2ERKA

Phosphorylated map kinase erk2
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
353
structure length
351
Chain Sequence
AAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLEVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Phosphotransferase
molecule keywords EXTRACELLULAR SIGNAL-REGULATED KINASE 2
publication title Activation mechanism of the MAP kinase ERK2 by dual phosphorylation.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 112
structure length 351
sequence length 353
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 1997-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2erkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2erkA01
2CKQA 1XO2B 4WNMA 2IW8A 5DWRA 4FGBA 4YNOA 5M4IA 2WIHA 4I4FA 3VRYA 3CBLA 5DLSA 4DN5A 3VS5A 4ZMFA 4L44A 4G6NA 4IM3A 3BCEA 4GEOA 4ENYA 3OFMA 3VUDA 2H6DA 2C6IA 4O22A 5EM7A 3RPRA 5JQ5A 4AF3A 3S00A 5CF5A 4DTKA 3U6HA 2XNPA 3LMGA 1JKSA 4PV0A 4YPSA 5DEYA 3Q4UA 5AX3A 5IA3A 3TL8A 5M07A 4K77A 4DF3A 2C1AA 5HKMA 3DJ6A 3ULIA 3OUNB 3NIEA 2CSNA 2QG5A 2ZM3A 2R7IA 2C0OA 3ORIA 5GJFA 2WQMA 2YM5A 3LFBA 3N4TA 1NY3A 5E8YA 4IM0A 1R3CA 3ORKA 3TN8A 4ACMA 3QCQA 3FXWA 4OTPA 3EYGA 4NKAA 3L8VA 3NUPA 3OD6X 1ZOEA 3HMOA 4S32A 3T9TA 2PUUA 3TWJA 1YI4A 4D2WA 1CKJA 2CGUA 4RFZA 3E7VA 4AGWA 5GZ8A 4DBXA 4MWHA 5M44A 4IX5A 4RVLA 1M2RA 3VWAA 1GY3A 4RJ5A 3MPMA 3RWQA 3V5TA 4C3RA 3I6UA 2C6EA 1CKIA 2Y0AA 4RPVA 4D55A 1IASA 2VWXA 1OBDA 3ORTA 4TYHA 3AD6A 3G9NA 4HNFA 2OKRA 4I20A 3T8OA 1YXXA 2OH0E 2UZDA 4LGGA 5E8ZA 4FTRA 4BDIA 3QZGA 1WBSA 3BHVA 2IN6A 4GG5A 5IUGA 1OKYA 5D12A 4FV5A 4L67A 2R3PA 4RVTA 2C68A 2YCSA 3FMNA 4RWJA 3F3TA 4USFA 5L8JA 1Q24A 2E9UA 2W1DA 3MY1A 3MESA 3V04A 4TT7A 3SW4A 5JMSA 3KY2A 3ID6C 5DHJA 2GFSA 4DEHA 3DZOA 2UZUE 2EUFB 2FO0A 3Q52A 2FSMX 3PWYA 4JX3A 3QHRA 4MD8E 3Q32A 4ZY6A 2VGOA 4DEAA 5JT2A 2HY81 1YOMA 1TKIA 4M8TA 4DGLC 3RM6A 5CAVA 4F9WA 1DI8A 2QU5A 5B0XA 4GFOA 3ORZA 5BNJA 4PL4A 5HBEA 3FMLA 3QTZA 3QD4A 4RGJA 3TEIA 4BKYA 1MRVA 5EG3A 3FWQA 5CEPA 2UW6A 3MYGA 2YM3A 5F95A 4P90A 4O21A 2BUJA 3UOJA 3EHAA 3QWJA 4L3LA 1XQZA 4WRSA 4CNHA 3A2CA 3Q4TA 4D1SA 2JGZA 3P23A 4AFJA 5IUHA 2C3IB 3DLSA 4EOKA 3Q2JA 4XG3A 5DFPA 2BTRA 3BX5A 4OLIA 4XG9A 4ZLZA 3NUXA 4XG4A 4D5KA 2GU8A 4FE2A 3A62A 3QTXA 2G2FA 4BL1A 1JVPP 3H9OA 5AP3A 5H3QA 4BDAA 3JVRA 3R2YA 4EUUA 3DAJA 3GCSA 4KIQA 5HTCA 4FL2A 3LCOA 3PXZA 2G2IA 4QYGA 4QO9A 3VF8A 2WXVA 4NFNA 5HVKA 4FZFB 3MBLA 2VWUA 2VO3A 1ZZ2A 4WUAA 2VTMA 1KOBA 4FIEA 4S34A 3MFRA 5FDXA 1OL5A 2RGPA 3W8LA 2R9SA 3CQWA 4QYYA 2HZ0A 3A4OX 4FTOA 4MKCA 4Q9ZA 3FL4A 5E8SA 1BI8A 4IZAA 2WTVA 5FBNC 4ASXA 4YO4A 3KVXA 3O8UA 3KRXA 4FTMA 3UOKA 3S4QA 4G3EA 1Q8YA 3TG1A 4E6DA 3UO4A 3VC4A 2ETKA 2Z7LA 3BYVA 3RKBA 4LG4A 2VO0A 3B8QA 5JFXA 2BAKA 2EXMA 4YHTA 3EQGA 4YJVA 3V8TA 3IQ7A 3R1YA 2EB2A 3HRCA 3QTQA 2XNOA 4O0UA 5IQAA 4XLIA 4DTAA 3GUBA 1FPUA 4A7CA 1OL2A 2OZAB 3N4UA 2ZM1A 5D7AA 4EZ7A 5JFSA 3UZPA 4O81A 1GJOA 1VYZA 3RK7A 2CKEA 3OF0A 5HE3A 3ZLYA 3BE2A 5A3XA 4YLLA 5IH4A 2XBJA 3ORXA 1P4FA 1YXUA 2JDVA 5BMMA 5KUPA 4ITIA 5HG8A 4M15A 3R04A 4FKGA 2WTJA 4J52A 3LJ2A 2R3KA 3FMKA 3A8XA 2PE1A 1OKWA 2JFLA 3MFSA 4IDVA 4QP1A 2R3JA 4EOIA 1G8SA 3SV0A 3MFUA 3I7CA 2E9NA 5HQ0A 3C4CA 3R71A 2Q0BA 3FI8A 3OW4A 4EYMA 1VJYA 4EH7A 1OPJA 5E90A 2FSOX 3I0OA 2NRUA 4WBOA 2YLFA 3U6IA 3NAXA 4RIYB 3QGWA 4TZRA 2IPXA 4WSYA 4IC7A 5AX9A 3W2CA 5E91A 1UU3A 3AC5A 4CFNA 2Z2WA 5FTQA 2QU6A 2QOLA 2ZAZA 3FMHA 4YJPA 3WZJA 5L3AA 5L2IA 1BKXA 5GINE 3QQFA 4JOAA 2R3FA 4EI4A 1J7IA 2OFUA 4H3BA 3D83A 2J9MA 5FTGA 2UZWE 2W1EA 4AG8A 3R7IA 5JSMA 1CKPA 4UYAA 4HW7A 2XBAA 1Q3DA 1U59A 5CEQA 3C51A 5GJDA 4QMYA 3C4WA 3COMA 2IZTA 3VAPA 2BKZA 5CSHA 5GJGA 3VBYA 1Q5KA 2IWIA 4F7JA 4PL3A 2X8EA 3QALE 1FMOE 4G16A 2QI8A 3QQUA 4PY1A 1ZYLA 4L00A 4S2ZA 3KKVA 4IEBA 4C02A 2ZYBA 3I6WA 5K0XA 1OUYA 3LCTA 3Q04A 3PE2A 1GIIA 2OJGA 3L8XA 5J7HA 2PMLX 2XP2A 3CKXA 3UNKA 3DKGA 4PRJA 4F99A 3FE3A 4KSPA 1B39A 2VTTA 3MA6A 4KIPA 4O0WA 4U97A 1PXMA 1A06A 4U45A 1RW8A 3I60A 4JS8A 4E5AX 1SZMA 3QXPA 5EI6A 3KN6A 3T3VA 4CFXA 1W7HA 1PXJA 5DR9A 5IQEA 3II5A 4FSMA 1JSTA 3CJFA 2B55A 5EW3A 3LMHA 4F64A 5F94A 4C36A 4XRLA 4BWKA 4PTEA 4TWPA 4GU9A 4X0MA 2PYWA 3ORNA 5DYJA 2BAQA 2OO8X 1FQ1B 3DTWA 5EKNA 3IO7A 2W4KA 3D9VA 2RL5A 1ZAOA 4HYSA 2VTSA 3ZUUA 3JXWA 2VTLA 3JY0A 3C4EA 5CAQA 3MPTA 3R1QA 5KBQA 4FT9A 1M2PA 5C26A 3OXIA 5L2SA 3FEGA 2CLXA 4JRVA 2HYYA 1OIRA 4FZAB 3RJCA 4M66A 3H3CA 2VX1A 2I0YA 4Q5EA 1YDRE 4XEYA 5DRBA 4EH2A 3VW6A 4A4OA 2PUIA 2W1HA 5ETCA 1ATPE 4CQGA 1OITA 1V0OA 4D0XA 4YU2A 4RG0A 4NIFA 3EQCA 4DFUA 4RQKA 4TXCA 2P2IA 2YAKA 2RFDA 4EOLA 4CMUA 5LVPA 4DYMA 5LVOA 3ALOA 3ZSGA 2B52A 4KRCA 4YJOA 4XHKB 2W5BA 5DGZA 4FSTA 2H8HA 2WMAA 3GFEA 3LFQA 3RCDA 1NW1A 1QCFA 4BDCA 2VTHA 4AE6A 1SM2A 4OR5A 4ACHA 4OAUC 2PVNA 2R0UA 2V0DA 4M68A 2BPMA 3LW0A 4F08A 2OGVA 5AAEA 4CXAA 1YRPA 2XCHA 1PMUA 3CY3A 3TNHA 1YHVA 4JL9A 3ZSHA 4ACCA 4G3CA 5AR2A 5F1ZA 4EQMA 3FKOA 4ZSAA 2C5YA 3UDBA 5E4HA 5HIEA 3I1AA 4RJ4A 4YZMA 2XYNA 3GCUA 3OMVA 4Y46A 5TR6A 4IACA 2AC5A 2OLCA 4UZDA 4UALA 3I0QA 3MJ1A 1U54A 4R7HA 3O8TA 2V55A 3QF9A 3V6RA 4F9BA 5DA3A 4MQ1A 4ERWA 4I6QA 3TIZA 2X8DA 4FV8A 4IB0A 5AP7A 3FPQA 4AQCA 2PK9A 3UMXA 3UPXA 4E7WA 2I0EA 3MVLA 4UB7A 3NYOA 5ANDA 3AQVA 2ETMA 1APME 4CFVA 5CNNA 4XV2A 4M0ZA 3SHEA 5LXMA 5FEQA 5CAPA 2Y4IB 4Y72A 4L43A 4RVKA 3QLFA 4XOZA 3SX9A 4EQUA 4RBLA 4OBPA 3PVUA 5FLFA 2HWOA 2Y9QA 3QTRA 2XZSA 4EUTA 5KO1A 1H1SA 3OG7A 4X2JA 4W8DA 5CU3A 3WARA 3E5AA 5I5ZA 1H8FA 3BKBA 3BQRA 3DB6A 3HMNA 1WBVA 3MSSA 4ANBA 2YIYA 2C5OA 2YISA 3P1AA 4FODA 4R3RA 2QOFA 4QP8A 4R1VA 4PQNA 2O0UA 2J90A 1J3HA 4FL1A 5E1EA 5LOHA 1I09A 2WKMA 2YM8A 5IA0A 3L9NA 4AW0A 4TYHB 4ANLA 4LM5A 2OJ9A 4I23A 5CVFA 1DS5A 4APPA 2FYSA 2GS6A 2VZ6A 5L2QA 1VEBA 3ZS5A 4EOPA 3G51A 2OK1A 2XKDA 4D58A 3A7GA 3BGQA 4IE9A 2YCFA 1XH6A 2BDWA 2OJFE 2YCQA 1H28A 4M67A 5BVFA 3ZYAA 3JYAA 3K3IA 1ZWSA 4NCTA 4MVFA 4I94A 4YZBA 3DA6A 3S95A 4L53A 5A6NA 3Q4CA 4DBNA 3ZM4A 4J71A 1J1BA 4OT5A 4Y83A 5TKDA 3TT0A 3LFEA 1M2QA 3HUBA 4MBIA 4I24A 2DS1A 1WFCA 3ZO2A 3VQUA 4IADA 2WQBA 1V1KA 3LJ1A 3IS5A 4RX8A 5B2KA 3CJGA 4FKPA 4AN9A 2VD5A 2G2HA 2C0TA 2YDJA 4FIJA 3UVRA 5ANEA 2E2BA 3PXRA 2WMTA 4IX4A 5T3QA 2V62A 2CDZA 3R73A 3BEAA 4JR7A 2XCKA 5C4LA 3O51A 4J95A 2ITYA 1M17A 2QO7A 3HP5A 4L01A 1WVXA 3Q60A 3UOHA 1UKIA 4CLIA 4O0SA 4DG2E 1WBTA 1U5RA 1JSUA 3LLAA 5GIPE 5H8EA 3D14A 4HJOA 3PY3A 4NM7A 4C35A 4TWNA 5K5XA 1ZXEA 4KKHA 3UP2A 3QTUA 3HLLA 4BKZA 4IBMA 4J96A 4IJ9A 3TKUA 1OIQA 5AP1A 4BHNA 4AZEA 1OMWA 4NJ3A 3QD3A 5AUZA 5HTIA 4QP7A 2GHMA 3OCSA 5AP2A 3R9OA 2YDIA 3W2SA 3FZ1A 2VNWA 3RCJA 4CMOA 2CJMA 3FLQA 2CCHA 3A99A 5M4CA 3BHYA 2BZJA 4B9DA 3LFNA 3R01A 3RGFA 3D7TA 3MGYA 4CV9A 3I5NA 3KXMA 4IH8A 5LVLA 2F7EE 3DBEA 3SRVA 4GS6A 2F7ZE 4K18A 4U44A 1Y8YA 5CZIA 5J87A 5C01A 5ACKA 3VS2A 3ZRKA 4LV5A 4FZ7A 5EOLA 5AR4A 4KINA 4MBLA 2J2IB 2VO7A 2Z7QA 4KS8A 4QYHA 5IA4A 3OC1A 3MH0A 5IQBA 4AN3A 4EL9A 4HCUA 3GNIB 4FEWA 5BVEA 3FMMA 3PSBA 4R8QA 2ERZE 5M53A 1RQQA 4BDBA 2CN5A 3OTUA 5DI1A 4YGAA 3NNWA 4U40A 2PU8A 5FD2A 2JIIA 5GNKA 4EOMA 2PUNA 3TIYA 1ZYCA 4R1YA 4QTAA 4YHJA 5EDPA 2OIBA 3FDNA 3TI1A 4GT3A 4ZJJA 4BZNA 3ODYX 4LGDA 3L9LA 3VBWA 3IOKA 5CNOA 3UIMA 2VO6A 4E4XA 4O2ZA 3DBFA 2P4IA 4RJ6A 1QPCA 4IAKA 3BV3A 3R8LA 4EBWA 5F4NA 5IA1A 3FMDA 5CT7A 3QTIA 3ZDIA 4IB3A 3ZRMA 4EWQA 4FYOA 3AC3A 2ITUA 4GH2A 4GRBA 3U9NA 4R78A 2BVAA 5LMKC 5AP0A 2YZLA 4NFMA 2EWAA 2XIYA 5HG7A 2BRNA 4AAAA 4M0YA 4EQCA 4QNAA 4A9TA 3NPCA 3DOGA 3C4FA 2BROA 5M4FA 2B9HA 4NYEA 2HY0A 4ZMEA 4DFBA 2GNGA 3AC8A 3GEQA 1PXOA 4XBRA 2IZSA 3DK3A 1ZOGA 2C3JA 1S9JA 4I0SA 2WMRA 2PZYA 4QPMA 4ZTNA 1ZOHA 3RM7A 1YXTA 3UPZA 5FDPA 1OL6A 3R0TA 4J98A 3EQFA 4U8ZA 4DGGA 5M08A 3UVQA 4L8MA 3QUEA 3ZFXA 4NL0A 4RWIA 2UZVA 1YKRA 2YACA 2BR1A 5HBHA 4JAIA 4MQ2A 3F2RA 4FTTA 1BX6A 2RFEA 3PG1A 4UYNA 4IDTA 2G9XA 4ZIMA 3TTJA 4IWPA 3KRLA 3EQIA 4RIYA 3D5UA 3MH1A 3AXWA 4UY9A 4FIIA 3POOA 4KS7A 3MPAA 3NIZA 4P5QA 4ITHA 2W05A 5FM3A 4MYGA 4A06A 4BKJA 4F63A 2UW5A 3UGCA 4KBCA 1HOWA 2PL0A 2B1PA 5DE2A 2JDRA 2GDOA 4M14A 2C69A 2X4FA 4RLKA 4DFNA 1OKVA 3DQWA 1ZY5A 4OBOA 4IAIA 1JKLA 1Q8ZA 4YC6A 5HICA 4CTCA 2QOIA 4R6VA 1VZOA 4XOYA 4UMUA 3QQKA 3F9NA 2WOUA 2C47A 3DB8A 3P78A 4TTHB 4C61A 5LWMA 1F0QA 3GU6A 1H26A 3MB6A 4PNKA 3D7ZA 2QD9A 3E8NA 4PDOA 2OICA 2JDTA 4JRNA 4I1ZA 4PP9A 3OVVA 2WELA 2UW7A 3IPHA 2W17A 5IEXA 5D7VA 2WQOA 3DBDA 3QYWA 3EH9A 4FYNA 4A9SA 5JRQA 4GG7A 4ANQA 4S30A 3EMGA 3MVMA 4YBKA 4FZDB 4NIFB 5LJJA 4QYEA 2JIUA 2VX3A 1NVSA 4BVUA 3GB2A 4D2PA 4AU8A 5DG5A 5EOBA 4IB5A 1H1WA 3ZOSA 2VTQA 3KEXA 3V5PA 1J1CA 4RFMA 3FYJX 4U3YA 3TV7A 4XYFA 1YDTE 3TV4A 4DA5A 2F9GA 1XH7A 2W1IA 3DLZA 3LM5A 3GU5A 5AAGA 3ZXZA 1S9IA 4C3FA 3SG8A 2PULA 4NU1A 2OU7A 3O2MA 4Y5HA 4JVGA 5LMKA 3O8PA 1P2AA 3JS2A 4KIOA 2JDOA 4DEGA 2ZB1A 4OBQA 3OEFX 1QL6A 5EKOA 1KE9A 2WTIA 2UVXA 4YTHA 2C5NA 2CHLA 2J5EA 4KIKA 3AMYA 2A1AB 2WU7A 5J1WA 4N57A 3UC3A 5FP6A 1GZNA 1PMVA 1YXSA 5CSVA 5AAFA 5AA8A 3BYMA 3T3UA 3R7UA 1B38A 2GS2A 4I0TA 5IF1A 4ZS0A 4FC0A 5L2TA 4MXCA 1QPDA 4GCJA 4CZYB 1U54B 5IQIA 3CE3A 1GOLA 2RFSA 3DKFA 3W18A 4RA4A 1FOTA 4FIGA 1H24A 3IECA 2QQ7A 3EFJA 3HDNA 3UC4A 1KV2A 2UZTA 2CNQA 4CYIA 1URCA 3OY1A 4DGMA 3D2KA 2C6OA 4C4JA 1OPKA 5K3YA 2UW3A 5KMOA 2R4BA 3D4QA 4JJRA 4LFIA 2XVDA 3BV2A 3LCKA 2W1ZA 2WTCA 3SA0A 5DRDA 2PVYA 3WI6A 5CEIA 5IQCA 4O0YA 5AIKA 3QFVA 4O7RA 4P2KA 3U8WA 3BHTA 3UE4A 2GNFA 3HL7A 3QC4A 5AWMA 4XG8A 4BN1A 2ONLC 3HMIA 4KB8A 4RC2A 4YLJA 2XH5A 5IA2A 3NDMA 3RINA 4FG8A 5CY3A 2X6EA 3SDJA 4EHEA 5HX8A 3CR0A 4RVMA 5ACBC 3AT3A 1Y6BA 3V6SA 1OIUA 3LIJA 5IDPA 3ACKA 3F5GA 4FNZA 4Z7GA 3WILA 4ERKA 5CEMA 2ITVA 4ASZA 2XIKA 4QT1A 3ZUTA 4O7VA 2CGVA 4S31A 4K2RA 3GENA 4RWKA 2IW6A 2B53A 5CX9A 1KE5A 3BQCA 4DFYA 3AG9A 3KGAA 3WIGA 3ZBFA 4RSSA 3KMMA 4EOQA 2ITPA 2W1GA 2Y8OA 4Q9SA 3GU8A 1MRYA 4K9YA 4V05A 4M84A 5AIRA 3GOKA 2Q0NA 4QMZA 3V5WA 3QD0A 3FLNC 3THBA 1WVWA 3FBVA 3PJ1A 5CVGA 1UNGA 2I0VA 4QNYA 4AACA 1ZYDA 2YZAA 4N4SA 2R3HA 4ZJVA 1W82A 3D94A 4JIAA 1ZY4A 2Y7JA 4MNEA 1KWPA 3HV6A 3FLYA 3P79A 3B8RA 3FQEA 1H0VA 2F57A 3DAEA 2OJIA 4IX6A 4EH8A 2RIOA 2JKMA 5HOAA 4KWPA 5LQFA 3OW3A 3TJCA 4CLJA 4FKVA 4LMNA 4RA5A 3VUIA 2IO6A 5EM6A 3L8SA 4YJTA 4FTAA 2BZIB 2QOHA 4EHGA 2FSLX 2WAJA 4APCA 3H9FA 1KE8A 5ANOA 4CSVA 3F5XA 3FPMA 3VS7A 3VRZA 3KFAA 2OSCA 2ACXA 2BZHB 4A9RA 2QO2A 3HA6A 5EI2A 2YN8A 4ANMA 3LE6A 2AUHA 4USEA 2OXYA 2O2UA 4FTNA 2C3LA 4O1OA 4U9AA 2ZOQA 3FZTA 4W4XA 2QG7A 1CMKE 4NM5A 2CGXA 5C03A 3S2PA 4YTCA 3H0ZA 1T45A 1YOJA 4HOKA 4CZUA 3Q2MA 4F6WA 3FC2A 4AOTA 4E4MA 5E92A 2QKWB 4MX9A 4BRXA 4EC8A 1XJDA 2XJ1A 4BDJA 3G0FA 4D5HA 4XRJA 3BRBA 3HMMA 3VS4A 3D7TB 2C6MA 3BBWA 3NYXA 4OTFA 5HHWA 4LOQA 4TNDA 4XV9A 3IKAA 3SRVB 3QD2B 4CCUA 4GKIA 4Y8DA 4HNIA 5D41A 3UP7A 4BF2A 1WBNA 4UMRA 3E93A 4A4XA 1KOAA 2HK5A 4BTKA 3LFAA 2GHGA 2P3GX 3H0YA 3ACJA 4LUDA 4BTJA 4EK3A 4O7SA 3RPYA 3IW7A 3I79A 4MWIA 2XUUA 5EYMA 4AOIA 4DAWA 3IDCA 4GYGA 4ZTQA 3ZTXA 2CGWA 4ZS4A 4AFEA 1YWRA 4X3FC 5E8WA 4IVCA 5JQ8A 4GSBA 1G8AA 2OXDA 4TNBA 4FT5A 2C5XA 4WUNA 2PUPA 4LUEA 2VN9A 4I5MA 5FXSA 4IFGA 3MW1A 4QMWA 5FG8A 3HYHA 3KL8A 3VUGA 3BELA 3TXOA 4B4LA 2WZJA 4Y73A 2DQ7X 2YM4A 3FHRA 4UV0A 4FVQA 2YEXA 4FVRA 3MH3A 3ROYA 1VYWA 3IW4A 3WBLA 4CQEA 1HCLA 3FUPA 4FKIA 4F0FA 4U41A 4MK0A 4BFMA 3BPRA 5IPJA 1DM2A 5FBOA 4JLCA 3LCSA 4LL5A 4WNKA 5G1XA 3G15A 3UO6A 4PDYA 4FTJA 4U0IA 3UIUA 2JBPA 2X2LA 4LI5A 1CM8A 5JGBA 4CD0A 3OXZA 4E73A 3E88A 3PIXA 4CV8A 3DXPA 1XH8A 2ZM4A 4XH6A 3HP2A 3ZLSA 3ZZEA 3U54A 4NZWB 4O38A 2UZBA 3DKOA 3FQSA 4C4EA 4IW0A 4DFLA 4HVSA 4QRCA 1IRKA 4DFZE 4NJDA 4XP2A 1IAJA 4M69A 5CSXA 3WZUA 5HO7A 3ZH8A 3EQPA 4FT3A 2PMIA 3WF5A 4FSWA 3K54A 3VN9A 4CT1A 3TUCA 3AC4A 5J5SA 2CN8A 4YZCA 3VBQA 4D9TA 5FGKA 3LAUA 4K6ZA 4UMTA 4ZZMA 3RHKA 2XKFA 4QQ5A 4QMXA 1PMNA 4H3PA 4E4NA 4L3JA 4JQEA 3R30A 3QCSA 4E1ZA 3C9WA 2CCIA 5EI8A 4ENXA 3R8PA 4DH7A 4YSJA 3PFQA 4FEVA 2W1CA 4YHFA 5C4KA 5C8MA 2H9VA 1FVTA 4NSTA 2NNWB 3GFWA 1O6KA 1KSWA 3HECA 5HD4A 5DT3A 4H05A 1UA2A 1MUOA 1W0XC 3Q4ZA 2HCKA 2VWZA 4Y95A 4PTGA 2RF9A 2YERA 5DVRA 2B9JA 2SRCA 3RAKA 1DAYA 5JGAA 2OF2A 4BCFA 4LRJA 3QGYA 3Q5ZA 4DEBA 4OTQA 2XM8A 2I40A 1FMKA 4O96A 3PRFA 3I7BA 1XBCA 3COKA 2UZNA 3R7VA 3WF8A 1JQHA 4AXAA 1IAHA 2WIPA 3BE9A 2FGIA 3EB0A 4MNFA 4FKWA 5C27A 3V01A 3ZO1A 3F69A 2PMOX 2P55A 3D0EA 5J1VA 4FEXA 3VNTA 5IEYA 3A61A 4FV9A 4G17A 3MTLA 3PJ2A 4TYGA 3SGCA 4RQVA 3VHKA 5BPYA 1J7LA 4FA2A 1P4OA 4CG9A 5KMNA 3ANQA 4YJUA 3POZA 4DEDA 5KCVA 3ZLWA 4RT7A 3LKMA 4GT4A 3OOMA 5J9YA 4O2PA 4PPBA 5D1JA 3QQJA 4WG4A 5HI2A 3RALA 5DR6A 4ALWA 2OXXA 4NTSA 2GPHA 3NYNA 4GVJA 4C2WA 5KZIA 4DITA 3RNIA 3R9NA 1JOWB 4HVGA 3Q9XA 3HZTA 4YZ9A 2ITNA 4D4YA 1PYEA 3R1SA 3IGGA 4L42A 2XA4A 5JN2A 3CTHA 3AGLA 1CDKA 3K5VA 4WOVA 2BRGA 4AUAA 4EH3A 2GNHA 4EHZA 3BLRA 5K5NA 1GZKA 4DCEA 3P9JA 3MDYA 2BZKB 4BI1A 2PY3A 3QKLA 3FZSA 4FV7A 1Z9XA 3O17A 5EHLA 2JC6A 1PKGA 3D2IA 3F2NA 4KBAA 4FZ6A 5FWKK 3D5VA 2QC6A 4CRLA 1SVHA 2IVSA 1ND4A 2WTKB 1E1XA 3EFLA 1REKA 3A8WA 4FIFA 5CQUA 3QYZA 3O7LB 2F2UA 3FKLA 3TTIA 1PW2A 1PYXA 3B2WA 5HE1A 4KIKB 4UWYA 3NUYA 4ZEGA 1NXKA 2X0GA 3ZEPA 5BYYA 4EK4A 3CPCA 1TVOA 3KU2A 4O7YA 1H25A 1Q41A 3E7OA 2J0KA 4HZRA 1V0PA 5F20A 3Q3BA 3R7YA 4AX8A 3SVVA 4PP7A 2QOQA 3VW8A 3MFTA 3LXNA 1XBAA 4F4PA 5BVNA 2XK3A 1H01A 4U80A 3Q9YA 4TY1A 2F2CB 1W83A 2WO6A 1KE6A 4M12A 4YO6A 4RX7A 2YJSA 4Z55A 3ZZWA 5EW8A 4LL0A 4KABA 2PZRA 2C1BA 4UWBA 2F7XE 4O7NA 1LPUA 3SKCA 3UIXA 2X8IA 5JFWA 2ITTA 4JDJA 4A4LA 3TNWA 1OUKA 4DE4A 4KUJA 5T68A 4RMZA 1P5EA 1YOLA 5KMJA 3F7WA 4P5ZA 4X2KA 1GZ8A 2C3KA 4DLJA 5A4CA 3PXQA 3NW7A 2IZRA 4C58A 5C8KA 3CGFA 3DU8A 1BMKA 3GBZA 3CQEA 2UVZA 3HX4A 3GCVA 4PX6A 3PJ3A 3OY3A 3G5DA 4ZTLA 3OUKA 4AT4A 4J8NA 4UXQA 3C0IA 3ENHA 5JZNA 4D28A 3QZIA 1ZARA 5ICPA 5JKGA 3QL8A 5CSWA 4J1RA 4O83A 3ATTA 3CPBA 5IKWA 2G01A 4AE9A 3GT8A 3C50A 4FTCA 4BCQA 5A54A 5KX8A 3UQCA 4K1BA 4DCAA 3Q9WA 4G3DA 3LMIA 4EEVA 4ITJA 4QOXA 4QP6A 3I81A 4X2NA 1M7NA 2BIYA 2C5VA 4MXOA 4O6EA 1PHKA 2ITOA 4YZDA 1Y57A 4A9UA 4XMOA 3EN7A 5HESA 3PDTA 1BUHA 4WG5A 2JBOA 1K9AA 5CTPA 4UWCA 5CQWA 3CC6A 3REPA 4BCNA 5IQDA 2E9VA 2IVTA 1OB3A 1W98A 2JKKA 3EL7A 4J53A 5AV3A 4B8LA 1TQPA 2BAJA 3ET7A 4MNEB 4U7ZA 5I3RA 2PE0A 2YABA 2Y6MA 3G9LX 4YJQA 4C3PA 4FI1A 2GFCA 2QCSA 3CKWA 4B0GA 4I92A 2VTRA 4JXFA 4L7SA 4I22A 3W2PA 2UZEA 5I9UA 5DR2A 4EK6A 5AMNA 3IDPA 5ANIA 4ZSLA 2DUVA 3GU4A 3PIZA 4LOPA 3D15A 3RI1A 4I4EA 2UW8A 3DJ5A 3C4XA 2I1MA 4IIRA 1R0PA 3DKCA 5AP6A 5BUEA 3PY1A 4O1PA 2BFXA 5BUIA 1M7QA 4IAFA 2XK9A 4C7TA 3BWJA 1WVYA 3PXYA 4FR4A 4XV3A 4AW2A 3O7LD 3D5XA 2CLQA 4OTIA 4AZTA 4BCOA 1UVRA 5CXHA 1PKDA 3V8SA 4AZSA 4EOOA 3NVKI 3NUAA 3PE1A 2JDSA 2UW4A 2XK8A 3HUCA 3V8WA 5KKRB 3S1HA 5CT0A 5B7VA 4BBEA 2J4ZA 4YBJA 5CF4A 2GS7A 3EJ1A 4FUYA 4I6BA 4EYJA 5EYKA 3DK7A 2WPAA 2J50A 3GC8A 2Y6OA 2F4JA 2WMUA 2WMVA 4DH8A 4O7WA 3NR9A 2YIRA 4FTQA 3NX8A 3UNZA 4RIXB 3RAHA 4FX3A 2REIA 3KXXA 4C57A 3UG1A 5E7RA 3EN5A 1OIYA 2CPKE 2GTMA 1XHAA 4GL9A 5HTBA 2BFYA 1F5QA 3P86A 1DAWA 3OTVA 4QMMA 4BDHA 3QX2A 4NUSA 4H36A 4NEUA 3FSKA 4ZSJA 5AUTA 3QBNA 5HE2A 4BWPA 4BIDA 5IH6A 2XK6A 3E8CA 4PPCA 3ULZA 3N51A 5BYZA 4F70A 4I6FA 4BBFA 5IMEA 3F5PA 5M4UA 3PLAE 4YC3A 3FJQE 2JKOA 4I93A 3TM0A 4K8AA 3NVMB 3NYVA 4M7IA 3DFCB 3VBTA 4XP0A 4BGQA 4CMTA 4F6UA 1J7UA 4EC9A 3LOKA 3RZFA 3WYYA 3QLGA 4MAOA 4JG7A 5AV2A 4GUBA 3TKHA 1R78A 2PMNX 3ERKA 3Q9ZA 3LLTA 5TE0A 2WQEA 3ALNA 5FP5A 2XF0A 3TCPA 2NO3A 2LAVA 1PXKA 3ZLXA 4FKTA 2X4ZA 4YTFA 3TZ7A 4I5HA 3PXKA 3EN9A 1MQBA 4J99A 4N0SA 4AOJA 4G5PA 3UZTA 2WNTA 2OBJA 4MBJA 3AMAA 3MWUA 4HGSA 5J7BA 5K9IA 4X6QC 4U3ZA 2RSVA 5EFQA 4E26A 5CF6A 4LRKA 3UIBA 4AA0A 3BEGA 3MN3A 4BWXA 5AUUA 3KN5A 4K33A 1Q61A 3CLYA 3HRFA 5DN3A 5L6PA 5B2MA 4O7TA 2A0CX 3BU3A 3DXNA 2AYPA 2VTPA 4Z16A 3MVHA 4WT6A 5A4LA 5AUVA 5DT4A 4FGRA 2EVAA 2OF4A 5EHYA 1PXNA 4JIKA 4IAAA 3QHWA 3JUHA 4JG6A 3K3JA 4BCGA 3DBCA 2OI4X 3R8UA 4BY9E 3TUDA 2HAKA 4AGUA 2BTSA 4TYIA 4ZK5A 1Q97A 2GNJA 3HV4A 1YVJA 2DYLA 3NCZA 4M69B 4ZTMA 3OBJA 4ZSEA 4DG0E 3B2TA 4AZVA 2UW0A 2R64A 4ZP5A 2A19B 3PVWA 4QMNA 4GFGA 1OVEA 5AR3A 1QPJA 4EJ7A 3NZ0A 1XH9A 4U81A 5H9BA 3WF6A 3M42A 4KKEA 4Q2AA 2XNMA 1KE7A 3DT1A 3U9CA 1RJBA 3KULA 3H4JA 1GAGA 3KRWA 4D0WA 3VS0A 1JNKA 4RC4A 2ITXA 2LGCA 2X7FA 3FI4A 3CP9A 4CG8A 3BYOA 4O0VA 2J0JA 4O7LA 5ITAA 4JBVA 4QP2A 4QMOA 3EOCA 3VS3A 2A4LA 2BALA 2GMXA 3GQIA 5LMAA 4Z7HA 3JPVA 4WHZA 2QOBA 1YW2A 5JRSA 1YHSA 3FYKX 3QCYA 3QCXA 1XWSA 4KNBA 4BDKA 4E3CA 4ACGA 4CVAA 5FQDC 4FBXA 4BGGA 5DOSA 4DH1A 5L6OA 4ZTHA 2R2PA 4O0TA 2Z7RA 4GVAA 4C37A 3IGOA 1WMKA 3SLSA 5I9ZA 3NNUA 2OH4A 4K0YA 3FZRA 5HBJA 1ERKA 1UNHA 3F2AA 2ZV8A 3W2QA 3DAKA 3VUKA 4C38A 4D4RA 2HZNA 3OROA 4DEIA 4ALUA 2VWWA 3VUTA 3EFWA 5CEKA 4U6RA 4FOCA 4ANSA 2ZMCA 4OW8A 5C8NA 3FZOA 4X3FB 5BMSA 3DBQA 1PRYA 3FI3A 4V04A 1YDSE 1XKKA 3VVHA 2Z7SA 2PVMA 5G6VA 4EK8A 3CTJA 3G90X 4H58A 3W2RA 2I7QA 1SMHA 1JPAA 1AD5A 3BU5A 2R3OA 3KMUA 5BQ0A 3F61A 4IWQA 4XV1A 5KZ0A 2B9FA 3PPJA 5FXRA 4IZYA 3ZBXA 5BVDA 4XG7A 3GCQA 3BLHA 3E8DA 4KKGA 4WBBB 3FXXA 3UVPA 1PF8A 1QPEA 2PVKA 3EZRA 4I5CA 4L46A 4PNIA 5AADA 4IXPA 2QURA 5J5TA 3MIAA 5ANKA 3G6GA 2O5KA 2WD1A 3C5IA 3KK9A 3GC0A 3P08A 3G2FA 4FKUA 3RPSA 5HIBA 4RIWA 2RFNA 4HYIA 5HORA 3CD3A 4GIHA 1IA8A 3PG3A 5EM8A 2WU6A 2PVRA 4GU6A 3GI3A 5HVJA 3KVWA 1H1QA 2AC3A 1GIHA 5L8LA 3IDBA 4QMVA 5CF8A 5CXZA 4XCUA 3V3VA 2XEYA 5HO6A 3U6JA 4L7FA 2BDJA 1JKKA 4YTIA 3DK6A 5JEBA 3GC7A 4LRMA 2IW9A 4E20A 3EQBA 4H1MA 3LFFA 3ZC5A 4PMPA 3TJDA 4FT0A 5IG1A 4PF4A 3MVJA 3NCGA 1FBNA 2R3NA 4L9IA 4CZTA 4EORA 4AT5A 5AR8A 4E5WA 4ASEA 4MXAA 3KMWA 4AA5A 5JGDA 1Z57A 5J9LA 4ZXTA 5HGIA 5HX6A 4QMTA 3DV3A 1CSNA 3HRBA 3TZMA 3IW6A 3Q6WA 2HW7A 5AM6A 3I4BA 4JT3A 4JDHA 2Y4IC 3KXHA 4W8EA 3DGKA 3L9PA 4FSQA 4RJ7A 3IK3A 1RDQE 2ITWA 4CKIA 3AT2A 3D5WA 3F82A 3BZ3A 1VR2A 1RE8A 5L2WA 4Z3VA 3R22A 3CTQA 4L3PA 4GK4A 4DG3E 4E4LA 3ORMA 1ZLTA 2CKPA 1UU7A 4EH9A 1Q62A 5BUJA 4XG6A 2W0JA 1BL6A 2VWYA 3KA0A 4DH5A 3R21A 4JI9A 1TQIA 2GNLA 4J97A 4IVDA 4DHFA 1FVRA 1W8CA 2YJRA 3AC2A 4BCMA 4MXXA 3OT3A 1G5SA 4ASDA 4C4HA 2YIQA 3Q96A 2GTNA 5K4JA 5FTOA 4H39A 3U4UA 3TZ8A 1NVQA 3OWPA 2VWIA 4UBAA 2DWBA 2QNJA 4IVAA 1ZZLA 3C4ZA 4FTKA 3R1NA 1F3MC 4GUEA 4TPTA 4BI0A 2JFMA 4EH4A 4ZLYA 4FKRA 4G1WA 4ZAUA 3R7EA 4HYHA 4CFFA 3NLBA 5CU0A 4U79A 4IFCA 2G1TA 3HKOA 3O96A 4F1MA 4F6SA 2WTWA 4YLKA 2V7OA 4EOSA 5GZ9A 1YWNA 4KSQA 2R7BA 3DY7A 3N9XA 3OS3A 2YM7A 4WG3A 4AWIA 4K11A 2I0HA 3F5UA 4BR3A 4O84A 5IEVA 4G9RA 2C30A 3NUSA 1UNLA 2PTKA 4DT9A 2QR8A 4YSMA 2R3QA 1PY5A 4FNWA 3GOPA 4FV4A 5E8TA 4RJ8A 4EKLA 1SNXA 3K5UA 3KXGA 4QMLA 4LQMA 1R39A 2X81A 5LWNA 3PRIA 2J0IA 2KULA 4S33A 4XNEA 3QZFA 5J95A 3ZU7A 4L45A 4UN0C 3PTGA 3OCGA 1BYGA 3BGPA 3WE4A 1IEPA 4FTUA 3R9HA 2OZOA 5KHWA 2QLQA 1Q3WA 4OTWA 2GHLA 3NS9A 4UX9A 4PMTA 4DGNA 2OIDA 4AZWA 4JQ7A 3RP9A 1A48A 5EQYA 4FL3A 1MQ4A 2W99B 3CQUA 3UMWA 4RIOA 4L68A 4NW6A 3TACA 4B7TA 2JAMA 4KAOA 5AV0A 3R02A 2VU3A 4I6HA 4PDPA 1CTPE 4MEDA 4C8BA 3EKKA 4PWNA 4TKSA 3KB7A 3A7FA 3NMUF 3DZQA 4AGCA 5EDRA 4BGHA 2XIXA 1ZYJA 5ETIA 1H1PA 3P4KA 4C0TA 2XIZA 5CVHA 2UW9A 5HE0A 1LEWA 3EQDA 2XKEA 3ZXTA 5CU2A 3PVBA 3VJNA 4D4VA 1XBBA 1J91A 1FINA 2V5QA 5AJQA 4O27B 4R5YA 5I0BA 2WFYA 3W16A 5HU3A 4QP9A 4RJ3A 5A4QA 3K2LA 3U55A 3R9DA 4HVIA 3F3UA 3M11A 4D9UA 1YI6A 1R0EA 4NH1A 5DIAA 2YLEA 3FXZA 4F65A 3CIKA 2VWBA 3SXSA 2R3GA 4QTCA 3ZEWA 5FUTA 4ANNA 1O6YA 3FKNA 5HEZA 4E6QA 3DJ7A 4IMYA 4D2RA 1FVVA 2R3IA 5AP4A 5H8BA 5EQEA 3PA5A 2WHBA 5D11A 4IWOA 4JG8A 3BHUA 3GU7A 4MXZA 4BDGA 3ORPA 3HA8A 3QWKA 2R3RA 4DT8A 2ESMA 3QC9A 3HMPA 2Z8CA 2XKCA 3DDPA 2X7GA 4FSUA 4PTCA 4RIXA 2QR7A 4FKSA 2RG6A 3IOPA 4FNXA 2ZDUA 3MY5A 1LEZA 3LFDA 3RZBA 3E64A 3BYSA 3DDQA 1SNUA 5A46A 5TF9A 4GK3A 5EYDA 2ITZA 3KQ7A 3PWDA 4XP3A 5GHVA 5KMMA 2JAVA 3KRJA 3RNYA 4FMQA 3ZCLA 2ZJWA 4F9YA 3G33A 4Y85A 4QD6A 4YJNA 3HV7A 3EKNA 3C5UA 5EHOA 3COHA 3AD5A 4BICA 4ZZNA 4BZDA 2ONLA 4YUQA 5IQHA 2IVVA 4F7NA 2EU9A 5BX0A 1QMZA 5D10A 3TDVA 1P14A 2ZV9A 2NPQA 2HWPA 2XB7A 2CMWA 4WRGA 3V5QA 4BDFA 1Z5MA 4FV3A 1Q8TA 4G3GA 4BDDA 3KREA 3ANRA 2BKKA 4D1XA 3R7OA 5JFVA 4R3PA 1U5QA 4HGLA 3SQQA 1UU9A 2WMQA 3S0OA 1OKZA 3KXNA 4I5PA 5HU9A 5JZJA 4FV2A 4V0GA 4CKRA 5LCJA 5AV4A 1WBPA 2OJJA 4HGEA 3QA8A 4KRDA 3MTFA 4GIIA 4NW5A 3R8VA 3UQGA 3V5JA 3WZDA 4EZ5A 3KULB 2QOCA 4IQ6A 4ALVA 3P5KA 4PUZA 3O71A 2IJMA 1LR4A 3TV6A 4NWMA 2A27A 4OGRA 4U42A 5IQGA 4TL0A 2YM6A 4XLVA 1E9HA 3GCPA 3JVSA 2HXQA 2BRHA 3FY0A 4O0XA 2PSQA 4GJ3A 5KMKA 3SC1A 1AQ1A 5E8XA 2Z60A 2J5FA 3BLQA 4HPUE 3L9MA 5CWZA 1IR3A 1XH5A 3A7IA 3TKIA 3ITZA 3PPKA 4TRLA 4JBQA 2JD5A 3PA3A 3AMBA 2X9FA 3NW6A 4BTMA 4FG9A 1H4LA 3FLWA 3PXFA 4UZHA 3VS6A 5D9HA 1Q8UA 4LMUA 3SXRA 3HV3A 5AUWA 5DEWA 5DMZA 4GV1A 4BDEA 3H9RA 4FK6A 2HXLA 4X21A 5HNBA 4CT2A 4WD5A 3KRRA 2PE2A 3LQ5A 3NEWA 3AGMA 3LXLA 2WEVA 4F0IA 5E9EA 3MB7A 2EXCX 1G3NA 2QOKA 2GCDA 4GT5A 1L8TA 3EWHA 2VRXA 3CY2A 4AT3A 3UO5A 1WAKA 1MRUA 3VHEA 2VGPA 3OBGA 3CCNA 4RC3A 2YDKA 3NW5A 3FHIA 4HYUA 4FV0A 4QMSA 2X6DA 5HD7A 1OM1A 4KBKA 3BWFA 3BU6A 4MD9E 3PZHA 2YFXA 5ETAA 2J0LA 3FAAA 3LVPA 3WYXA 4EK5A 2RKUA 3DTCA 3F66A 4EZ3A 3C1XA 5CI6A 4MD7E 1NVRA 2B9IA 3C7QA 4CFMA 2E9PA 4HCTA 3G6HA 3SD0A 4D2VA 4Z9LA 4R77A 2UVYA 4RIWB 3U51A 2XK4A 1GZOA 3VBVA 2QO9A 1UWJA 5FRIA 1SVGA 4D4SA 3HEGA 3KK8A 5E1SA 3LXPA 5L6WL 1PXLA 4QQTA 5IQFA 4JR3A 4X3FA 4Q5HA 3O23A 4RRVA 3W8QA 5EQPA 5K4IA 1E1VA 2R3MA 3C0HA 3C0GA 1EH4A 5LVMA 3R7GA 4H1JA 4QTBA 5AV1A 2CNUA 3W33A 4F0GA 1SVEA 3FC1X 2W5AA 2X9EA 4R7BA 3PUPA 2QODA 3Q5IA 4CCBA 2FB8A 2ZB0A 3AC1A 4C62A 2W9ZB 5CALA 5FXQA 4GKHA 2R0IA 4DGOA 4QMQA 5H2UA 3QA0A 4U5JA 1PXPA 4M97A 4QP3A 4AW1A 3H30A 2WGJA 4PL5A 5HVYA 4M13A 1BI7A 2YA9A 4OTRA 1Y8GA 3DS6A 4FKQA 3UOLA 4RZVA 3R9RA 5LARA 2YHVA 3OHTA 2FUMA 3LCDA 4OAVB 2BIKB 2PVHA 3IONA 3PVGA 2UZOA 2JITA 1V0BA 1OPLA 2B7AA 4XS2A 3SG9A 5AR5A 1STCE 3QAME 5AM7A 3PY0A 4A07A 4V01A 4F09A 4UMPA 4C4GA 5I4NA 1H07A 3FLZA 4FTLA 2VV9A 2GQRA 5CSPA 2UUEA 1YXVA 2VNYA 4GJ2A 4E5BA 4F9CA 4IB1A 4P4CA 5A4TA 4LV8A 2YIWA 3ZO4A 5KE0A 2QVSE 4DINA 4WIHA 3TNPC 4EONA 4OTGA 1OGUA 1XR1A 2W4JA 2ZV2A 4JBOA 4UXLA 5KHXA 3S3IA 4X2FA 4QTEA 3FLSA 4R3CA 2ZVAA 5LMBA 3UQFA 5CS6A 4BCIA 1ZMWA 3DNDA 4CRSA 3NRMA 2V22A 2C6DA 5JK3A 1W84A 4BCHA 2XEZA 3EYHA 3EN4A 4ZOGA 4AZFA 5CEOA 2HENA 3KF7A 2HELA 4C4IA 2BHHA 4C59A 1M52A 4LOOA 2EB3A 5HO8A 5TT7A 3SOAA 3WE8A 4AS0A 3FV8A 4E93A 5CASA 3UODA 4F1OA 5HG9A 3VULA 1TQMA 1FGIA 4RX5A 4W4WA 3E87A 5M57A 4WNOA 5TO8A 4EJNA 3EFKA 5K0KA 2XNEA 3R8ZA 2WMXA 2C6LA 3PYYA 3QX4A 4G31A 2BMCA 2WEIA 3BHHA 3LM0A 4NCTC 2ZV7A 3E62A 3F88A 3ZFMA 4DFXE 5IZFA 2PVFA 3UZRA 4OTHA 3WOWA 2X7OA 1JLUE 1PXIA 1K3AA 3EIDA 3T9IA 4YURA 4X3JA 2IG7A 5CU4A 1A9UA 2YITA 4TWCA 4BHZA 2W96B 3QRKA 1Q4LA 3IW5A 3ODZX 5CYIA 5AEPA 5AP5A 4DTBA 3MI9A 4JBPA 2HOGA 3COIA 2X1NA 3FMEA 2R5TA 3P7BA 4G34A 3E8EA 4CEGA 4B99A 4F7LA 4G3FA 4YR8A 1H00A 3KC3A 4FKOA 4PMSA 4FV6A 4O6LA 4YNEA 3R00A 3TZ9A 4JDKA 2Q83A 2CKOA 4TWOA 4L52A 5HCXA 5M56A 5HNGA 2VTIA 5BVKA 3ZHPC 3AOXA 3SW7A 1IG1A 3NNXA 5GIOE 5B2LA 3F3VA 4FK3A 4OUCA 3MS9A 4FEUA 5M09A 3PSCA 2EXEA 3ATSA 1KUTA 2XNNA 4EH5A 2B4SB 2R3LA 4ZZOA 3C13A 4IZ7A 2V7AA 5IUIA 3RVGA 3JR1A 4YP8A 4X6RA 4ZSGA 4FTIA 1U4DA 3AD4A 4ONAA 4BC6A 3MIYA 3DPKA 2WB8A 2X39A 4QTDA 5CENA 4I0RA 4OTDA 4AN2A 3IG7A 3LFSA 2ETRA 4WA9A 2YWPA 4ANOA 4HGTA 4XG2A 4AP7A 5E8VA 5I3OA 4BYJA 4F9AA 3EL8A 3JY9A 3OWLA 4RX9A 3MV5A 2QLUA 5TOZA 4JDIA 2HW6A 3U4WA 4IWDA 3VO3A 2XYUA 4NK9A 4G9CA 3RBWA 2ERKA 3OOGA 3FZPA 5HCZA 4DC2A 5HNIX 5EH0A 4RWLA 3NWWA 4ZY4A 2W9FB 3Q53A 4FG7A 2J0MB 2XJ0A 4I41A 4C4FA 3R2BA 5I9YA 3GC9A 3DFAA 1OL1A 1H27A 3BYUA 4KA3A 3OT8A 4EH6A 3ZM9A 3KCFA 3NNVA 3VBXA 3O0GA 2QKRA 2C6TA 2W5HA 4MF0A 1UKHA 4BCJA 4E6AA 3IW8A 3R8MA 2VTNA 1HCKA 3W2OA 4E6CA 2QHNA 4QMPA 4AA4A 4G2FA 3PZEA 5DPVA 2B0QA 1JBPE 1BLXA 4UMQA 3CS9A 5A4EA 1H0WA 2FA2A 2YWVA 3R63A 1OL7A 3MA3A 2PPQA 3CSVA 4XJ0A 5IISA 2O8YA 4C34A 5KNJA 5M06A 3NSZA 5HLNA 4FSNA 1JWHA 5AUYA 1JKTA 3P7AA 4RLLA 4USDA 2XRUA 3KCKA 2A2AA 4GK2A 3WF7A 1YI3A 4EOJA 1OZ1A 2X2MA 5ETFA 3UNJA 2OFVA 2VWVA 3A7HA 4ACDA 2J6MA 3A4PA 2XM9A 3PLSA 4PMMA 5EM5A 3AT4A 3DNEA 5M55A 4GMYA 1UWHA 2BILB 5CANA 5CU6A 4QPAA 3N4VA 3KXZA 2XS0A 4BTFA 5T6KA 3RK5A 3TDWA 2GQSA 2BRBA 5I9XA 2XK7A 2WQNA 5LCKA 3H10A 4O91A 2PZPA 3HNGA 3QUDA 5L4QA 3QKKA 1OBGA 3A7JA 3G0EA 3LQ3A 4BB4A 4FOBA 4IZ5A 5FM2A 3QQHA 3NUNA 4CTBA 5ANJA 5KMIA 3ZO3A 3TNQB 1U46A 3RAWA 3PP1A 2FH9A 3EQRA 2WTDA 3FL5A 4QQJA 1O9UA 4G6LA 5AA9A 5C1QB 3LFCA 2P33A 3GXLA 2O64A 4MH7A 1PJKA 3P7CA 4V0GB 4CYJA 5H8GA 3QQLA 2PZ5A 5DT0A 3U87A 4QYFA 3UYSA 5A6OA 5A9UA 3QU0A 4MTAA 1YWVA 4EKKA 3ZRLA 2QONA 3UG2A 4JNWA 1H08A 2W4OA 2I6LA 4YZNA 1PMEA 4TYJA 3PJCA 4N70A 4IX3A 4BI2A 3VF9A 3ZDUA 2VTAA 3RMFA 5EYCA 3QZHA 4R5SA 3SXFA 4E8AA 3VIDA 5AFVA 4IANA 4U43A 2XJ2A 5HLPA 3QXOA 1REJA 5IMXA 2ITQA 1R1WA 2W1FA 2VUWA 4HVDA 4YPDA 4PPAA 2F49A 2J51A 5IA5A 4C2VA 3W32A 3LQ8A 2XRWA 4YJSA 1NT2A 1M14A 4D2SA 4QPSA 2B54A 1WCCA 4ZLOA 4WNPA 3W55A 5EK7A 4H3QA 2WOTA 3L1SA 2XNGA 5DBXA 1IA9A 3PA4A 1K2PA 1UV5A 1L3RE 3PP0A 1AGWA 3LJ0A 4JAJA 2H96A 2XIRA 3QRJA 5HZNA 3I5ZA 4MXYA 4DH3A 4NTTA 2J7TA 4HCVA 4C33A 5CAOA 3V51A 1NA7A 4X2GA 1H1RA 3F6XA 5IH5A 2C4GA 4PDSA 3QRTA 3RWPA 2X2KA 3ZFYA 4TW9A 1Y91A 1WBOA 2ZDTA 2PHKA 3A60A 2VTJA 3FI2A 4FUXA 3HVCA 3VS1A 4BBMA 1BL7A 2KTYA 4FEQA 5A14A 5DNRA 5KBRA 4II5A 5CZHA 3QRIA 2HZ4A 5FEDA 4BCKA 4M3QA 3E3PA 4BIEA 3NAYA 3ZUVA 3OWJA 5KMLA 1OI9A 5CI7A 2UV2A 2PWLA 3LPBA 2XMYA 5CAUA 2PVJA 2YIXA 4O82A 4RZWA 1FGKA 2PZIA 2FVDA 2WTKC 2JIVA 5EDQA 4CKJA 2OZAA 3HGKA 4FSRA 4HPTE 4NKSA 2JKQA 4A9YA 5AUXA 3F3WA 5EW9A 4B6LA 5HIDA 2WMBA 4FNYA 2IVUA 5AR7A 4ZTSA 2W06A 2CNVA 3M1SA 4DLIA 1I44A 3R6XA 4CGAA 2NP8A 4N6ZA 4QQCA 3DCVA 4I3ZA 4FKLA 5JH6A 1Q8WA 1YQJA 2PVLA 4CFWA 4YMJA 3GVUA 5J79A 3BBTB 3RAIA 2VX0A 5DH3A 4BIBA 1JAMA 4HVHA 3LZBA 1Q99A 1MP8A 3LHJA 3LXKA 3M2WA 4Y5QA 1GNGA 2BDFA 4FVPA 4ID7A 2IZUA 1X8BA 2OG8A 1ZYSA 3TNIA 2HZIA 3QQGA 1UU8A 3V5LA 1ZMUA 4FKJA 4XX9A 3PPZA 3ORLA 3WIKA 4HZSA 4EWHA 2UZLA 3KF4A 4GW8A 3VUMA 2YCRA 4IM2A 3PIYA 1LP4A 4FIHA 4BYIA 1XH4A 4JQ8A 4TN6A 1B6CB 2HIWA 4FICA 4MF1A 2WMWA 3DQXA 3E63A 3FMJA 3QRUA 3CGOA 4BCPA 2ZMDA 4F1TA 5IU2A 3GQLA 4TYEA 3SOCA 4J7BA 5M51A 3MJ2A 1JSVA 3QUPA 4IJPA 4D1ZA 2GSFA 3RPOA 5I9VA 1LUFA 2C0IA 2C6KA 3EQHA 3PSDA 3UBDA 3MY0A 3E92A 4FV1A 4N6YA 4IHPA 4AGDA 2GQGA 4ZTRA 3RK9A 4O86A 5FEEA 3CEKA 3R28A 5F9EA 3UTOA 3F7ZA 2XNBA 4IAYA 4JX7A 4AW5A 2Z02A 2VAGA 3GP0A 3NUUA 3RPVA 3MH2A 3ROCA 3DXQA 4MCVA 2NRYA 2VTOA 4XBUA 5IDNA 3QKMA 4R7IA 5E8UA 5HLWA 3EZVA 5CLPA 2OW3A 2P0CA 4XUFA 4W9XA 4B8MA 3O50A 3VQHA 2H34A 4LYNA 5LVNA 1ZRZA 3HDMA 5HG5A 4YJRA 2W7XA 4NM0A 3UYTA 1WZYA 2OIQA 2BCJA 3ZMMA 3RTPA 4UEUA 5ANGA 3ETAA 3WZEA 3BI6A 2GNIA 3EN6A 1YHWA 4I21A 3FY2A 3HAMA 3OCBA 3HAVA 4BZOA 2JEDA 1URWA 5BYLA 2JLDA 1Y6AA 2OWBA 3L8PA 4W9WA 4YC8A 3VUHA 3GGFA 2QHMA 5J9ZA 3OEZA 3PJ8A 3ELJA 4WKQA 1KV1A 1SYKA 4G6OA 3ZSIA 4GYIA 3UJGA 4OT6A 3QTSA 1GIJA 1O6LA 4FT7A 4NM3A 4WO5A 4DEEA 4IVBA 3FQHA 3R83A 4ZY5A 5I9WA 3OWKA 3ENMA 4ORKA 1DI9A 4P7EA 4W4VA 3WZKA 3RHXA 3Q6UA 3OCTA 5J8IA 2O63A 3OZ6A 4F7SA 5GZAA 2O3PA 4ZJIA 3OP5A 4D2TA 2QOOA 4G5JA 3OXTA 5KKRC 4CFUA 3CD8A 3ZONA 4LGHA 3TUBA 3W1FA 3P0MA 3VJOA 3NGAA 2WMSA 3CXWA 4X7QA 4EBVA 4GFMA 2BHEA 2FSTX 1OECA 2Y4PA 4O7ZA 4O0RA 5HCYA 2RG5A 3BGZA 3WF9A 2G15A 5C9CA 4WSQA 3QTWA 4QMUA 4FF8A 4NT4A 3W10A 5L8KA 2O65A 4L6QA 4FSYA 5BVOA 2BRMA 3ZC6A 3FSFA 4IC8A 3HV5A 1WBWA 1ZMVA 3BIZA 2P2HA 1T46A 3E3BX 4QP4A 2YAAA 4RFYA 2E9OA 4J8MA 4W4YA 4EHVA 3SAYA 4IAZA 5BVWA 4MHAA 4KD1A 4ARKA 3F3ZA 4FSZA
chains in the Genus database with same CATH superfamily
2CKQA 1XO2B 4WNMA 2IW8A 5DWRA 4FGBA 4YNOA 5M4IA 2WIHA 4I4FA 3VRYA 3CBLA 5DLSA 4DN5A 3VS5A 4ZMFA 4L44A 4G6NA 4IM3A 3BCEA 4GEOA 4ENYA 3OFMA 3VUDA 2H6DA 2C6IA 4O22A 5EM7A 3RPRA 5JQ5A 4AF3A 3S00A 5CF5A 4DTKA 3U6HA 2XNPA 3LMGA 1JKSA 4PV0A 4YPSA 5DEYA 3Q4UA 5AX3A 5IA3A 3TL8A 5M07A 4K77A 4DF3A 2C1AA 5HKMA 3DJ6A 3ULIA 3OUNB 3NIEA 2CSNA 2QG5A 2ZM3A 2R7IA 2C0OA 3ORIA 5GJFA 3W0QA 2WQMA 2YM5A 3LFBA 3N4TA 1NY3A 5E8YA 4IM0A 1R3CA 3ORKA 3TN8A 4ACMA 3QCQA 3FXWA 4DHZA 4OTPA 3EYGA 4NKAA 3L8VA 3NUPA 3OD6X 1ZOEA 3HMOA 4S32A 3T9TA 2PUUA 3TWJA 1YI4A 4D2WA 1CKJA 2CGUA 4RFZA 3E7VA 1G8JA 4AGWA 5GZ8A 4DBXA 4MWHA 5M44A 4IX5A 4RVLA 1M2RA 3VWAA 1GY3A 4RJ5A 3MPMA 3RWQA 3V5TA 4C3RA 3I6UA 2C6EA 1CKIA 2Y0AA 4RPVA 4D55A 1IASA 2VWXA 1OBDA 3ORTA 4TYHA 3AD6A 3G9NA 4HNFA 2OKRA 4I20A 3T8OA 1YXXA 2OH0E 2UZDA 4LGGA 5E8ZA 4FTRA 4BDIA 3QZGA 1WBSA 3BHVA 3W0NA 2IN6A 4GG5A 5IUGA 1OKYA 5D12A 4FV5A 4L67A 2R3PA 4RVTA 2C68A 2YCSA 3FMNA 4RWJA 3F3TA 4USFA 5L8JA 1Q24A 2E9UA 2W1DA 3MY1A 3MESA 3V04A 4TT7A 3SW4A 5JMSA 3KY2A 3ID6C 5DHJA 2GFSA 4DEHA 3DZOA 2UZUE 2EUFB 2FO0A 3Q52A 2FSMX 3PWYA 4JX3A 3QHRA 4MD8E 3Q32A 4ZY6A 2VGOA 4DEAA 5JT2A 2HY81 1YOMA 1TKIA 4M8TA 4DGLC 3RM6A 5CAVA 4F9WA 1DI8A 2QU5A 5B0XA 4GFOA 1XMLA 3ORZA 5BNJA 4PL4A 5HBEA 3FMLA 3QTZA 3QD4A 4RGJA 3TEIA 4BKYA 1MRVA 5EG3A 3FWQA 5CEPA 2UW6A 3MYGA 2YM3A 5F95A 4P90A 4O21A 2BUJA 3UOJA 3EHAA 3QWJA 4L3LA 1XQZA 4WRSA 4CNHA 3A2CA 3Q4TA 4D1SA 2JGZA 3P23A 4AFJA 5IUHA 2C3IB 3DLSA 4EOKA 3Q2JA 4XG3A 5DFPA 2BTRA 3BX5A 4OLIA 4XG9A 4ZLZA 3NUXA 4XG4A 4D5KA 2GU8A 4FE2A 3A62A 3QTXA 2G2FA 4BL1A 1JVPP 3H9OA 5AP3A 5H3QA 4BDAA 3JVRA 3R2YA 4EUUA 3DAJA 3GCSA 4KIQA 5HTCA 4FL2A 3LCOA 3PXZA 2G2IA 4QYGA 4QO9A 3VF8A 2WXVA 4NFNA 5HVKA 4FZFB 3MBLA 2VWUA 2VO3A 1ZZ2A 4WUAA 2VTMA 1KOBA 4FIEA 4S34A 3MFRA 5FDXA 1OL5A 2RGPA 3W8LA 2R9SA 3CQWA 4QYYA 2HZ0A 3A4OX 4FTOA 4MKCA 4Q9ZA 3FL4A 5E8SA 1BI8A 4IZAA 2WTVA 5FBNC 4ASXA 4YO4A 3KVXA 3O8UA 3KRXA 4FTMA 3UOKA 3S4QA 4G3EA 1Q8YA 3TG1A 4E6DA 3UO4A 3VC4A 2ETKA 2Z7LA 3BYVA 3RKBA 4LG4A 2VO0A 3B8QA 5JFXA 2BAKA 2EXMA 4YHTA 3EQGA 4O4FA 4YJVA 3V8TA 3IQ7A 3R1YA 2EB2A 3HRCA 3QTQA 2XNOA 4O0UA 5IQAA 4XLIA 4DTAA 3GUBA 1FPUA 2X0QA 4A7CA 1OL2A 2OZAB 3N4UA 2ZM1A 5D7AA 4EZ7A 5JFSA 3UZPA 4O81A 1GJOA 1VYZA 3RK7A 2CKEA 3OF0A 5HE3A 3ZLYA 4LDTA 3BE2A 5A3XA 4YLLA 5IH4A 2XBJA 3ORXA 2X0PA 3NFGB 1P4FA 1YXUA 2JDVA 5BMMA 5KUPA 4ITIA 5HG8A 4M15A 3R04A 4FKGA 3BLAA 2WTJA 4J52A 3LJ2A 2R3KA 3FMKA 3A8XA 2PE1A 1OKWA 2JFLA 3MFSA 4IDVA 4QP1A 2R3JA 4EOIA 1G8SA 3SV0A 3MFUA 3I7CA 2E9NA 5HQ0A 3C4CA 3R71A 2Q0BA 3FI8A 3OW4A 4EYMA 1VJYA 4EH7A 1OPJA 5E90A 2FSOX 3I0OA 2NRUA 4WBOA 2YLFA 3U6IA 3NAXA 4RIYB 3QGWA 4TZRA 2IPXA 4WSYA 4IC7A 5AX9A 3W2CA 5E91A 1UU3A 3AC5A 4CFNA 2Z2WA 5FTQA 2QU6A 2QOLA 2ZAZA 3FMHA 4YJPA 3WZJA 5L3AA 5L2IA 1BKXA 5GINE 3QQFA 4JOAA 2R3FA 4EI4A 1J7IA 2OFUA 4H3BA 3D83A 2J9MA 5FTGA 2UZWE 2W1EA 4AG8A 3R7IA 5JSMA 1CKPA 4UYAA 4HW7A 2XBAA 1Q3DA 1U59A 5CEQA 3C51A 5GJDA 4QMYA 3C4WA 3COMA 2IZTA 3VAPA 2BKZA 5CSHA 5GJGA 3VBYA 1Q5KA 2IWIA 4F7JA 4PL3A 2X8EA 3QALE 1FMOE 4G16A 2QI8A 3QQUA 4PY1A 1ZYLA 4L00A 4S2ZA 3KKVA 4IEBA 4C02A 2ZYBA 3I6WA 5K0XA 1OUYA 3LCTA 3Q04A 3PE2A 1GIIA 2OJGA 3L8XA 5J7HA 2PMLX 2XP2A 3CKXA 3UNKA 2AQXA 3DKGA 4PRJA 4F99A 3FE3A 4KSPA 1B39A 2VTTA 3MA6A 4KIPA 4O0WA 4U97A 1PXMA 1A06A 4U45A 1RW8A 3I60A 4JS8A 4E5AX 1SZMA 3QXPA 5EI6A 3KN6A 3T3VA 4CFXA 1W7HA 1PXJA 5DR9A 5IQEA 3II5A 4FSMA 1JSTA 3CJFA 2B55A 5EW3A 3LMHA 4F64A 5F94A 4C36A 4XRLA 4BWKA 3UDSA 4PTEA 4TWPA 4GU9A 4X0MA 2PYWA 3ORNA 5DYJA 2BAQA 2OO8X 1FQ1B 3DTWA 5EKNA 3IO7A 2W4KA 3D9VA 2RL5A 1ZAOA 4HYSA 2VTSA 3ZUUA 3JXWA 2VTLA 3JY0A 3C4EA 5CAQA 3MPTA 3R1QA 5KBQA 4FT9A 1M2PA 5C26A 3OXIA 5L2SA 3FEGA 2CLXA 4JRVA 2HYYA 1OIRA 4FZAB 3RJCA 4M66A 3H3CA 2VX1A 2I0YA 4Q5EA 1YDRE 4XEYA 5DRBA 4EH2A 3VW6A 4A4OA 2PUIA 2W1HA 5ETCA 1ATPE 4CQGA 1OITA 1V0OA 4D0XA 4YU2A 4RG0A 4NIFA 3EQCA 4DFUA 4RQKA 4TXCA 2P2IA 2YAKA 2RFDA 4EOLA 4CMUA 5LVPA 4DYMA 5LVOA 3ALOA 3ZSGA 2B52A 4KRCA 4YJOA 4XHKB 2W5BA 5DGZA 4FSTA 2H8HA 2WMAA 3GFEA 3LFQA 3RCDA 1NW1A 1QCFA 4BDCA 2VTHA 4AE6A 3UDZA 1SM2A 4OR5A 4ACHA 4OAUC 2PVNA 2R0UA 2V0DA 4M68A 2BPMA 3LW0A 4F08A 2OGVA 5AAEA 4CXAA 1YRPA 2XCHA 1PMUA 3CY3A 3TNHA 1YHVA 4JL9A 3ZSHA 4ACCA 4G3CA 5AR2A 1XMMA 5F1ZA 4EQMA 3FKOA 4ZSAA 2C5YA 3UDBA 5E4HA 5HIEA 3I1AA 4RJ4A 4YZMA 2XYNA 3GCUA 3OMVA 4Y46A 5TR6A 4IACA 2AC5A 2OLCA 4UZDA 4UALA 3I0QA 3MJ1A 1U54A 4R7HA 3O8TA 2V55A 3QF9A 3V6RA 4F9BA 5DA3A 4MQ1A 4ERWA 4I6QA 3TIZA 2X8DA 4FV8A 4IB0A 5AP7A 3FPQA 4AQCA 2PK9A 3UMXA 3UPXA 4E7WA 2I0EA 3MVLA 4UB7A 3NYOA 5ANDA 3AQVA 2ETMA 1APME 4CFVA 5CNNA 4XV2A 4M0ZA 3SHEA 5LXMA 5FEQA 4AXCA 5CAPA 2Y4IB 4Y72A 4L43A 4RVKA 3QLFA 4XOZA 3SX9A 4EQUA 4RBLA 4OBPA 3PVUA 5FLFA 4AXDA 2HWOA 2Y9QA 3QTRA 2XZSA 4EUTA 5KO1A 1H1SA 3OG7A 4X2JA 4W8DA 5CU3A 3WARA 3E5AA 5I5ZA 1H8FA 3BKBA 3BQRA 3DB6A 3HMNA 1WBVA 3MSSA 4ANBA 2YIYA 2C5OA 2YISA 3P1AA 4FODA 4R3RA 2QOFA 4QP8A 4R1VA 4PQNA 2O0UA 2J90A 1J3HA 4FL1A 5E1EA 5LOHA 1I09A 2WKMA 2YM8A 5IA0A 3L9NA 4AW0A 4TYHB 4ANLA 4LM5A 2OJ9A 4I23A 5CVFA 1DS5A 4APPA 4FJVA 2FYSA 2GS6A 2VZ6A 5L2QA 1VEBA 3ZS5A 4EOPA 3G51A 2OK1A 2XKDA 4D58A 3A7GA 3BGQA 4IE9A 2YCFA 1XH6A 2BDWA 2OJFE 2YCQA 1H28A 4M67A 5BVFA 3ZYAA 3JYAA 3K3IA 1ZWSA 4NCTA 4MVFA 4I94A 4YZBA 3DA6A 3S95A 4L53A 5A6NA 3Q4CA 4DBNA 3ZM4A 4J71A 1J1BA 4OT5A 4Y83A 5TKDA 3TT0A 3LFEA 1M2QA 3HUBA 4MBIA 4I24A 2DS1A 1WFCA 3ZO2A 3VQUA 4IADA 2WQBA 1V1KA 3LJ1A 3IS5A 4RX8A 5B2KA 3CJGA 4FKPA 4AN9A 2VD5A 2G2HA 4QDEA 2C0TA 2YDJA 4FIJA 3UVRA 5ANEA 2E2BA 3PXRA 2WMTA 3TYKA 4IX4A 5T3QA 2V62A 2CDZA 3R73A 3BEAA 4JR7A 2XCKA 5C4LA 3O51A 4J95A 2ITYA 1M17A 2QO7A 3HP5A 4L01A 1WVXA 3Q60A 3UOHA 1UKIA 4CLIA 4MUQA 4O0SA 4DG2E 1WBTA 1U5RA 1JSUA 3LLAA 5GIPE 5H8EA 3D14A 4HJOA 3PY3A 4NM7A 4C35A 4TWNA 5K5XA 1ZXEA 4KKHA 3UP2A 3QTUA 3HLLA 4BKZA 4IBMA 4J96A 4IJ9A 3TKUA 1OIQA 5AP1A 4BHNA 4AZEA 1OMWA 4NJ3A 3QD3A 5AUZA 5HTIA 4QP7A 2GHMA 3OCSA 5AP2A 3R9OA 2YDIA 3W2SA 3FZ1A 2VNWA 3RCJA 4CMOA 2CJMA 3FLQA 2CCHA 3A99A 5M4CA 3BHYA 2BZJA 4B9DA 3LFNA 3R01A 3RGFA 3D7TA 3MGYA 4CV9A 3I5NA 3KXMA 4IH8A 5LVLA 2F7EE 3DBEA 3SRVA 4GS6A 2F7ZE 4K18A 4U44A 1Y8YA 5CZIA 5J87A 5C01A 5ACKA 3VS2A 3ZRKA 4LV5A 4FZ7A 5EOLA 5AR4A 4KINA 4MBLA 2J2IB 2VO7A 2Z7QA 4KS8A 4QYHA 5IA4A 3OC1A 3MH0A 5IQBA 4AN3A 4EL9A 4HCUA 3GNIB 4FEWA 5BVEA 3FMMA 3PSBA 4R8QA 2ERZE 5M53A 1RQQA 4BDBA 2CN5A 3OTUA 5DI1A 4YGAA 3NNWA 4U40A 2PU8A 5FD2A 2JIIA 5GNKA 4EOMA 2PUNA 3TIYA 1ZYCA 4R1YA 4QTAA 4YHJA 5EDPA 2OIBA 3FDNA 3TI1A 4GT3A 4ZJJA 4BZNA 3ODYX 4LGDA 3L9LA 3W0OA 3VBWA 3IOKA 5CNOA 3UIMA 2VO6A 4E4XA 4O2ZA 3DBFA 2P4IA 4RJ6A 1QPCA 4IAKA 3BV3A 3R8LA 4EBWA 5F4NA 5IA1A 3FMDA 5CT7A 3QTIA 3ZDIA 4IB3A 3ZRMA 4EWQA 4FYOA 3AC3A 2ITUA 4GH2A 4GRBA 3U9NA 4R78A 2BVAA 3TMOA 5LMKC 5AP0A 2YZLA 4NFMA 2EWAA 2XIYA 5HG7A 2BRNA 4AAAA 4M0YA 4EQCA 4QNAA 4A9TA 3NPCA 3DOGA 3C4FA 2BROA 5M4FA 2B9HA 4NYEA 2HY0A 4ZMEA 4DFBA 2GNGA 3AC8A 3GEQA 1PXOA 4XBRA 2IZSA 3DK3A 1ZOGA 2C3JA 1S9JA 4I0SA 2WMRA 2PZYA 4QPMA 4ZTNA 1ZOHA 3RM7A 1YXTA 3UPZA 5FDPA 1OL6A 3R0TA 4J98A 3EQFA 4U8ZA 4DGGA 5M08A 3UVQA 4L8MA 3QUEA 3ZFXA 4NL0A 4RWIA 2UZVA 1YKRA 2YACA 2BR1A 5HBHA 4JAIA 4MQ2A 3F2RA 4FTTA 1BX6A 2RFEA 3PG1A 4UYNA 4IDTA 2G9XA 4ZIMA 3TTJA 4IWPA 3KRLA 3EQIA 4RIYA 3D5UA 3MH1A 3AXWA 4UY9A 4FIIA 3POOA 4KS7A 3MPAA 3NIZA 4P5QA 4ITHA 2W05A 5FM3A 4MYGA 4A06A 4BKJA 4F63A 2UW5A 3UGCA 4KBCA 1HOWA 2PL0A 2B1PA 5DE2A 2JDRA 2GDOA 4M14A 2C69A 2X4FA 4RLKA 4DFNA 1OKVA 3DQWA 1ZY5A 4OBOA 4IAIA 1JKLA 1Q8ZA 4YC6A 5HICA 4CTCA 2QOIA 4R6VA 1VZOA 4XOYA 4UMUA 3QQKA 3F9NA 2WOUA 2C47A 3DB8A 3P78A 4TTHB 4C61A 5LWMA 1F0QA 3GU6A 1H26A 3MB6A 4PNKA 3D7ZA 4QDVA 2QD9A 3E8NA 4PDOA 2OICA 2JDTA 4JRNA 4I1ZA 4PP9A 3OVVA 2WELA 2UW7A 3IPHA 4I6LA 2W17A 5IEXA 5D7VA 2WQOA 3DBDA 3QYWA 3EH9A 4FYNA 4A9SA 5JRQA 3W0SA 4GG7A 4ANQA 4S30A 3EMGA 3MVMA 4YBKA 4FZDB 4NIFB 5LJJA 4QYEA 2JIUA 2VX3A 1NVSA 4BVUA 3GB2A 4D2PA 4AU8A 5DG5A 5EOBA 4IB5A 1H1WA 3ZOSA 2VTQA 3KEXA 3V5PA 1J1CA 4RFMA 3FYJX 4U3YA 3TV7A 4XYFA 1YDTE 3TV4A 4AQKA 4DA5A 2F9GA 2AEGA 1XH7A 2W1IA 3DLZA 3LM5A 3GU5A 5AAGA 3ZXZA 1S9IA 4C3FA 3SG8A 2PULA 4NU1A 2OU7A 3O2MA 4Y5HA 4JVGA 5LMKA 3O8PA 1P2AA 3JS2A 4KIOA 2JDOA 4DEGA 2ZB1A 4OBQA 3OEFX 1QL6A 5EKOA 1KE9A 2WTIA 2UVXA 4YTHA 2C5NA 2CHLA 2J5EA 4KIKA 3AMYA 2A1AB 2WU7A 5J1WA 4N57A 3UC3A 5FP6A 1GZNA 1PMVA 1YXSA 5CSVA 5AAFA 5AA8A 3BYMA 3T3UA 3R7UA 1B38A 2GS2A 4I0TA 5IF1A 4ZS0A 4FC0A 5L2TA 4MXCA 1QPDA 4GCJA 4CZYB 1U54B 5IQIA 3CE3A 1GOLA 2RFSA 3DKFA 3W18A 4RA4A 1FOTA 4FIGA 1H24A 3IECA 2QQ7A 3EFJA 3HDNA 3UC4A 1KV2A 2UZTA 2CNQA 4CYIA 1URCA 3OY1A 4DGMA 3D2KA 2C6OA 4C4JA 1OPKA 5K3YA 2UW3A 5KMOA 2R4BA 3D4QA 4JJRA 4LFIA 2XVDA 3BV2A 3LCKA 2W1ZA 2WTCA 3SA0A 5DRDA 2PVYA 3WI6A 5CEIA 5IQCA 4O0YA 5AIKA 3QFVA 3W0RA 4O7RA 4P2KA 3U8WA 3BHTA 3UE4A 2GNFA 3HL7A 3QC4A 5AWMA 4XG8A 4BN1A 2ONLC 3HMIA 4KB8A 4RC2A 4YLJA 2XH5A 5IA2A 3NDMA 3RINA 4FG8A 5CY3A 2X6EA 3SDJA 4EHEA 5HX8A 3CR0A 4RVMA 5ACBC 3AT3A 1Y6BA 3V6SA 1OIUA 3LIJA 5IDPA 3ACKA 3F5GA 4FNZA 4Z7GA 3WILA 4ERKA 5CEMA 2ITVA 4ASZA 2XIKA 4QT1A 3ZUTA 4O7VA 2CGVA 4S31A 4K2RA 3GENA 4RWKA 2IW6A 2B53A 5CX9A 1KE5A 3BQCA 4DFYA 3AG9A 3KGAA 3WIGA 3ZBFA 4RSSA 3KMMA 4EOQA 2ITPA 2W1GA 2Y8OA 4Q9SA 3GU8A 1MRYA 4K9YA 4V05A 4M84A 5AIRA 3GOKA 2Q0NA 4QMZA 3V5WA 3QD0A 3FLNC 3THBA 1WVWA 3FBVA 3PJ1A 5CVGA 1UNGA 2I0VA 4QNYA 4AACA 1ZYDA 2YZAA 4N4SA 2R3HA 4ZJVA 1W82A 3D94A 4JIAA 1ZY4A 2Y7JA 4MNEA 1KWPA 3HV6A 3FLYA 3P79A 3B8RA 3FQEA 1H0VA 2F57A 3DAEA 2OJIA 4IX6A 4EH8A 2RIOA 2JKMA 5HOAA 4KWPA 5LQFA 3OW3A 3TJCA 4CLJA 4FKVA 4LMNA 4RA5A 3VUIA 2IO6A 5EM6A 3L8SA 4YJTA 4FTAA 2BZIB 2QOHA 4EHGA 2FSLX 2WAJA 4APCA 3H9FA 1KE8A 5ANOA 4CSVA 3F5XA 3FPMA 3VS7A 3VRZA 3KFAA 2OSCA 2ACXA 2BZHB 4A9RA 2QO2A 3HA6A 5EI2A 2YN8A 4ANMA 3LE6A 2AUHA 4USEA 2OXYA 2O2UA 4FTNA 2C3LA 4O1OA 4U9AA 2ZOQA 3FZTA 4W4XA 2QG7A 1CMKE 4NM5A 2CGXA 5C03A 3S2PA 4YTCA 3H0ZA 1T45A 1YOJA 4HOKA 4CZUA 2XAMA 3Q2MA 4F6WA 3FC2A 4AOTA 4E4MA 5E92A 2QKWB 4MX9A 4BRXA 4EC8A 1XJDA 2XJ1A 4BDJA 3G0FA 4D5HA 4XRJA 3BRBA 3HMMA 3VS4A 3D7TB 2C6MA 3BBWA 3NYXA 4OTFA 5HHWA 4LOQA 4TNDA 4XV9A 3IKAA 3SRVB 3QD2B 4CCUA 2XAOA 4Y8DA 4GKIA 4HNIA 5D41A 3UP7A 4BF2A 1WBNA 4UMRA 3E93A 4A4XA 1KOAA 4DDGA 2HK5A 4BTKA 3LFAA 2GHGA 2P3GX 3H0YA 3ACJA 4LUDA 4BTJA 4EK3A 4O7SA 3RPYA 3IW7A 3I79A 4MWIA 2XUUA 5EYMA 4AOIA 4DAWA 3IDCA 4GYGA 4ZTQA 3ZTXA 2CGWA 4ZS4A 4AFEA 1YWRA 4X3FC 5E8WA 4IVCA 5JQ8A 4GSBA 1G8AA 2OXDA 4TNBA 4FT5A 2C5XA 4WUNA 2PUPA 4LUEA 2VN9A 4I5MA 5FXSA 4IFGA 3MW1A 4QMWA 5FG8A 3HYHA 3KL8A 3VUGA 3BELA 3TXOA 4B4LA 2WZJA 4Y73A 2DQ7X 2YM4A 3FHRA 4UV0A 4FVQA 2YEXA 4FVRA 3MH3A 3ROYA 1VYWA 3IW4A 3WBLA 4CQEA 1HCLA 3FUPA 4FKIA 4F0FA 4U41A 4MK0A 4BFMA 3BPRA 5IPJA 1DM2A 5FBOA 4JLCA 3LCSA 4LL5A 4WNKA 5G1XA 3G15A 3UO6A 4PDYA 4FTJA 4U0IA 3UIUA 2JBPA 2X2LA 4LI5A 1CM8A 5JGBA 4CD0A 3OXZA 4E73A 3E88A 3PIXA 4CV8A 3DXPA 1XH8A 2ZM4A 4XH6A 3HP2A 3ZLSA 3ZZEA 3U54A 4NZWB 4O38A 2UZBA 3DKOA 3FQSA 4C4EA 4IW0A 4DFLA 4HVSA 4QRCA 1IRKA 4DFZE 4NJDA 4XP2A 1IAJA 4M69A 5CSXA 3WZUA 5HO7A 3ZH8A 3EQPA 4FT3A 2PMIA 3WF5A 4FSWA 3K54A 3VN9A 4CT1A 3TUCA 3AC4A 5J5SA 2CN8A 4YZCA 3VBQA 4D9TA 5FGKA 3LAUA 4K6ZA 4UMTA 4ZZMA 3RHKA 2XKFA 4QQ5A 4QMXA 1PMNA 4H3PA 4E4NA 4L3JA 4JQEA 3R30A 3QCSA 4E1ZA 3C9WA 2CCIA 5EI8A 4ENXA 3R8PA 4DH7A 4YSJA 3PFQA 4FEVA 2W1CA 4YHFA 5C4KA 5C8MA 2H9VA 1FVTA 4NSTA 2NNWB 3GFWA 1O6KA 1KSWA 3HECA 5HD4A 5DT3A 4H05A 1UA2A 1MUOA 1W0XC 3Q4ZA 2HCKA 2VWZA 4Y95A 4PTGA 2RF9A 2NYAA 2YERA 5DVRA 2B9JA 2SRCA 3RAKA 1DAYA 5JGAA 2OF2A 4BCFA 4LRJA 3QGYA 3Q5ZA 4DEBA 4OTQA 2XM8A 2I40A 1FMKA 4O96A 3PRFA 3I7BA 1XBCA 3COKA 2UZNA 3R7VA 3WF8A 1JQHA 4AXAA 1IAHA 2WIPA 3BE9A 2FGIA 3EB0A 4MNFA 4O4CA 4FKWA 5C27A 3V01A 3ZO1A 3F69A 2PMOX 2P55A 3D0EA 5J1VA 4FEXA 3VNTA 5IEYA 3A61A 4FV9A 4G17A 3MTLA 3PJ2A 4TYGA 3SGCA 4RQVA 3VHKA 5BPYA 1J7LA 4FA2A 1P4OA 4CG9A 5KMNA 3ANQA 4YJUA 3POZA 4DEDA 5KCVA 3UDTA 3ZLWA 4RT7A 3LKMA 4GT4A 3OOMA 5J9YA 4O2PA 4PPBA 5D1JA 3QQJA 4WG4A 5HI2A 3RALA 5DR6A 4ALWA 2OXXA 4NTSA 2GPHA 3NYNA 4GVJA 4C2WA 5KZIA 4JMQA 4DITA 3RNIA 3R9NA 1JOWB 4HVGA 3Q9XA 3HZTA 4YZ9A 2ITNA 4D4YA 1PYEA 3R1SA 3IGGA 4L42A 2XA4A 5JN2A 3CTHA 3AGLA 1CDKA 3K5VA 4WOVA 2BRGA 4AUAA 4EH3A 2GNHA 4EHZA 3BLRA 5K5NA 1GZKA 4DCEA 3P9JA 3MDYA 2BZKB 4BI1A 2PY3A 3QKLA 3FZSA 4FV7A 1Z9XA 3O17A 5EHLA 2JC6A 1PKGA 3D2IA 3F2NA 4KBAA 4FZ6A 5FWKK 3D5VA 2QC6A 4CRLA 1SVHA 2IVSA 1ND4A 2WTKB 1E1XA 3EFLA 1REKA 3A8WA 3BL7A 4FIFA 5CQUA 3QYZA 3O7LB 2F2UA 3FKLA 3TTIA 1PW2A 1PYXA 3B2WA 5HE1A 4KIKB 4UWYA 3NUYA 4ZEGA 1NXKA 2X0GA 3ZEPA 5BYYA 4EK4A 3CPCA 1TVOA 3KU2A 4O7YA 1H25A 1Q41A 3E7OA 2J0KA 4HZRA 1V0PA 5F20A 3Q3BA 3R7YA 4AX8A 3SVVA 4PP7A 2QOQA 3VW8A 3MFTA 3LXNA 1XBAA 4F4PA 5BVNA 2XK3A 1H01A 4U80A 3Q9YA 4TY1A 2F2CB 1W83A 2WO6A 1KE6A 4M12A 4YO6A 4BJJA 4RX7A 2YJSA 4Z55A 3ZZWA 5EW8A 4LL0A 4KABA 2PZRA 2C1BA 4UWBA 2F7XE 4O7NA 1LPUA 3SKCA 3UIXA 2X8IA 5JFWA 2ITTA 4JDJA 4A4LA 3TNWA 1OUKA 4DE4A 4KUJA 5T68A 4RMZA 1P5EA 1YOLA 5KMJA 3F7WA 4P5ZA 4X2KA 1GZ8A 2C3KA 4DLJA 5A4CA 3PXQA 3NW7A 2IZRA 4C58A 5C8KA 3CGFA 3DU8A 1BMKA 3GBZA 3CQEA 2UVZA 3HX4A 3GCVA 4PX6A 3PJ3A 3OY3A 3G5DA 4ZTLA 3OUKA 4AT4A 4J8NA 4UXQA 3C0IA 3ENHA 5JZNA 4D28A 3QZIA 1ZARA 5ICPA 5JKGA 3QL8A 5CSWA 4J1RA 4O83A 3ATTA 3CPBA 5IKWA 2G01A 4AE9A 3GT8A 3C50A 4FTCA 4BCQA 5A54A 5KX8A 3UQCA 4K1BA 4DCAA 3Q9WA 4G3DA 3LMIA 4EEVA 4ITJA 4QOXA 4QP6A 3I81A 4X2NA 1M7NA 2BIYA 2C5VA 4MXOA 4O6EA 1PHKA 2ITOA 4YZDA 1Y57A 4A9UA 4XMOA 3EN7A 5HESA 3PDTA 1BUHA 4WG5A 2JBOA 1K9AA 5CTPA 4UWCA 5CQWA 3CC6A 3REPA 2A98A 4BCNA 5IQDA 2E9VA 2IVTA 1OB3A 1W98A 2JKKA 3EL7A 4J53A 5AV3A 4B8LA 1TQPA 2BAJA 3ET7A 4MNEB 4U7ZA 5I3RA 2PE0A 2YABA 2Y6MA 3G9LX 4YJQA 4C3PA 4FI1A 2GFCA 2QCSA 3CKWA 4B0GA 4I92A 2VTRA 4JXFA 4L7SA 4I22A 3W2PA 2UZEA 5I9UA 5DR2A 4EK6A 5AMNA 3IDPA 5ANIA 4ZSLA 2DUVA 3GU4A 3PIZA 4LOPA