VRZA 4F7SA 2VTRA 5HE2A 2F2CB 3R83A 4CTCA 2Z02A 2H34A 3FMHA 4U3YA 3VNTA 2CCIA 3QKMA 2BCJA 2P2IA 2GCDA 2JEDA 4AX8A 2R3HA 1ZMUA 4U43A 4E6AA 4H39A 3BWFA 3D94A 3GQIA 3RK9A 3TNHA 5TE0A 1OB3A 1MRVA 4CEGA 3MI9A 3MGYA 4EHEA 4OTGA 4Y72A 2AC3A 2XEYA 3QFVA 4D2SA 2ZV2A 4KB8A 3OG7A 3TKIA 3UYSA 4E26A 5ANIA 2YJSA 1OL7A 4O7LA 4R3RA 1J7LA 5D41A 3EN9A 5DE2A 5HTBA 1FGKA 1YOLA 4MCVA 4G17A 3UMWA 2CGXA 1KE8A 3ZRKA 3S00A 4MEDA 2PVMA 3ZDUA 3GU6A 4CFVA 3MA3A 1CKJA 3AG9A 3RAHA 4D0WA 4QMTA 2UW7A 4ZTMA 2OJGA 3ZEPA 2C0OA 2R3QA 5L3AA 4QYFA 3ENHA 2ZM4A 4XOZA 3ZLWA 4HGTA 1W8CA 4HZSA 3DXPA 2OO8X 3W18A 4O86A 4I0TA 3TTIA 2YDKA 4ASEA 5LWNA 4MBJA 5HD7A 4D9UA 4GYIA 1XQZA 3S4QA 4KRCA 5CSVA 3CE3A 4ZIMA 3VAPA 4R1VA 3QUPA 5AV0A 4RJ8A 4LMNA 4EOSA 2J0IA 1XH9A 2WMAA 5CU2A 5D12A 4AWIA 3LXLA 5FBNC 3Q4CA 3BGZA 4FTMA 4FVPA 4GFOA 2QO9A 2O8YA 3R0TA 5ACBC 4CD0A 3BV3A 3ORIA 4Z7HA 1ND4A 3MESA 1T45A 3TJDA 2BDFA 3BX5A 2WXVA 3GNIB 4DN5A 3HAVA 3BPRA 3GXLA 1GZ8A 1F0QA 3D4QA 3RPYA 3VF9A 3S1HA 4YHFA 4JQ8A 3DJ5A 2XEZA 1ZYSA 5IA2A 4FV7A 4F1MA 2BZKB 3R63A 3PFQA 4XOYA 4IVBA 4BGHA 4I0RA 2QOKA 4R77A 3UZTA 3FLWA 2EWAA 1GIIA 3OP5A 3COIA 4YJNA 5GNKA 3DBDA 4FSTA 3PSDA 1YRPA 3CTQA 4IWQA 2XK9A 3AC5A 3EQHA 2J51A 3ZDIA 3EFLA 4GKHA 3UNJA 4MAOA 4W4XA 1KUTA 4TZRA 4W8EA 4KUJA 4DH8A 4IACA 4CG9A 2JIIA 2X6DA 4DCAA 4QTDA 3UODA 2YM3A 3N4UA 1H24A 1M14A 4FIEA 4BWKA 3C4ZA 2C6MA 2DYLA 3F3UA 3GU7A 2CJMA 5K0XA 3GVUA 5LMAA 3FHRA 3IW6A 5HU3A 4C62A 3QBNA 2W06A 4HW7A 3W2CA 4BBFA 1RDQE 2C30A 3G90X 3WARA 5BYLA 4IZ5A 2YEXA 3EN4A 4X2JA 5A14A 2CPKE 5AX9A 2ITQA 5FTQA 4QPAA 3Q2MA 4LQMA 1FVRA 5HVKA 4NIFA 3Q6UA 4FG8A 4JQ7A 1V1KA 1H01A 2YDJA 4OT5A 5EI2A 5K4IA 4FIFA 4YZCA 5BVEA 4KKGA 3PPJA 3QCSA 1ZXEA 2W5HA 1GZKA 1S9IA 4I3ZA 4JOAA 4DT9A 3D5UA 1UVRA 2REIA 5HVJA 3UIUA 4EC9A 1RW8A 4DG3E 1OKZA 2W1IA 3BQRA 2YCSA 2QU6A 3F3WA 3UPZA 4XS2A 4IEBA 3ANRA 4Y73A 3RPVA 4DCEA 4J97A 4HNIA 3KCFA 5FP6A 4EH4A 1PXMA 4IVDA 4S34A 5HOAA 2QHMA 4MXXA 1NXKA 2JAVA 5JZNA 4Q5HA 2QURA 3P08A 3HDNA 3UC3A 5M44A 2Z7QA 4Q9SA 2G2FA 3VUIA 2OIQA 4JDKA 3PXFA 2EUFB 3E8EA 3TIZA 4B6LA 3KEXA 5GZ9A 4F9YA 3ELJA 3A7JA 2PZ5A 1E1VA 3GC8A 5CU6A 3R9OA 4OR5A 5JRQA 2UZDA 3F5XA 2YCQA 3LLTA 4FZ7A 3QC9A 2PK9A 4HJOA 4ZLZA 3JYAA 1ZOHA 5GJFA 2E9VA 4BDFA 5M4UA 5IQDA 1GJOA 3WZKA 2HXQA 3VS7A 2IVTA 3F3VA 5GJGA 4YZDA 5BUEA 5L2WA 3FZRA 5D11A 3R7IA 2HZNA 2HYYA 3OT3A 4FT0A 3Q4TA 4LOQA 2Y9QA 2C5VA 4WHZA 2PZRA 4FEVA 5FEDA 1QPEA 1HCKA 2RIOA 3GU4A 4F6SA 4DEEA 3HUCA 1OIQA 3ZCLA 1PMUA 4IM3A 1YOMA 2OF4A 3G5DA 4JS8A 4L68A 4LOPA 4E8AA 2GMXA 2NPQA 3NPCA 4FKRA 4FL2A 4PL4A 5DT0A 4QMSA 3RVGA 4A4LA 2XYNA 4AFEA 5J7BA 3VUTA 5IEVA 4BTFA 4BCIA 4RJ5A 3E7VA 5HBJA 5AP1A 4MHAA 4TYHA 3W2OA 2V7OA 2BHHA 5IKWA 4BI1A 2FGIA 5L6PA 4BTJA 3L9NA 4IWOA 2J0KA 4EBVA 5EFQA 5E8WA 4D5HA 3ANQA 4M15A 3MPMA 4F0FA 5I5ZA 3UQGA 2UZNA 3EIDA 5AR8A 1OKYA 3D7TB 2ZOQA 2RG5A 2WQNA 1S9JA 1P2AA 1IA9A 2RGPA 4GCJA 4J1RA 3ZO1A 3OWPA 5C8MA 5E8XA 4DH7A 2B54A 4H1MA 2I0YA 2J5FA 2A0CX 3BRBA 4LGDA 3AC4A 3DK7A 3WZDA 3ZYAA 4AT4A 1Z9XA 3MTLA 3JY0A 4H05A 2OWBA 4C8BA 3E3PA 2VNWA 1LEZA 3PP0A 1F5QA 3SKCA 4FODA 3U9CA 4AZVA 1GZOA 2BR1A 2KTYA 2HW6A 4FKVA 1PKGA 5HO8A 5J7HA 2VNYA 2UZEA 4QQCA 5J5TA 4L3JA 5F9EA 3PVUA 2C68A 1PMVA 4AE6A 2ZV9A 3TJCA 5IH6A 3VS0A 4IJ9A 4EL9A 3ZTXA 2W0JA 4KKHA 2YA9A 2QU5A 2H6DA 3GC9A 4R1YA 3BZ3A 3BBTB 4PL5A 4QQ5A 4YTHA 2EU9A 4C2WA 5AUUA 3QZHA 1FMKA 4L01A 4TKSA 4ZY4A 5GZ8A 3I1AA 4BIEA 5T6KA 4H3BA 5HE1A 4XG4A 4CYIA 1Q99A 3KA0A 3LQ8A 3R01A 4RVLA 4DTAA 4OTQA 1W0XC 1JBPE 4AW1A 3U4UA 2QI8A 4FV3A 4NT4A 2OJIA 3TNPC 3RM7A 3TV4A 4BKYA 5M53A 3EKKA 5FM3A 4RRVA 5DYJA 3UYTA 4CLJA 3C51A 3PY1A 4YC6A 4CSVA 4X3FB 3O23A 4C37A 3FI8A 2XBJA 3FLQA 4QT1A 5CEQA 2JBOA 2I0VA 4HCTA 5J95A 3QX4A 3O50A 3V8TA 2BTSA 4G5PA 3LFEA 4QMVA 4RFYA 1H1PA 4K1BA 1JKTA 2H8HA 5DIAA 1OGUA 3OWLA 4I5HA 5AP0A 2FSMX 3KXXA 1U5QA 3LM0A 5AUYA 5TT7A 5BVOA 4NEUA 5A4TA 3O7LD 3DOGA 2HELA 1QCFA 4RJ4A 3SRVB 4FEQA 5K5NA 4IX4A 3FYJX 5FTOA 4AOTA 3Q9ZA 3E92A 5A4EA 3CLYA 2FUMA 4FKSA 4PY1A 1GAGA 1M2QA 2O64A 2XNEA 3P23A 3TM0A 3P78A 2FB8A 4FBXA 2XM8A 4Y83A 2XIXA 2BRGA 3D0EA 2ZVAA 3GBZA 4I6BA 5IQIA 3IG7A 3NAYA 4RA4A 3ZO3A 2JAMA 3G0FA 1B6CB 1OL6A 4W4WA 5D7AA 4H36A 4AT5A 2GNHA 3QKLA 4BDJA 4TYGA 2B0QA 2HIWA 3K5UA 3Q5ZA 1UA2A 3KGAA 5H8BA 3QCQA 5ITAA 3PJ3A 4F7NA 3N9XA 4R5YA 2FYSA 2EVAA 4NJDA 4WNOA 3UO6A 3S0OA 1OM1A 3R7OA 3F2RA 4IE9A 3C7QA 5DT3A 2QVSE 4HPTE 3ZOSA 2CN8A 4KSPA 1ZLTA 3OBJA 4QD6A 3VN9A 3NWWA 4BGQA 4JIAA 4MYGA 3DBQA 4RIXA 5HCZA 4AN2A 4F6WA 5IDNA 3LIJA 1MUOA 1URCA 5JQ8A 4Q9ZA 3Q4ZA 3EQCA 4YBKA 2YZLA 3TL8A 2IW9A 5ANDA 5EW3A 3SOAA 2Y0AA 5JMSA 4W9XA 4FZAB 3RK5A 3V51A 5HTCA 3ZH8A 3SG8A 2Q0NA 3HX4A 4ZZOA 1PKDA 4QMPA 3BHVA 3NNXA 3OUNB 2UZUE 5JGDA 2WTKC 4YJVA 1BL6A 3L9LA 4KIKA 5JEBA 4OAUC 1V0BA 2WIPA 4PPBA 5KBRA 1ZARA 4JG7A 3F82A 2CKQA 2NNWB 2CN5A 5AA9A 3OFMA 3R73A 2C4GA 4QMYA 4Z55A 4GG5A 3LFQA 1WCCA 3EH9A 2W1DA 1WBTA 2R3MA 4JBPA 3FLZA 1YQJA 4N4SA 4TT7A 3ZFMA 3PSBA 3FDNA 4RJ3A 5F95A 5HG9A 3UO4A 4ZZNA 4EHVA 3M11A 2C0IA 4FTJA 2R9SA 4OBQA 5AM6A 1PXIA 4DINA 2QQ7A 5CXZA 1CM8A 1A48A 4O6LA 1JKKA 2GFCA 3NS9A 5CZHA 4O81A 4FICA 1AGWA 4F7LA 1R3CA 4L8MA 2A1AB 2YJRA 4FTLA 1OKVA 3MBLA 5LWMA 4Y95A 4NM5A 5A54A 4J52A 3OOGA 4TNBA 2WMWA 5CVFA 2PVKA 2JDTA 3VQUA 5I3RA 5M57A 4EOJA 3DY7A 4M69B 4O0YA 4PRJA 4UEUA 4CLIA 4BVUA 2PUPA 4CRSA 4FSNA 3RWQA 5HCXA 2YIRA 3AXWA 1Q3WA 5EM5A 5FXSA 4G3CA 3JUHA 3LMIA 2C1BA 3VS6A 4C4HA 5JGAA 1KE6A 3A7FA 4MF1A 1OKWA 4BKJA 2XF0A 3OWKA 4B8MA 1XH4A 3E62A 4DHFA 3TNIA 3D5WA 4A9YA 3OOMA 3ZSGA 1H27A 3LXKA 4AZSA 4C57A 3MFSA 5DA3A 2CHLA 3A8WA 2WPAA 5HIBA 4RWIA 1BX6A 4GT5A 4FNWA 5IISA 1XWSA 2JIVA 4XV1A 2PU8A 4D4YA 4DG2E 1KE7A 4N0SA 1OECA 4RIOA 3P86A 3NUSA 3L1SA 5EM7A 4I93A 2B9IA 4X0MA 5DI1A 4ZMEA 3EQGA 4ZJJA 4IM0A 3V5TA 4YJSA 4K9YA 3VVHA 3UG1A 1QPJA 4WNPA 1DI9A 2GQGA 4RGJA 4BBEA 3NDMA 4EK4A 3VUDA 5BPYA 1Y57A 3ACJA 3DBFA 5JN2A 4Y5QA 5EYCA 5B2LA 4X2KA 1H1RA 4FTTA 4O7RA 3FWQA 4CFWA 5E8YA 2E9NA 3E8NA 3OF0A 3GB2A 3SQQA 4BI2A 4DFLA 4F1OA 5IDPA 1XBAA 3SA0A 4EJNA 5EM8A 3T3UA 4R6VA 3AGLA 2WAJA 5DR9A 3WF7A 4DGLC 4Y85A 3R2YA 1M2RA 1CMKE 3ZFYA 3I81A 2IVVA 4BDCA 4DH1A 5HQ0A 5AP6A 4NSTA 5EG3A 2OH4A 4GK2A 3GT8A 4U44A 4IWPA 2F49A 5HORA 3CS9A 4C34A 5AR3A 3S2PA 3TZ7A 2BKKA 4HPUE 5L2IA 4D4VA 4C59A 5LQFA 3HMOA 5EDRA 3LOKA 3F7WA 3IPHA 3HV3A 4OTFA 3V6RA 3WIGA 5BNJA 1YXVA 2Y4IB 4FIIA 4ZTRA 3QWJA 4CQEA 3FI2A 3A4OX 4FTIA 4YBJA 5CVGA 3AT2A 1T46A 4DITA 4FIJA 4BCJA 4DGGA 2VX0A 4OTPA 4DEDA 1OBGA 2JC6A 3VO3A 3K2LA 4O2PA 5KBQA 4B7TA 4PL3A 2QO7A 5AADA 5IQBA 1UWHA 3GU5A 4R8QA 2C47A 3MTFA 4DFXE 2BHEA 3OROA 4TRLA 5CWZA 4ANQA 4BHNA 4D2RA 3W32A 4EOKA 3QCYA 3C5UA 4G16A 5HI2A 3VUGA 3W33A 1H28A 4YR8A 1QL6A 4AA0A 2R3OA 3R2BA 3ORZA 4JL9A 4C3FA 2VTLA 4BF2A 4ZTQA 4JG8A 1NW1A 1Y91A 3FHIA 1B39A 1WBNA 4Y8DA 3HRCA 4YHTA 3F3ZA 4BRXA 4EWQA 1JAMA 2GNFA 2YCFA 5L2TA 2FA2A 4XRLA 3LQ3A 2UZBA 4FTNA 3OCTA 3MN3A 1LR4A 4FT3A 3ZHPC 1YVJA 4EC8A 4UN0C 1X8BA 4JDIA 3Q53A 4XNEA 1Q97A 2VWWA 3Q2JA 3E87A 3H9RA 3KMWA 3EQPA 4JX3A 4WD5A 3ZONA 4TL0A 3NUNA 4FKJA 4TTHB 3MYGA 3M1SA 4RX9A 5BX0A 3LJ2A 5I4NA 2OW3A 2W4JA 5HBEA 4YP8A 2ERKA 4D5KA 4EUUA 3F69A 4I6HA 4MVFA 5BQ0A 2XKCA 4FV5A 3RHXA 5ANEA 4K77A 3NNUA 3Q9WA 2JKKA 4G3EA 4RZWA 4AT3A 2QODA 4NFMA 4AZEA 3KXHA 4YLLA 2OSCA 3D2IA 1GIHA 3ATTA 4MH7A 3IW8A 4V05A 3UE4A 4FKPA 4M14A 2VX3A 4LM5A 1IAHA 2QONA 4YUQA 3F3TA 5CI6A 3VJOA 3UIXA 4YZNA 3UOKA 3QUDA 4AUAA 2GQSA 4JAIA 2B9FA 4BY9E 2Y8OA 3DZQA 3MVMA 4YJRA 3UOHA 3QYWA 1JOWB 3GCVA 5HIDA 3QRJA 3UQCA 2JFMA 3FKOA 3PJ2A 2G1TA 5CZIA 2ZDTA 1IR3A 5EM6A 2YIWA 2RFDA 4I23A 3SLSA 4II5A 2JIUA 2UW6A 3DPKA 4O0WA 4BCGA 2OU7A 4O83A 4FOBA 3NIZA 4IIRA 3ET7A 4JR7A 4B9DA 3QTXA 3KC3A 5D7VA 4NFNA 4FTRA 3CQWA 1YI3A 4P2KA 3PRIA 4RVTA 3R7GA 2R64A 4JAJA 5EW8A 3DNEA 5FUTA 2QR8A 4OTWA 2WTVA 3DGKA 4N6ZA 4XCUA 5CLPA 3RI1A 2QR7A 4G6OA 4JQEA 5ANJA 1G3NA 4I1ZA 5LMBA 3EN6A 2RSVA 3LCKA 3NW7A 4DGMA 3QRUA 2I7QA 3E5AA 3T3VA 4CT2A 2IPXA 2QOLA 4YLKA 5DWRA 3UVQA 4EH5A 4PDPA 3D15A 3IKAA 3EN7A 2OXDA 3R22A 2OJJA 3R8VA 4DA5A 5CAVA 3CBLA 3O96A 1VZOA 2JDOA 4H3QA 2EXMA 4OTHA 4LG4A 2C6DA 3WZJA 2IZRA 5JZJA 5DRBA 5E1SA 4QTBA 1WVWA 5CSPA 3FZSA 3PVGA 4M68A 2J6MA 3K54A 5HE0A 2QOIA 4I4EA 2XP2A 4A07A 3DAKA 3R1SA 3AD6A 1Q4LA 3BGPA 4FK3A 5CF5A 3N4TA 4R5SA 4OLIA 3DKGA 2AUHA 3ZUVA 3LFDA 1O9UA 3P79A 4YC8A 1SNUA 1UU9A 2PE1A 5CYIA 3U9NA 5EDQA 4EOIA 2X1NA 1FMOE 5JFSA 2C0TA 3II5A 5GZAA 4LV5A 3HV7A 5DEWA 2XIKA 3RPRA 2WNTA 3OTVA 4UYAA 4OT6A 3MVJA 4D28A 5H2UA 4D2WA 4DGNA 4EK8A 2QD9A 3L8VA 2UZLA 4PDSA 5J9YA 1WBOA 3TZMA 2UVXA 4G2FA 4TXCA 4YPDA 4B0GA 4ZXTA 2X9FA 3L8SA 4FG7A 3PXYA 2ITOA 4FI1A 4LMUA 3AT3A 3PE2A 4FSWA 4UB7A 5E8UA 4PP7A 4HCUA 5FTGA 1G8SA 4FZFB 3SAYA 1V0PA 3VS5A 3VIDA 5I3OA 4HVSA 1E9HA 5EK7A 3AD5A 5DGZA 5J5SA 2ACXA 4F09A 3PJCA 4HYSA 3D2KA 5BVNA 2CCHA 1NVRA 2V55A 3FY2A 4LRMA 3MVLA 3PXRA 1JKSA 3GCQA 4X6RA 4BI0A 3IGGA 3SXRA 3UVRA 4HYUA 2PWLA 3E63A 5HO7A 4O7ZA 3CQEA 4LRJA 4ZMFA 2BZHB 2QNJA 3PA4A 4MX9A 2WOTA 2O3PA 3P7BA 3NR9A 3O8PA 1IEPA 2B9JA 4ITHA 3MW1A 4V0GB 4X3FC 4NL0A 3F61A 4GVAA 2JD5A 4PMSA 2BAJA 4DBNA 4P90A 5CVHA 4J8MA 2E9PA 1APME 1OL2A 4QP1A 2R3LA 2VTSA 2C6IA 3BI6A 3FSKA 4PP9A 4AGDA 3VRYA 5E8ZA 2QCSA 3PRFA 4ANSA 4PDYA 4HVHA 2HWPA 4TYIA 2CDZA 3IS5A 2VO3A 4MXZA 3RINA 3CEKA 3ZO4A 1MQ4A 4C4GA 3SGCA 5IQEA 4UX9A 1PJKA 3MH2A 3PPZA 4G5JA 4O1PA 3MY1A 5LVMA 1BUHA 3PWDA 3VBWA 1U54A 3BHHA 1W7HA 1YHVA 3E64A 3TDWA 3OTUA 4IVAA 4QMWA 1JVPP 1Q5KA 2F4JA 4FA2A 4WBOA 4RSSA 3L9MA 4IBMA 3MPTA 3UMXA 4D1SA 2PYWA 4IJPA 1LPUA 4G1WA 4APPA 1UV5A 4DGOA 2FSOX 5K3YA 3GCSA 5G6VA 1G8AA 3O2MA 3W16A 3A7HA 2VTOA 4CMTA 2DQ7X 3CD3A 2R3GA 2C6TA 4GIHA 5EOLA 4WIHA 4R7IA 3SXSA 4CFNA 5C9CA 5IA4A 1DAYA 4I24A 3N4VA 5CXHA 5CAOA 2F57A 3R8PA 3NX8A 3UIMA 5IA0A 4L6QA 4PWNA 3SDJA 4IXPA 3FMMA 3QKKA 1REJA 4LOOA 1FINA 1YDRE 2ITWA 4BDAA 3FC2A 4E7WA 4CV8A 3HMIA 3UNKA 4PTCA 4RIXB 3FI4A 3NLBA 4G3DA 2J0JA 4QTCA 2V7AA 5L2SA 3QRKA 5BVKA 2PMNX 4QP2A 3PP1A 3R28A 5ETAA 2OZAB 5FDPA 4NZWB 3K3JA 5E1EA 4C0TA 3WF5A 3AOXA 4YTFA 3R02A 3VUHA 4AZWA 4DLIA 2CNVA 3G51A 2YIXA 4BB4A 3Q4UA 3OMVA 5EKOA 4NW5A 3QALE 5EQYA 3DZOA 3KULA 4I94A 2PUUA 3KKVA 4IAFA 4AA5A 2YIYA 3FL5A 2JDSA 5LMKC 3FAAA 2RKUA 1H0VA 4EZ3A 4HCVA 4U0IA 2I6LA 3NYOA 3PWYA 4KAOA 5TKDA 4EHZA 1ZZ2A 2J50A 4JJRA 4JI9A 4ZJIA 4EQMA 1YHWA 5AAEA 3DBCA 5KO1A 2C1AA 2WGJA 2WTWA 4U9AA 3DAEA 1LUFA 2WEIA 3RZFA 3I5ZA 4QNYA 4R3PA 4BCHA 2RFEA 2Y6MA 2FSTX 1PHKA 2E9UA 4NKAA 4DE4A 4YSJA 4UMRA 5JK3A 3CTHA 3LM5A 2VTIA 4O2ZA 5AUZA 1OUYA 3BLQA 1IG1A 3EFWA 4QP7A 4AN9A 3MH1A 3BIZA 4IX5A 4IANA 4GSBA 3O71A 3MFTA 2PVRA 3OT8A 4XP0A 3RNYA 4F9AA 3SX9A 4F0IA 4QQTA 1OBDA 2YM6A 4AP7A 3JVRA 2A2AA 4EI4A 1GIJA 3E93A 5HG8A 4F64A 3A60A 4FT9A 1CKPA 5LVPA 4K33A 4PX6A 2R3IA 4KBKA 4E6QA 5A4LA 5CANA 2XUUA 1UU3A 2R3KA 4H1JA 5HG7A 5JH6A 5IQCA 4XEYA 4IM2A 4FGBA 4ANNA 4F65A 4GV1A 3P5KA 1K3AA 3R1NA 2YABA 2WFYA 1PY5A 5M55A 4U40A 1DAWA 3DLZA 2E9OA 3POZA 1GY3A 2PL0A 3DA6A 4X2FA 5AV3A 3RZBA 4BDBA 4E5BA 4BTMA 4DFUA 3LFSA 3O8TA 2BRNA 3T9IA 3VUKA 5JSMA 5BVDA 2BRHA 2WTCA 2OICA 5IH5A 3CC6A 4YNOA 3HRBA 2OFVA 3EJ1A 4AA4A 4E5AX 5FXRA 2GNLA 4IADA 5A6NA 5KKRC 4S32A 2GPHA 3IECA 3WZUA 2AC5A 3H9OA 4RC2A 3PZEA 2UVYA 3EL7A 4JR3A 4WG5A 2PVJA 2G15A 3NSZA 4EH8A 3KK8A 1H25A 4RPVA 2XB7A 1NY3A 5F20A 3VF8A 4GU6A 2OF2A 3OVVA 5AR7A 4CMUA 3FL4A 5AR2A 4YJQA 4M12A 4C4EA 4EEVA 4FEXA 3G9LX 1VR2A 3H3CA 3ZBFA 4GJ2A 4RX7A 3MH3A 2QLUA 2IZSA 5DHJA 2PULA 4G6NA 4MBLA 3ORNA 3DV3A 3U6JA 5EI8A 3P7CA 1SM2A 4IW0A 2ETRA 3JXWA 4PTGA 5AV1A 3V5JA 4ALWA 1K9AA 4YJOA 3BKBA 4ACCA 4F7JA 2UW5A 1SYKA 4PDOA 4YMJA 4YPSA 4AZFA 4CQGA 1ZYLA 2ITUA 3QA0A 5LVLA 4FEUA 3WF6A 2VWIA 3MB6A 2OXYA 1RJBA 5CX9A 2PUNA 1FGIA 4GUBA 4L42A 4W9WA 4E4MA 2P3GX 4I41A 4WBBB 4AF3A 1IAJA 2WKMA 5M07A 3WYYA 4QOXA 5CU3A 4ANBA 1PW2A 3BEAA 2BTRA 3VBQA 5CI7A 2GHMA 3DAJA 3D5VA 2WTJA 1F3MC 4IZ7A 1GOLA 4V04A 1BI8A 4IVCA 5FGKA 3A7GA 3TN8A 3IQ7A 3HL7A 5HU9A 4D2PA 2JFLA 4GJ3A 2WQEA 2IO6A 4XG7A 1ZYJA 1J7UA 4RJ6A 5F94A 1FVTA 3EMGA 1H1WA 2BROA 3KFAA 2QKWB 3NUYA 3OC1A 5CSXA 5LJJA 5C03A 3GGFA 5ANOA 2BPMA 5L6OA 3C4FA 3OBGA 3OEFX 1TQMA 2OI4X 1YI6A 1L3RE 3S3IA 3BHUA 3U87A 2DS1A 5K9IA 2VWZA 3DNDA 3W10A 5J1WA 1JQHA 3MWUA 4RLLA 3QTQA 4YZMA 1TQIA 2OGVA 3UP2A 4C3RA 4RWKA 1KV1A 1YXTA 2YISA 4F6UA 2PE2A 1UNLA 4GH2A 3RJCA 4QRCA 3EQFA 4GUEA 3WOWA 4EUTA 1H08A 3TWJA 4BCKA 1VYWA 3R8LA 5FG8A 3SC1A 2ESMA 3R71A 2P55A 2RG6A 3FJQE 3HV5A 5CALA 3OW3A 2VTAA 4E1ZA 2DUVA 1YXUA 3LVPA 1W98A 1XHAA 4I22A 4UALA 4EORA 4O0RA 4RIWA 5J79A 1ZWSA 3PVBA 3Q04A 4A9SA 4N57A 4O7YA 4TN6A 5J87A 4QYYA 3QZFA 2R3JA 5B0XA 2BILB 1H00A 3BLHA 2YIQA 3CPCA 3KRRA 5IA5A 2FO0A 2HZIA 5KE0A 3ZZWA 2O5KA 1J3HA 4LRKA 5T68A 4B4LA 4O1OA 4BCPA 2PVNA 1J1BA 5A4QA 5J9ZA 3ERKA 4HGSA 3ZU7A 3ZLXA 3KVXA 5AMNA 5ANGA 4ZS4A 4QP3A 3L8PA 5I0BA 4BCFA 3NEWA 3QD4A 3OCGA 4GL9A 4MXYA 3HYHA 4XV2A 3WYXA 1KV2A 2PVHA 3C4CA 4PPCA 5TO8A 3VULA 5AEPA 4M8TA 4NWMA 3UO5A 1PXLA 4IMYA 3KF7A 4GIIA 1P4OA 4DTKA 1HOWA 3MY0A 4LL0A 3G2FA 5IUIA 2ZJWA 2R2PA 5DOSA 5ETIA 5C8KA 2WMVA 4CKIA 2F2UA 2IW6A 5FBOA 4MQ1A 1ZMVA 3NVMB 2IG7A 5IEYA 3UOJA 4AQCA 2XNPA 5DH3A 3HAMA 4A9UA 5HBHA 3SXFA 4BTKA 3EFKA 3QF9A 3NUPA 4G9RA 3DCVA 4KIOA 5M56A 2UVZA 4KNBA 4ACDA 2XIZA 3CR0A 3KMMA 2R7BA 2H9VA 1EH4A 4HVGA 3WI6A 3DB6A 4J99A 2B1PA 4EYMA 1JSVA 1KOAA 3DDQA 1GZNA 4EH6A 2HENA 2NP8A 3W55A 4I4FA 4IB1A 4XH6A 2G9XA 5IA1A 1Y8YA 3C0GA 1WBPA 2QOCA 4GS6A 3F88A 4BZDA 2YLFA 5CU4A 1M7NA 2ITPA 1M17A 1WBVA 2WMBA 4WSQA 3RGFA 3BGQA 3I6UA 3QRIA 1WZYA 2YWPA 3FKNA 1BI7A 4RFZA 3V8SA 4FIHA 5M06A 4AZTA 5M09A 4FG9A 3FSFA 2W1GA 4WG4A 3SD0A 4FNXA 5E90A 4EH7A 4A4OA 4XG6A 4O7VA 4QMUA 3FYKX 2QOOA 3OD6X 4TYEA 2JBPA 2W17A 5EW9A 4UZHA 3LW0A 4L67A 4C35A 4IH8A 3DB8A 3ETAA 3KK9A 3KN5A 4MTAA 4EJ7A 1YHSA 5CEOA 1NVQA 5E9EA 3PJ1A 1NVSA 3H10A 4XG3A 3ORLA 3QTZA 2IVSA 4O0VA 4XMOA 3KREA 3HA6A 5AP2A 3LCDA 3HZTA 4O84A 3UC4A 3VBVA 3ZLSA 3FY0A 4LFIA 3W2SA 4RWLA 4E73A 5FEQA 5DNRA 4DF3A 4FTOA 4M7IA 4AGUA 2Z7SA 3PIYA 4FVRA 4GT4A 2XBAA 3VHEA 4RZVA 3JY9A 1XH6A 3G0EA 4BYIA 4NTSA 3RPSA 4NTTA 5IQFA 4AG8A 3KXGA 2VRXA 4QNAA 5CAUA 3THBA 1H26A 3C1XA 4KIPA 4AGWA 2XVDA 4IHPA 4CZUA 2W1CA 2X7GA 3JR1A 4F0GA 2ZAZA 4E93A 2W9FB 4FGRA 4PTEA 5M4IA 3BELA 3HNGA 5IMEA 1WBWA 1TQPA 2UV2A 3QX2A 4O0SA 1TVOA 4S31A 4ASDA 4J8NA 4E20A 5FQDC 4BCQA 4BZNA 3NVKI 4BDGA 4DLJA 4O7TA 1GNGA 3D9VA 1JWHA 3ID6C 4IAZA 4FL1A 3CP9A 4K6ZA 3GC7A 3IK3A 1UNGA 4YNEA 4TY1A 1R78A 3Q32A 5H9BA 3SW4A 5E7RA 4JRNA 2XS0A 1H07A 4X2GA 1BL7A 2X39A 2EB2A 3HMPA 5I9VA 2ZM3A 5KMMA 3ITZA 3R6XA 4FTQA 4O22A 2CLXA 4BIDA 3DS6A 3DKOA 2GQRA 5HVYA 4QMOA 4M3QA 2J5EA 1KE5A 1ZYCA 3KF4A 1NA7A 4PMPA 4PUZA 1U5RA 4IX6A 3R7EA 5AIRA 1DS5A 4J53A 4C7TA 1Q8ZA 3QLGA 2VWYA 2Z60A 4FKLA 2X4ZA 3VBXA 5C8NA 1UNHA 4ZJVA 4BZOA 4YSMA 2C3LA 1WMKA 2W7XA 2BDJA 4C58A 5KMLA 2C3JA 3D7TA 5HZNA 3BYMA 4NK9A 4K2RA 5ICPA 1W82A 3BYOA 3BU6A 4I21A 4ONAA 3B8QA 3HV4A 3Q96A 3ZLYA 5IG1A 3AC2A 4FSQA 3OXTA 5AAFA 4XP2A 3COHA 1I09A 4J95A 3OXIA 5DT4A 2ZB1A 3TV6A 4ZTHA 1XH8A 4P4CA 3EQDA 3TEIA 2PZPA 4GRBA 5EHLA 3IONA 4IB5A 3BE2A 5EOBA 2J9MA 2ZB0A 1Z5MA 3QZGA 4JBVA 4OAVB 3FQHA 3OCSA 3DLSA 4CCBA 3GENA 2XJ0A 3QXOA 4DEHA 1U54B 2XCHA 4FNYA 4IAKA 2UZOA 3NUAA 3CY3A 3IGOA 4S30A 3C4WA 3DXQA 1UKIA 5C27A 3R04A 1H0WA 4M0YA 3ZS5A 4JT3A 2BFYA 5HG5A 2QC6A 4G9CA 5BUJA 4K11A 2BFXA 2B9HA 4U81A 4DEBA 4ZLYA 3FLYA 2XJ2A 3UVPA 4WUAA 2UW0A 4FSRA 3LCOA 4L3PA 4S2ZA 4U3ZA 3KRLA 4FSZA 3RCJA 4ERWA 4JVGA 3ALOA 4OW8A 5AWMA 2CNQA 2F7ZE 2XCKA 1OITA 1Q61A 3EZRA 4FTCA 5CQUA 4CMOA 3KXNA 5LVOA 3G33A 4OTRA 3ZZEA 3C9WA 3FBVA 5AV4A 4O7WA 1B38A 4R7HA 4ZSJA 3A61A 2HCKA 3W8LA 1ZYDA 1JLUE 3UDBA 2BVAA 4XX9A 3FLSA 4EKKA 5A6OA 3KCKA 3QRTA 4AGCA 4M66A 2GFSA 3OWJA 4O21A 2VAGA 3MJ2A 5AIKA 3W2PA 4F70A 4MXOA 1OIYA 4DAWA 4GFMA 4FE2A 3BU5A 3D5XA 1MRUA 3SRVA 1SVHA 5CENA 2X8DA 2QG5A 3AMAA 5FWKK 3QQFA 4L7FA 2JLDA 4EONA 4X3JA 5KMIA 4QMLA 3BYVA 5L4QA 3KULB 2BMCA 1OVEA 2I40A 2VWVA 4QP6A 5JFWA 1L8TA 2QOQA 1JKLA 2HY0A 3AC1A 4P5QA 5FEEA 3R8ZA 4NIFB 2W9ZB 3AMBA 3OW4A 5BMMA 4ALVA 2YAKA 5CQWA 5IQAA 4QO9A 3U8WA 4E6CA 4EH2A 2P4IA 4KS7A 4H3PA 3GOKA 3HMNA 3ZMMA 5A4CA 3ZSIA 1YOJA 5GIOE 4W4VA 4U97A 4CCUA 1YW2A 1STCE 4RQKA 5DBXA 3UZRA 2YITA 2GHLA 4FR4A 4DFYA 2YM7A 4RC4A 4E3CA 4MNFA 1Q41A 4U6RA 3U4WA 2YWVA 3OZ6A 3TG1A 2CGVA 5ETCA 4R78A 2WTIA 2OJFE 3HGKA 4FMQA 4FYOA 4MKCA 3UG2A 3E8CA 3RAWA 5M4CA 3O8UA 4IB3A 3TI1A 4LGHA 4C4JA 2P2HA 2GHGA 3B2TA 5HEZA 3HRFA 5EHYA 4GYGA 3PE1A 3TACA 5IQHA 2QOFA 2I0EA 5EQEA 4R7BA 2OBJA 2ZDUA 3B2WA 4USEA 2HXLA 5I9YA 1M7QA 4K0YA 5K4JA 2J7TA 1R0PA 4PMMA 4J96A 3EYGA 3QXPA 3W8QA 2XKEA 3OY1A 2AYPA 3QTRA 4L7SA 3H4JA 1CKIA 3R1QA 3Q9XA 4AAAA 4YZ9A 5CEIA 4FV0A 4TPTA 4JXFA 5T3QA 3D83A 5C4LA 2P0CA 1P4FA 5LMKA 2C3IB 4F9WA 1K2PA 1R1WA 2BIKB 2PMOX 2W99B 2XKDA 3QGWA 4UBAA 5KZ0A 2W1EA 4BDEA 4GK4A 2VO6A 3F66A 5CEKA 5LARA 1OPKA 5KX8A 4G31A 4ARKA 2ITXA 3F9NA 4BDKA 4RA5A 3FMEA 4EH3A 4I92A 4H58A 1H1QA 4CXAA 4BDHA 3RALA 3CTJA 1PXKA 4G3GA 4BN1A 4YJUA 4YZBA 3TUCA 2OG8A 3K5VA 3HUBA 3MIYA 5GIPE 1RQQA 4JRVA 2A19B 4TYHB 1YDTE 2GTNA 4MXAA 4UMQA 1ZRZA 1ZOEA 3CGOA 3FMDA 3QTWA 2C5XA 4NU1A 4UV0A 5FRIA 3TKUA 4FKOA 3TZ8A 4BR3A 4FKWA 3MIAA 1YWNA 5KHXA 2WHBA 4LUDA 4ZAUA 3V5PA 2OFUA 3FZOA 2EB3A 4ZSEA 3EQIA 4YHJA 4GT3A 4YLJA 5F1ZA 5I9UA 2VTHA 1H8FA 1ZOGA 3RTPA 2WZJA 3KL8A 5HICA 3EYHA 4CRLA 2ONLC 4D4RA 3QD0A 2SRCA 4ZTLA 4TWOA 5AX3A 5LXMA 3VWAA 3EN5A 4F08A 4ANLA 4O7NA 2XRUA 4TW9A 5DRDA 3KRJA 2YERA 5HLPA 5C4KA 4ZOGA 3LXNA 4JBOA 3PSCA 4IZYA 2B7AA 5D1JA 3I79A 3I0OA 4QMMA 2ZV7A 4KD1A 4EOPA 5GJDA 2YN8A 4CT1A 3RNIA 3FXXA 5EHOA 5CEPA 1MP8A 3EOCA 3ZC5A 4JNWA 4NJ3A 3LPBA 3NUUA 3G15A 2X2MA 3FKLA 4FVQA 3ZXTA 4KRDA 3WF9A 3LLAA 2R4BA 5IEXA 1XO2B 2J4ZA 2HOGA 3I7BA 3AMYA 3QQJA 4XG8A 3SV0A 2CKPA 1KSWA 3OHTA 4NH1A 4PPAA 4X21A 4E6DA 2YFXA 3BE9A 3VHKA 2PZYA 2QO2A 4UMUA 5AUTA 1ZZLA 2VO7A 4EOOA 3R9HA 5I9XA 5J1VA 2R3NA 3KQ7A 2QOHA 2FSLX 4I5MA 2P33A 3KU2A 5KMJA 4XHKB 3MB7A 3T9TA 4GU9A 3ODYX 2W4KA 3CIKA 4D2VA 4FV2A 4L9IA 2UZTA 5HO6A 3FZTA 3V3VA 2FH9A 5K0KA 4EYJA 4BIBA 3IDBA 3UZPA 5CAQA 4DTBA 3LQ5A 3RM6A 4FSYA 5E8TA 2VWUA 1P14A 2X4FA 3ALNA 4D1ZA 5CNNA 3V5WA 1J7IA 2X8EA 4OBPA 3MJ1A 3GEQA 4FL3A 2WU7A 5JQ5A 2VUWA 2W1ZA 1CTPE 2W1FA 4ACHA 2V0DA 2VV9A 4FKTA 1U46A 5DEYA 2B52A 2WMUA 3WIKA 4BKZA 1NT2A 2Q83A 4TWPA 3LMHA 3LFBA 4FEWA 4RC3A 2WMSA 3EL8A 5FM2A 1SVEA 4FX3A 4QYEA 4L52A 5DR2A 4RIWB 2LAVA 4JLCA 2WEVA 4GMYA 3HA8A 2E2BA 4IQ6A 4U79A 2UW3A 5HCYA 3P1AA 2R0UA 1Q8UA 2XA4A 3TTJA 4BBMA 5CF6A 3LJ1A 3POOA 3COKA 3DFCB 3CGFA 3AQVA 3HDMA 4MBIA 5JGBA 5AFVA 2XRWA 3BU3A 5BUIA 3FV8A 4PF4A 2DWBA 4UMPA 3C0HA 1O6YA 4FV1A 4AW5A 5C1QB 4DBXA 5AP5A 4UXLA 3JVSA 3QAME 4FSUA 4HGEA 3DQXA 2V5QA 3BEGA 4LGGA 5GHVA 4E5WA 3RP9A 3MY5A 5CS6A 2PMLX 2Z2WA 3FZPA 4GEOA 4RVKA 4QP8A 2G2IA 4BWXA 2JKMA 3DK3A 4QMXA 2XK7A 3UJGA 4QQJA 2WQMA 4O0XA 4DFNA 2QHNA 4PQNA 3VBTA 3C50A 5H8GA 1Q24A 3FPMA 3KRWA 4IAAA 4C02A 4M97A 5EYKA 4CKRA 1FBNA 2OKRA 4JIKA 5DFPA 1MQBA 3DXNA 3ENMA 4G6LA 2WMXA 2UZWE 4KBAA 2X0GA 4KIKB 5HGIA 5C26A 2VTTA 3PZHA 3NRMA 4JDHA 3F6XA 4UZDA 4L53A 2WQBA 1MRYA 3IDPA 3EWHA 3KN6A 4XG9A 4ZTNA 5JFVA 2RF9A 2VZ6A 3ORXA 2HK5A 4RBLA 3PXKA 1W83A 4WT6A 4N6YA 4ZK5A 3A99A 4USFA 4AFJA 3Q52A 5KZIA 3BLRA 4CZTA 1PMEA 5HHWA 3PG3A 2CGWA 4D55A 1IRKA 3LXPA 4HZRA 5HESA 5BVFA 3FLNC 4ZSLA 5HE3A 3FPQA 5EKNA 4FF8A 1QMZA 4L46A 3V6SA 3PJ8A 2UZVA 3ZFXA 3TNWA 4AW2A 3F5PA 3V8WA 4ZS0A 4UWCA 2RFNA 5DPVA 4CGAA 2XIYA 2VN9A 3NCGA 3SOCA 3QHRA 4HGLA 1DI8A 2C3KA 3H9FA 3LCSA 4UMTA 2F9GA 2CKEA 1I44A 2R5TA 4FTAA 4R3CA 3VW6A 2PZIA 2R7IA 3NNWA 3RHKA 3MVHA 1E1XA 1UKHA 3FQEA 4B99A 4DEGA 2PUIA 2XJ1A 3GI3A 4FKQA 3ORMA 1OMWA 3R9NA 3ORTA 4MQ2A 5HNIX 3DQWA 3FZ1A 1OZ1A 3AD4A 3KVWA 4WKQA 4IAIA 4X6QC 5HD4A 4F63A 1Z57A 4FNZA 5L2QA 4KINA 4EH9A 3EB0A 3S95A 1UU7A 5BYZA 4YU2A 2Y7JA 3UBDA 1TKIA 1BLXA 3TZ9A 4EQCA 2Y4PA 4BCOA 4F9CA 3BHYA 3K3IA 2XKFA 3QWKA 4XRJA 1SMHA 4PMTA 3MDYA 5BYYA 5EI6A 3UPXA 4KKEA 3BV2A 2BDWA 3VQHA 4KA3A 3TKHA 2ZM1A 4ASXA 3OUKA 2C6LA 5IU2A 3IOPA 3OCBA 3QQKA 4HNFA 4ALUA 2H96A 4NCTC 4JG6A 1PXPA 3QZIA 2X81A 3DKFA 4IFCA 4C61A 1WBSA 2VO0A 4FT7A 4E4XA 5CT7A 5EQPA 4NKSA 5JKGA 1YWRA 4ZSAA 4YJPA 5DLSA 5B2KA 5LCKA 5LVNA 5TR6A 4G3FA 5B2MA 5HX6A 4DT8A 1QPDA 4IAYA 4WSYA 5M51A 3NUXA 3GC0A 4I5CA 3QCXA 2XMYA 1HCLA 3KY2A 4J7BA 4UWYA 2VD5A 2V22A 3P7AA 4F1TA 4M84A 3R8UA 5D9HA 2VU3A 2ZMCA 3ZM4A 4E4LA 4Y5HA 2YHVA 5KNJA 2RFSA 2YDIA 3EQBA 4FZ6A 4V01A 3RAIA 3RKBA 3UGCA 5I9WA 2C6OA 3WBLA 3SHEA 1KOBA 1SZMA 2C5OA 4AACA 4ENXA 5KMOA 1WFCA 3Q3BA 4XBUA 1FQ1B 3LFNA 3I4BA 3NNVA 4QMZA 3R7UA 3RWPA 2CKOA 4O82A 1PRYA 3BHTA 4TWNA 4O7SA 3QQLA 4FUXA 3ROCA 2WD1A 4MNEA 4ZSGA 3UP7A 3WE4A 4HVIA 4GG7A 4XG2A 3IOKA 2XNBA 4K8AA 2UUEA 3H0YA 2GDOA 4ZP5A 3QQUA 4WOVA 3ULZA 4D0XA 4M0ZA 4RJ7A 1OUKA 3F7ZA 4FYNA 1U59A 4GW8A 4M13A 3UQFA 2CMWA 2WO6A 4IFGA 2Y4IC 4O96A 4RIYA 4DC2A 2B55A 3ZRLA 4FV8A 2WIHA 2ITVA 1FOTA 1OIUA 3NYXA 2ZYBA 5H3QA 3EQRA 5IQGA 2JITA 3OS3A 4FTUA 4OUCA 2IZTA 5DN3A 4NYEA 4LV8A 4BC6A 1YXSA 5CAPA 1Q3DA 3VS1A 2WU6A 5IA3A 3HP2A 4DYMA 4C2VA 4BYJA 3A7IA 3MH0A 5JRSA 4FUYA 4UY9A 3TT0A 4O6EA 3PYYA 3LE6A 2OJ9A 4IDTA 5EYMA 3FMNA 1SNXA 4U80A 2JGZA 2PVFA 1AD5A 3PTGA 2CNUA 5IUHA 5KCVA 3ZC6A 2HWOA 3IW7A 4RLKA 3C0IA 5ACKA 2IWIA 4KWPA 1OL5A 4CVAA 5CSWA 3MA6A 3F5UA 3F2NA 4J71A 1LP4A 5TF9A 1QPCA 1A06A 1ZY4A 3E88A 4I5PA 3LFCA 4C4IA 3QTIA 2BZIB 5E91A 4EQUA 1R39A 4EZ7A 4RWJA 3O17A 3QA8A 3PPKA 4V0GA 4CFUA 3R00A 3NIEA 1XBBA 3BYSA 3PIZA 4JBQA 3RCDA 4JX7A 2BUJA 3DTCA 4WG3A 4XUFA 4ERKA 2YM8A 1A9UA 4EOQA 2XNNA 1OPLA 2XNMA 3AT4A 5EDPA 4WUNA 5IUGA 5CF8A 2UW4A 4PV0A 3AC3A 4FK6A 5IMXA 2W5BA 2XYUA 3QU0A 4FKUA 4G34A 1VYZA 4W4YA 3QTSA 4EHGA 5CU0A 5IH4A 3NMUF 2I0HA 3HVCA 5C01A 4S33A 2XNGA 4RX5A 3QGYA 2WMQA 4FV4A 4IX3A 3ZUTA 2F7XE 2VGPA 3QD2B 4WRSA 3UIBA 2VX1A 3U55A 4GFGA 3BQCA 2GU8A 3FC1X 3FMKA 4AOJA 4U7ZA 4GKIA 3GQLA 3D14A 2W96B 4BCNA 1FVVA 3ZBXA 2R0IA 4ENYA 4A4XA 2XH5A 5AR4A 3TDVA 4HOKA 2G01A 2QG7A 2WMRA 3PUPA 1PF8A 4YURA 2YACA 4KS8A 4EOMA 5BVWA 2HY81 3PY3A 4C33A 4M67A 4BL1A 5L8KA 3A62A 3FMJA 5I9ZA 2VWXA 2IJMA 4YJTA 3CKXA 4L43A 1XR1A 1YXXA 4I6FA 5ANKA 4XBRA 5G1XA 4ZEGA 4AE9A 1OPJA 2CLQA 5GINE 4BHZA 2ZV8A 4MD9E 4WO5A 4I20A 2XIRA 5CTPA 4E4NA 2PE0A 4UXQA 2X7OA 3B8RA 4NW6A 1BYGA 3UOLA 4MWHA 2BRMA 2J0MB 3BYUA 3N51A 3ODZX 2GNIA 2YZAA 3SW7A 3CJGA 4Q5EA 4XYFA 3ZM9A 2OZAA 1G5SA 3ORKA 4ZZMA 1Q8YA 4AS0A 2J2IB 4RFMA 3AGMA 3LAUA 5CASA 4AOIA 4QP9A 2GTMA 4DH3A 3A8XA 5IPJA 3DDPA 3M2WA 5AP7A 3F2AA 1IASA 1H4LA 4RG0A 3V5QA 4F99A 3KB7A 2ITNA 3PA5A 5HNGA 2YCRA 4FZDB 3WILA 5L8LA 1RE8A 4RVMA 5F4NA 4PNKA 3NAXA 4WRGA 4CNHA 2O63A 4TNDA 3QD3A 1W84A 3MV5A 2ITZA 2O2UA 3A2CA 3DKCA 4WA9A 5D10A 2XK6A 4RQVA 4LI5A 2W1HA 2QKRA 3FMLA 3OEZA 4IZAA 4P7EA 2NRYA 3DT1A 5ETFA 2I1MA 5HIEA 2KULA 4FKGA 5AP4A 3CKWA 1BMKA 2X8IA 5A46A 4YC3A 3KMUA 3LFAA 4YGAA 4OBOA 2PSQA 2XNOA 3R1YA 3ZEWA 5JT2A 4FIGA 4OTDA 3CD8A 4EBWA 5L8JA 2Z8CA 4UWBA 3DK6A 1FPUA 3O51A 3PVWA 3GFWA 3GCUA 4LL5A 4XV9A 4QMNA 3EZVA 3IO7A 3O7LB 4QTEA 2C69A 2VTMA 2XK8A 5AUWA 3QQHA 1R0EA 4ANMA 2BRBA 4B8LA 4DFBA 3VUMA 2CSNA 2JKQA 2OXXA 2WQOA 3E8DA 2EXEA 4O38A 2X9EA 3PA3A 5JFXA 5B7VA 1Q8WA 2HAKA 4I6QA 5FLFA 4ITIA 3PG1A 1OIRA 4USDA 4LYNA 3JPVA 5DR6A 4DH5A 3V5LA 5E4HA 2GNJA 5FD2A 3FEGA 4O27B 4FSMA 2C6KA 5KMKA 1SVGA 1V0OA 4YO6A 3ZUUA 1J91A 1PYXA 3FXWA 3U6IA 3QHWA 4C38A 4NUSA 3E3BX 2ZMDA 3IW4A 2X7FA 2RL5A 4BGGA 5AUXA 5FP5A 1Y6AA 1P5EA 3CCNA 2C6EA 3QUEA 4CYJA 4YTCA 3BBWA 3VS3A 2WOUA 4MXCA 3PDTA 3PIXA 1YDSE 5AUVA 4CV9A 1H1SA 2ITTA 4C4FA 4WNMA 3FXZA 2G2HA 1M2PA 4AXAA 4A9TA 1JSUA 2JDRA 5CEMA 3LMGA 4XLIA 5KHWA 3FI3A 4KIQA 4F4PA 2WMTA 2LGCA 2W5AA 3PY0A 4DG0E 1CDKA 3T8OA 3R7VA 1JNKA 4BFMA 5KKRB 2YM4A 1YI4A 2Z7LA 3C13A 2GS6A 4RMZA 3G6HA 3NYNA 4AU8A 4Z3VA 4QYGA 4UYNA 2XK4A 4BCMA 2ERZE 2QLQA 1Q8TA 4KBCA 3E7OA 5CF4A 3NCZA 4BDDA 5E92A 3CSVA 2WB8A 2NO3A 3LCTA 5CSHA 3WE8A 4EOLA 2R3FA 1OL1A 4C3PA 1JSTA 1LEWA 3CQUA 3CY2A 3O0GA 4NM3A 2IVUA 4U41A 4J98A 3UNZA 2Z7RA 3DFAA 3CXWA 3MS9A 3GCPA 4Z16A 3TXOA 5BMSA 2ONLA 3MSSA 5J8IA 5IF1A 1XKKA 2J0LA 1KE9A 3REPA 5DG5A 3VW8A 4AN3A 3HV6A 5LOHA 3PXZA 4ACMA 1Y8GA 4APCA 1YKRA 3R21A 3U54A 4DEAA 3NZ0A 2Y6OA 3EHAA 2HZ4A 3M42A 3MFRA 4L44A 4LUEA 3R8MA 4GVJA 1PXOA 2VTNA 1PYEA 2GSFA 2O65A 3OXZA 3V01A 4BWPA 2W4OA 5E8SA 3RBWA 4ASZA 3C4XA 5AR5A 2A4LA 5CY3A 4X2NA 4OTIA 1J1CA 2OIBA 1XBCA 3IDCA 4IDVA 3RMFA 1IA8A 3ZXZA 4TYJA 5HLWA 3P9JA 4XP3A 1KWPA 4OGRA 3GU8A 4MF0A 2UW8A 2ETMA 2NRUA 1ZY5A 4EK5A 1VJYA 3EFJA 4YTIA 3H30A 2YAAA 4ZTSA 3R7YA 3FE3A 3L9PA 3QL8A 3NGAA 1Q62A 2XM9A 3BCEA 5EH0A 2B4SB 2OIDA 4XJ0A 1JPAA 2O0UA 2EXCX 3ZSHA 1AQ1A 4X3FA 1Y6BA 3Q5IA 3QLFA 2PY3A 4KSQA 5J9LA 4NM0A 4QPSA 3UTOA 4FV9A 3RPOA 5M4FA 1VEBA 4HYHA 4CFXA 1WVXA 1OI9A 3KXMA 2GNGA 5KMNA 2FVDA 3W2QA 4XLVA 3WF8A 2OK1A 3F5GA 4D4SA 3AC8A 3HECA 5HNBA 3VJNA 4DEIA 2W05A 2YLEA 4HVDA 3V04A 3JS2A 4EWHA 2WELA 4CFMA 3U6HA 3GUBA 4CG8A 3VBYA 1O6LA 3NW5A 2JDVA 4Y46A 2GS2A 4YO4A 2B53A 4Z7GA 1URWA 3HEGA 2X2KA 4X7QA 4L3LA 3RK7A 2XK3A 2BAQA 4MWIA 4Q2AA 1ATPE 3ORPA 4D9TA 4P5ZA 4XV3A 3HKOA 4QMQA 5K5XA 1ZMWA 2CGUA 3I6WA 5M08A 4EZ5A 2YM5A 3Q60A 2R3RA 2IN6A 3R9RA 3QC4A 3CPBA
chains in the Genus database with same CATH superfamily
2OLCA 2PHKA 4C36A 4O0TA 2VTQA 3I60A 5L6WL 1M52A 3WZEA 4CFFA 4ID7A 4GK3A 3VC4A 4FTKA 3SG9A 3I7CA 2IEWA 4MK0A 4FT5A 5FXQA 3DTWA 3LFFA 1PMNA 4BICA 4A7CA 3G6GA 5AJQA 5HTIA 3LZBA 1WVYA 2A27A 2VWBA 2PVYA 1BKXA 4ITJA 1REKA 3IW5A 1WAKA 3BWJA 1UU8A 3OY3A 4QTAA 5AAGA 5HLNA 2BIYA 2OH0E 3DJ7A 2VTPA 3U51A 3NYVA 4A06A 5HX8A 2C5YA 3A4PA 3NW6A 2BAKA 4FV6A 4MD8E 1DM2A 5TOZA 1XH7A 3H0ZA 4IC7A 4IC8A 3P4KA 3VS2A 3HP5A 3COMA 4TWCA 2WTKB 2WTDA 3DU8A 4FOCA 2UW9A 3R30A 3MFUA 3QQGA 4KABA 3W1FA 2X6EA 3DBEA 5DVRA 3R9DA 4U45A 5CT0A 5FDXA 3L8XA 3TIYA 4ZY5A 4HYIA 4IB0A 1YWVA 3C4EA 4ANOA 2IW8A 3TV7A 3W2RA 3HLLA 2BALA 2BKZA 4I0SA 4IWDA 3LKMA 3HMMA 3ATSA 2PTKA 4CKJA 2VTJA 4NM7A 3G9NA 3PXQA 3W0SA 2PMIA 5DMZA 2QOBA 2VGOA 4U5JA 5A9UA 3FQSA 3QYZA 3ZO2A 1CSNA 3I0QA 4U42A 4CTBA 3LHJA 4O91A 3TUDA 4QP4A 2Q0BA 3ACKA 1XH5A 1U4DA 3MPAA 3P0MA 2PVLA 5H8EA 5AM7A 1O6KA 2R3PA 3GFEA 5KUPA 4FKIA 5LCJA 3PLSA 3DJ6A 3ROYA 3TNQB 4ZY6A 2BZJA 5EYDA 4RT7A 2XZSA 3PLAE 5E8VA 2F7EE 2IZUA 1UWJA 4D2TA 2V62A 4ACGA 3GOPA 2X2LA 4MD7E 3ZRMA 4EK3A 3TUBA 3SVVA 2C5NA 4EK6A 3FUPA 1ZAOA 3I5NA 3KRXA 4M69A 5HKMA 4D58A 4BDIA 3KXZA 3GP0A 4A9RA 3ULIA 4WNKA 3C5IA 1PXJA 5AV2A 3TCPA 3D7ZA 4FC0A 4EKLA 2J90A 3Q6WA 2ETKA 4AAYA 4L45A 3EKNA 3QTUA 4JDJA 4CZYB 2ITYA 4U8ZA 1ERKA 3VS4A 1XJDA 2OZOA 4MNEB 2JKOA 4F9BA 4W8DA 2HW7A 3LJ0A 4DDGA 4QPMA 4N70A 4D1XA 3Q9YA 4AW0A 4RX8A 4Z9LA 3CJFA 4K18A 4ORKA 4L00A 4DFZE 4O0UA 5CNOA 4LDTA 4QYHA 5IZFA 2GS7A 4ZLOA 4RIYB 4NCTA 3RAKA 2PPQA 4PNIA 5AA8A 5AP3A 5A3XA 1PXNA 2HZ0A 3VRZA 4F7SA 2VTRA 5HE2A 2F2CB 3R83A 4CTCA 2Z02A 2H34A 3FMHA 4U3YA 3VNTA 4QDVA 2CCIA 3QKMA 2BCJA 2P2IA 2GCDA 2JEDA 4AX8A 2R3HA 1ZMUA 4U43A 4E6AA 4H39A 3BWFA 3D94A 3GQIA 3RK9A 3TNHA 5TE0A 1OB3A 1MRVA 4CEGA 3MI9A 3MGYA 4EHEA 4OTGA 4Y72A 2AC3A 2XEYA 3QFVA 4D2SA 2ZV2A 4KB8A 3OG7A 3TKIA 3UYSA 4E26A 5ANIA 2YJSA 1OL7A 4O7LA 4R3RA 1J7LA 5D41A 3EN9A 4AXEA 5DE2A 5HTBA 1FGKA 1YOLA 4MCVA 4G17A 3UMWA 2CGXA 1KE8A 3ZRKA 3S00A 3TMOA 4MEDA 2PVMA 3ZDUA 3GU6A 4CFVA 3MA3A 1CKJA 3AG9A 3RAHA 4D0WA 4QMTA 2UW7A 4ZTMA 2OJGA 3ZEPA 2C0OA 2R3QA 5L3AA 4QYFA 3ENHA 2ZM4A 4XOZA 3ZLWA 4HGTA 1W8CA 4HZSA 3DXPA 2OO8X 3W18A 4O86A 4I0TA 3TTIA 2YDKA 4ASEA 5LWNA 4MBJA 5HD7A 4D9UA 4GYIA 1XQZA 3S4QA 4KRCA 5CSVA 3CE3A 4ZIMA 3VAPA 4R1VA 3QUPA 5AV0A 4RJ8A 4LMNA 4EOSA 2J0IA 1XH9A 2WMAA 5CU2A 5D12A 4AWIA 3AKLA 3LXLA 5FBNC 3Q4CA 3BGZA 4FTMA 4FVPA 4GFOA 2QO9A 2O8YA 3R0TA 5ACBC 4CD0A 3BV3A 3ORIA 4Z7HA 1ND4A 3MESA 3W0MA 1T45A 3TJDA 2BDFA 3BX5A 2WXVA 3GNIB 4DN5A 3HAVA 3BPRA 3GXLA 1GZ8A 1F0QA 3D4QA 3RPYA 3VF9A 3S1HA 4YHFA 4JQ8A 3DJ5A 2XEZA 1ZYSA 5IA2A 4FV7A 4F1MA 2BZKB 3R63A 3PFQA 4XOYA 4IVBA 4BGHA 4I0RA 2QOKA 4R77A 3UZTA 3FLWA 2EWAA 1GIIA 3OP5A 3COIA 4YJNA 5GNKA 3DBDA 4FSTA 3PSDA 1YRPA 3CTQA 4IWQA 2XK9A 3AC5A 3EQHA 2J51A 3ZDIA 3W0OA 3EFLA 4GKHA 3UNJA 4MAOA 4W4XA 1KUTA 4TZRA 4W8EA 4KUJA 4DH8A 4IACA 4CG9A 2JIIA 2X6DA 4DCAA 4QTDA 3UODA 2YM3A 3N4UA 1H24A 1M14A 4FIEA 4BWKA 3C4ZA 2C6MA 2DYLA 3F3UA 3GU7A 2CJMA 5K0XA 3GVUA 5LMAA 3FHRA 3IW6A 5HU3A 4C62A 3QBNA 2W06A 4HW7A 3W2CA 4BBFA 1RDQE 2C30A 3G90X 3WARA 5BYLA 4IZ5A 2YEXA 3EN4A 4X2JA 5A14A 2CPKE 5AX9A 2ITQA 5FTQA 4QPAA 3Q2MA 4LQMA 1FVRA 5HVKA 4NIFA 3Q6UA 4FG8A 4JQ7A 1V1KA 1H01A 2YDJA 4OT5A 5EI2A 5K4IA 4FIFA 4YZCA 5BVEA 4KKGA 3PPJA 3QCSA 1ZXEA 2W5HA 1GZKA 1S9IA 4I3ZA 4JOAA 4DT9A 3D5UA 1UVRA 2REIA 5HVJA 3UIUA 4EC9A 1RW8A 4DG3E 1OKZA 2W1IA 3BQRA 2YCSA 2QU6A 3F3WA 3UPZA 4XS2A 4IEBA 3ANRA 4Y73A 3RPVA 4DCEA 4J97A 4HNIA 3KCFA 5FP6A 4EH4A 1PXMA 4IVDA 4S34A 5HOAA 2QHMA 4MXXA 1NXKA 2JAVA 5JZNA 4Q5HA 2QURA 3P08A 3HDNA 3UC3A 5M44A 2Z7QA 4Q9SA 2G2FA 3VUIA 2OIQA 4JDKA 3PXFA 2EUFB 3E8EA 3TIZA 4B6LA 3KEXA 5GZ9A 4F9YA 3ELJA 3A7JA 2PZ5A 1E1VA 3GC8A 5CU6A 3R9OA 4OR5A 5JRQA 3ML1A 2UZDA 3F5XA 2YCQA 3LLTA 4FZ7A 3QC9A 2PK9A 4HJOA 4ZLZA 3JYAA 1ZOHA 5GJFA 2E9VA 4BDFA 5M4UA 4AXDA 1GJOA 3WZKA 2HXQA 5IQDA 3VS7A 2IVTA 3F3VA 5GJGA 4YZDA 5BUEA 5L2WA 3FZRA 5D11A 1XMLA 3R7IA 2HZNA 2HYYA 3OT3A 4FT0A 3Q4TA 4LOQA 2Y9QA 2C5VA 4WHZA 2PZRA 4FEVA 5FEDA 1QPEA 1HCKA 2RIOA 3GU4A 4F6SA 4DEEA 3HUCA 1OIQA 3ZCLA 1PMUA 4IM3A 1YOMA 2OF4A 3G5DA 4JS8A 4L68A 4LOPA 4E8AA 2GMXA 2NPQA 3NPCA 4FKRA 4FL2A 4PL4A 5DT0A 4QMSA 3RVGA 4A4LA 2XYNA 4AFEA 5J7BA 3VUTA 5IEVA 4BTFA 4BCIA 4RJ5A 1G8KA 3E7VA 5HBJA 5AP1A 4MHAA 4TYHA 3W2OA 2V7OA 2BHHA 1W2DA 5IKWA 4BI1A 2FGIA 5L6PA 4BTJA 3L9NA 4IWOA 2J0KA 4EBVA 5EFQA 5E8WA 3NFFB 4D5HA 3ANQA 4M15A 3MPMA 4F0FA 5I5ZA 3UQGA 2UZNA 3EIDA 5AR8A 1OKYA 3D7TB 2ZOQA 2RG5A 2WQNA 1S9JA 1P2AA 1IA9A 2RGPA 4GCJA 4J1RA 3ZO1A 3OWPA 5C8MA 5E8XA 4DH7A 2B54A 4H1MA 2I0YA 2J5FA 2A0CX 3BRBA 4LGDA 3AC4A 3DK7A 3WZDA 3ZYAA 4AT4A 1Z9XA 3MTLA 3JY0A 4H05A 2OWBA 4C8BA 3E3PA 2VNWA 1LEZA 3PP0A 1F5QA 3SKCA 4FODA 3U9CA 4AZVA 1GZOA 2BR1A 2KTYA 2HW6A 4FKVA 1PKGA 5HO8A 5J7HA 2VNYA 2UZEA 1G8JA 4QQCA 5J5TA 4L3JA 5F9EA 3PVUA 2C68A 1PMVA 4AE6A 2ZV9A 3TJCA 5IH6A 3P5JC 3VS0A 4IJ9A 4EL9A 3ZTXA 2XALA 2W0JA 4KKHA 2YA9A 2QU5A 2H6DA 3GC9A 4R1YA 3BZ3A 3BBTB 4PL5A 4QQ5A 4YTHA 2EU9A 4C2WA 3TYKA 5AUUA 3QZHA 1FMKA 4L01A 4TKSA 4ZY4A 5GZ8A 3I1AA 4BIEA 5T6KA 4H3BA 5HE1A 4XG4A 4CYIA 1Q99A 3KA0A 3LQ8A 3R01A 4RVLA 4DTAA 4OTQA 1W0XC 1JBPE 4AW1A 3U4UA 2QI8A 4FV3A 4NT4A 2OJIA 3TNPC 3RM7A 3TV4A 4BKYA 5M53A 3EKKA 5FM3A 4RRVA 2XANA 5DYJA 3UYTA 4CLJA 3C51A 3PY1A 4YC6A 4CSVA 4X3FB 3O23A 4C37A 3FI8A 2XBJA 3FLQA 4QT1A 5CEQA 2JBOA 2I0VA 4HCTA 5J95A 3QX4A 3O50A 3V8TA 2BTSA 4G5PA 3LFEA 4QMVA 4RFYA 3VONA 1H1PA 4K1BA 1JKTA 2H8HA 5DIAA 1OGUA 3OWLA 4I5HA 5AP0A 2FSMX 3KXXA 1U5QA 3LM0A 5AUYA 5TT7A 5BVOA 4NEUA 5A4TA 3O7LD 3DOGA 2HELA 1QCFA 4RJ4A 3SRVB 4FEQA 5K5NA 4IX4A 3FYJX 5FTOA 4AOTA 3Q9ZA 3E92A 5A4EA 3CLYA 2FUMA 4FKSA 4PY1A 1GAGA 1M2QA 2O64A 2XNEA 3P23A 3TM0A 3P78A 2FB8A 4FBXA 2XM8A 4Y83A 2XIXA 2BRGA 3D0EA 2ZVAA 3GBZA 4I6BA 5IQIA 3IG7A 3NAYA 4RA4A 3ZO3A 2JAMA 3G0FA 1B6CB 1OL6A 4W4WA 5D7AA 4H36A 4AT5A 2GNHA 3QKLA 4BDJA 3NMUF 4TYGA 2B0QA 2HIWA 3K5UA 3Q5ZA 1UA2A 3KGAA 5H8BA 3QCQA 5ITAA 3PJ3A 4F7NA 3N9XA 4R5YA 2FYSA 2EVAA 4NJDA 4WNOA 3UO6A 3S0OA 1OM1A 3R7OA 3F2RA 4IE9A 3C7QA 5DT3A 2QVSE 4HPTE 3ZOSA 2CN8A 4KSPA 1ZLTA 3OBJA 4QD6A 3VN9A 3NWWA 4BGQA 4JIAA 4MYGA 3DBQA 4RIXA 5HCZA 4AN2A 4F6WA 5IDNA 3LIJA 1MUOA 1URCA 1OGYA 5JQ8A 4Q9ZA 3Q4ZA 3EQCA 4YBKA 2YZLA 3TL8A 2IW9A 5ANDA 5EW3A 3SOAA 2Y0AA 5JMSA 4W9XA 4FZAB 3RK5A 3V51A 5HTCA 3ZH8A 3SG8A 2Q0NA 3HX4A 4ZZOA 1PKDA 4QMPA 3BHVA 3NNXA 3OUNB 2UZUE 5JGDA 2WTKC 4YJVA 1BL6A 3L9LA 4KIKA 5JEBA 4OAUC 1V0BA 2WIPA 4PPBA 5KBRA 1ZARA 4JG7A 3F82A 2CKQA 2NNWB 2CN5A 5AA9A 3OFMA 3R73A 2C4GA 4QMYA 4Z55A 4GG5A 3LFQA 1WCCA 3EH9A 2W1DA 1WBTA 2R3MA 4JBPA 3FLZA 1YQJA 4N4SA 4TT7A 3ZFMA 3PSBA 3FDNA 4RJ3A 5F95A 5HG9A 3UO4A 4ZZNA 4EHVA 3M11A 2C0IA 4FTJA 2R9SA 4OBQA 5AM6A 1PXIA 4DINA 2QQ7A 5CXZA 1CM8A 1A48A 4O6LA 1JKKA 2GFCA 3NS9A 5CZHA 4O81A 4FICA 1AGWA 4F7LA 1R3CA 4L8MA 2A1AB 2YJRA 4FTLA 1OKVA 3MBLA 5LWMA 4Y95A 4NM5A 5A54A 4J52A 3OOGA 4TNBA 2WMWA 5CVFA 2PVKA 2JDTA 3VQUA 5I3RA 5M57A 4EOJA 3DY7A 4M69B 4O0YA 4PRJA 4UEUA 4CLIA 4BVUA 2PUPA 3AKKA 4CRSA 4FSNA 3RWQA 5HCXA 2YIRA 3AXWA 4BJJB 1Q3WA 5EM5A 5FXSA 4G3CA 3JUHA 3LMIA 2C1BA 3VS6A 4C4HA 5JGAA 1KE6A 3A7FA 4MF1A 1OKWA 4BKJA 2XF0A 3OWKA 4B8MA 1XH4A 3E62A 4DHFA 3TNIA 3D5WA 1W2FA 4A9YA 3OOMA 3ZSGA 1H27A 3LXKA 4AZSA 4C57A 3MFSA 5DA3A 2CHLA 3A8WA 2WPAA 5HIBA 4RWIA 1BX6A 4GT5A 4FNWA 5IISA 1XWSA 2JIVA 4XV1A 2PU8A 4D4YA 4DG2E 1KE7A 4N0SA 1OECA 4RIOA 3P86A 3NUSA 3L1SA 5EM7A 4I93A 2B9IA 4X0MA 5DI1A 4ZMEA 3EQGA 4ZJJA 4IM0A 3V5TA 4YJSA 4K9YA 3VVHA 3UG1A 1QPJA 4WNPA 1DI9A 2GQGA 4RGJA 4BBEA 3NDMA 4EK4A 3VUDA 5BPYA 1XMMA 1Y57A 3ACJA 3DBFA 5JN2A 4Y5QA 5EYCA 5B2LA 4X2KA 1H1RA 4FTTA 4O7RA 3FWQA 4CFWA 5E8YA 2E9NA 3E8NA 3OF0A 3GB2A 3SQQA 4BI2A 4DFLA 4F1OA 5IDPA 3PUFC 1XBAA 3SA0A 4EJNA 5EM8A 3T3UA 4R6VA 3AGLA 2WAJA 5DR9A 3WF7A 4DGLC 4Y85A 3R2YA 1M2RA 1CMKE 4DHJA 3ZFYA 3I81A 2IVVA 4BDCA 4DH1A 5HQ0A 5AP6A 4NSTA 5EG3A 2OH4A 4GK2A 3GT8A 4U44A 4IWPA 2F49A 5HORA 3CS9A 4C34A 5AR3A 3S2PA 3TZ7A 2BKKA 4HPUE 5L2IA 4D4VA 4C59A 5LQFA 3HMOA 5EDRA 3LOKA 3F7WA 3IPHA 3HV3A 4OTFA 3V6RA 3WIGA 5BNJA 1YXVA 2Y4IB 4FIIA 4ZTRA 3QWJA 4CQEA 3FI2A 3A4OX 4FTIA 4YBJA 5CVGA 3AT2A 1T46A 4DITA 4FIJA 4BCJA 4DGGA 2VX0A 4OTPA 4DEDA 1OBGA 2JC6A 3VO3A 3K2LA 4O2PA 5KBQA 4B7TA 4PL3A 2QO7A 5AADA 5IQBA 1UWHA 3GU5A 4R8QA 3PFYA 2C47A 3MTFA 4DFXE 2BHEA 3OROA 4TRLA 5CWZA 4ANQA 4BHNA 4D2RA 3W32A 4EOKA 3QCYA 3C5UA 4G16A 5HI2A 3VUGA 3W33A 1H28A 4YR8A 1QL6A 4AA0A 2R3OA 3R2BA 3ORZA 4JL9A 4C3FA 2VTLA 4BF2A 4ZTQA 4JG8A 1NW1A 1Y91A 1VLRA 3FHIA 1B39A 1WBNA 4Y8DA 3HRCA 4YHTA 3F3ZA 4BRXA 4EWQA 1JAMA 2GNFA 2YCFA 5L2TA 2FA2A 4XRLA 3LQ3A 2UZBA 4FTNA 3OCTA 3MN3A 1LR4A 4FT3A 3ZHPC 1YVJA 4EC8A 4UN0C 1X8BA 4JDIA 3Q53A 4XNEA 1Q97A 2VWWA 3Q2JA 3E87A 3H9RA 3KMWA 3EQPA 4JX3A 4WD5A 3ZONA 4TL0A 3NUNA 4FKJA 4TTHB 3MYGA 3M1SA 4RX9A 5BX0A 3LJ2A 5I4NA 2OW3A 2W4JA 5HBEA 4YP8A 2ERKA 4D5KA 4EUUA 3F69A 4I6HA 4MVFA 5BQ0A 2XKCA 4FV5A 3RHXA 5ANEA 4K77A 3NNUA 3Q9WA 2JKKA 4G3EA 4RZWA 4AT3A 2QODA 4NFMA 4AZEA 3KXHA 4YLLA 2OSCA 3D2IA 1GIHA 3ATTA 4MH7A 3IW8A 4V05A 2A98A 3UE4A 4FKPA 4M14A 2VX3A 4LM5A 1IAHA 2QONA 4YUQA 3F3TA 5CI6A 3VJOA 3UIXA 4YZNA 3UOKA 3QUDA 4AUAA 2GQSA 4JAIA 2B9FA 4BY9E 2Y8OA 3DZQA 3MVMA 4YJRA 3UOHA 3QYWA 1JOWB 3GCVA 5HIDA 3QRJA 3UQCA 2JFMA 3FKOA 3PJ2A 2G1TA 5CZIA 2ZDTA 1IR3A 5EM6A 2YIWA 2RFDA 4I23A 3SLSA 4II5A 2JIUA 2UW6A 3DPKA 4O0WA 4BCGA 2OU7A 4O83A 4FOBA 3NIZA 4IIRA 3ET7A 4JR7A 4B9DA 3QTXA 3KC3A 5D7VA 4NFNA 4FTRA 3CQWA 1YI3A 4P2KA 3PRIA 4RVTA 3R7GA 2R64A 4JAJA 5EW8A 3DNEA 5FUTA 2QR8A 4OTWA 2WTVA 3DGKA 4N6ZA 4XCUA 5CLPA 3RI1A 2QR7A 4G6OA 4JQEA 5ANJA 1G3NA 4I1ZA 5LMBA 3EN6A 2RSVA 3LCKA 3NW7A 4DGMA 3QRUA 2I7QA 3E5AA 3T3VA 4CT2A 2IPXA 2QOLA 4YLKA 5DWRA 3UVQA 4EH5A 4PDPA 3D15A 3IKAA 3EN7A 2IF8A 2OXDA 3R22A 2OJJA 3R8VA 4DA5A 5CAVA 3CBLA 3O96A 1VZOA 2JDOA 4H3QA 2EXMA 4OTHA 4LG4A 2C6DA 3WZJA 2IZRA 5JZJA 5DRBA 5E1SA 4QTBA 1WVWA 5CSPA 3FZSA 3PVGA 4M68A 2J6MA 3K54A 5HE0A 2QOIA 4I4EA 2XP2A 4A07A 3DAKA 3R1SA 3AD6A 1Q4LA 3BGPA 4FK3A 5CF5A 3N4TA 4R5SA 4OLIA 3DKGA 2AUHA 3ZUVA 3LFDA 1O9UA 3P79A 4YC8A 1SNUA 1UU9A 2PE1A 5CYIA 3U9NA 5EDQA 4EOIA 2X1NA 1FMOE 5JFSA 2C0TA 3II5A 5GZAA 4LV5A 3HV7A 5DEWA 2XIKA 3RPRA 3O5AA 2WNTA 3OTVA 4UYAA 4OT6A 3MVJA 4D28A 5H2UA 4D2WA 4DGNA 4EK8A 2QD9A 3L8VA 2UZLA 4PDSA 5J9YA 1WBOA 3TZMA 2UVXA 4G2FA 4TXCA 4YPDA 4B0GA 4ZXTA 2X9FA 3L8SA 4FG7A 3PXYA 2ITOA 4FI1A 4LMUA 3AT3A 3PE2A 4FSWA 4UB7A 5E8UA 4PP7A 4HCUA 5FTGA 1G8SA 4FZFB 3SAYA 1V0PA 3VS5A 3VIDA 5I3OA 4HVSA 1E9HA 5EK7A 3AD5A 5DGZA 5J5SA 2ACXA 4F09A 3PJCA 4HYSA 3D2KA 5BVNA 2CCHA 1NVRA 2V55A 3FY2A 4LRMA 3MVLA 3PXRA 1JKSA 3GCQA 4X6RA 4BI0A 3IGGA 3SXRA 3UVRA 4HYUA 2PWLA 3E63A 5HO7A 4O7ZA 3CQEA 4LRJA 4ZMFA 2BZHB 2QNJA 3PA4A 4MX9A 2WOTA 2O3PA 3P7BA 3NR9A 3O8PA 1IEPA 2B9JA 4ITHA 3MW1A 4V0GB 4X3FC 4NL0A 3F61A 4GVAA 2JD5A 4PMSA 2BAJA 4DBNA 4P90A 5CVHA 4J8MA 2E9PA 1APME 1OL2A 4QP1A 2R3LA 2VTSA 2C6IA 3BI6A 3FSKA 4PP9A 4AGDA 3VRYA 5E8ZA 2QCSA 3PRFA 4ANSA 4PDYA 4HVHA 2HWPA 4TYIA 2CDZA 3IS5A 2VO3A 4MXZA 3RINA 3CEKA 3ZO4A 1MQ4A 4C4GA 3SGCA 5IQEA 4UX9A 1PJKA 3MH2A 3PPZA 4G5JA 4O1PA 3MY1A 5LVMA 1BUHA 3PWDA 3VBWA 1U54A 3BHHA 1W7HA 1YHVA 3E64A 3TDWA 3OTUA 4IVAA 4QMWA 1JVPP 1Q5KA 2F4JA 4FA2A 4WBOA 4RSSA 3L9MA 4IBMA 3MPTA 3UMXA 4D1SA 2PYWA 4IJPA 1LPUA 4G1WA 4APPA 1UV5A 4DGOA 2FSOX 5K3YA 3GCSA 5G6VA 1G8AA 3O2MA 3W16A 3A7HA 2VTOA 4CMTA 2DQ7X 3CD3A 2R3GA 2C6TA 4GIHA 5EOLA 4WIHA 4R7IA 3SXSA 4CFNA 5C9CA 5IA4A 1DAYA 4I24A 3N4VA 5CXHA 5CAOA 2F57A 3R8PA 3NX8A 3UIMA 5IA0A 4L6QA 4PWNA 3SDJA 4IXPA 3FMMA 3QKKA 1REJA 4LOOA 1FINA 1YDRE 2ITWA 4BDAA 4O4EA 3FC2A 4E7WA 4CV8A 3HMIA 3UNKA 4PTCA 4RIXB 3FI4A 3NLBA 4G3DA 2J0JA 4QTCA 2V7AA 5L2SA 3QRKA 5BVKA 2PMNX 4QP2A 3PP1A 3R28A 5ETAA 2OZAB 5FDPA 4NZWB 3K3JA 5E1EA 4C0TA 3KIOC 3WF5A 3AOXA 4YTFA 3R02A 3VUHA 4AZWA 4DLIA 2CNVA 3G51A 2YIXA 4BB4A 3Q4UA 3OMVA 5EKOA 4NW5A 3QALE 5EQYA 3DZOA 3KULA 4I94A 2PUUA 3KKVA 4IAFA 4AA5A 2YIYA 3FL5A 2JDSA 5LMKC 3FAAA 2RKUA 1H0VA 4EZ3A 4HCVA 4U0IA 2I6LA 3NYOA 3PWYA 4KAOA 5TKDA 4EHZA 1ZZ2A 2J50A 4JJRA 4JI9A 4ZJIA 4EQMA 1YHWA 5AAEA 3DBCA 5KO1A 2C1AA 2WGJA 2WTWA 4U9AA 3DAEA 1LUFA 2WEIA 3RZFA 3I5ZA 4QNYA 4R3PA 4BCHA 2RFEA 2Y6MA 2FSTX 1PHKA 2E9UA 4NKAA 4DE4A 4YSJA 4UMRA 5JK3A 3CTHA 3LM5A 2VTIA 4O2ZA 5AUZA 1OUYA 3BLQA 1IG1A 3EFWA 3W0NA 4QP7A 4AN9A 3MH1A 3BIZA 4IX5A 4IANA 4GSBA 3O71A 3MFTA 2PVRA 3OT8A 4XP0A 3RNYA 4F9AA 3SX9A 4F0IA 4QQTA 1OBDA 2YM6A 4AP7A 3JVRA 2A2AA 4EI4A 1GIJA 3E93A 5HG8A 4F64A 3A60A 4FT9A 1CKPA 5LVPA 4K33A 4PX6A 2R3IA 4KBKA 4E6QA 5A4LA 5CANA 2XUUA 1UU3A 2R3KA 4H1JA 5HG7A 5JH6A 5IQCA 4XEYA 4IM2A 4MUQA 4FGBA 4ANNA 4F65A 4GV1A 3P5KA 1K3AA 3R1NA 2YABA 2WFYA 1PY5A 5M55A 4U40A 1DAWA 3DLZA 2E9OA 3POZA 1GY3A 2PL0A 3DA6A 4X2FA 5AV3A 3RZBA 4BDBA 4E5BA 4BTMA 4DFUA 3LFSA 3O8TA 2BRNA 3T9IA 3VUKA 1TFFA 5JSMA 5BVDA 2BRHA 2WTCA 2OICA 5IH5A 3CC6A 4YNOA 3HRBA 2OFVA 3EJ1A 4AA4A 4E5AX 5FXRA 2GNLA 4IADA 5A6NA 5KKRC 4S32A 2GPHA 3IECA 3WZUA 2AC5A 3H9OA 4RC2A 3W0RA 3PZEA 2UVYA 3EL7A 4JR3A 4WG5A 2PVJA 2G15A 3NSZA 4EH8A 3KK8A 1H25A 4RPVA 2XB7A 1NY3A 5F20A 3VF8A 4GU6A 2OF2A 3OVVA 5AR7A 4CMUA 3FL4A 5AR2A 4YJQA 4M12A 4C4EA 4EEVA 4FEXA 3G9LX 1VR2A 3H3CA 3ZBFA 4GJ2A 4RX7A 3MH3A 2QLUA 2IZSA 4O4CA 5DHJA 2PULA 4G6NA 4MBLA 3ORNA 3DV3A 3U6JA 5EI8A 3P7CA 1SM2A 4IW0A 2ETRA 3JXWA 4PTGA 5AV1A 3V5JA 4ALWA 1K9AA 4YJOA 3BKBA 4ACCA 4F7JA 2UW5A 1SYKA 4PDOA 4YMJA 4YPSA 4AZFA 4CQGA 1ZYLA 2ITUA 3QA0A 5LVLA 3BLAA 4FEUA 3WF6A 2VWIA 3MB6A 2OXYA 1RJBA 5CX9A 2PUNA 1FGIA 4GUBA 4L42A 4W9WA 4E4MA 2P3GX 4I41A 4WBBB 4AF3A 1IAJA 2WKMA 5M07A 3WYYA 4QOXA 5CU3A 4ANBA 1PW2A 3BEAA 2BTRA 3VBQA 5CI7A 2GHMA 3DAJA 3D5VA 2WTJA 1F3MC 4IZ7A 1GOLA 4V04A 1BI8A 4IVCA 5FGKA 3A7GA 3TN8A 3IQ7A 3HL7A 5HU9A 4D2PA 2JFLA 4GJ3A 2WQEA 2IO6A 4XG7A 1ZYJA 1J7UA 4RJ6A 5F94A 1FVTA 3EMGA 1H1WA 2BROA 3KFAA 2QKWB 3NUYA 3OC1A 5CSXA 5LJJA 5C03A 3GGFA 5ANOA 2BPMA 5L6OA 3C4FA 3OBGA 3OEFX