2ERKA

Phosphorylated map kinase erk2
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
353
structure length
351
Chain Sequence
AAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLEVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Activation mechanism of the MAP kinase ERK2 by dual phosphorylation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Phosphotransferase
molecule keywords EXTRACELLULAR SIGNAL-REGULATED KINASE 2
total genus 112
structure length 351
sequence length 353
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 1997-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2erkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2erkA01
5DEYA 4C35A 3LPBA 3TV7A 2R4BA 4I23A 3DNEA 4M97A 5LCKA 4AE9A 5FD2A 5HU3A 3QX4A 5KMIA 4FC0A 4EOSA 3V04A 4JAIA 3Q2JA 3ZLWA 4RVKA 4BCKA 4D58A 1H1WA 4ONAA 5AADA 5BYLA 1F3MC 1IAJA 3V6SA 2WTKB 3NIEA 5HE0A 3TNHA 3EN7A 4TYEA 5IA5A 4DGNA 4O96A 4YZ9A 5JT2A 2IZRA 3IOPA 5IQBA 4MWIA 1PMUA 5E91A 3OXTA 2BDWA 3PY0A 1UU9A 5IDNA 5DVRA 3VBXA 3LMHA 4PTGA 4G3FA 4TL0A 3KB7A 3KXMA 3PPKA 2QO2A 2PVLA 1JOWB 3GCUA 4IANA 4BIBA 4RIWA 5AJQA 4QMTA 5L2IA 3PDTA 1URWA 4JVGA 3BZ3A 2BIYA 4KS8A 4HPTE 4UYNA 1SYKA 3GP0A 4QMOA 1J7IA 3S00A 5DWRA 5CF5A 3I7CA 3IQ7A 3VUHA 3QKLA 4AW2A 1OPKA 2BZJA 3BPRA 5IUGA 3LFEA 3LQ8A 4D4VA 3FLSA 4J52A 1R1WA 5FTQA 2YIYA 1TQPA 3KRWA 2C68A 5HI2A 3WIGA 2IW8A 2W9ZB 4EUUA 2WMUA 4IEBA 5E1EA 2BRHA 5HG5A 2BFXA 4H1JA 2OZAB 5D7AA 2QOIA 4OUCA 3QRKA 3UO5A 5IQDA 3F69A 1A06A 5C8NA 3HV7A 4IADA 5HTBA 5JMSA 1DM2A 2C6TA 2J7TA 1P2AA 2IVTA 3DFCB 4TRLA 5AV1A 4AT3A 4BWXA 3RWQA 5FDXA 2CKEA 3FZPA 3KEXA 4NIFB 2B9FA 2JGZA 4DFZE 2Z60A 1J3HA 2VX1A 3FMJA 3R22A 2OJGA 3PWDA 5JQ5A 4NUSA 3VUDA 4G16A 1JKSA 4L6QA 4BCMA 2Y8OA 3R63A 3R9DA 5F94A 4BIDA 4F7NA 2QG7A 4FKIA 2JIIA 4ERWA 4FVPA 4GG7A 2XK9A 1SNUA 1M2QA 1WZYA 4MNFA 2ZVAA 5E9EA 3DAJA 4QMMA 4ZTRA 4HVGA 3VUGA 1I44A 5JGAA 3IONA 3LE6A 2GNFA 3NWWA 4W4WA 3EQPA 4FNXA 4BHZA 3FSFA 4FIGA 4YP8A 1DI9A 4PL4A 4F6SA 4GJ3A 3PE2A 5AEPA 5AUUA 4IVBA 5AR5A 4O81A 3TXOA 1XQZA 5HTCA 3KY2A 4IWOA 1ZYDA 1B6CB 4FL2A 3TV6A 2JAMA 1M2RA 2IPXA 3G15A 1DAWA 4E26A 4KD1A 2C5OA 4BDDA 4I20A 4MK0A 4BCPA 2QOQA 4EHZA 4J7BA 3WILA 2WO6A 3N4TA 2QG5A 1RQQA 5HOAA 5BMSA 3UZPA 3ETAA 4IB0A 3OC1A 2WD1A 3OBJA 3EH9A 1FINA 4R5YA 1H0VA 1VYZA 1W83A 3I6UA 5HLNA 5IQEA 4BDCA 2R3RA 1R3CA 3D5UA 4BIEA 4C61A 4F1TA 3GC0A 5DA3A 3MH1A 4QP8A 4BBEA 3WE8A 4FVQA 4IZYA 2W9FB 4KBAA 3MA6A 3ORKA 4ALVA 4O84A 3BEAA 5EW9A 3UMXA 3F66A 5EDQA 3FKNA 4M13A 5CQUA 1ND4A 2GS7A 3R1QA 4C58A 2ITTA 4EK3A 1O9UA 2B9JA 3KVXA 2WFYA 4FTJA 2JLDA 3JS2A 3FY0A 4BGGA 3ERKA 3JUHA 2YM6A 4FODA 2VO7A 4UBAA 4XV1A 3DB6A 3VQHA 3GU4A 4YZNA 1UNHA 2ZB1A 2RSVA 3ANQA 3PRFA 3PRIA 4IFGA 4JAJA 5DPVA 3RNIA 3TACA 3VWAA 2BDFA 4FKPA 3SXSA 3UIMA 4CFUA 3GI3A 4YU2A 4IB1A 4D1XA 5A46A 4O0WA 1Q62A 2YZAA 3VQUA 4ZTMA 4DEAA 3BE9A 3UIUA 5BUJA 4B0GA 4OTRA 5DN3A 2CJMA 3E88A 2UZNA 2J0MB 3FYJX 4MBIA 3BRBA 4BBMA 4K1BA 1YDRE 3BLHA 3EQHA 1LEZA 2BAJA 3FHRA 4GSBA 4M68A 2XJ1A 3CR0A 5J5TA 4ACCA 1H4LA 1GZNA 3OFMA 2C3LA 1JVPP 2OH4A 3DLZA 2KTYA 1H01A 5M55A 4QYEA 3NUPA 2CCHA 2HWPA 5C1QB 4ZXTA 4X7QA 3W2QA 3ZBFA 4NTTA 2W1GA 4K2RA 5IKWA 3CY3A 2CLQA 5E7RA 1M2PA 2PVFA 2R3FA 2JAVA 3OWPA 3AT2A 3DK6A 3EQFA 4OTDA 4X2KA 4O2PA 3ZXTA 1P14A 4W4XA 5L6PA 1JKLA 3R8MA 4EH7A 4ZZMA 4UB7A 4BRXA 2RGPA 4J8MA 4CQEA 2QODA 2OXDA 1PXNA 4XV2A 4ZEGA 3VF9A 4E73A 1CTPE 1TQIA 5BVNA 4IQ6A 4CG9A 3HX4A 3FJQE 2W0JA 3SC1A 3FXWA 2RL5A 4EC8A 4ENYA 4W8EA 4QQTA 1OKVA 3C4WA 4PY1A 4O0YA 4FKOA 4PDPA 3MY1A 3C4FA 3MIAA 2QOBA 4CFWA 5L2QA 2VN9A 2V62A 5FXSA 4GT3A 5AX3A 3WZEA 4QP1A 5L6WL 5BPYA 4MF0A 4R7BA 3A4PA 3DJ6A 4YZMA 2WMWA 3LM0A 4KKHA 3R7IA 1ZYLA 4G31A 4UZHA 3S0OA 4O7RA 2ZV2A 2XKFA 3P7AA 2W1HA 5GJDA 3T8OA 5CEOA 5KBRA 4KNBA 3MDYA 3FY2A 3IS5A 1WBPA 4PMSA 4J71A 3V5QA 5J7BA 4BKJA 5E4HA 3QFVA 4U7ZA 1MUOA 3F3WA 3RNYA 5F1ZA 3NX8A 1XBCA 5EYMA 5TT7A 2HELA 3N51A 4S30A 3UNJA 3NNWA 3OXZA 2QOOA 3A2CA 3QTQA 4FG9A 3RINA 4FKQA 2GQSA 4AWIA 3U54A 1PXJA 3H3CA 1O6LA 5TR6A 5IQCA 4JDIA 2I0YA 2C3IB 3EQCA 3EIDA 5IG1A 2WQBA 3TWJA 4U45A 4XP3A 5EDRA 5DNRA 3FMDA 1G8AA 3FZTA 5FTOA 5KUPA 4H3QA 2X4FA 1B38A 3QA0A 4XBUA 4UMRA 2GHGA 4J53A 4O7VA 4IJPA 3NVKI 5F4NA 3V8WA 3EQDA 3MSSA 4DGOA 4BTFA 4I0RA 4L43A 2X1NA 4RWKA 1GIIA 3AMYA 3E7VA 5C26A 1A48A 3UE4A 3QUPA 4L3PA 4GVAA 4EONA 3P86A 2HXQA 4GV1A 3R83A 1JBPE 4XG8A 4GW8A 5D9HA 5IA1A 3Q9XA 5AM6A 4DBXA 2H8HA 5DRDA 4DH8A 4PPCA 1OL7A 5HG7A 4EJ7A 5A4LA 2IWIA 3BU3A 2XKDA 3DKCA 1BLXA 4X2JA 3MVHA 3VVHA 1OMWA 1X8BA 4ALWA 3T3VA 3BHUA 2UZVA 3F5UA 3FYKX 4D4YA 3F7WA 1U5QA 2ESMA 1APME 5CSPA 4HYIA 4M7IA 4YBJA 1TQMA 3TDVA 5K0KA 2FUMA 4AE6A 3KN6A 4BTJA 2WMTA 5C01A 5HZNA 3ENHA 4BZDA 2ZM3A 1OL5A 1XR1A 1YWRA 2C5YA 2W17A 4OTPA 4PPAA 4XV9A 2AYPA 5CAVA 4MF1A 3P78A 2JDSA 4E4NA 1WBWA 4UMPA 4ACHA 3BHVA 3IW6A 3SVVA 1S9JA 4NM5A 3OS3A 4RIXB 3WF5A 2BAQA 3CSVA 1LPUA 4QT1A 5ETCA 2RIOA 2PK9A 3Q4ZA 4L46A 1Q4LA 2X2KA 2YDKA 2YM7A 2ZMCA 1MRVA 3DU8A 3KMWA 3VW6A 5ANOA 2F2UA 3ID6C 3BI6A 3L8XA 4BDFA 3R8PA 4YSMA 3H0YA 3FPQA 3MGYA 4ZK5A 4EBWA 2EB2A 4R77A 5M4FA 5AR8A 4FK6A 5IEXA 2OJJA 3U87A 4FIHA 4EL9A 3EJ1A 3A7HA 2IW9A 3DT1A 4ASDA 4C2WA 1J7LA 2B9HA 4IC7A 4UMTA 4RZWA 3ZSGA 4GH2A 5JSMA 3HV5A 3OBGA 4YO6A 2YN8A 4XP2A 3CQUA 3QHRA 3Q32A 5GJGA 2XNBA 4FOBA 2Z7QA 4E4MA 2X39A 3NAXA 4GFGA 4MBJA 3PUPA 4TYGA 4W9XA 3HNGA 4C02A 4EWQA 4M12A 2RF9A 3PJ8A 4RQKA 3DGKA 1KV1A 5EH0A 1BUHA 1YOLA 4RVMA 3W8QA 4EYJA 5KKRC 5CASA 1YXUA 3QZHA 4M69A 5KMOA 4OGRA 4KS7A 5DT0A 3V8TA 1WBSA 1PMEA 1REKA 1VJYA 3NCGA 4FG8A 4YC6A 3FUPA 5CSWA 3T3UA 4HYHA 4OT5A 3S3IA 1F0QA 5AAGA 2B0QA 2XIKA 4AOJA 1H00A 4TPTA 2OG8A 4AZVA 3PXFA 5CXHA 4JI9A 3U8WA 2C6OA 4Y95A 2XVDA 4EH5A 1XH7A 5JFXA 4Y8DA 1BX6A 2X9EA 3L8SA 4JG8A 4EH4A 2H34A 2ZDTA 4MTAA 1CKIA 1SVHA 3TDWA 3NUYA 4C4GA 3UNZA 1JAMA 3RMFA 5CSHA 3Q3BA 1ZYJA 2PMOX 3VS7A 2XRWA 4BGHA 4D55A 2JKMA 3KK8A 3PVBA 4AP7A 4CNHA 2QOLA 4CV9A 3DQWA 5L3AA 4PDYA 2PE2A 2CKQA 3C9WA 3OHTA 3D94A 2JD5A 4ANNA 2UVXA 3TIZA 3NNUA 1R0EA 4PUZA 4JJRA 4UN0C 5KZ0A 4OAVB 3LCOA 4FV1A 4USEA 4LL0A 1VEBA 1KV2A 4YNEA 4EHVA 4F4PA 5IUHA 2ETRA 3QQJA 5HE3A 1R0PA 5CI6A 4QOXA 4WOVA 4APCA 5J79A 3HP2A 4AGWA 1GZ8A 4FKGA 3DLSA 3JYAA 2IZSA 4EQUA 4IX5A 4WRGA 1IR3A 3O23A 5AP5A 2XK3A 2C6MA 3TJDA 5IQFA 4C3RA 4QMLA 4AF3A 5AAEA 4PMMA 3KMMA 3UC3A 4BFMA 4YPSA 2NRYA 3DV3A 3ROYA 2QI8A 4RX7A 1H27A 3PJ3A 2C69A 5IH5A 5LVLA 4PTCA 3QRJA 2G15A 3RM7A 2YCQA 4D2WA 5M4CA 2NPQA 4GCJA 4IMYA 3QU0A 3W32A 3DFAA 4XHKB 3EQGA 3NW6A 5AP1A 3SW4A 3ZLYA 4EBVA 2QO7A 5KX8A 4R7IA 1CM8A 3NZ0A 4ZMEA 4FE2A 4XH6A 4H3BA 3W2SA 1MP8A 5EOLA 5H3QA 5I9UA 4KIQA 3FI2A 3RPVA 4RLLA 4EHEA 5CTPA 4R1VA 4MXOA 4XG9A 4G3CA 3UOJA 2VRXA 5AUYA 1Q99A 4G3DA 5CNNA 3G0EA 2W1EA 3KU2A 4ZTQA 4F08A 4EYMA 5I9XA 3UQCA 3PJ1A 5CEKA 2PUPA 3LLTA 3DY7A 4PL5A 2VTTA 3CQWA 2XF0A 2IVVA 4O0SA 5KMJA 3CPCA 4FUYA 4C59A 3UG1A 4FF8A 2GTNA 4FV8A 1Q5KA 3K3JA 4GU9A 4ZAUA 3AC5A 3O51A 3ZONA 1ATPE 1STCE 3FMKA 4LI5A 5IA4A 4RRVA 1E9HA 2CGUA 4TT7A 5LWMA 3ZUUA 5JQ8A 4DEHA 4AZWA 5K3YA 4BDIA 3KCFA 3Q6UA 3ZH8A 1SVGA 2XUUA 2ITUA 4IW0A 4U6RA 4F9YA 4PPBA 3GU6A 3HMPA 4X21A 2WIHA 3NGAA 4GYIA 5D10A 2XEYA 2H9VA 3KXHA 1YI3A 3UP2A 2R3OA 2W05A 1OVEA 2W4OA 4RC3A 3VIDA 2W99B 4OTGA 2JBPA 2ITZA 3E5AA 4AA5A 2R3HA 2QURA 5KMMA 4ORKA 1H8FA 4YHFA 5E90A 5LCJA 4EORA 2BRNA 1OECA 3QALE 2WNTA 1P4OA 4YC8A 3VBYA 3ATTA 3M11A 2GS2A 4C4FA 2UW3A 3VHKA 3FEGA 2VWXA 5CSXA 3TKUA 2YWPA 4ASEA 2ZB0A 4J96A 1UKIA 4BBFA 4FSZA 3FHIA 4N6YA 2XEZA 2BHEA 3NCZA 3MWUA 3D5WA 4CYIA 4L8MA 4YLKA 2C5VA 4M0ZA 4DG2E 1GIJA 3FV8A 5AMNA 4BF2A 4DH3A 3HAMA 3KXGA 3K54A 3RAIA 4PNKA 5LQFA 4S2ZA 5DG5A 4FNYA 4PP7A 2FSMX 3SDJA 1UKHA 5M06A 4RSSA 1YWNA 2X7OA 1SM2A 4CSVA 3H9FA 3WF8A 2J0JA 3AC2A 4FSYA 4AOIA 4R8QA 1AQ1A 1OKZA 2NP8A 3BQRA 3F3UA 3NW5A 5E8SA 2B7AA 2BRGA 4YLLA 3Q4UA 5AA8A 1H07A 4CZYB 3RAKA 4D1SA 1PMNA 5HE1A 4MXZA 4KUJA 4L67A 2Z7RA 3NNXA 4O0VA 4A9UA 2X0GA 4HOKA 3R8UA 4L42A 4ZSAA 3FI4A 5JFWA 2VWUA 2PL0A 3FMNA 2VTQA 1ZWSA 5CWZA 4BYJA 2ONLC 5FDPA 1Q8ZA 1ZLTA 3F3VA 4CKIA 4TZRA 3ORLA 2XA4A 2PVKA 3FWQA 4KRDA 4OR5A 5HNBA 3MVLA 4BWPA 3LJ1A 3B2WA 2W96B 4U0IA 3DBQA 3RK7A 4ERKA 3L9PA 3R8VA 5M4UA 4ZY6A 4ZLYA 1IAHA 2X2LA 5C4LA 5EYKA 4I1ZA 5L8JA 4CVAA 3Q96A 4ZP5A 3QD4A 2C4GA 3ZDUA 1YXXA 4AFEA 4YUQA 2YISA 3M2WA 5CT7A 4TYIA 3GT8A 3QUEA 2HY81 3COIA 1ZXEA 4QRCA 5FQDC 1O6KA 2BAKA 4MYGA 1R39A 4UMUA 2RFDA 3AMBA 2YM5A 4NFNA 4TYHB 5AIRA 5F95A 2UZUE 3UJGA 2VZ6A 3QC9A 5J1VA 2GFCA 3BIZA 1Y6AA 2V5QA 3O8PA 4L3JA 3ZTXA 4ZJJA 5LMAA 4DH7A 3DNDA 3C4XA 5JFSA 2P0CA 2W4KA 3CBLA 5HHWA 3U4WA 4HW7A 4R3PA 3MPTA 5HVKA 2WPAA 3D2KA 4AA4A 3C51A 3BYSA 3MY0A 4MD9E 5AFVA 2QNJA 2XK4A 4FUXA 1YRPA 4RJ5A 4CT2A 4DTAA 4U44A 4UXLA 3E87A 4IB5A 5A4QA 1H0WA 3TTJA 1OPLA 4FT7A 4L9IA 4A7CA 3FBVA 3QKMA 4JL9A 4D4RA 5DMZA 4O1PA 5G6VA 4L7FA 4HCTA 2PUIA 2OI4X 1XHAA 4CRLA 1ZAOA 4RIWB 2VAGA 5DFPA 1YHVA 4KWPA 2JKQA 1ZRZA 3OXIA 1WBTA 2B52A 2O3PA 3B8QA 3CCNA 3FKLA 3HVCA 3U51A 4A4OA 4ALUA 4BI2A 4NTSA 5IZFA 5A3XA 5IMEA 3ORTA 1U54B 3D7TA 4P5ZA 5AV4A 3A7IA 3LFQA 3O17A 4P2KA 2BKKA 4O27B 2QKRA 1K3AA 2XK8A 2YHVA 2YCSA 2EXMA 4YTHA 4X3JA 3GQIA 4ZSLA 3E63A 2PVHA 4H05A 5EKNA 5CAUA 4TNDA 4C37A 4KBCA 3MTLA 4K0YA 4BI1A 4GIHA 4GL9A 5LVPA 1I09A 2YIXA 2VTRA 3GBZA 4H3PA 2OWBA 4FSQA 3A8XA 3EYHA 3GNIB 4G2FA 1J7UA 5EQYA 1M52A 3GOKA 1NVQA 2W1FA 3C0HA 3EFKA 4H39A 2HXLA 3KXZA 2UZTA 1BYGA 3IKAA 3VBTA 3QQHA 5DR2A 2QU6A 2W1IA 3QD2B 3CTQA 3B2TA 4HPUE 4LQMA 3E8NA 3O2MA 3OW3A 4O21A 2HK5A 4L53A 3U6HA 3VBWA 4O6LA 4FV9A 3WBLA 3QXPA 4DFLA 3HYHA 1F5QA 1YOMA 4U3ZA 5LWNA 4YZCA 3HRCA 5J95A 4OAUC 4QPAA 2VTSA 3UOHA 2RKUA 2P2IA 2LGCA 2X8IA 4JT3A 3EOCA 1JSUA 3TI1A 3HEGA 4JBVA 3ACKA 2C0TA 4C7TA 4O0RA 3LCTA 3QYZA 2QOFA 3EN6A 4ZTNA 5FP6A 2P33A 4PX6A 1XH4A 3GVUA 3NW7A 5HLPA 2O0UA 2UW5A 2W5HA 2C3KA 2P3GX 4C57A 2C1AA 4HVDA 4CRSA 4YTCA 2AC3A 1OM1A 3HMNA 4DFUA 3LXNA 3PZEA 2JDRA 3C4EA 4V0GA 5LVOA 3BYUA 2XP2A 2XCKA 1S9IA 2WB8A 2A1AB 3N9XA 4L68A 1QCFA 2UZOA 4BB4A 4F99A 2I7QA 3LHJA 3GOPA 2CN8A 5H9BA 4Q9SA 3WYYA 4IZAA 1Y91A 5D7VA 5M08A 4RVLA 5TF9A 4I6FA 3R28A 4DN5A 3BBWA 4I6HA 3VF8A 4YZBA 2A27A 5ANGA 1JNKA 4CEGA 1U46A 3A8WA 2J0KA 1M7NA 4NL0A 1FPUA 2DS1A 3BLRA 5AIKA 4E6AA 4ARKA 3E8DA 4YZDA 4DINA 4QP6A 4RFYA 3LFAA 4Y85A 2HOGA 2F7EE 4G9RA 3WOWA 2VWZA 3WZJA 4BDHA 2WMQA 3QGWA 2JEDA 5DGZA 2E9VA 4R1YA 3ZO1A 2R9SA 5EHOA 4A9RA 5JH6A 4UEUA 3SV0A 2WAJA 4LGHA 2YM8A 4MKCA 2B53A 5L2WA 3LFSA 4O7YA 4D1ZA 3W2RA 4V0GB 5E8ZA 3MH2A 5I5ZA 4QTCA 1LP4A 4U8ZA 3GXLA 2OICA 4F09A 3MJ1A 1KE5A 4EZ5A 3NPCA 3EZVA 1H24A 1NW1A 4EOJA 4QTEA 3CGFA 3SGCA 3ZU7A 4IDTA 4RGJA 5LXMA 3LFFA 3IDCA 3W16A 4D9UA 2X2MA 3BLQA 3RI1A 3OWLA 4FZFB 3DBFA 5FEEA 4UWYA 3DJ5A 4LV8A 3NYVA 3QRUA 5BYZA 5J9LA 3P7CA 4MXCA 4RA4A 3REPA 5C8KA 1Q3WA 5AAFA 3E93A 2UW0A 4FGBA 4Y73A 4C4EA 2B1PA 4GYGA 1V0PA 3F2RA 3RPRA 3GC7A 3MI9A 3U9NA 1HOWA 1E1VA 2R7BA 3DBDA 4KABA 5FM3A 2UW4A 2WQEA 3A7JA 5I9VA 3H4JA 2FVDA 3MN3A 4TYHA 3DK7A 3ET7A 1XH9A 5JRQA 4TKSA 4XRLA 4M84A 4DT9A 3POOA 4BY9E 5GJFA 2CKOA 3Q52A 2UZBA 4N70A 3VUIA 1IG1A 3NUXA 5AX9A 3C7QA 1QL6A 2REIA 4AN3A 5ETFA 5FWKK 3ULZA 2EXCX 2FH9A 2C6EA 2BUJA 1ZYCA 2VUWA 3R7OA 3P08A 4EOQA 1BI8A 2QVSE 2XKCA 3G9LX 3DTWA 4RX9A 3CKWA 4JG6A 5D1JA 4FEWA 5EOBA 4JDKA 2JDOA 2J50A 4HZRA 2VGOA 2WTKC 3KMUA 4O86A 1GY3A 4GG5A 3O50A 5GZ8A 1JLUE 4LRKA 1OGUA 2EUFB 3ZM4A 1FQ1B 4FOCA 4QMVA 2VWWA 3HECA 4FTNA 3QAME 2VNWA 3DPKA 4GU6A 4PV0A 3FPMA 3Q53A 3KN5A 4HJOA 4NEUA 2W06A 5GINE 2IJMA 2UVYA 4CZTA 4AFJA 4LM5A 4QP3A 4F9CA 4DFYA 4RT7A 5HVYA 3R01A 4FTAA 5H2UA 4MQ2A 4XEYA 4NU1A 4HYUA 2VO0A 2BZHB 3R00A 3V01A 3F61A 1ZOGA 4TNBA 3C0GA 2CNVA 4YJRA 1T45A 1XWSA 2BTSA 2ZV9A 1OB3A 4FSWA 3ZO2A 4AGDA 3TT0A 4AGUA 4JRNA 3PIYA 4AW5A 2CCIA 4G34A 5IA0A 3OP5A 4MQ1A 4DEEA 5DT4A 3ZSHA 4DH1A 2OU7A 4YURA 2HAKA 1H1PA 3BE2A 3GC8A 2ZM4A 4RX8A 1OUKA 2F7XE 3P7BA 3R1NA 3QRIA 3EL7A 5D12A 2RG5A 2PU8A 2PVYA 3COMA 5ETAA 4BKYA 4I93A 5HO7A 4FZ7A 1FMOE 2I1MA 2YITA 3I5NA 4C36A 3W1FA 5IF1A 2YCFA 4EC9A 4K8AA 3P0MA 4F0FA 1BI7A 3PIXA 4G6NA 4BCJA 3A7FA 4YJSA 4GKIA 1JKTA 3P9JA 3BBTB 2JC6A 4YTIA 3QTWA 3Q6WA 4RZVA 4DE4A 3PSBA 3RALA 4UY9A 4BKZA 4ACGA 4QMWA 3DDQA 3PWYA 4EKLA 4GK4A 2EXEA 4KA3A 3I5ZA 3MB6A 1P5EA 2JFMA 5CQWA 4I5CA 5EW3A 5BVKA 3O0GA 5HG9A 1URCA 4TW9A 2ZMDA 5ANKA 3TN8A 2R3NA 4A4XA 3TUCA 3F3TA 4O82A 1V1KA 3FXXA 3NIZA 4CCBA 2YJSA 2GTMA 4JR3A 4K11A 4WBOA 4XOYA 2E9OA 3WIKA 2PVRA 3BCEA 4NW6A 4YSJA 5I9WA 2WQNA 3JVSA 4EJNA 3THBA 1OL1A 2YAAA 4IZ5A 4DAWA 4DGLC 1H08A 3C50A 3R02A 2HZNA 3DXNA 3H10A 4NM7A 3CIKA 4WUAA 2CNUA 4RMZA 4QMNA 1JPAA 2YA9A 5ANIA 3MPAA 4FV7A 4O22A 4HGSA 1JSTA 2B4SB 5HX8A 3A99A 3MV5A 3TL8A 1QPDA 1OPJA 2GNIA 1MQ4A 1SVEA 5EI8A 4EH9A 4IAIA 3KXNA 1KWPA 4YJTA 4MCVA 2O5KA 3F82A 5C9CA 4UV0A 2XKEA 4CYJA 5CEPA 5M51A 4AOTA 2YM4A 2OIQA 3R1SA 3UVRA 2OXXA 3AD6A 4KRCA 3TNPC 4O7TA 3PTGA 3BU5A 1FVRA 5AP0A 4AU8A 2ZAZA 4BDAA 4EK4A 2PUUA 2VGPA 4AX8A 4EQCA 3PPJA 1NXKA 4FZDB 1OBGA 2PVMA 2W4JA 3SKCA 3TKHA 4YC3A 1EH4A 2QU5A 2BMCA 2YIRA 4UWBA 3SLSA 3UOKA 4CMUA 1WAKA 4XYFA 2EU9A 3O8UA 5J5SA 3PA3A 2I40A 3EHAA 4XG3A 3UQGA 4G17A 3I79A 4WG4A 3ZLXA 2BDJA 5TE0A 3WF9A 4WRSA 5HX6A 4GK2A 2YACA 2C30A 3BYOA 4JDHA 1NT2A 4EH3A 4DTBA 2XK6A 5HE2A 5A4EA 4NYEA 3UZRA 2BHHA 1KSWA 4IIRA 2VTHA 4EK6A 4ZS0A 5BUIA 1UVRA 2VTPA 4AA0A 5L6OA 3KGAA 5LOHA 3QCXA 4GS6A 3VS3A 1LR4A 3VW8A 1B39A 3QTXA 1BL7A 4E5WA 1YXVA 4GFOA 3ROCA 1LEWA 2BCJA 2IZTA 4IJ9A 5AWMA 4QQ5A 2H96A 3RPYA 3WZKA 2YFXA 4JQEA 4CFNA 4I4FA 2C6IA 3KL8A 2UW6A 4O2ZA 3P4KA 3LCSA 4FKTA 4CFMA 2QOCA 4JQ7A 2QHNA 3GU7A 4MVFA 3E7OA 4FL1A 2F4JA 1OIQA 4G3EA 4DHFA 4PDOA 3MH0A 3HV3A 4XBRA 3VBVA 4DG0E 4IWPA 2UZWE 4I4EA 4GUEA 3SHEA 4QP4A 2W1DA 3VO3A 3PJ2A 4AN2A 3R30A 3KK9A 4FKJA 3Q4CA 5B2KA 4NKSA 4NJ3A 3UBDA 4CKJA 1PXPA 3QCYA 1PHKA 3EQBA 3NR9A 4O1OA 3SX9A 4RJ4A 3TCPA 2FYSA 5JGDA 5CVHA 5TOZA 4R3CA 1YI6A 4NSTA 2ACXA 3UQFA 1PMVA 4BICA 4FEXA 4FEQA 4P7EA 3OCBA 4JIAA 4JRVA 4F6UA 1WVWA 3NUUA 4DCEA 3HGKA 5CU3A 1Q8WA 3ANRA 3LZBA 4DA5A 1UU3A 4PF4A 4XCUA 2C5NA 4JG7A 3TNWA 3BQCA 4QD6A 3Q60A 2PMNX 3ODYX 4S33A 3LW0A 3GB2A 4FSRA 4ZOGA 5TKDA 3ZEPA 3R7VA 3R0TA 3AQVA 4U97A 4WO5A 2BVAA 3ZUVA 3U6IA 4DC2A 3VS4A 5EQEA 4Q2AA 5F20A 3D9VA 4DGGA 4DLJA 4FV3A 5JZJA 3UGCA 3QX2A 1ZYSA 4XNEA 4YJVA 3CD8A 3S95A 1PKDA 4V04A 5EM6A 3QA8A 3TZ7A 5BX0A 4V05A 3FZRA 4IBMA 1XBBA 3MTFA 4I41A 2GMXA 4F6WA 5M57A 4RC4A 3ENMA 3ZXZA 4U40A 3DJ7A 4FK3A 4EH8A 4GT5A 5BNJA 4EOKA 4YPDA 5HNIX 3OCTA 5L8KA 3HAVA 3OT8A 3P1AA 4HYSA 4QNYA 4L45A 3BHYA 4OTHA 5IA2A 3CS9A 5GZAA 4PRJA 4E4XA 3ORMA 2OJFE 4I3ZA 3Q9ZA 3CTHA 2C3JA 1OUYA 4AZEA 4KKEA 3ALNA 4FTLA 5T6KA 4RX5A 5J1WA 5DI1A 4G5JA 3IOKA 5DBXA 4TXCA 2J5FA 4JBQA 2V22A 3UVPA 1JQHA 4MAOA 5IDPA 4II5A 4XRJA 1WMKA 1ZZLA 4NZWB 4DH5A 2OW3A 4NFMA 1OL6A 2Y4IC 3D0EA 3QTZA 3KVWA 5HICA 5A6NA 1OL2A 2GHMA 2W7XA 2GNJA 1ZY4A 2FSOX 4MXXA 2B54A 4QO9A 5A14A 2E9PA 4FKWA 2OO8X 3DZQA 3G90X 4J1RA 3BV2A 5FTGA 1H1QA 2C1BA 2XNNA 3SAYA 5FBNC 4B4LA 2VTJA 3DDPA 4M69B 1XJDA 5EHYA 2R3LA 1G8SA 3R8LA 5IQGA 2VNYA 4EOLA 2YLEA 5D11A 5JN2A 2QLQA 3DK3A 4ZS4A 3BELA 4F9BA 2OLCA 3TEIA 3PXRA 3SOAA 2YCRA 3W10A 5LMKA 3BV3A 2ITOA 4M66A 5LMBA 2GQRA 2QCSA 4IXPA 3F9NA 3HA6A 3I0QA 2GCDA 4FYNA 3QQKA 4FV4A 3RWPA 4USFA 4FTCA 4BN1A 1AGWA 1BKXA 3A61A 5CT0A 3PE1A 1XH5A 2J2IB 4QMZA 2O8YA 1M14A 4G6OA 1YI4A 4XG4A 3EMGA 3JPVA 3CTJA 5K0XA 3HUBA 2WU6A 2WOUA 3MS9A 3QCSA 4ANBA 1Z9XA 2BPMA 4V01A 4FV2A 3SOCA 1PYEA 5B2MA 4K77A 3C4CA 3N4UA 3EQRA 4ITHA 4UWCA 2Q0BA 4Q5HA 3R1YA 4IVDA 2J0IA 4FT9A 2Z02A 3W2CA 3B8RA 4P4CA 2YDIA 4FX3A 2XMYA 3VJOA 4X3FB 2VTOA 4AZSA 4C4HA 4D2VA 1YDSE 3HZTA 1KE7A 2J90A 5KO1A 1HCLA 3PY1A 4GIIA 4YJNA 2DYLA 5HBJA 3ZHPC 3VULA 4EH2A 3S4QA 5J7HA 3F88A 4ANLA 3O8TA 2G1TA 4BDKA 3TNIA 1BL6A 3CJGA 4NW5A 4RC2A 5EQPA 4U5JA 3AC8A 3ZBXA 3DXPA 5AP3A 4FG7A 3IGOA 2VV9A 2EVAA 3VS6A 2GDOA 3DAKA 2X7FA 2X81A 4I5PA 4XUFA 4YO4A 2XIZA 2J6MA 4APPA 2ZM1A 4ZIMA 5JFVA 1RDQE 2OH0E 5HGIA 3WZUA 2PMLX 4YJUA 3LXKA 3WYXA 4KKGA 3OEZA 2BR1A 3MFUA 3TUBA 4ZMFA 3R6XA 3BU6A 4W9WA 5CEIA 2YZLA 2XM8A 1WVXA 2Y0AA 5H8GA 3AG9A 4CG8A 4KIKA 3F2NA 2XYNA 3F5PA 5B0XA 3P23A 5DRBA 3MVMA 4QYFA 3GU5A 3R9RA 4IM0A 4USDA 2VWIA 3QRTA 1IRKA 3DOGA 4L01A 4AW1A 4X3FA 5DLSA 2W1CA 2CGVA 3DTCA 5HQ0A 3FMHA 4FIIA 5CU4A 3PLAE 2GSFA 4YJQA 3ORXA 3PXQA 5G1XA 5AUTA 4MH7A 3HRBA 4J8NA 1K9AA 2WGJA 3CGOA 2DUVA 4GEOA 1XKKA 2X8DA 3OUKA 5IQAA 3Q2MA 1PXLA 5C27A 5HORA 3LKMA 2PULA 3KULB 2F49A 3EKNA 4QQCA 4IZ7A 2XRUA 2JIUA 2BZKB 4L44A 3QTUA 3DKOA 5HCYA 2ZYBA 1IA8A 3L8PA 4DF3A 3NYNA 2WMSA 3C1XA 4U79A 2J4ZA 4MBLA 4FSTA 3IW4A 5IQHA 4C4IA 2XNMA 4R78A 4GUBA 4G3GA 3L9NA 4OBPA 4ZJVA 1KE9A 3PA5A 2Z8CA 3GGFA 4C33A 4N0SA 3R7YA 3RZFA 4EOIA 5E8XA 3F7ZA 4XX9A 3LAUA 3LFNA 3WI6A 1XH6A 2WTDA 3CEKA 3E62A 4CTBA 4F65A 2XBAA 1OIRA 5DHJA 3VRZA 1NA7A 3POZA 2XYUA 4FKRA 3VRYA 2F2CB 2ONLA 5CYIA 4RBLA 5BMMA 5LJJA 5J9ZA 4IB3A 3KC3A 2WTWA 3MB7A 1PW2A 3QTIA 1JWHA 4CXAA 4OBOA 1PKGA 3FI3A 4L7SA 4YJPA 4UALA 2JDVA 4MD8E 4L3LA 2DWBA 3BEGA 2PZYA 3A4OX 2PY3A 3UNKA 1OKYA 3VHEA 2HCKA 2Z7SA 2VTIA 4X6QC 2GQGA 2XJ0A 2FA2A 3UPXA 4XV3A 4QP2A 2FGIA 2VTNA 1WBOA 4CLJA 4H58A 4XLIA 1U4DA 2XB7A 3FMMA 3RAHA 4AGCA 3KFAA 3MYGA 4E5BA 1FVVA 1NY3A 4FTQA 3ZFMA 3Q5IA 3ZRLA 4F7JA 3N4VA 4FV6A 4WG5A 3UDBA 1M7QA 2EB3A 2Y4IB 5KMKA 4DFBA 2GNLA 5CY3A 2Q0NA 4UYAA 4I5HA 5BUEA 1Q41A 3BWJA 3QLFA 4ZZOA 2IVSA 3HMMA 2GS6A 5ACBC 4DT8A 1L3RE 4UX9A 5AR2A 5CS6A 4FV0A 4Q9ZA 3GC9A 5HD7A 2HW6A 5I4NA 5EM7A 1A9UA 4W4VA 4Z3VA 3ZRKA 3QL8A 3MFSA 3TM0A 4CD0A 3EN9A 5EM8A 1YXSA 1IA9A 3R9OA 2QO9A 3IDBA 2NRUA 1QPEA 3FDNA 3HUCA 5AV0A 3R2YA 1Q8UA 3QZIA 4GJ2A 4RVTA 5GNKA 5C8MA 3NEWA 1L8TA 3UO6A 4JS8A 5IU2A 4FTKA 2GNGA 2DQ7X 3UMWA 3LQ3A 4OTWA 3G9NA 1Z5MA 2PZ5A 4LRMA 1W8CA 3CQEA 3O71A 4EOMA 4LL5A 1H26A 4IHPA 5HVJA 2X9FA 3CKXA 2V7AA 1FMKA 3KRJA 4HNIA 1WCCA 2G9XA 4IE9A 3VUKA 1ZOEA 5FP5A 2SRCA 3C5UA 2OXYA 5BVDA 4PTEA 4RWLA 3PZHA 4PMTA 4EOPA 5I3RA 3CC6A 5HIDA 2XS0A 3TZ8A 5AUZA 1ZMUA 5DR9A 5IUIA 3H30A 4XOZA 5HEZA 5LARA 3LXPA 3FZ1A 4F63A 1PXIA 4Y83A 3MIYA 5EW8A 2VWBA 4O0TA 3LQ5A 3VS2A 2LAVA 4QMYA 3BHTA 4D0WA 3Q4TA 2ZDUA 4C8BA 3ZM9A 2ERZE 3HDMA 3QBNA 4QNAA 2W1ZA 4U41A 4UXQA 3MH3A 3VNTA 4DEDA 2Y7JA 3F5XA 1CMKE 4ACDA 2R0UA 3Q04A 4IACA 4RA5A 5HKMA 3DZOA 3FL4A 3OTVA 4H1MA 3ZFXA 2XNPA 4P5QA 4ACMA 3SXFA 3BGZA 3PVUA 4QYHA 3GFEA 1OBDA 4ID7A 1PRYA 4IAZA 2GHLA 3FC1X 4G6LA 3QF9A 1Q8YA 4LFIA 4IM2A 2BKZA 4EZ7A 5BYYA 3V8SA 4WHZA 5I3OA 3RCDA 4DFNA 2I6LA 5A6OA 2CSNA 2OF4A 3GCQA 3V5LA 3Q9WA 5IA3A 4BCFA 5FEDA 4OBQA 5E8WA 3H0ZA 3ZZWA 4DEBA 4BDEA 2YM3A 5CVGA 3QTRA 2R3PA 3SG9A 3DKGA 3QHWA 3QGYA 4MD7E 4QPMA 3AXWA 5DIAA 5CU2A 3PXZA 2R3JA 4AUAA 3RHXA 5IH4A 3PIZA 3QUDA 4KINA 4RLKA 5FM2A 3JY9A 2PHKA 5CANA 4J99A 2YWVA 4E8AA 4KIKB 5HCXA 5AP7A 4ANSA 4HVSA 3ZEWA 2UV2A 3VBQA 4YHJA 3EFLA 4DCAA 3RPSA 2JDTA 5EKOA 2CPKE 4U43A 3G33A 4HNFA 4Y46A 3FLWA 2XM9A 1W82A 3R9NA 2BFYA 4R7HA 4IH8A 4K33A 5CALA 2JIVA 4XG2A 4FGRA 4QP7A 3DS6A 4IX3A 4O0UA 2FSLX 4ZLZA 3FI8A 4BHNA 1G3NA 4FBXA 2XNEA 5HBHA 2H6DA 3E8CA 4F0GA 4N6ZA 4YNOA 3JXWA 2OIBA 1PYXA 2PUNA 5KKRB 1R78A 2JKKA 2B55A 3QQGA 4FEUA 4XMOA 3UYTA 3LCDA 5K5XA 5ANDA 2IW6A 3MVJA 5FG8A 4F1OA 2JITA 2R3QA 4DG3E 2VD5A 4J98A 4NIFA 3A62A 3O7LD 4P90A 4AACA 4EI4A 4EHGA 2IO6A 3SQQA 4B7TA 3TIYA 4YR8A 1UNGA 4BZOA 3E64A 3QTSA 4HCVA 4IDVA 3JVRA 4TTHB 2FB8A 5EK7A 4F70A 2CKPA 1TKIA 2OFUA 5KHWA 5FEQA 4ZY5A 2OIDA 1G5SA 4PWNA 2R0IA 1FOTA 3NRMA 1KUTA 4BTMA 3WARA 2V7OA 3HDNA 5K5NA 3LIJA 3T9IA 3I1AA 4L00A 4MXYA 3PVGA 3MESA 2A2AA 5CF8A 4LGGA 1YHSA 4GFMA 3O96A 4QTDA 4NM3A 3UPZA 4KIOA 4IAAA 1U54A 2PPQA 4ENXA 3FE3A 3II5A 3QKKA 3AT4A 3EWHA 3W8LA 2PZRA 3ODZX 5KMLA 2UW8A 1Q97A 2PZPA 4D5KA 4I94A 4KAOA 3JY0A 4FYOA 4FSNA 1YWVA 4U42A 2GFSA 3HL7A 4ZZNA 4I92A 5CEQA 3UODA 4NCTC 2A4LA 4FI1A 4HGLA 4NT4A 3TZMA 4A9SA 1KOAA 2VX3A 3CD3A 3RK5A 4BC6A 5KCVA 1PXKA 4LUDA 4LYNA 3UTOA 4IVAA 4CZUA 3AD5A 3IG7A 4GK3A 5KE0A 1SNXA 5CU6A 4K9YA 3ZUTA 4S31A 3EB0A 1GOLA 2C6LA 3R7EA 3FLQA 4AZFA 3GCPA 3SRVA 2IG7A 3V5JA 5JEBA 3JR1A 4CQGA 4W4YA 3PPZA 4O83A 4LV5A 3OTUA 4E93A 2BROA 2BRMA 3IK3A 5KZIA 3V5WA 4E3CA 4PNIA 3G6HA 3DA6A 3WE4A 4EEVA 3CLYA 4LUEA 3LOKA 3D14A 4BCGA 4ANMA 5EM5A 4F9AA 4KSQA 3PVWA 4FIJA 1WFCA 1YOJA 2OZOA 2Z7LA 4LOQA 5AR4A 3SW7A 3RM6A 4FEVA 4FKVA 1UWHA 5AUWA 4AG8A 2RFNA 5ETIA 2UZEA 3KRRA 3OMVA 4WD5A 5M09A 4YBKA 1KOBA 3MBLA 4RWJA 2HY0A 3ZCLA 3SG8A 3V51A 4EZ3A 4HVHA 4NJDA 4XS2A 4E1ZA 4AW0A 4DITA 1ZMWA 1CSNA 4YGAA 5I9YA 4X6RA 2VWYA 2YABA 5BQ0A 3E92A 2WEIA 3R9HA 3RZBA 1UNLA 4C3PA 5M07A 4HGEA 5BVFA 5A4CA 4E6CA 3VS5A 2O63A 2E9UA 2WOTA 2X6EA 3DAEA 3HV4A 4I21A 2W5AA 4QYGA 4FMQA 3V3VA 4HGTA 4C3FA 3KRXA 2BILB 4DGMA 2R3GA 5HESA 3ZDIA 1YQJA 3NAYA 4WSYA 3DQXA 3ZZEA 4A4LA 1W84A 2WEVA 5EFQA 5BVOA 3F6XA 3FQHA 2VTAA 5ANEA 4FKLA 3PFQA 3D4QA 1GJOA 2PWLA 3IW5A 3OWJA 4OW8A 4AT5A 3R04A 4DEIA 4E5AX 2BRBA 3V5TA 2J5EA 4FNZA 4FSMA 3I0OA 3V6RA 3WF6A 2HZIA 3EZRA 2E2BA 3D5VA 5HO8A 4S32A 3LJ0A 3UOLA 4Z7HA 4ZJIA 3NMUF 4AXAA 3ZC6A 2HIWA 3PP0A 4H36A 5I0BA 3I81A 4RIYA 1NVRA 4AZTA 2UVZA 5CX9A 1Q8TA 3C4ZA 3OY3A 1J1BA 3OEFX 3LFCA 5GIPE 1OIUA 3DB8A 4WBBB 5A54A 4IAFA 3F5GA 3LFDA 4PDSA 3VS1A 4BCQA 5HBEA 3SXRA 2ITPA 2O2UA 3QLGA 5T68A 4FTTA 2R64A 2WTVA 3F2AA 3G2FA 2P4IA 4I0SA 4YLJA 5C03A 3AC1A 5HG8A 3AGMA 3FSKA 4FTOA 4BTKA 4B8LA 4C34A 4FNWA 5HLWA 5CI7A 4G1WA 4YHTA 2RFEA 5FBOA 4TWOA 2C5XA 2C0OA 1LUFA 4I0TA 4DFXE 1W7HA 2X6DA 1YKRA 3HKOA 1ZMVA 5I9ZA 3ZLSA 2WTJA 5HCZA 3MFRA 2HW7A 3KXXA 4M8TA 4XJ0A 1MRYA 4Z9LA 5F9EA 5AR7A 3GU8A 3RBWA 3I4BA 2P2HA 3NYXA 2Y6MA 4ASZA 3QQLA 3MW1A 3RK9A 3KKVA 3DCVA 2UZDA 2WXVA 3Q9YA 3EL8A 4J97A 3LVPA 3QZGA 1UU7A 2P55A 5EI2A 2YERA 3K3IA 4FVRA 4RIXA 3QQUA 5EDPA 4ZSJA 3VJNA 3FMLA 3ELJA 4B6LA 2BZIB 2J0LA 3ORZA 3CJFA 2Y9QA 1JKKA 5E92A 4BCHA 4A06A 4U3YA 3L9LA 4QMXA 2YJRA 2HZ4A 3R73A 5AP4A 3AOXA 3ZMMA 2ERKA 3QZFA 2O64A 3NUSA 5CZIA 2PZIA 3ZO4A 4F7LA 1Y8GA 1ZY5A 3GQLA 1ZARA 2R5TA 5IMXA 2WKMA 3Q5ZA 2ITVA 2CN5A 2QR8A 4WT6A 2OKRA 4I5MA 3ZYAA 3D83A 1M17A 4E6DA 4O7SA 1QPJA 4WSQA 1V0BA 5CU0A 1GZKA 3RCJA 4EKKA 1DS5A 1E1XA 4D0XA 4FZ6A 3COHA 4QYYA 4ZSGA 1PJKA 4RJ7A 2WMAA 3TZ9A 4G9CA 4E7WA 3R2BA 4FT0A 3VUMA 1YVJA 3L9MA 2AC5A 4JR7A 3UP7A 3RGFA 3NUAA 3I6WA 2GPHA 2PVNA 3A60A 3LXLA 3RHKA 2OK1A 4M14A 2HZ0A 2PYWA 3NSZA 2I0HA 5AUXA 1UWJA 1WVYA 2YEXA 3QWJA 4I6BA 3UG2A 3RKBA 4Y5HA 4AQCA 2R3KA 2XCHA 1W98A 3L8VA 2A0CX 4RIOA 3EFWA 3IGGA 3SD0A 3NYOA 3CE3A 4HZSA 5ICPA 5C4KA 4LMNA 3UYSA 1O6YA 3HA8A 3LLAA 3P5KA 4QP9A 4Y5QA 4BVUA 2ZV7A 4X2FA 3PXYA 4MHAA 4RJ6A 5EHLA 2JKOA 1Z57A 3COKA 4F9WA 3NLBA 4O6EA 5CLPA 5DEWA 4DTKA 5JZNA 4YJOA 2X4ZA 4U9AA 3ATSA 5CAQA 3EQIA 3S2PA 3QC4A 4QMSA 3CXWA 2XJ2A 2XIRA 3PXKA 4PL3A 4C38A 3CPBA 3PA4A 1U59A 4D2SA 1XH8A 3QD3A 1TVOA 2HYYA 3BGPA 3MA3A 3PJCA 5H8EA 3G0FA 1H1SA 2CMWA 3IDPA 4NCTA 4OTIA 5L4QA 2UW7A 3KQ7A 4I6QA 2C47A 4ZTSA 4LGDA 5ACKA 4D28A 3E3PA 3UVQA 4EH6A 2OF2A 2ITWA 4CMOA 3E8EA 4WG3A 5GIOE 4RPVA 3RPOA 2OJ9A 1UU8A 2OSCA 3PG3A 4FTIA 2Q83A 4QMQA 1XBAA 4AT4A 4FSUA 5KMNA 4ITIA 3TG1A 3G5DA 2GNHA 3FAAA 4WNKA 4ANQA 2WMXA 4OT6A 3HRFA 4RJ3A 2XIYA 5K4IA 2FSTX 3BGQA 2G01A 5E8UA 2PSQA 3MY5A 5ANJA 4IC8A 3VC4A 3W33A 1V0OA 1GNGA 5CXZA 4JNWA 1OITA 5FXQA 2RFSA 5B2LA 4M67A 2WQOA 1Q24A 3EKKA 3FLYA 3D2IA 1MRUA 4IWQA 3KRLA 5K9IA 1QPCA 2WMBA 2G2HA 2A19B 3OD6X 4KB8A 4Z16A 2V0DA 1YHWA 3BYMA 5T3QA 2PE1A 3HLLA 4U80A 2WMRA 3RAWA 4R3RA 2IVUA 5L8LA 3ZOSA 2YAKA 5CAPA 4I22A 4IAYA 4NWMA 1PY5A 4NM0A 2JBOA 4RQVA 2I0EA 4D2TA 2B9IA 2ITNA 3DBEA 3QQFA 3K5VA 4GVJA 4R6VA 3OT3A 2HWOA 5AM7A 2UW9A 4JIKA 2XNGA 2ITQA 1REJA 4X0MA 3R21A 5AP2A 5GHVA 5H8BA 5EYCA 4EK5A 4BDGA 4BCOA 4Q5EA 3ZC5A 2QHMA 1GIHA 2E9NA 4J95A 4AAAA 5IH6A 4BDBA 4ITJA 5DE2A 2PVJA 2I0VA 5TO8A 5IPJA 3O7LB 5IEVA 1GAGA 1YDTE 3E3BX 3I7BA 1W0XC 4IVCA 4RFZA 4ZTHA 3DBCA 5FGKA 5CSVA 5DT3A 5HTIA 4FIEA 2JFLA 4N4SA 4LMUA 4B99A 2XH5A 3IPHA 4M3QA 2CGWA 3BYVA 3MJ2A 4E4LA 3FKOA 2WU7A 3QXOA 2R7IA 3HP5A 3WF7A 2C6DA 3NUNA 4O7WA 4TWNA 3ACJA 5M4IA 3I60A 3R7GA 3K2LA 4HCUA 3FXZA 2OJIA 5CVFA 1YW2A 5IEYA 1J1CA 5AV3A 4CGAA 3OUNB 4XLVA 4CLIA 3TKIA 3A7GA 5DOSA 2CLXA 2ZOQA 4X2GA 1H25A 3RJCA 4WNOA 4BR3A 4ZY4A 4FT3A 3U6JA 3GFWA 1SMHA 2VO6A 3GCSA 3QCQA 2EWAA 2YIWA 4FKSA 4U81A 5EG3A 4BDJA 5KNJA 4CFFA 3TNQB 4F0IA 5IISA 5IQIA 2ZV8A 3W2PA 3OW4A 4CV8A 1J91A 1WBVA 3IW8A 2QOKA 4XG6A 4C4JA 2PMIA 2F7ZE 2VU3A 3KCKA 3QD0A 4I24A 4JBOA 2V55A 4LG4A 4BI0A 1JSVA 3HMOA 4CKRA 2IN6A 4BL1A 2QKWB 3P79A 2XZSA 3BKBA 3OROA 1VZOA 5A4TA 5LVNA 2J9MA 2WTIA 4QTAA 4RJ8A 4F7SA 4UZDA 1ZZ2A 1RW8A 2XBJA 3FLZA 2QR7A 3ITZA 3SA0A 4F1MA 3ORPA 2Y4PA 1H28A 3CP9A 4E6QA 2CDZA 5D41A 3LMIA 4JX3A 3IW7A 1FBNA 4OLIA 1PXMA 5ITAA 4JXFA 3AT3A 5E8YA 3C0IA 3VAPA 4OTQA 1FGKA 5GZ9A 2ZJWA 2OFVA 4S34A 5HO6A 3L1SA 4YTFA 4A9TA 5E8TA 4CCUA 4O7LA 2QD9A 4JLCA 5M53A 5J9YA 3RVGA 4UMQA 5AR3A 4RWIA 3R71A 1Q61A 2W5BA 1FVTA 2NO3A 3RP9A 4IX4A 3IO7A 5HD4A 3UZTA 4IFCA 4RFMA 3UC4A 4ZLOA 2BIKB 3RTPA 2ETMA 4FTRA 3PP1A 1BMKA 4CFVA 4NKAA 4EK8A 3UIXA 1OZ1A 3FZOA 3PLSA 4TWPA 3KF4A 4MNEA 3VS0A 1KE8A 4JBPA 1ZOHA 5CF6A 3U4UA 5J8IA 2BALA 3LCKA 5K4JA 3TUDA 3BWFA 3U9CA 4DEGA 5L2SA 4ZTLA 2PTKA 2Z2WA 3UIBA 3K5UA 3OWKA 2C6KA 3KF7A 1OKWA 4QMPA 3ZFYA 3D5XA 4D9TA 3OOGA 4QQJA 1WBNA 5E8VA 1ERKA 4BYIA 2NNWB 3VN9A 1Y6BA 3LM5A 4JQ8A 4LOOA 4A9YA 5JGBA 4B8MA 4IWDA 4Y72A 4D2RA 2OZAA 1RE8A 3PYYA 5DYJA 1IASA 5JK3A 4LOPA 4MWHA 4MX9A 4F64A 3NVMB 3U55A 2G2FA 1OIYA 3OCSA 4JOAA 2QC6A 2VX0A 4B9DA 4CT1A 3ALOA 3DXQA 1RJBA 1VR2A 4R5SA 5AP6A 3PSDA 4KIPA 3G6GA 5L2TA 4WNPA 3OZ6A 4G5PA 4GT4A 4O0XA 3ZRMA 4CFXA 4FT5A 2F57A 5CENA 3G51A 2HENA 3OF0A 5FXRA 3W55A 4AS0A 1T46A 3GENA 5CF4A 1P4FA 1FGIA 3OY1A 1HCKA 3DKFA 4WNMA 2VTMA 2C0IA 2J51A 3FLNC 2WZJA 3QWKA 4W8DA 4GMYA 3R8ZA 3ZSIA 3EN4A 4MNEB 1Y8YA 2YDJA 4X3FC 3GEQA 3OG7A 2GU8A 4K18A 4X2NA 4YMJA 5A9UA 4C62A 4O7NA 2XNOA 4QMUA 2ITYA 2WTCA 4N57A 5DR6A 3FZSA 4IM3A 2WQMA 3H9RA 3ZO3A 4C0TA 3M42A 4PQNA 4RIYB 4KBKA 2RG6A 4A07A 2AUHA 4HVIA 4FR4A 5AA9A 2OBJA 2R3IA 5KBQA 4DBNA 4FIFA 5HIEA 2WMVA 4E20A 1UA2A 5HNGA 2VO3A 3OCGA 3C5IA 2YLFA 3TTIA 4PMPA 5CAOA 1H1RA 2CNQA 1CKJA 5HU9A 4DYMA 1U5RA 4GKHA 1PF8A 1PXOA 4BZNA 2R3MA 5BVWA 4XP0A 2OGVA 4TWCA 1NVSA 3IECA 4IX6A 5DH3A 2VTLA 4CTCA 2QLUA 4FICA 5FUTA 5HIBA 5M44A 4MXAA 3FC2A 4WA9A 2G2IA 3AC4A 3NS9A 4O7ZA 1Y57A 2IZUA 3AC3A 1XO2B 5AV2A 2UUEA 3AD4A 2PE0A 1CKPA 2FO0A 2X7GA 5BVEA 4D4SA 1DI8A 4FKUA 3EYGA 3TJCA 5E1SA 4BCNA 4PP9A 4RG0A 2KULA 3LJ2A 4O38A 4FTUA 3GUBA 4AN9A 4BCIA 3MPMA 5EI6A 5M56A 3PY3A 3S1HA 4Z55A 1IEPA 3D7TB 3VUTA 3NDMA 5LMKC 2QONA 2UZLA 1KE6A 4O91A 4EUTA 2QQ7A 4QPSA 3HV6A 2Y6OA 3C13A 1YXTA 3H9OA 2WELA 2BTRA 4K6ZA 2ITXA 4EOOA 3KA0A 1OI9A 5CNOA 3CY2A 4WIHA 2R2PA 5CZHA 4XG7A 5FLFA 3HMIA 5JRSA 1VYWA 4LRJA 2CHLA 4MEDA 3BHHA 3M1SA 4NH1A 4FTMA 4FV5A 4KSPA 4NK9A 4OTFA 4WUNA 3UO4A 4FL3A 4D2PA 5KHXA 4WKQA 3GCVA 1MQBA 1UV5A 3AGLA 3NNVA 2O65A 5LVMA 4BWKA 4IAKA 1K2PA 1DAYA 2ETKA 4ZSEA 3D7ZA 3FL5A 3FQSA 4C2VA 3EFJA 2WHBA 4GRBA 5B7VA 1SZMA 5CEMA 3KREA 4M0YA 3SRVB 3ORIA 3T9TA 1QMZA 4M15A 3V5PA 5AUVA 3W2OA 4FA2A 2XIXA 4FZAB 3AMAA 4ASXA 3MFTA 2CGXA 3TV4A 2YIQA 5JKGA 4ANOA 3ZS5A 1GZOA 3OOMA 4TN6A 5FRIA 3ULIA 3WZDA 3W18A 4EWHA 4TY1A 3OVVA 2WIPA 4BGQA 4L52A 5J87A 4QTBA 2XK7A 1Q3DA 3R7UA 3LMGA 3PSCA 4D5HA 1AD5A 1CDKA 2VWVA 4TYJA 4JDJA 4Z7GA 3ORNA 3QYWA 4JX7A 2F9GA 2QOHA 2X8EA 3LFBA 3BX5A 3FQEA 3F3ZA 3FMEA 3PG1A 3D15A 4CMTA 4DLIA 5EYDA 4EQMA 3KULA 3EN5A
chains in the Genus database with same CATH superfamily
5DEYA 4C35A 3LPBA 3TV7A 2R4BA 4I23A 3DNEA 4M97A 5LCKA 4AE9A 5FD2A 5HU3A 3QX4A 5KMIA 4FC0A 4EOSA 3V04A 4JAIA 3Q2JA 3ZLWA 4RVKA 4BCKA 4D58A 1H1WA 4ONAA 5AADA 5BYLA 1F3MC 1IAJA 3V6SA 2WTKB 3NIEA 5HE0A 3TNHA 3EN7A 4TYEA 5IA5A 4DHZA 4DGNA 4O96A 4YZ9A 5JT2A 2IZRA 3IOPA 5IQBA 4MWIA 1PMUA 5E91A 3OXTA 2BDWA 3PY0A 1UU9A 5IDNA 5DVRA 3VBXA 3LMHA 4PTGA 4G3FA 4TL0A 3KB7A 3KXMA 3PPKA 2QO2A 2PVLA 1JOWB 3GCUA 4IANA 4BIBA 4RIWA 5AJQA 4QMTA 5L2IA 3PDTA 1URWA 4JVGA 3BZ3A 2BIYA 4KS8A 4HPTE 4UYNA 1SYKA 3GP0A 4QMOA 1J7IA 3S00A 5DWRA 5CF5A 3I7CA 3IQ7A 3VUHA 3QKLA 4AW2A 1OPKA 2BZJA 3BPRA 5IUGA 3LFEA 3LQ8A 4D4VA 3FLSA 4J52A 1R1WA 5FTQA 2YIYA 1TQPA 3KRWA 2C68A 5HI2A 3WIGA 2IW8A 2W9ZB 4EUUA 2WMUA 4IEBA 5E1EA 2BRHA 5HG5A 2BFXA 4H1JA 4O4BB 2OZAB 5D7AA 2QOIA 4OUCA 3QRKA 3UO5A 5IQDA 3F69A 1A06A 5C8NA 3HV7A 4IADA 5HTBA 5JMSA 1DM2A 2C6TA 2J7TA 1P2AA 2IVTA 3DFCB 4TRLA 5AV1A 4AT3A 4BWXA 3RWQA 5FDXA 2CKEA 3FZPA 3KEXA 4NIFB 2B9FA 2JGZA 4DFZE 2Z60A 1J3HA 2VX1A 3FMJA 3R22A 2OJGA 3PWDA 5JQ5A 4NUSA 3VUDA 4G16A 1JKSA 4L6QA 4BCMA 2Y8OA 3R63A 3R9DA 5F94A 4BIDA 4F7NA 2QG7A 4FKIA 2JIIA 4ERWA 4FVPA 4GG7A 2XK9A 1SNUA 1M2QA 1WZYA 4MNFA 2ZVAA 5E9EA 3DAJA 4QMMA 4ZTRA 4HVGA 3VUGA 1I44A 5JGAA 3IONA 3LE6A 2GNFA 3NWWA 4W4WA 3EQPA 4FNXA 4BHZA 3FSFA 4FIGA 4YP8A 1DI9A 4PL4A 4F6SA 4GJ3A 3PE2A 5AEPA 5AUUA 4IVBA 5AR5A 4F78A 4O81A 3TXOA 1XQZA 5HTCA 3KY2A 4IWOA 1ZYDA 1B6CB 4FL2A 3TV6A 2JAMA 1M2RA 2IPXA 3G15A 1DAWA 4E26A 4KD1A 2C5OA 4BDDA 4I20A 4MK0A 4BCPA 2XALA 2QOQA 4EHZA 4J7BA 3WILA 2WO6A 3N4TA 2QG5A 1RQQA 5HOAA 5BMSA 3UZPA 3ETAA 4IB0A 3OC1A 2WD1A 3OBJA 3EH9A 1FINA 4R5YA 1H0VA 1VYZA 1W83A 3I6UA 5HLNA 5IQEA 4BDCA 2R3RA 1R3CA 3D5UA 4BIEA 4C61A 4F1TA 3GC0A 5DA3A 3MH1A 4QP8A 4BBEA 3WE8A 4FVQA 4IZYA 2W9FB 4KBAA 3MA6A 3ORKA 4ALVA 4O84A 3BEAA 5EW9A 3UMXA 3F66A 5EDQA 3FKNA 4M13A 5CQUA 1ND4A 2GS7A 3R1QA 4C58A 2ITTA 4EK3A 1O9UA 2B9JA 3KVXA 2WFYA 4FTJA 2JLDA 3JS2A 3FY0A 4BGGA 3ERKA 3JUHA 2YM6A 4FODA 2VO7A 4UBAA 4XV1A 3BL7A 3DB6A 3VQHA 3GU4A 4YZNA 1UNHA 2ZB1A 2RSVA 3ANQA 3PRFA 3PRIA 4IFGA 4JAJA 5DPVA 3RNIA 3TACA 3VWAA 2BDFA 4FKPA 3SXSA 3UIMA 4CFUA 3GI3A 4YU2A 4IB1A 4D1XA 5A46A 4O0WA 1Q62A 2YZAA 3VQUA 4ZTMA 4DEAA 3BE9A 3UIUA 5BUJA 4B0GA 4OTRA 5DN3A 2CJMA 3E88A 2UZNA 2J0MB 3FYJX 4MBIA 3BRBA 4BBMA 4K1BA 1YDRE 3BLHA 3EQHA 1LEZA 2BAJA 3FHRA 4GSBA 4M68A 2XJ1A 3CR0A 5J5TA 4ACCA 1H4LA 1GZNA 3OFMA 2C3LA 1JVPP 2OH4A 3DLZA 2KTYA 1H01A 5M55A 4QYEA 3NUPA 2CCHA 2HWPA 5C1QB 4ZXTA 4X7QA 3W2QA 3ZBFA 4NTTA 2W1GA 4K2RA 5IKWA 3CY3A 2CLQA 5E7RA 1M2PA 2PVFA 2R3FA 2JAVA 3OWPA 3AT2A 3DK6A 3EQFA 4OTDA 4X2KA 4O2PA 3ZXTA 1P14A 4W4XA 5L6PA 1JKLA 3R8MA 4EH7A 4ZZMA 4UB7A 4BRXA 2RGPA 4J8MA 4CQEA 2QODA 2OXDA 1PXNA 4XV2A 4ZEGA 3VF9A 4E73A 1CTPE 1TQIA 5BVNA 4IQ6A 4CG9A 3HX4A 3FJQE 2W0JA 3SC1A 3FXWA 2RL5A 4EC8A 4ENYA 3ML1A 4W8EA 4QQTA 1OKVA 3C4WA 4PY1A 4O0YA 4FKOA 4PDPA 3MY1A 3C4FA 3MIAA 2QOBA 4CFWA 5L2QA 2VN9A 2V62A 5FXSA 4GT3A 5AX3A 3WZEA 4QP1A 5L6WL 5BPYA 4MF0A 4R7BA 3A4PA 2AQXA 3DJ6A 4YZMA 2WMWA 3LM0A 4KKHA 3R7IA 1ZYLA 4G31A 4UZHA 3S0OA 4O7RA 2ZV2A 2XKFA 3P7AA 2W1HA 5GJDA 3T8OA 5CEOA 5KBRA 4KNBA 3MDYA 3FY2A 3IS5A 1WBPA 4PMSA 4J71A 3V5QA 5J7BA 4BKJA 5E4HA 3QFVA 4U7ZA 1MUOA 3F3WA 3RNYA 5F1ZA 3NX8A 1XBCA 5EYMA 5TT7A 2HELA 3N51A 4S30A 3UNJA 3NNWA 3OXZA 2QOOA 3A2CA 3QTQA 4FG9A 3RINA 4FKQA 2GQSA 4AWIA 4AAYA 3U54A 1PXJA 3H3CA 1O6LA 5TR6A 5IQCA 4JDIA 2I0YA 2C3IB 3EQCA 3EIDA 5IG1A 2WQBA 3TWJA 4U45A 4XP3A 5EDRA 5DNRA 3FMDA 1G8AA 3FZTA 5FTOA 5KUPA 4H3QA 2X4FA 1B38A 3QA0A 4XBUA 4UMRA 2GHGA 4J53A 4O7VA 4IJPA 3NVKI 5F4NA 3V8WA 3EQDA 3MSSA 4DGOA 4BTFA 4I0RA 4L43A 2X1NA 4RWKA 1GIIA 3AMYA 3E7VA 5C26A 1A48A 3UE4A 1XMLA 4AXDA 3QUPA 4L3PA 4GVAA 4EONA 3P86A 2HXQA 4GV1A 3R83A 1JBPE 4XG8A 4GW8A 5D9HA 5IA1A 3Q9XA 5AM6A 4DBXA 2H8HA 5DRDA 4DH8A 4PPCA 1OL7A 5HG7A 4EJ7A 5A4LA 2IWIA 3BU3A 2XKDA 3DKCA 1BLXA 4X2JA 3MVHA 3VVHA 1OMWA 1X8BA 4ALWA 3T3VA 3BHUA 2UZVA 3F5UA 3FYKX 4D4YA 1U5QA 3F7WA 2ESMA 1APME 5CSPA 4HYIA 4M7IA 4YBJA 1TQMA 3TDVA 5K0KA 2FUMA 4AE6A 3KN6A 4BTJA 2WMTA 5C01A 5HZNA 3ENHA 4BZDA 2ZM3A 1OL5A 1XR1A 1YWRA 2C5YA 2W17A 4OTPA 4PPAA 4XV9A 2AYPA 5CAVA 4MF1A 3P78A 2JDSA 4E4NA 1WBWA 4UMPA 4ACHA 3BHVA 3IW6A 3SVVA 1S9JA 4NM5A 3OS3A 4RIXB 3WF5A 2BAQA 3CSVA 1LPUA 4QT1A 5ETCA 2RIOA 2PK9A 3Q4ZA 4L46A 1Q4LA 2X2KA 2YDKA 2YM7A 2ZMCA 1MRVA 3DU8A 3KMWA 3VW6A 5ANOA 2F2UA 3ID6C 3BI6A 3L8XA 4BDFA 3R8PA 4YSMA 3H0YA 3FPQA 3MGYA 4ZK5A 4EBWA 2EB2A 4R77A 5M4FA 5AR8A 4FK6A 5IEXA 2OJJA 3U87A 4FIHA 4EL9A 3EJ1A 3A7HA 2IW9A 3DT1A 4ASDA 4C2WA 1J7LA 2B9HA 4IC7A 4UMTA 4RZWA 3ZSGA 4GH2A 5JSMA 3HV5A 3OBGA 4YO6A 2YN8A 4XP2A 3CQUA 3QHRA 3Q32A 5GJGA 2XNBA 4FOBA 2Z7QA 4E4MA 2X39A 3NAXA 4GFGA 4MBJA 3PUPA 4TYGA 4W9XA 3HNGA 4C02A 4EWQA 4M12A 2RF9A 3PJ8A 4RQKA 3DGKA 1KV1A 5EH0A 1BUHA 1YOLA 4RVMA 3W8QA 4EYJA 5KKRC 5CASA 1YXUA 3QZHA 4M69A 5KMOA 4OGRA 5BV3A 4KS7A 5DT0A 3V8TA 1WBSA 1PMEA 1REKA 1VJYA 3NCGA 4FG8A 1OGYA 4YC6A 3FUPA 5CSWA 3T3UA 4HYHA 4OT5A 3S3IA 1F0QA 5AAGA 2B0QA 2XIKA 4AOJA 1H00A 4TPTA 2OG8A 4AZVA 3PXFA 5CXHA 4JI9A 3U8WA 2C6OA 4Y95A 2XVDA 4EH5A 1XH7A 5JFXA 4Y8DA 1BX6A 2X9EA 3L8SA 4JG8A 4EH4A 2H34A 2ZDTA 4MTAA 1CKIA 1SVHA 3TDWA 3NUYA 4C4GA 3UNZA 1JAMA 3RMFA 5CSHA 3Q3BA 1ZYJA 2PMOX 3VS7A 2XRWA 4BGHA 4D55A 2JKMA 3KK8A 3PVBA 4AP7A 4CNHA 2QOLA 4CV9A 3DQWA 5L3AA 4PDYA 2PE2A 2CKQA 3C9WA 3OHTA 3D94A 2JD5A 4ANNA 2UVXA 3TIZA 3NNUA 1R0EA 4PUZA 4JJRA 4UN0C 5KZ0A 4OAVB 3LCOA 4FV1A 4USEA 4LL0A 2XAOA 1VEBA 1KV2A 4YNEA 4EHVA 4F4PA 5IUHA 2ETRA 3QQJA 5HE3A 1R0PA 5CI6A 4QOXA 4WOVA 4APCA 5J79A 3HP2A 4AGWA 1GZ8A 4FKGA 3DLSA 3JYAA 2IZSA 4EQUA 4IX5A 4WRGA 1IR3A 3O23A 5AP5A 2XK3A 2C6MA 3TJDA 5IQFA 4C3RA 4QMLA 4AF3A 5AAEA 4PMMA 3KMMA 3UC3A 4BFMA 4YPSA 2NRYA 3DV3A 3ROYA 2QI8A 4RX7A 1H27A 3PJ3A 2C69A 5IH5A 5LVLA 4PTCA 3QRJA 2G15A 3RM7A 2YCQA 4D2WA 5M4CA 2NPQA 4GCJA 4IMYA 3QU0A 3W32A 3DFAA 4FRFA 4XHKB 3EQGA 3NW6A 5AP1A 3SW4A 3ZLYA 4EBVA 2QO7A 5KX8A 4R7IA 1CM8A 3NZ0A 4ZMEA 4FE2A 4XH6A 4H3BA 3W2SA 1MP8A 5EOLA 5H3QA 5I9UA 4KIQA 3FI2A 2X0OA 3RPVA 4RLLA 4EHEA 5CTPA 4R1VA 4MXOA 4XG9A 4G3CA 4DHJA 3UOJA 2VRXA 5AUYA 1Q99A 4G3DA 5CNNA 3G0EA 2W1EA 4QDEA 3KU2A 4ZTQA 4F08A 4EYMA 5I9XA 3UQCA 3PJ1A 5CEKA 2PUPA 3LLTA 3DY7A 4PL5A 2VTTA 3CQWA 2XF0A 2IVVA 4O0SA 5KMJA 3CPCA 4FUYA 4C59A 3UG1A 4FF8A 2GTNA 4FV8A 1Q5KA 3K3JA 4GU9A 4ZAUA 3AC5A 3O51A 3ZONA 1ATPE 1STCE 3FMKA 4LI5A 5IA4A 4RRVA 1E9HA 2CGUA 4TT7A 5LWMA 3ZUUA 5JQ8A 4DEHA 4AZWA 5K3YA 4BDIA 3KCFA 3Q6UA 3ZH8A 1SVGA 2XUUA 2ITUA 4IW0A 4U6RA 4F9YA 4PPBA 3GU6A 3HMPA 4X21A 2WIHA 3NGAA 4GYIA 5D10A 2XEYA 2H9VA 3KXHA 1YI3A 3UP2A 2R3OA 2W05A 1OVEA 2W4OA 4RC3A 3VIDA 2W99B 4OTGA 2JBPA 2ITZA 3E5AA 4AA5A 2R3HA 2QURA 5KMMA 4ORKA 1H8FA 4YHFA 5E90A 5LCJA 4EORA 2BRNA 1OECA 3QALE 2WNTA 1P4OA 4YC8A 3VBYA 3ATTA 3M11A 2GS2A 4C4FA 2UW3A 3VHKA 3FEGA 2VWXA 5CSXA 3TKUA 2YWPA 4ASEA 2ZB0A 4J96A 1UKIA 4BBFA 4FSZA 3FHIA 4N6YA 2XEZA 2BHEA 3NCZA 3MWUA 3D5WA 4CYIA 4L8MA 4YLKA 2C5VA 4M0ZA 4DG2E 1GIJA 3FV8A 5AMNA 4BF2A 4DH3A 3HAMA 3KXGA 3K54A 3RAIA 4PNKA 5LQFA 4S2ZA 5DG5A 4FNYA 4PP7A 2FSMX 3SDJA 1UKHA 5M06A 4RSSA 1YWNA 2X7OA 1SM2A 4CSVA 3H9FA 3WF8A 2J0JA 3AC2A 4FSYA 3UDSA 4AOIA 4R8QA 1AQ1A 1OKZA 2NP8A 3BQRA 3F3UA 3NW5A 5E8SA 2B7AA 2BRGA 4YLLA 3Q4UA 5AA8A 1H07A 4CZYB 3RAKA 4D1SA 1PMNA 5HE1A 4MXZA 4KUJA 4L67A 2Z7RA 3NNXA 4O0VA 4A9UA 2X0GA 4HOKA 3R8UA 4L42A 4ZSAA 3FI4A 5JFWA 2VWUA 2PL0A 3FMNA 2VTQA 1ZWSA 5CWZA 4BYJA 2ONLC 5FDPA 1Q8ZA 1ZLTA 3F3VA 4CKIA 4TZRA 3ORLA 2XA4A 2PVKA 3FWQA 4KRDA 4OR5A 5HNBA 3MVLA 4BWPA 3LJ1A 3B2WA 4AXFA 2W96B 4U0IA 3DBQA 3RK7A 4ERKA 3L9PA 3R8VA 5M4UA 4ZY6A 4ZLYA 1IAHA 2X2LA 5C4LA 5EYKA 4I1ZA 5L8JA 4CVAA 3UDZA 3Q96A 4O4EA 4ZP5A 3QD4A 2C4GA 3ZDUA 1YXXA 4AFEA 4YUQA 2YISA 3M2WA 5CT7A 4TYIA 3GT8A 3QUEA 2HY81 3COIA 1ZXEA 4QRCA 2IF8A 5FQDC 1O6KA 2BAKA 4MYGA 1R39A 4UMUA 2RFDA 3AMBA 2YM5A 4NFNA 4TYHB 5AIRA 5F95A 2UZUE 3UJGA 2VZ6A 2XAMA 3QC9A 5J1VA 2GFCA 3BIZA 1Y6AA 2V5QA 3O8PA 4L3JA 3ZTXA 4ZJJA 5LMAA 4DH7A 3DNDA 3C4XA 5JFSA 2P0CA 2W4KA 3CBLA 5HHWA 3U4WA 4HW7A 4R3PA 3MPTA 5HVKA 2WPAA 3D2KA 4AA4A 3C51A 3BYSA 3MY0A 4MD9E 3AKKA 5AFVA 2QNJA 2XK4A 4FUXA 1YRPA 4RJ5A 4CT2A 4DTAA 4U44A 4UXLA 3E87A 4IB5A 5A4QA 1H0WA 3TTJA 1OPLA 4FT7A 4L9IA 4A7CA 3FBVA 3QKMA 4JL9A 4D4RA 5DMZA 4O1PA 5G6VA 4L7FA 4HCTA 2PUIA 2OI4X 1XHAA 4CRLA 1ZAOA 4RIWB 2VAGA 5DFPA 1YHVA 4KWPA 2JKQA 1ZRZA 3OXIA 1WBTA 2B52A 2O3PA 3B8QA 3CCNA 3FKLA 3HVCA 3U51A 4A4OA 4ALUA 4BI2A 4NTSA 5IZFA 5A3XA 5IMEA 1ST4A 3ORTA 1U54B 3D7TA 4P5ZA 5AV4A 3A7IA 3LFQA 3O17A 4P2KA 2BKKA 4O27B 2QKRA 1K3AA 2XK8A 2YHVA 2YCSA 2EXMA 4YTHA 4X3JA 3GQIA 4ZSLA 3E63A 2PVHA 4H05A 5EKNA 3AKJA 5CAUA 4TNDA 4C37A 4KBCA 3MTLA 4K0YA 4BI1A 4GIHA 4GL9A 5LVPA 1I09A 2YIXA 2VTRA 3GBZA 4H3PA 2OWBA 4FSQA 3A8XA 3EYHA 3GNIB 4G2FA 1J7UA 5EQYA 1M52A 3GOKA 1NVQA 2W1FA 3C0HA 3EFKA 4H39A 2HXLA 3KXZA 2UZTA 1BYGA 3IKAA 3VBTA 3QQHA 5DR2A 2QU6A 2W1IA 3QD2B 3CTQA 3B2TA 4HPUE 4LQMA 3E8NA 3O2MA 3OW3A 4O21A 2HK5A 4L53A 3U6HA 3VBWA 4O6LA 4FV9A 3WBLA 3QXPA 4DFLA 3HYHA 1F5QA 1YOMA 4U3ZA 5LWNA 4YZCA 3HRCA 5J95A 4OAUC 4QPAA 2VTSA 3UOHA 2RKUA 2P2IA 2LGCA 2X8IA 4JT3A 3EOCA 1JSUA 3TI1A 3HEGA 4JBVA 3ACKA 2C0TA 4C7TA 4O0RA 3LCTA 3QYZA 2QOFA 3EN6A 4ZTNA 5FP6A 2P33A 4PX6A 1XH4A 3GVUA 3NFFB 3NW7A 5HLPA 2O0UA 2UW5A 2W5HA 2C3KA 2P3GX 4C57A 2C1AA 4HVDA 4CRSA 4YTCA 2AC3A 1OM1A 3HMNA 4DFUA 3LXNA 3PZEA 2JDRA 3C4EA 4V0GA 5LVOA 3BYUA 2XP2A 2XCKA 1S9IA 2WB8A 2A1AB 3N9XA 4L68A 1QCFA 2UZOA 4BB4A 4F99A 2I7QA 3LHJA 3GOPA 2CN8A 5H9BA 4Q9SA 3WYYA 4IZAA 1Y91A 5D7VA 5M08A 4RVLA 5TF9A 4I6FA 3R28A 4DN5A 3BBWA 4I6HA 3VF8A 4YZBA 2A27A 5ANGA 1JNKA 4CEGA 1U46A 3A8WA 2J0KA 1M7NA 4NL0A 1FPUA 2DS1A 3BLRA 5AIKA 4E6AA 4ARKA 3E8DA 4YZDA 4DINA 4QP6A 4RFYA 3LFAA 4Y85A 2HOGA 2F7EE 4G9RA 3WOWA 2VWZA 3WZJA 4BDHA 2WMQA 3QGWA 2JEDA 5DGZA 2E9VA 4R1YA 3ZO1A 2R9SA 5EHOA 4A9RA 5JH6A 4UEUA 3SV0A 2WAJA 4LGHA 2YM8A 4MKCA 2B53A 5L2WA 3LFSA 4O7YA 4D1ZA 3W2RA 4V0GB 5E8ZA 3MH2A 5I5ZA 4QTCA 1LP4A 4U8ZA 3GXLA 2OICA 4F09A 3MJ1A 1KE5A 4EZ5A 3NPCA 3EZVA 1H24A 1NW1A 4EOJA 4QTEA 3CGFA 3SGCA 3ZU7A 4IDTA 4RGJA 5LXMA 3LFFA 3IDCA 3W16A 4D9UA 2X2MA 3BLQA 3RI1A 3OWLA 4FZFB 3DBFA 5FEEA 4UWYA 3DJ5A 4LV8A 3NYVA 3QRUA 5BYZA 5J9LA 3P7CA 4MXCA 4RA4A 3REPA 5C8KA 1Q3WA 5AAFA 3E93A 2UW0A 4FGBA 4Y73A 4C4EA 2B1PA 4GYGA 1V0PA 3F2RA 3RPRA 3GC7A 3MI9A 3U9NA 1HOWA 1E1VA 2R7BA 3DBDA 4KABA 5FM3A 2UW4A 2WQEA 3A7JA 5I9VA 3H4JA 2FVDA 3MN3A 4TYHA 4LV7A 3DK7A 3ET7A 1XH9A 5JRQA 4TKSA 4XRLA 4M84A 4DT9A 3POOA 4BY9E 5GJFA 2CKOA 3Q52A 2UZBA 4N70A 3VUIA 1IG1A 3NUXA 5AX9A 3C7QA 1QL6A 2REIA 4AN3A 5ETFA 5FWKK 3ULZA 2EXCX 2FH9A 2C6EA 2BUJA 1ZYCA 2VUWA 3R7OA 1G8KA 3P08A 4EOQA 1BI8A 2QVSE 2XKCA 3G9LX 3DTWA 4RX9A 3CKWA 4JG6A 5D1JA 4FEWA 5EOBA 4JDKA 2JDOA 2J50A 4HZRA 2VGOA 2WTKC 3KMUA 4O86A 1GY3A 4GG5A 3O50A 5GZ8A 1JLUE 4LRKA 1OGUA 2EUFB 3ZM4A 1FQ1B 4FOCA 4QMVA 2VWWA 3HECA 4FTNA 3QAME 2VNWA 3DPKA 4GU6A 4PV0A 3FPMA 3Q53A 3KN5A 4HJOA 4NEUA 2W06A 5GINE 2IJMA 2UVYA 4CZTA 4AFJA 4LM5A 4QP3A 4F9CA 4DFYA 4RT7A 5HVYA 3R01A 4FTAA 5H2UA 4MQ2A 4XEYA 3W0MA 4NU1A 4HYUA 2VO0A 2BZHB 3R00A 3V01A 3F61A 1ZOGA 4TNBA 3C0GA 2CNVA 4YJRA 1T45A 1XWSA 2BTSA 2ZV9A 1OB3A 4FSWA 3ZO2A 4AGDA 3TT0A 4AGUA 4JRNA 3PIYA 4AW5A 2CCIA 4G34A 5IA0A 3OP5A 4MQ1A 4DEEA 5DT4A 3ZSHA 4DH1A 2OU7A 4YURA 2HAKA 1H1PA 3BE2A 3GC8A 2ZM4A 4RX8A 1OUKA 2F7XE 3P7BA 3R1NA 3QRIA 3EL7A 5D12A 2RG5A 2PU8A 2PVYA 3COMA 5ETAA 4BKYA 4I93A 5HO7A 4FZ7A 1FMOE 2I1MA 2YITA 3I5NA 4C36A 3W1FA 5IF1A 2YCFA 4EC9A 4K8AA 3P0MA 4F0FA 1BI7A 3PIXA 4G6NA 4BCJA 3A7FA 4YJSA 4GKIA 1JKTA 3P9JA 3BBTB 2JC6A 4YTIA 3QTWA 3Q6WA 4RZVA 4DE4A 3PSBA 3RALA 4UY9A 4BKZA 4ACGA 4QMWA 3DDQA 3PWYA 4EKLA 4GK4A 2EXEA 4KA3A 3I5ZA 3MB6A 1P5EA 2JFMA 5CQWA 4I5CA 5EW3A 5BVKA 3O0GA 5HG9A 1URCA 4TW9A 2ZMDA 5ANKA 3TN8A 2R3NA 4A4XA 3TUCA 3F3TA 4O82A 1V1KA 3FXXA 3NIZA 4CCBA 2YJSA 2GTMA 4JR3A 4K11A 4WBOA 4XOYA 2E9OA 3WIKA 2PVRA 3BCEA 4NW6A 4YSJA 5I9WA 2WQNA 3JVSA 4EJNA 3THBA 1OL1A 2YAAA 4IZ5A 4DAWA 4DGLC 1H08A 3C50A 3R02A 2HZNA 3DXNA 3H10A 4NM7A 3CIKA 4WUAA 2CNUA 4RMZA 4QMNA 1JPAA 2YA9A 5ANIA 3MPAA 4FV7A 4O22A 4HGSA 1JSTA 2B4SB 5HX8A 3A99A 3AKLA 3MV5A 3TL8A 1QPDA 1OPJA 2GNIA 1MQ4A 1SVEA 5EI8A 4EH9A 4IAIA 3KXNA 1KWPA 4YJTA 4MCVA 2O5KA 3F82A 5C9CA 4UV0A 2XKEA 4CYJA 5CEPA 5M51A 4AOTA 2YM4A 2OIQA 3R1SA 3UVRA 2OXXA 3AD6A 4KRCA 3TNPC 4O7TA 3PTGA 3BU5A 1FVRA 5AP0A 4AU8A 2ZAZA 4BDAA 4EK4A 2PUUA 2VGPA 4AX8A 4EQCA 3PPJA 2ZFYA 1NXKA 4FZDB 1OBGA 2PVMA 2W4JA 3SKCA 3VONA 3TKHA 4YC3A 1EH4A 2QU5A 2BMCA 2YIRA 4UWBA 3SLSA 3UOKA 4CMUA 1WAKA 4XYFA 2EU9A 3O8UA 5J5SA 3PA3A 2I40A 3EHAA 4XG3A 3UQGA 4G17A 3I79A 4WG4A 3ZLXA 2BDJA 5TE0A 3WF9A 4WRSA 5HX6A 4GK2A 2YACA 2C30A 3BYOA 4JDHA 1NT2A 4EH3A 4DTBA 2XK6A 5HE2A 5A4EA 4NYEA 3UZRA 2BHHA 1KSWA 4IIRA 2VTHA 4EK6A 4ZS0A 5BUIA 1UVRA 2VTPA 4AA0A 5L6OA 3KGAA 5LOHA 3QCXA 4GS6A 3VS3A 1LR4A 3VW8A 1B39A 3QTXA 1BL7A 4E5WA 1YXVA 4GFOA 3ROCA 1LEWA 2BCJA 2IZTA 4IJ9A 5AWMA 4QQ5A 2H96A 3RPYA 3WZKA 2YFXA 4JQEA 4CFNA 3W0NA 4I4FA 2C6IA 3KL8A 2UW6A 4O2ZA 3P4KA 3LCSA 4FKTA 4CFMA 2QOCA 4JQ7A 2QHNA 3GU7A 4MVFA 3E7OA 4FL1A 2F4JA 1OIQA 4G3EA 4DHFA 1G8JA 4PDOA 3MH0A 3HV3A 4XBRA 3VBVA 4DG0E 4IWPA 2UZWE 4I4EA 4GUEA 3SHEA 4QP4A 2W1DA 3VO3A 3PJ2A 4AN2A 3R30A 3KK9A 4FKJA 3Q4CA 5B2KA 4NKSA 4NJ3A 3UBDA 4CKJA 1PXPA 3QCYA 1PHKA 3EQBA 3NR9A 4O1OA 3SX9A 4RJ4A 3TCPA 2FYSA 5JGDA 5CVHA 5TOZA 4R3CA 1YI6A 4NSTA 2ACXA 3UQFA 1PMVA 4BICA 4FEXA 4FEQA 4P7EA 3OCBA 4JIAA 4JRVA 4F6UA 1WVWA 3NUUA 4DCEA 3HGKA 5CU3A 1Q8WA 3ANRA 3LZBA 4DA5A 1UU3A 3KIOC 4PF4A 4XCUA 2C5NA 4JG7A 3TNWA 3BQCA 4QD6A 3Q60A 2PMNX 3ODYX 4S33A 3LW0A 3GB2A 4FSRA 4ZOGA 5TKDA 3ZEPA 3R7VA 3R0TA 3AQVA 4U97A 3PUFC 4WO5A 2BVAA 3ZUVA 3U6IA 4DC2A 3VS4A 5EQEA 4Q2AA 5F20A 3D9VA 4DGGA 4DLJA 4FV3A 5JZJA 3UGCA 3QX2A 1ZYSA 4XNEA 4YJVA 3CD8A 3S95A 1PKDA 4V04A 5EM6A 3QA8A 3TZ7A