2ERKA

Phosphorylated map kinase erk2
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
353
structure length
351
Chain Sequence
AAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLEVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXTRACELLULAR SIGNAL-REGULATED KINASE 2
publication title Activation mechanism of the MAP kinase ERK2 by dual phosphorylation.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Phosphotransferase
total genus 112
structure length 351
sequence length 353
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 1997-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2erkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2erkA01
4WT6A 4QTCA 4UYAA 5GNKA 3GT8A 3K3IA 2HWPA 4UXQA 3FC1X 3VUGA 1XH9A 5AFVA 5AAGA 4PTEA 2QC6A 3R71A 2AUHA 4FL1A 4BCQA 3ORPA 5EW3A 4YPSA 3PXRA 4EOPA 2C6DA 5AIRA 5DEWA 2R3OA 3EQPA 2GNIA 3NUUA 4K33A 5C8KA 3ZZWA 4AFJA 3DFAA 4QP9A 2PE2A 5HIDA 2CGUA 4O81A 1GJOA 4KIKA 4M84A 3KMWA 3D2IA 4J97A 1KE5A 4BICA 3VS4A 5GINE 4HVHA 1IG1A 1X8BA 3O71A 4IVBA 3ZLYA 4S33A 3QALE 3PA5A 4JIAA 4I6FA 4G17A 3BHYA 4QMTA 3KRLA 1LPUA 3GOPA 4MKCA 5AP2A 2OG8A 3OMVA 3O23A 2UZNA 4M68A 3NS9A 2NRUA 2IPXA 1ZYSA 4PP9A 3BWJA 1UV5A 4S31A 4S34A 3QTQA 4YNOA 5H9BA 4ERWA 4G16A 2W1FA 2YM8A 4WBOA 3D0EA 3OY3A 3QTRA 5E8YA 5G6VA 4A9TA 3W8QA 3IDCA 4CFMA 2ZDUA 1VYZA 2ZMCA 1J7LA 5FTOA 4TY1A 4UXLA 4AZSA 4F99A 4X6RA 2XYUA 4DCAA 2W1IA 3TCPA 1M7NA 3DB6A 3GCPA 3KC3A 4FV6A 4WNOA 4D2PA 1KE6A 4DHFA 1KSWA 4KIQA 5L2IA 4DGOA 4JBOA 1BX6A 4WD5A 4EK6A 4L9IA 3S1HA 2PZPA 5CF5A 4GCJA 4D0XA 4GKIA 3Q9YA 4W9XA 5FLFA 4OAVB 1NY3A 2QCSA 4ZOGA 4K77A 4G3FA 5JFSA 2WTKC 4AT4A 4E6AA 1YXUA 3DZOA 1IEPA 2VU3A 1SYKA 1YI3A 3VUMA 3RAKA 4JXFA 3EFLA 3ZLSA 3MVHA 3MJ2A 3R8ZA 3R1NA 1R0PA 2UVZA 1OPJA 5ACKA 5I5ZA 4LV5A 2V5QA 3LKMA 3NDMA 4EOLA 3I6UA 3D4QA 3FQHA 4PPAA 4ZSGA 5JSMA 2F57A 4FNYA 5M07A 1OIYA 2HW6A 4P90A 3QCYA 4TNDA 4X2NA 3ZO4A 3WF5A 4FSWA 4I24A 3F3ZA 5AR8A 3MGYA 2Y4IB 1CTPE 1FINA 3L8VA 3VUIA 3LMIA 4K6ZA 4O7WA 4A06A 2ZV7A 2C0IA 5D9HA 5AUUA 4FYNA 3EWHA 2IVSA 4I1ZA 3RNIA 4D2TA 4L3PA 4OTQA 3OCSA 3TNHA 2V7AA 4CMOA 2XKFA 3DS6A 1YXTA 2NO3A 3DK7A 5KKRB 1KE9A 3QBNA 3RCDA 4IWQA 5EHYA 4ACGA 2ZV9A 3LE6A 4L52A 5CQWA 1W83A 2HENA 4X7QA 2OZAA 2BKZA 4MXOA 3BHTA 3CEKA 3AC1A 3Q96A 4BHZA 1JPAA 1SVGA 3QQUA 1WVYA 4IAAA 3BHUA 4E4XA 2VO0A 5D10A 3F3TA 4F1TA 4ZEGA 5AUTA 4G31A 1V0BA 3VS2A 1BL7A 2BHHA 1TQIA 4I5CA 5CU2A 4BZOA 4WO5A 4M12A 4F7NA 3LFBA 4QPAA 3QL8A 2QO9A 1E1VA 3R02A 2R3JA 3M2WA 4KSQA 3QUDA 5J1VA 1QPEA 2FVDA 3ZFXA 5IA4A 3BKBA 4QMPA 1FMKA 3LQ5A 3M11A 4DEGA 4RWKA 3CLYA 4FT3A 5EHLA 3ZRLA 1ZMVA 2XIYA 4BYJA 4HYSA 4D1ZA 1XH8A 2ITQA 3RK5A 1PXIA 4NM5A 4CTCA 1YWRA 2XYNA 4H39A 2YIWA 2ITXA 3BE2A 2ETRA 3VRYA 3R8VA 3SXFA 2XZSA 4RLKA 3C4FA 3CD8A 3QQLA 4UMUA 3LFNA 4KBKA 2YM4A 4IIRA 3K5VA 4ZSEA 2XIXA 4BR3A 3CE3A 5E8UA 4BZDA 1WAKA 4IJ9A 2PZ5A 4CMTA 2UZUE 4F4PA 5CF6A 3MA6A 3P0MA 3ORTA 4J7BA 2EUFB 3VUDA 4HGSA 3ZFMA 1J1BA 4LRKA 4X0MA 4ZMFA 3ULIA 2OJIA 2R0IA 2R7BA 4HW7A 1GIJA 2I40A 2GFSA 3I1AA 1YVJA 3L8XA 4ZTQA 4BDKA 1Q8UA 4CMUA 4EOOA 1YWNA 3SOCA 1M2RA 3IOKA 5JQ8A 2WIPA 1BKXA 4M69B 1ZY5A 5DNRA 4L3JA 1ZYJA 2W5AA 3R7EA 4BYIA 4D2RA 2IVTA 4LYNA 5LCJA 2Y9QA 4XRLA 5D7AA 1M2QA 4L68A 3C51A 2W9ZB 3IW7A 3CD3A 3FY0A 1HCKA 2VX3A 3MDYA 4LFIA 2WMBA 3VVHA 3FLSA 4X2GA 5HQ0A 1ZYDA 2CPKE 4GYIA 1DI8A 4K11A 5EM7A 4C7TA 4OUCA 5J79A 5LVOA 3BWFA 5HE1A 3PSBA 4FZ7A 2IN6A 3R21A 5TF9A 4CFNA 4DC2A 5KBQA 5JZNA 1PYEA 3F5XA 2QOBA 4HVSA 5IEXA 3NYNA 5ANEA 4MWHA 2G15A 3W1FA 2X6DA 3L9PA 5FUTA 5GHVA 2XP2A 3L9NA 3NVMB 3N9XA 5C9CA 2J4ZA 1OIRA 3DTCA 2YIYA 4JL9A 3HMPA 2XBJA 2NNWB 2YERA 3RWPA 2R7IA 2C4GA 4X2JA 5IEYA 2EXCX 3QTIA 5J5SA 2UW0A 4EKKA 3UVPA 4E26A 3KCKA 2YCQA 2O63A 4FSMA 4KBAA 4RWLA 3FPQA 4D28A 1A48A 4G9CA 3T9TA 4U79A 4FTOA 4JR3A 4QMMA 4ZSJA 1XHAA 4IXPA 1XBAA 4FC0A 1ZOGA 1URCA 2WTWA 3BYSA 3HP2A 5L8LA 4EBVA 4ASEA 2YHVA 5C03A 5A4EA 3KN5A 4FNWA 4FTAA 1A9UA 3NUXA 3R9NA 3S2PA 4X3FB 4XBRA 4O7RA 1Q8YA 3II5A 2YWPA 4FK3A 3F7WA 2BRGA 2J7TA 5DPVA 5LMKC 3SOAA 2R3KA 4EK8A 3R73A 3VBYA 3JPVA 2W5HA 4C59A 2XEYA 2OIQA 5EH0A 1Z57A 2YZLA 3TZ7A 3FMHA 3EZVA 3FMKA 4NW5A 4U7ZA 3V5PA 2BMCA 2P55A 3AC4A 4W8DA 4YHJA 1U46A 4OW8A 3R7VA 3HUBA 4J53A 4BWPA 2DQ7X 3V5LA 5HCYA 5HD7A 4F1OA 3IS5A 4G9RA 4U3YA 3HV3A 3BYUA 4L53A 3HZTA 3RTPA 5BMMA 4FGRA 5GZ9A 4HVGA 4JBPA 2WB8A 3NUAA 4Y46A 3ANRA 3THBA 3VBQA 4C3RA 5B2LA 1OPLA 3Q32A 5AAEA 3ENMA 3KULB 1TQPA 3EQRA 2PVJA 5H2UA 1H1SA 5KMOA 3E8NA 4YURA 4BBFA 3UZTA 3PLSA 4FA2A 4YZCA 2JFLA 3I81A 1J1CA 4KKHA 1W8CA 5AP7A 4CG8A 2HXQA 1REKA 3HAVA 3BPRA 4MXAA 2WIHA 2BRMA 4O0UA 5TOZA 4XMOA 4RBLA 3JYAA 2JAVA 3PE1A 5HX6A 3PWYA 4RRVA 3KK8A 2WQBA 2W4OA 3GNIB 5CNNA 1Y6AA 1U54B 3PJCA 3QD4A 5JH6A 3FSFA 4ZS4A 3NRMA 3TNQB 5HVYA 3QQHA 3RVGA 3MSSA 3QAME 4FYOA 5CU4A 1ERKA 4CTBA 2ESMA 4RVTA 5KZIA 2XIZA 5CENA 4FT0A 3EH9A 2OXXA 4O1OA 5IDPA 1JLUE 2W1ZA 4ANLA 3FMNA 1STCE 3PA4A 4ZZNA 5L6OA 4R7IA 3VBVA 5E1EA 4AGUA 3U6IA 4ID7A 4FKTA 5K4IA 4NWMA 3D5XA 3IONA 4BDBA 4R5SA 4II5A 3QQFA 3PY0A 4HVIA 2YIXA 3QZGA 4ERKA 4W4VA 3DBCA 4EZ7A 4MVFA 3U87A 4FKPA 5ANJA 4L00A 5DE2A 4BDCA 5AWMA 4C34A 4QMYA 4B8MA 3CS9A 2CJMA 3MA3A 5HE3A 1QMZA 2GNHA 3ALOA 4RZWA 3UVQA 4AT5A 5D41A 5IEVA 4BCKA 2ZB1A 4IVCA 4CQGA 3V51A 5JMSA 5BVWA 2H8HA 2VTOA 5DRBA 5EFQA 4RJ4A 5HNGA 4DN5A 3FL5A 4G5JA 2JFMA 4HYIA 2XA4A 4D2SA 2JKQA 3DAKA 3POOA 4DA5A 4GUBA 2ZV2A 4IB0A 2VWYA 1AQ1A 4I6HA 3GCUA 3IGOA 2XK4A 4JX7A 5AR3A 4D9UA 3L9LA 4LV8A 5EOBA 1SZMA 4I21A 1FVRA 1ZARA 4HOKA 5HIBA 4TYJA 4YJQA 3TTJA 2JDOA 3IQ7A 4IWOA 3NNWA 4LOPA 3SRVB 5AV4A 2Q83A 2BDJA 3MB7A 4D5HA 3H0ZA 2C30A 2B52A 2VTHA 3OUKA 3R1QA 3R0TA 2JD5A 5M55A 3ZLXA 4CFUA 3R01A 1OBDA 3ZO1A 2EB2A 4GFGA 5ITAA 3EN4A 4D9TA 3E8CA 2W7XA 3BGPA 3EL7A 2BFYA 4Q5EA 4J8MA 5AAFA 4EHZA 3LIJA 3QFVA 1WBVA 3FC2A 4TYHA 2YDJA 3AT3A 3QCSA 4ALVA 3UGCA 4IAFA 2HZIA 4U44A 5HHWA 3VULA 4NTTA 5M06A 2ONLC 2WAJA 4O0XA 3WIGA 3NVKI 4RX5A 3D7TA 2XJ1A 3WF9A 4Q9SA 1XBBA 4TYGA 3DCVA 3QYWA 1L8TA 5AA9A 4CSVA 4PL4A 5GZAA 2A1AB 2QU6A 3ETAA 1O6LA 4DG3E 5LWNA 4DGNA 4UN0C 4N6YA 4MAOA 4FSTA 4XOYA 2PMNX 4KWPA 5I9WA 2OBJA 5KCVA 2R0UA 5I4NA 4KD1A 2E9NA 1JBPE 3LM5A 4RX8A 3FHIA 5DMZA 1UU9A 3V5JA 5HBEA 3MIYA 4BIBA 3UO6A 3LFFA 4W4WA 5F1ZA 2WMVA 4DFLA 4ANSA 3I0QA 2X1NA 3SHEA 1MQBA 4K18A 2Y0AA 5EM6A 3SD0A 4QP6A 4EOKA 2YM3A 2Z7SA 4Z3VA 4YJSA 3E62A 3UMXA 1BUHA 4LGHA 3GVUA 3MTFA 3DTWA 5IISA 4V0GA 1GZOA 4AW0A 3CY2A 4F6UA 4YC6A 3OXIA 2XK8A 2NRYA 4FOCA 3CGOA 2RFEA 4X21A 3UIBA 4DG2E 2W1HA 3I0OA 2DS1A 3OROA 4RFYA 2GTNA 4FKSA 4WHZA 3FHRA 5EW9A 5HE2A 1ZZ2A 3WOWA 1Q4LA 4ENXA 2VWUA 4R3CA 3LXKA 3TM0A 2ZJWA 4FNXA 4L67A 2I0YA 1JSTA 3A8XA 3A61A 3PJ3A 2EVAA 4I5MA 4OTHA 4MX9A 3MN3A 4IX5A 5DVRA 1GZ8A 2QO7A 3PLAE 2QNJA 2R3LA 2XIKA 4QP4A 3EQFA 1RJBA 3CC6A 3D7TB 3TUDA 4F0IA 3S4QA 3CTHA 4RIXA 3LMGA 2FUMA 3FI3A 3FKOA 5EDRA 4C58A 2AYPA 4QNYA 3UP7A 5IQBA 2PVKA 4AQCA 3KF7A 4BGGA 3TI1A 5HKMA 2C5NA 4FTJA 4PNKA 3WZDA 4KS8A 4JJRA 4PL3A 4B9DA 5E7RA 4XOZA 4DT8A 1LEZA 3CXWA 2IW8A 4C4HA 2J9MA 3OS3A 3HAMA 3QZHA 3W18A 4J8NA 5LOHA 3DKGA 3ERKA 5BYZA 4AXAA 4L3LA 3CIKA 5BX0A 4DEAA 2ZM3A 4CFWA 5IA2A 3WYYA 2OJJA 3W8LA 5E4HA 3NNVA 3ZHPC 4FX3A 3TACA 5DT4A 3C9WA 1PXNA 2UW9A 5IKWA 1H0WA 2Y4PA 4DTBA 3OY1A 3WZKA 4OAUC 5IMXA 3UO5A 2I6LA 2QOLA 4K1BA 5FXRA 4FV0A 3OFMA 2R3FA 3JVSA 3GQIA 2C1BA 4ZS0A 4QMXA 3SG9A 5JQ5A 4GSBA 4ZP5A 3TZ9A 5FBOA 4ZLOA 3E3BX 3VS7A 2WMQA 1H25A 1XBCA 2R64A 3PVBA 3JR1A 3D15A 4RVKA 4E6DA 2YM6A 2VTQA 4EC8A 5DN3A 4IM2A 2WMXA 3LCKA 1Q97A 3FAAA 3I6WA 4UWCA 2Z2WA 3GC9A 2XS0A 2WXVA 4FI1A 4JDJA 3LCTA 3F3WA 3FQSA 4AU8A 2IVUA 2HAKA 4CFXA 4JG6A 5KZ0A 4Z7GA 2VWIA 5B7VA 5HVJA 4JG8A 4PRJA 1FOTA 3R7YA 3R04A 3GU5A 3KVXA 1GOLA 3Q60A 1H01A 2ITYA 5H8GA 3LM0A 3HV4A 5DRDA 1J7UA 4IWPA 2F7EE 3R8UA 2UZEA 3PJ2A 5AR7A 2IJMA 3HUCA 2PHKA 3QTXA 4BC6A 1PY5A 1REJA 2O65A 1B39A 1IAHA 5JRSA 5KHXA 1OUKA 3FMJA 3OF0A 4C2WA 3Q04A 1B6CB 3JS2A 4YGAA 2XUUA 3R9DA 3RPVA 3O8UA 2GQRA 2A4LA 4EHVA 4XUFA 3CPCA 1YI4A 4DEBA 1UNLA 2JDTA 3DK6A 4OTDA 3FSKA 4ITJA 3HV6A 4C8BA 4C02A 1OITA 4I3ZA 5JFVA 3SGCA 3A8WA 4J95A 4KUJA 3K2LA 4IX3A 5L3AA 4GKHA 4TNBA 3COMA 2UZOA 4PTGA 5AV0A 5M4UA 1IA8A 3H4JA 4HYHA 3OWKA 1PW2A 2Z8CA 4GK2A 4ZSLA 1ZWSA 3R28A 3IG7A 2GHMA 2BHEA 2OW3A 4AN3A 4L7SA 1H1RA 2YWVA 2W4KA 4QQCA 4C3PA 4ASZA 3BBTB 4USDA 5ETFA 5A46A 5CALA 3TN8A 2GHLA 2E9VA 2GPHA 2BDWA 3F88A 3QYZA 4GS6A 5FD2A 4YLJA 4W9WA 4DGGA 1KOBA 4EQCA 2P33A 1PXPA 2OJ9A 3CKXA 5AP3A 4GRBA 4QYHA 5EDPA 3W2QA 3ZMMA 3LFCA 4FSZA 4XRJA 3FE3A 2G2FA 4F9CA 1M2PA 5J7HA 2QOCA 5KE0A 3RHKA 3TG1A 5F4NA 3HLLA 2WFYA 3HP5A 4BDFA 2O8YA 1K9AA 2C68A 3NGAA 2YIQA 4J71A 3H3CA 4DBNA 5FG8A 5HX8A 3LFQA 3W2OA 3HKOA 1PMVA 4IVDA 3NMUF 2BTSA 3R30A 4AS0A 4BGQA 3QWKA 4FG7A 3TV6A 4E6QA 4YO4A 3BGZA 3KY2A 2WTIA 1WBNA 5CF4A 3GCSA 5CEIA 5E92A 4C38A 4EK4A 3WI6A 4UMTA 3DNEA 4ZTRA 2VNWA 4M0ZA 1H28A 3SV0A 4CGAA 3H9RA 2BZIB 4O0YA 3R22A 4EONA 4IAZA 3KXHA 4F6SA 3KF4A 4FSUA 4QMNA 5KMMA 4BTJA 3HRBA 4FUXA 4L6QA 3G6GA 5DOSA 5AV2A 5K9IA 2REIA 5EQPA 5HVKA 1P4OA 4FV3A 3R9OA 4TZRA 2QONA 5HGIA 5E8SA 2JIVA 3UP2A 3CBLA 4J98A 5M4CA 3ACKA 3EB0A 2HELA 2Z7RA 4HGEA 4AX8A 2JGZA 4A07A 2C1AA 3W32A 2IZTA 3E5AA 4YZNA 5J9ZA 2Z7QA 1DAYA 3FQEA 3HDNA 5ETIA 3UIXA 2OLCA 3ZH8A 2J0LA 1FGIA 2JIUA 4FKLA 2YABA 3JY9A 5CY3A 3SDJA 4JOAA 4B4LA 5CZIA 1Q41A 1W7HA 3UOKA 2CNQA 3IO7A 3PPKA 3Q9WA 4LUDA 1PJKA 5HCXA 5IA1A 1UWJA 3FXXA 2QI8A 1SM2A 1IRKA 5KMNA 5H8BA 1GNGA 2DUVA 3DJ7A 4FKRA 5AV3A 3ZC5A 2EWAA 4RLLA 3G9NA 3QTSA 4IDVA 5HE0A 3WZUA 3R1YA 4G3DA 3OC1A 3WF8A 4BN1A 3KCFA 3FMLA 4MXCA 4UALA 2UV2A 3RWQA 5HTCA 5IQAA 4X2KA 1XJDA 5AUWA 4RGJA 4Y5HA 2B9HA 4OTWA 3UG1A 4NIFB 2YA9A 2XMYA 1HOWA 4HVDA 1UNHA 3WBLA 3QGYA 3C0HA 4BIDA 3Q9XA 2PZYA 3LHJA 4XV9A 2I0EA 1DS5A 1HCLA 2ITOA 5FEQA 3BV2A 5JZJA 2G2IA 4APCA 4L01A 1H26A 3TUCA 2ITNA 2AC3A 4MEDA 3O96A 3PVGA 1KUTA 4O7TA 5J87A 4IAIA 1FBNA 4E3CA 2W1CA 4Y8DA 5HORA 4PL5A 3BHHA 3ORMA 4FSRA 4F7JA 5HNBA 3KGAA 4W4YA 3VQUA 2CNVA 3GFEA 2J5FA 2V55A 4XHKB 2Z02A 4Q9ZA 4IZAA 4FEVA 3BIZA 2R3QA 4ZTSA 3UNZA 3QZFA 3V5WA 3VS3A 4JS8A 4I0RA 3HMMA 2XNMA 2HY81 3UNKA 1JNKA 3F5UA 5HU9A 5M51A 3C5IA 1CKPA 3TDWA 1UNGA 4MHAA 4FKUA 4FBXA 4U3ZA 4CKRA 2B0QA 1H1WA 4FTRA 3SW4A 1FPUA 3DDQA 3SC1A 4IX6A 5HLPA 3RBWA 4IMYA 3BELA 2P2IA 2GNLA 4U40A 4XV1A 2C47A 5AA8A 3BU3A 2J51A 2VX0A 2O2UA 3GP0A 3MPAA 2ZMDA 2OGVA 2WMSA 3E7OA 3FPMA 1OL5A 4GFMA 3MIAA 2WNTA 3DOGA 5A54A 5C8NA 4RA4A 2Y6OA 5LQFA 3TKHA 3COIA 4QYYA 3DAJA 3PPZA 2FH9A 5CX9A 5DI1A 4EKLA 1OPKA 2BPMA 2QO2A 5CXZA 3GCQA 1H08A 2PVNA 4YTIA 4KSPA 4I0SA 4Z7HA 3B2TA 3MYGA 4IACA 5JFWA 4IH8A 2W17A 4FTLA 4JDKA 3UVRA 3FLQA 1KV2A 3A4PA 4U97A 3FMMA 4OBPA 3GB2A 5IUHA 4M69A 3M1SA 3G0FA 1URWA 1U59A 1XH6A 2BILB 2BZKB 3Q6UA 2AC5A 4M67A 5I0BA 5D7VA 2YCSA 4IQ6A 2BUJA 2PVFA 2RGPA 3BU6A 3Q6WA 1PMUA 5ANIA 2R3GA 1V0PA 3DPKA 3NYOA 2FSMX 4LI5A 3UNJA 3PY1A 4AZVA 3CQWA 4D0WA 3MFUA 4IDTA 3CPBA 3FYJX 4ASXA 3LW0A 4YLLA 4V05A 2BROA 1CM8A 3BQRA 4FUYA 4J1RA 4WG5A 3GXLA 4CXAA 3RPYA 4GK3A 4AW2A 4CEGA 3ZBXA 1XWSA 4GW8A 4AOTA 1H07A 4F0GA 5FRIA 4WA9A 4XYFA 4AZWA 4DFBA 5KNJA 1XO2B 4YTFA 2QODA 4WNKA 3PG1A 3FJQE 3TNIA 3W16A 4BI0A 3DKOA 3A7JA 3U55A 3G33A 4JR7A 1Z5MA 4F63A 4F7LA 3VHKA 5L6PA 1YI6A 4OTIA 4F7SA 4FV1A 2VGOA 2HZNA 3UOJA 5DR9A 2GMXA 3PYYA 4L45A 4E4LA 4ZJJA 4D4VA 4AZTA 3BU5A 3NCZA 2PZIA 3Q9ZA 4XJ0A 3VS5A 4F64A 4ANQA 2BFXA 4V01A 5M09A 4XP0A 1WBOA 3DXPA 5T68A 3DXQA 4C3FA 4DFNA 2O5KA 4G3EA 3OZ6A 4AA0A 3HA8A 4IZ5A 3E92A 2O0UA 3MB6A 3NSZA 2JBPA 5DYJA 3IDBA 5IQHA 4Y83A 3NAYA 3MPTA 5FDPA 4L7FA 4X3FA 4A4LA 1SVEA 4QD6A 3VBXA 3RI1A 2Y7JA 3UPXA 3Q2JA 3TDVA 3E3PA 4I6BA 5DG5A 1TKIA 3ZYAA 3U6HA 3E63A 2FSLX 2VN9A 4GJ3A 3HVCA 5CAPA 1OIUA 5CSWA 3LJ2A 4O7ZA 2J5EA 3CQEA 3D5VA 3DY7A 1Q8ZA 3ORLA 3DKFA 1U5RA 4WUNA 1OKYA 5FM2A 4NM3A 1MRUA 4BDGA 4OT6A 5B2KA 3UODA 1QCFA 3O7LD 4S32A 4FEUA 4JDIA 3P5KA 1M14A 2XNEA 3FUPA 3I5ZA 2YLEA 4HZRA 2I0HA 4ZJIA 2QKWB 5BVOA 1JSUA 2WQNA 4NH1A 4EZ3A 3DGKA 5TKDA 2KULA 5FQDC 2WO6A 1QPJA 4GMYA 4RA5A 3OUNB 3DJ6A 3BLHA 3KULA 4QP8A 4QMVA 1QL6A 2IVVA 5KMKA 1YOMA 2UZBA 3RPRA 3PZEA 4E20A 5M4IA 3AD6A 2XNGA 2JDVA 3GFWA 3KA0A 5CEMA 4CKIA 3A7FA 1Q62A 2BIYA 2UZTA 4N0SA 3COKA 2XRWA 4NJ3A 1OI9A 4P2KA 1KE8A 4U80A 3LCDA 4TPTA 3EL8A 5I3OA 1JQHA 5HESA 4EUUA 3DQXA 2ZB0A 4U41A 3TZ8A 1BI8A 1BLXA 2B53A 5L6WL 4DTAA 3Q53A 2EXEA 1U54A 3F6XA 1PXJA 2VRXA 3HRFA 3KVWA 3QHWA 5L2WA 3ZC6A 1ND4A 2RSVA 4NSTA 4RFZA 2IW9A 5CT7A 2XNBA 4C4GA 3O8TA 2WOTA 4QP3A 4FTIA 5KBRA 1JKSA 2RF9A 3W2CA 4WRGA 2PTKA 1OB3A 2J2IB 3ORNA 4O1PA 1OL6A 2B9IA 3MTLA 2LGCA 4GH2A 4RQVA 4IFGA 2CKEA 4GG7A 5DR2A 2H96A 4C37A 3GQLA 4NJDA 3BBWA 4X6QC 5BVEA 2BRBA 3CQUA 1K3AA 5J9YA 4YSJA 4BFMA 5I9YA 5JKGA 2VWXA 3KFAA 2WHBA 3GUBA 5IUGA 3ROYA 1OECA 4XLVA 4UBAA 3QKMA 4QRCA 2WTCA 3KXGA 4HGLA 4E8AA 4XNEA 4BCMA 2J0IA 2OICA 5E9EA 3DKCA 2QLQA 3DA6A 5AV1A 5IZFA 2WOUA 4YTHA 4MF1A 4EEVA 4KRCA 3PJ1A 1FGKA 2O3PA 1WVWA 2VTTA 1GY3A 2X2KA 3OXTA 4YZBA 3H9FA 4O0TA 4B99A 4FF8A 5M57A 2PYWA 1MUOA 5LVMA 4WSQA 5J9LA 2WMTA 4AWIA 2PL0A 3P4KA 3GOKA 5GIPE 5CF8A 3UJGA 2ZAZA 2VTPA 2X9FA 4AACA 4QPMA 3KRJA 3PWDA 2XCHA 4PV0A 4RIYB 3MW1A 3PP1A 1UA2A 2WTKB 4HYUA 3AQVA 4GU6A 4OTFA 4LL0A 3O50A 2OO8X 4D4RA 4CLJA 3VJOA 3OTUA 2X8EA 3WYXA 3SRVA 4BDIA 4N4SA 3TNPC 4WG3A 1P2AA 2J50A 3UIUA 5AX3A 4MCVA 4XG3A 2P3GX 4ACHA 3R8PA 2PMIA 3GBZA 2R5TA 5C27A 4BDJA 3LLAA 3HNGA 3NPCA 4NZWB 1DI9A 1KV1A 3MJ1A 4QMSA 5DHJA 2WMRA 2X7FA 2GS2A 4YO6A 3OEFX 5CI7A 2UUEA 5A4TA 4BZNA 4XEYA 3PIYA 4I94A 3OEZA 3AC2A 3TIZA 3FKNA 1WBTA 2OF2A 4GEOA 3CSVA 4AUAA 3ODYX 2R3MA 4YJNA 3NUNA 1OKVA 3PXYA 4JVGA 4KBCA 3U54A 3DNDA 3I60A 4E1ZA 2JC6A 2WMAA 2ITZA 2OFVA 2YZAA 3OCGA 2BVAA 3V04A 1PYXA 4MK0A 2WMWA 2YM7A 2C6KA 4MWIA 2DWBA 2CLXA 1P4FA 3RP9A 3RPOA 4EHEA 2VO3A 2IG7A 3GEQA 4CT1A 4FV2A 5AUYA 4FODA 3EJ1A 4U43A 3UZRA 4UWYA 3QXPA 4X2FA 4PUZA 4Z16A 1IA9A 1F0QA 3OBGA 4IM3A 2YJRA 4WKQA 2VX1A 4M0YA 1Q24A 1K2PA 4LMNA 3DV3A 5EM8A 3BRBA 1OIQA 5T3QA 2XRUA 4Y72A 4CVAA 2J90A 3DBEA 4I6QA 1JWHA 4D2WA 3O51A 2C3JA 4NFMA 5E8ZA 4E4NA 5J1WA 4C57A 5BMSA 5IQDA 3I7CA 2BALA 4QOXA 4BCGA 3PP0A 3HGKA 4FV7A 3MV5A 4RVMA 2JLDA 3A7IA 4YJUA 3ZEPA 3NR9A 4PWNA 1JOWB 2XK6A 3G0EA 3NW5A 2HY0A 3BHVA 4FKJA 1UKIA 2JKKA 1GIIA 4IHPA 2VWVA 4PMTA 2PE1A 5I9ZA 3R2YA 2UZLA 4GIIA 2ZYBA 4XP2A 4YTCA 4O7VA 4YSMA 3GU8A 3EZRA 4JDHA 4O0VA 1JKKA 3T3UA 1G3NA 3PG3A 4BDHA 4S2ZA 1PHKA 2PVHA 5I9VA 3PSCA 4LG4A 3TIYA 3BCEA 4FKQA 4H3PA 1SMHA 2ITVA 5CU6A 1O9UA 1Q8WA 1YQJA 4M3QA 2G2HA 2XJ2A 3A2CA 3E7VA 4TYIA 2C3KA 4WIHA 4B0GA 5B2MA 3A7GA 3FL4A 5DT3A 4TL0A 4O0WA 3BEAA 4GVJA 4H05A 5L8KA 5F9EA 1SNUA 3EQCA 3PZHA 3ZEWA 4LRMA 4BTFA 4DH5A 5L8JA 1Y91A 3S95A 4F6WA 3U9NA 2J6MA 4P4CA 4F65A 2UW4A 4H3BA 5EKOA 3RAIA 5ANKA 4ARKA 5AEPA 2WQMA 3D94A 5AP0A 3UOLA 5JFXA 3ZU7A 2QURA 4C62A 3G15A 4FTKA 4MNEB 4QPSA 4IBMA 3GC0A 5L2QA 2WU7A 2GNFA 2VTLA 4C4EA 5JGBA 1OKZA 5L2TA 3ZRKA 1W82A 3AMBA 4FVQA 4YJVA 4CRLA 4G5PA 4FT5A 4MBLA 2P4IA 3DBQA 5EDQA 1UKHA 4YC8A 3QLFA 5A6OA 4NEUA 3HMOA 3RJCA 3UPZA 3UQCA 1ZZLA 2KTYA 2QOFA 2VO7A 2YAAA 3BLQA 3F61A 5DFPA 1G8AA 5B0XA 2C6TA 4FTCA 3ANQA 4DINA 3CTQA 2PVRA 2RFNA 5EKNA 2YN8A 2OFUA 2PZRA 1H1PA 5IA5A 4L42A 3U4WA 2BAKA 2CKPA 4NYEA 4IVAA 4LL5A 4MD7E 4LOQA 3DK3A 4QNAA 4NFNA 4IZ7A 3LLTA 1LP4A 4AG8A 3WILA 1H1QA 1PMEA 2HYYA 5I9UA 4FV8A 4BTKA 4V04A 4EJ7A 5A9UA 2F2UA 2ACXA 5K4JA 3QD0A 4DEDA 1M7QA 2E9OA 2JAMA 2XCKA 2YLFA 3N4UA 2CNUA 2VUWA 3TEIA 4FNZA 3U51A 4FKOA 3LPBA 4NT4A 5CWZA 5HG8A 5JRQA 2WQEA 3KXZA 3OW4A 3DFCB 3C7QA 2Z7LA 3QC4A 1H00A 4W4XA 2IWIA 4GK4A 3IECA 3ELJA 4W8EA 2XVDA 3KL8A 4BI1A 3ZUVA 2XJ0A 2C3LA 1JKTA 5CVGA 3BX5A 3B8QA 3TT0A 2F2CB 4GT3A 3FMEA 4BWKA 4MXYA 4EYMA 3K3JA 4OTGA 5F20A 4EH4A 3HX4A 3PIXA 1VZOA 3R8LA 4B8LA 3ITZA 4U9AA 5HBJA 4CG9A 1OGUA 4UY9A 3FZRA 4AW1A 4BCPA 5LVPA 4RWJA 3ZCLA 4CT2A 2F7ZE 1E9HA 1IR3A 2HXLA 2VTIA 3AC8A 2R2PA 3Q5ZA 4G3CA 3FZTA 3JXWA 4YHTA 4DITA 5CEQA 2XNNA 1WVXA 4FR4A 3KMMA 4O96A 3NIZA 3HMIA 3QA8A 4MXXA 2OI4X 1EH4A 3C0IA 4GU9A 2OXDA 3OD6X 3R1SA 3TZMA 3UYSA 3Q4UA 2VGPA 5CXHA 4EH6A 3FY2A 4TRLA 2QR7A 2WZJA 4MQ1A 4WRSA 1XH4A 2HZ4A 2YEXA 4F08A 1WMKA 2UZWE 3QRKA 2G9XA 2P2HA 2QR8A 3IDPA 3UYTA 4A9UA 3UBDA 4CKJA 5IDNA 4WSYA 3F5PA 2B7AA 2VTRA 3VC4A 3KREA 5FBNC 4YJTA 3C1XA 4L44A 4I93A 3DLSA 3L9MA 3IGGA 4CNHA 5DLSA 3AG9A 5EM5A 4AAAA 4AZFA 3RHXA 4ZAUA 2CDZA 2OJGA 4PTCA 2BZHB 3C0GA 2PUPA 4FTQA 5IQCA 4G1WA 4QQTA 3L1SA 4DFXE 5C1QB 2C6MA 4D2VA 3P08A 4RIOA 2W96B 4XX9A 4XS2A 2XNOA 2IW6A 3PVWA 3I4BA 5M53A 1PRYA 4RPVA 4PMPA 2GNGA 4RZVA 4GFOA 5FGKA 3QQJA 1NVQA 3Q4CA 5KMIA 4O2PA 5JGAA 4QQ5A 3QQGA 5F94A 4RC3A 5AUXA 4BY9E 3VS6A 4JG7A 4EH2A 3AMAA 3QCXA 5AJQA 2Y4IC 3SQQA 4S30A 2HK5A 4BL1A 3F2AA 5CS6A 1Z9XA 2ONLA 5ETCA 4NCTA 4FG9A 3VBTA 3LQ8A 3CKWA 5IQGA 2CN8A 1T45A 2HW7A 2OWBA 2RFSA 3O0GA 3NEWA 1MRVA 3NZ0A 4X3JA 2W1GA 5KKRC 3U6JA 3P7BA 2JITA 5DIAA 3FZSA 5M56A 3AMYA 1H0VA 1GZKA 5IU2A 4A7CA 3TWJA 1AD5A 2PVMA 3AGLA 4LRJA 3TXOA 2WMUA 4TXCA 3VNTA 1S9JA 2BRNA 5AUZA 3AT4A 3PFQA 4JNWA 5DT0A 5IH5A 4QMLA 2PE0A 4XP3A 4YBKA 4BDAA 2QU5A 3DB8A 3GC8A 3LVPA 4NUSA 3UTOA 4EQUA 3TJDA 5HI2A 4ZTMA 3R7OA 4F9AA 4UX9A 1U5QA 3VQHA 4EK5A 2JKOA 3G5DA 3RKBA 4R78A 4FGBA 2BTRA 5A4QA 5IF1A 5ANGA 1Q99A 3PXFA 4ZZMA 4QP7A 4FZAB 4YJOA 5EYMA 1PXKA 2XKEA 2C0OA 4IADA 4YZMA 4AA5A 2F7XE 5HLNA 4TTHB 3SG8A 3ZM9A 1PXLA 3EQGA 1OBGA 5C8MA 4AE6A 2QVSE 3UE4A 4JQEA 4A4XA 2OF4A 3N4TA 5DEYA 3QLGA 3QX2A 4NIFA 2JEDA 3PJ8A 2WTDA 2WGJA 3CY3A 3NW7A 2RFDA 3D83A 5AR4A 4DGMA 4P7EA 4MYGA 3UIMA 4FTNA 5HOAA 2PK9A 4ALWA 4GV1A 4PX6A 2VTJA 3F3UA 4OGRA 2ZDTA 5CLPA 4APPA 2W05A 5DGZA 4C4IA 4USFA 4ITHA 1O6YA 1W0XC 2JDSA 2X8DA 4G2FA 4M7IA 3O2MA 4RSSA 4UEUA 4Y95A 3C4CA 5GJDA 4JBVA 1RE8A 3RINA 4HCUA 5DWRA 3DZQA 3LAUA 3AXWA 4JQ7A 3MI9A 3P9JA 2XM9A 4LOOA 4ZY4A 5A4LA 3T9IA 3HV5A 3MH2A 3C4ZA 3MY1A 4NTSA 3DLZA 3V01A 4EH3A 4QTAA 3F3VA 2BR1A 2YACA 1XQZA 4OT5A 2VAGA 5A6NA 4F09A 4HCVA 5FEEA 1UU7A 5L4QA 3FXWA 1YXSA 3OXZA 5TR6A 3U9CA 3WARA 3ZM4A 4DH1A 3VW6A 3QC9A 2C0TA 2E9PA 3O17A 4FV4A 1I09A 3VW8A 1YDRE 3DAEA 4FZFB 5JK3A 3COHA 3FEGA 4B7TA 5TE0A 4BDDA 2YDKA 5EW8A 5FTQA 3H0YA 5GIOE 4O2ZA 2OIDA 2DYLA 4P5ZA 4JAJA 3OVVA 4KKGA 2PMOX 4NU1A 4DCEA 3D7ZA 3LJ1A 3PIZA 4WOVA 4QTDA 1YRPA 1GZNA 4BCOA 5IMEA 1GAGA 5CSVA 3OOGA 2JDRA 2A19B 3EFJA 4QQJA 4AF3A 4JX3A 3UC4A 4I4FA 2GHGA 4R7HA 4HJOA 4PF4A 5E8TA 3ORZA 3VF9A 5CAOA 1YHWA 5KMLA 4GYGA 2W4JA 5AIKA 2X6EA 3L8PA 5HO8A 4MQ2A 3EKNA 4F70A 4ZIMA 4CZTA 3VO3A 4X3FC 3HYHA 3ROCA 4D55A 2WTVA 3TNWA 1YXXA 4U81A 3RM6A 1VYWA 3MH1A 4IX4A 3EOCA 3HMNA 5H8EA 2V7OA 4BB4A 2BIKB 4NM7A 4RX9A 4FKIA 3REPA 1Y57A 4PPBA 4IAYA 2CGVA 4EOMA 1DAWA 5JGDA 3MBLA 4BBMA 1NT2A 1FMOE 4OR5A 4QP2A 2CCHA 3NYXA 3W55A 2FB8A 5AP4A 4E5BA 2XKDA 4KA3A 3HRCA 4MNFA 3E8EA 1JVPP 3OHTA 4BIEA 4AT3A 2UZDA 3VIDA 1OL2A 2A0CX 3KMUA 2V62A 1ZOHA 4JAIA 3BYVA 1NXKA 2UVYA 1Y8GA 1J3HA 2XEZA 3ZSIA 4CCUA 1OMWA 4P5QA 3EYGA 4I22A 4ACCA 5BVDA 1T46A 2QOHA 2VTMA 4FV9A 4USEA 4EOSA 2EXMA 5AP1A 4A9SA 4RJ8A 3VS0A 4HNIA 4R3RA 4R8QA 3QUEA 2WEIA 2HCKA 2ZV8A 4G6LA 4U0IA 4YJRA 3VRZA 3LXPA 1PXMA 2B1PA 2VNYA 2VWWA 5E91A 1E1XA 4EOIA 5IA0A 2XBAA 3NAXA 5HNIX 3PUPA 2CGXA 5FP5A 4BWXA 3NWWA 4CRSA 3OWPA 4TW9A 2XB7A 2PY3A 4BKYA 4D5KA 5ICPA 3LOKA 3QXOA 4MTAA 4ZZOA 2CSNA 5TO8A 4ORKA 2A2AA 3NX8A 3I7BA 4IWDA 2XNPA 4O6EA 3VBWA 4CLIA 5HZNA 3G90X 3QGWA 3EN6A 4XG7A 4C36A 2PPQA 4J99A 3Q4ZA 1P14A 4TWOA 3LXNA 3QF9A 4IZYA 2E2BA 4D1SA 4ZY5A 2W1EA 3LFEA 3IK3A 3MFSA 4XG4A 3KQ7A 1PF8A 4IE9A 5CNOA 4AOIA 1IASA 4C4FA 3N4VA 4XG6A 5LVLA 3LQ3A 1XKKA 2OXYA 3NW6A 3PXZA 4KIKB 1OL7A 4K8AA 1JAMA 3ZTXA 4J52A 5F95A 2ITWA 2P0CA 5E8WA 4FV5A 2W0JA 3FDNA 5E8VA 1XH7A 4ZTHA 4D4YA 5HG9A 1R78A 4CYJA 3MH0A 4R6VA 5BQ0A 1OKWA 3QRTA 3VF8A 1FVVA 2JIIA 4MF0A 1WZYA 3EQDA 3OTVA 1M17A 4FKGA 5EYCA 5CAVA 2X7OA 5A14A 4DTKA 4GG5A 4F9BA 3WZJA 4GJ2A 2OZOA 3ZFYA 3RAHA 3A62A 4WG4A 1ZRZA 5FXSA 1ZMUA 3HEGA 1Y6BA 5T6KA 3PSDA 5KMJA 2GQSA 3ID6C 4FTMA 2CN5A 4FTTA 4OBOA 3F82A 4N70A 3R9RA 4OTPA 1B38A 4IB5A 3S3IA 5KX8A 5HBHA 1Q5KA 2G1TA 5I3RA 1P5EA 3FI4A 3UQGA 2W1DA 3MESA 1OZ1A 2GDOA 4EWQA 3IW8A 2XK9A 4FEXA 4I4EA 3CP9A 4ANNA 4RVLA 3BYMA 5BVKA 3TUBA 3W33A 3SAYA 1PMNA 2X2MA 4PMMA 2C5XA 3ZS5A 5LXMA 3WE4A 2CKQA 3LMHA 3HL7A 5KHWA 4AGCA 2R3PA 5HO6A 3V8WA 4LQMA 3ZRMA 2FO0A 4O7LA 5E8XA 4FT9A 4F1MA 3ATSA 4ZY6A 5ACBC 2UW8A 2GFCA 3ZO3A 4C33A 3V3VA 4BCJA 5D1JA 3OCTA 3WIKA 4YR8A 1BYGA 1Q8TA 2BAQA 4I20A 5CSXA 4EI4A 5EK7A 5BYLA 2XK7A 5IQFA 1QPDA 3FLNC 2BDFA 2C5VA 3A4OX 4FKVA 4DBXA 4WNMA 2H9VA 1Q61A 4QMUA 4I23A 3SXRA 5CASA 4KIOA 2UVXA 2ERZE 4RC2A 3MVJA 5HU3A 4G6OA 4GUEA 4ALUA 1R3CA 2YISA 4AN2A 3EQHA 4ANOA 1LUFA 1YHSA 3QRJA 3UC3A 4ANMA 4EOQA 3QUPA 3KEXA 5BVNA 2RL5A 4DEHA 5JEBA 2J0MB 4FL2A 2OK1A 4FIGA 4E4MA 4UZHA 2UW7A 3GENA 4XLIA 4BF2A 1IAJA 2IZUA 4B6LA 3G51A 2HOGA 4RFMA 3SKCA 4EHGA 3DT1A 3Q3BA 1VEBA 4MD9E 2NP8A 2GS7A 3W2SA 1ATPE 3AC3A 1JKLA 1ZYCA 2NPQA 5CT0A 2OZAB 4ZTNA 3UO4A 5ANOA 3GGFA 4CD0A 3R9HA 5K5XA 2BCJA 4NM0A 5M08A 4ACDA 3LCSA 4FE2A 5IQIA 4DH7A 4EH9A 4C2VA 4EK3A 4QMWA 2FSTX 2XF0A 3RZFA 3OOMA 1YHVA 3I5NA 4I5PA 3CGFA 4R3PA 4RIWA 5GZ8A 3QHRA 5L2SA 4RIYA 3QTUA 2VTNA 4ZSAA 2W5BA 3B8RA 4A4OA 5BVFA 4TWPA 4CCBA 4G6NA 3WF6A 4IFCA 3V8SA 3TTIA 3TL8A 5JT2A 3DQWA 5FM3A 2Y6MA 2QOQA 3A60A 3OT3A 5CTPA 4ITIA 5HCZA 4EH8A 4EOJA 1WFCA 1J91A 4FVPA 4Y73A 2F4JA 2H6DA 4FIFA 4IEBA 5JN2A 4EJNA 2V22A 3JY0A 3NIEA 1SVHA 2HZ0A 3OP5A 4O82A 2VV9A 3S0OA 5EQYA 4EWHA 1ZY4A 3FXZA 3KXXA 3RK7A 4RJ3A 5HLWA 4TN6A 3FLYA 4O7SA 3LFAA 2Q0NA 5CEKA 2GU8A 3ALNA 3Q2MA 3VWAA 2VTSA 1Q3WA 5AUVA 2YJSA 4HNFA 3NCGA 4IANA 5AP5A 3CJGA 3F5GA 2R3NA 4FVRA 5A3XA 4FIEA 3T8OA 5IQEA 5LMBA 3KB7A 5LWMA 4N57A 4M8TA 1OM1A 2R3HA 2YDIA 3RALA 3Q52A 3D14A 5G1XA 3C4WA 1YDSE 4DF3A 3MY5A 3NUYA 2QOKA 3B2WA 5FP6A 4O84A 2WKMA 3Q4TA 3ATTA 3LFDA 4KABA 3SX9A 1YW2A 3GC7A 3UMWA 3O8PA 2B54A 4DG0E 4UYNA 2HWOA 3ZO2A 3NLBA 3UOHA 3OT8A 4DAWA 2BAJA 4JRNA 4LMUA 1JSVA 5HG7A 2QD9A 3P78A 3W2PA 3RCJA 1PXOA 4RIWB 3TV4A 1XR1A 5LVNA 2B55A 5EOLA 4ACMA 1ZYLA 2PVYA 5AR5A 3BGQA 3LZBA 5LCKA 3ZUUA 5AP6A 4YHFA 3V5TA 2UW5A 4AE9A 1UU8A 4O7YA 3MS9A 3I79A 4E7WA 4CZYB 2E9UA 4H1JA 3V6SA 4FEWA 4IJPA 4O21A 2XM8A 2QG7A 4E93A 3CTJA 2X4ZA 4RX7A 2C5YA 4U45A 4EC9A 4YBJA 1AGWA 2BRHA 4M13A 5D12A 3LJ0A 3VUTA 3R63A 3FMDA 2PUIA 4YZDA 3VUKA 4ZLZA 1KE7A 4MBJA 4R1VA 2B9FA 3OWLA 4OTRA 5EYKA 2B9JA 4ZXTA 3FZPA 5C01A 3PTGA 3F9NA 4EZ5A 1SNXA 4RWIA 4QMOA 3FV8A 2OKRA 4DEEA 2A27A 2GQGA 3P79A 5DR6A 4R77A 5CYIA 1GIHA 2X4FA 5CI6A 4IB3A 2OIBA 4KKEA 4BCIA 1TVOA 1F3MC 3PXKA 3FLWA 4PY1A 3CJFA 2FYSA 2W06A 1G8SA 3KXMA 4FIIA 4ENYA 2OH4A 2VTAA 4RG0A 3NUSA 2V0DA 3BI6A 2WELA 3ZUTA 4G3GA 5GJGA 3R7IA 3LCOA 2QOOA 4FG8A 5D11A 3RNYA 3RAWA 1Y8YA 5ETAA 5K0XA 5TT7A 5AADA 2CKOA 4XBUA 3E93A 3P7CA 4MNEA 5EHOA 4BBEA 4QT1A 4FZDB 5ANDA 4I0TA 3ZONA 4C61A 5DH3A 5FTGA 3LXLA 2VWBA 2WQOA 4PMSA 5C4LA 4U42A 2CGWA 3QRUA 5FEDA 4BHNA 3SA0A 3HA6A 3H9OA 3OBJA 3PA3A 4WBBB 5EQEA 2EB3A 4I92A 3ZSGA 2W99B 3SXSA 2J0KA 4BCFA 2FSOX 3NUPA 2OH0E 4O0RA 3V8TA 3F2NA 4O86A 4TWNA 5K5NA 1YOLA 1BI7A 3ACJA 1YWVA 5LJJA 3QRIA 3FZOA 4JI9A 4RJ7A 2R3IA 3MFTA 3C50A 2OJFE 2PWLA 4XV3A 2J0JA 2QQ7A 5CEPA 2IZSA 1R39A 3P23A 5AR2A 5A4CA 1NA7A 1VR2A 2PUNA 2ZM4A 4Q5HA 4NK9A 3QKLA 4IW0A 2I7QA 5AM7A 2YFXA 4CYIA 2GTMA 1ZXEA 1S9IA 2C6IA 3MVLA 1ZAOA 5CVHA 4E5AX 1CKJA 4RJ6A 3RK9A 2QHNA 3MPMA 1V1KA 3F66A 4J96A 3GU4A 3FLZA 3G6HA 3MH3A 5CAUA 4KS7A 3DU8A 3EFWA 2WU6A 2VD5A 5EI8A 3R2BA 2XKCA 4KNBA 5J5TA 2C6LA 4PDPA 4H36A 1WBSA 3K54A 3EFKA 3IW6A 4YLKA 4JBQA 4LGGA 5LMKA 4GL9A 5LMAA 4TT7A 3ZBFA 2WTJA 3GCVA 2C69A 3PRFA 3ULZA 2I0VA 3SVVA 4IC8A 1YDTE 5J8IA 4YNEA 3FI8A 3ZXZA 2UW6A 4Q2AA 2B4SB 2BKKA 3ORXA 1H24A 3HV7A 5EI2A 5FWKK 4DFYA 4DFZE 4F9WA 3VAPA 3VS1A 4HGTA 4JT3A 4WNPA 2BZJA 2WD1A 4CV9A 4PDSA 3IOPA 4QP1A 4FSYA 5HTIA 1WCCA 4O6LA 4NCTC 2QG5A 4BKZA 4GT4A 4JIKA 4C4JA 4PPCA 4AFEA 3QTWA 4U8ZA 5J95A 3BE9A 2GS6A 1QPCA 3EN5A 1L3RE 4MD8E 4PQNA 2X39A 5AX9A 3RZBA 5CSPA 5HD4A 5HO7A 4C35A 1YOJA 4M15A 3KRWA 4LUEA 3ZOSA 4QYEA 5BUJA 2VO6A 3V5QA 3ZLWA 1WBPA 4CFVA 4N6ZA 1R1WA 2X0GA 3NNXA 3EN9A 2ZVAA 3MWUA 2PULA 5LARA 4FMQA 3MY0A 3E88A 2F9GA 3ZSHA 3FYKX 4Y5QA 4IC7A 2ETMA 4FSQA 4PNIA 4XG8A 4NKAA 3PY3A 4L46A 5IA3A 2G01A 1ZLTA 4RJ5A 3EHAA 1TQMA 5DA3A 5C26A 2PUUA 4QTBA 4AGWA 4XH6A 3AOXA 4FK6A 4U6RA 4G34A 2GSFA 2ETKA 2VZ6A 3KRXA 3KKVA 4FOBA 4EH7A 3A99A 3GU6A 4IB1A 2OU7A 3W2RA 4YC3A 3ODZX 2JBOA 4MBIA 5EYDA 3ZDUA 4D1XA 4DGLC 5BUEA 3PVUA 3G9LX 3TKIA 1I44A 4QYFA 2YCFA 3FZ1A 2CMWA 5CZHA 4KIPA 4UMRA 1YXVA 4XG9A 1NW1A 5EI6A 2Y8OA 4M14A 3KXNA 3D5WA 5GJFA 3QX4A 4BCNA 3D2KA 3JVRA 2XH5A 5CVFA 5BPYA 2ITPA 3DBDA 4PDYA 1KWPA 4RMZA 4DT9A 3EIDA 3SW7A 3UG2A 4MXZA 4TYHB 4O83A 3BEGA 4RQKA 4O7NA 1G5SA 3QWJA 4CFFA 4EORA 3OG7A 4CV8A 1NVRA 4YUQA 3BLRA 3ENHA 3IPHA 3K5UA 3R00A 4WUAA 1BL6A 2OSCA 4DH3A 4R7BA 4ZMEA 4DFUA 2PMLX 5HICA 3QTZA 4YJPA 3UDBA 1PKDA 4L8MA 3FBVA 4GT5A 1OL1A 3QU0A 2HIWA 3DXNA 2QKRA 4E5WA 2Q0BA 5IH4A 2PVLA 3AD5A 3AGMA 4FTUA 5K0KA 4OBQA 5FDXA 2X8IA 4KAOA 4NKSA 4EQMA 3P86A 3C13A 4XG2A 4QMZA 5BNJA 3KRRA 3CCNA 4ZK5A 1M52A 4F9YA 3PPJA 4Z9LA 3M42A 2WPAA 3UQFA 1R0EA 4PDOA 4CZUA 4QMQA 1UVRA 3RGFA 3UZPA 2R9SA 4QYGA 5CU0A 5E90A 4R5YA 4FICA 1W84A 3VN9A 3EN7A 3F2RA 2ITUA 2CHLA 4AP7A 4IM0A 2X9EA 1OVEA 4V0GB 4XV2A 3OW3A 3ZZEA 4HZSA 2X7GA 2GCDA 2X81A 4JRVA 4DLJA 3QZIA 3POZA 4BGHA 3OCBA 4QTEA 3BYOA 2X2LA 3NNUA 3KK9A 5J7BA 4GIHA 2VWZA 4DYMA 1ZMWA 1APME 4A9RA 4K2RA 4BI2A 1O6KA 3Q5IA 3RMFA 4A9YA 2PSQA 2IZRA 1RDQE 2JKMA 2PU8A 4I41A 4ASDA 2GNJA 4AGDA 1CDKA 2XIRA 4HPTE 2ERKA 2R4BA 2YIRA 3QKKA 4FEQA 4KB8A 2YITA 3N51A 3PDTA 4NL0A 2R3RA 3TV7A 1KOAA 4K0YA 1H8FA 1NVSA 1YKRA 1CKIA 3A7HA 3R8MA 4FIJA 1MQ4A 3QA0A 2ZM1A 3P1AA 3E87A 3PXQA 3AT2A 4O0SA 4QO9A 3P7AA 3ET7A 3QD2B 4RIXB 3D9VA 4HCTA 4XCUA 4FKWA 5C4KA 2I1MA 2YM5A 4AOJA 2ZOQA 1CMKE 1LEWA 3ORKA 3D5UA 3AC5A 4BDEA 4C0TA 1H4LA 3DDPA 3IW4A 3T3VA 2O64A 4JLCA 4RC4A 1RW8A 4TYEA 3EYHA 3O7LB 3R7UA 5CU3A 4UWBA 4ZTLA 4KINA 3CR0A 4BCHA 4UV0A 3EQIA 4FZ6A 3L8SA 2LAVA 4LM5A 4YP8A 3C5UA 5KUPA 4D4SA 4M97A 3R83A 1DM2A 3FKLA 3OWJA 4YZ9A 3U8WA 1OUYA 1H27A 2W9FB 4O91A 5CQUA 4LGDA 4KRDA 2EU9A 4NW6A 4E6CA 2F49A 2WEVA 4FSNA 1ZOEA 3E64A 4AN9A 4FIHA 4D58A 5BYYA 3TKUA 1A06A 5BUIA 4O27B 1U4DA 3EMGA 4EL9A 4FT7A 3ORIA 3RM7A 3H30A 2QLUA 4R1YA 4H58A 3DJ5A 4I5HA 3DBFA 2C6EA 3VUHA 4EYJA 2H34A 4BKJA 5IUIA 3R7GA 2C3IB 5DBXA 5CANA 4DLIA 5M4FA 4UMPA 5IPJA 3ZDIA 3W10A 1V0OA 5HG5A 5KO1A 4RT7A 4M66A 3H10A 5EG3A 1WBWA 4F0FA 4Y85A 5I9XA 3FI2A 3VHEA 3S00A 3C4XA 5CAQA 3BQCA 3ZXTA 2RG6A 3MVMA 4FL3A 4BVUA 1RQQA 3V6RA 4AA4A 1W98A 3BZ3A 4TWCA 1MRYA 3BV3A 3QD3A 5FXQA 4BTMA 1LR4A 4ANBA 3R6XA 1J7IA 2Z60A 3KU2A 4UMQA 2FGIA 2QHMA 3EKKA 1UWHA 4YU2A 3JUHA 3F69A 4AZEA 4YMJA 2ITTA 3QQKA 4DE4A 3SLSA 5K3YA 4H3QA 3WZEA 2QOIA 4BRXA 5IG1A 1UU3A 3EQBA 3TJCA 2YAKA 4UB7A 4UZDA 2CLQA 3HECA 4JQ8A 3PE2A 4L43A 5H3QA 3HDMA 4OLIA 4Z55A 4DEIA 3FWQA 5E1SA 4MH7A 5CSHA 4H1MA 3GI3A 2C5OA 3G2FA 3LFSA 4K9YA 3U4UA 3RPSA 2RIOA 3VJNA 4EH5A 5M44A 4HPUE 2IO6A 4YPDA 1FQ1B 3F7ZA 5CEOA 4EUTA 2CCIA 2UZVA 4O38A 4TKSA 3WF7A 3IKAA 1BMKA 5HTBA 1PKGA 2FA2A 4IAKA 3IW5A 2SRCA 3QCQA 4DH8A 4ZJVA 3AD4A 3GU7A 4CQEA 1CSNA 4EBWA 3PRIA 2UW3A 5AM6A 1F5QA 4O22A 4ZLYA 3KN6A 3MFRA 4GVAA 4ONAA 5AMNA 5IH6A 1MP8A 4U5JA 2RG5A 4PP7A 3E8DA 2RKUA 2C6OA 1FVTA 2XK3A 5HEZA 2YCRA 4AW5A 3NYVA 3C4EA 3WE8A 1Q3DA 4E73A 1VJYA 5HIEA 1XH5A
chains in the Genus database with same CATH superfamily
4WT6A 4QTCA 4UYAA 5GNKA 3GT8A 3K3IA 2HWPA 4UXQA 3FC1X 3VUGA 1XH9A 5AFVA 5AAGA 4PTEA 2QC6A 3R71A 2AUHA 4FL1A 4BCQA 3ORPA 5EW3A 4YPSA 3PXRA 4EOPA 2C6DA 5AIRA 5DEWA 2R3OA 3EQPA 2GNIA 3NUUA 4K33A 5C8KA 3ZZWA 4AFJA 3DFAA 4QP9A 2PE2A 5HIDA 2CGUA 4O81A 1GJOA 4KIKA 4M84A 3KMWA 3D2IA 4J97A 1KE5A 4BICA 3VS4A 5GINE 4HVHA 1IG1A 1X8BA 3O71A 4IVBA 3ZLYA 4S33A 3QALE 3PA5A 4JIAA 4I6FA 4G17A 3BHYA 4QMTA 4AXFA 3KRLA 1LPUA 3GOPA 4MKCA 5AP2A 1W2DA 2OG8A 3O23A 2UZNA 3OMVA 4M68A 3NS9A 2NRUA 2IPXA 1ZYSA 4PP9A 3BWJA 1UV5A 4S31A 4S34A 3QTQA 4YNOA 5H9BA 4ERWA 4G16A 2W1FA 2YM8A 4WBOA 3D0EA 3OY3A 3QTRA 5E8YA 5G6VA 4A9TA 3W8QA 3IDCA 4CFMA 2ZDUA 1VYZA 2ZMCA 1J7LA 5FTOA 4TY1A 4UXLA 4AZSA 4F99A 4X6RA 2XYUA 4DCAA 2W1IA 3TCPA 1M7NA 3DB6A 3GCPA 3KC3A 4FV6A 4WNOA 4D2PA 1KE6A 4DHFA 1KSWA 4KIQA 5L2IA 4DGOA 4JBOA 1BX6A 4WD5A 4EK6A 1G8JA 4L9IA 3S1HA 2PZPA 5CF5A 4GCJA 4D0XA 4GKIA 3Q9YA 4W9XA 5FLFA 4OAVB 1NY3A 2QCSA 4ZOGA 4K77A 4G3FA 5JFSA 2WTKC 4AT4A 4E6AA 1YXUA 3DZOA 1IEPA 2VU3A 1SYKA 1YI3A 3VUMA 3RAKA 4JXFA 3EFLA 3ZLSA 3MVHA 3MJ2A 3R8ZA 3R1NA 1R0PA 2UVZA 1OPJA 5ACKA 5I5ZA 4LV5A 2V5QA 3LKMA 3NDMA 4EOLA 3I6UA 3D4QA 3FQHA 4PPAA 4ZSGA 5JSMA 2F57A 4FNYA 5M07A 1OIYA 2HW6A 4P90A 3QCYA 4TNDA 4X2NA 3ZO4A 3WF5A 4FSWA 4I24A 3F3ZA 5AR8A 3MGYA 2Y4IB 1CTPE 1FINA 3L8VA 3VUIA 3LMIA 4K6ZA 4O7WA 4A06A 1VLRA 2ZV7A 2C0IA 5D9HA 5AUUA 4FYNA 3EWHA 2IVSA 4I1ZA 3RNIA 4D2TA 4L3PA 4OTQA 3OCSA 3TNHA 2V7AA 4CMOA 3W0SA 2XKFA 3DS6A 1YXTA 2NO3A 3DK7A 5KKRB 1KE9A 3QBNA 3RCDA 4IWQA 5EHYA 4ACGA 2ZV9A 3LE6A 4L52A 5CQWA 1W83A 2HENA 4X7QA 2OZAA 2BKZA 4MXOA 3BHTA 3CEKA 3AC1A 3Q96A 4BHZA 1JPAA 1SVGA 3QQUA 1WVYA 4IAAA 3BHUA 4E4XA 2VO0A 5D10A 2X0PA 3F3TA 4ZEGA 4F1TA 5AUTA 4G31A 1V0BA 3VS2A 1BL7A 2BHHA 1TQIA 4I5CA 5CU2A 4BZOA 4WO5A 4M12A 4F7NA 3LFBA 4QPAA 3QL8A 2QO9A 1E1VA 3R02A 2R3JA 3M2WA 4FRFA 4KSQA 3QUDA 5J1VA 1QPEA 2FVDA 3ZFXA 5IA4A 3BKBA 4QMPA 1FMKA 3LQ5A 3M11A 4DEGA 4RWKA 3CLYA 4FT3A 5EHLA 3ZRLA 1ZMVA 2XIYA 4BYJA 4HYSA 4D1ZA 1XH8A 2ITQA 3RK5A 1PXIA 4NM5A 4CTCA 1YWRA 2XYNA 4H39A 2YIWA 2ITXA 3BE2A 2ETRA 3VRYA 3R8VA 3SXFA 2XZSA 4RLKA 3C4FA 3CD8A 3QQLA 4UMUA 3LFNA 4KBKA 2YM4A 4IIRA 3K5VA 4ZSEA 2XIXA 4BR3A 3CE3A 5E8UA 4BZDA 1WAKA 4IJ9A 2PZ5A 4CMTA 2UZUE 4F4PA 5CF6A 3MA6A 3P0MA 3ORTA 4J7BA 2EUFB 3VUDA 4HGSA 3ZFMA 1J1BA 4LRKA 4X0MA 4ZMFA 3P5JC 3ULIA 2OJIA 2R0IA 2R7BA 4HW7A 1GIJA 2I40A 2GFSA 3I1AA 1YVJA 3L8XA 4ZTQA 4BDKA 1Q8UA 4CMUA 4EOOA 1YWNA 3SOCA 1M2RA 3IOKA 5JQ8A 2WIPA 1BKXA 4M69B 1ZY5A 5DNRA 4L3JA 1ZYJA 2W5AA 4O4FA 3R7EA 4BYIA 2IVTA 4D2RA 4LYNA 5LCJA 2Y9QA 4XRLA 5D7AA 1M2QA 4L68A 3C51A 2W9ZB 3IW7A 3CD3A 3FY0A 1HCKA 2VX3A 3MDYA 4LFIA 2WMBA 3VVHA 3FLSA 4X2GA 5HQ0A 1ZYDA 2CPKE 4GYIA 1DI8A 4K11A 5EM7A 4C7TA 4OUCA 5J79A 5LVOA 3BWFA 5HE1A 3PSBA 4FZ7A 2IN6A 3R21A 5TF9A 4CFNA 4DC2A 5KBQA 5JZNA 1PYEA 3F5XA 2QOBA 4HVSA 5IEXA 3NYNA 5ANEA 4MWHA 2G15A 3W1FA 2X6DA 3L9PA 5FUTA 5GHVA 2XP2A 3L9NA 3NVMB 3N9XA 5C9CA 2J4ZA 1OIRA 3DTCA 2YIYA 4JL9A 3HMPA 2XBJA 2NNWB 2YERA 3RWPA 2R7IA 2C4GA 4X2JA 5IEYA 2EXCX 3QTIA 5J5SA 2UW0A 4EKKA 3AKKA 3UVPA 4E26A 3KCKA 2YCQA 2O63A 4FSMA 4KBAA 4RWLA 3FPQA 2ZFYA 4D28A 1A48A 4G9CA 3T9TA 4U79A 4FTOA 4JR3A 4QMMA 4ZSJA 1XHAA 4IXPA 1XBAA 4FC0A 1ZOGA 1URCA 2WTWA 3BYSA 3HP2A 5L8LA 4EBVA 4ASEA 2YHVA 5C03A 5A4EA 3KN5A 4FNWA 4FTAA 1A9UA 3NUXA 3R9NA 3S2PA 4X3FB 4XBRA 4O7RA 1Q8YA 3II5A 2YWPA 4FK3A 3F7WA 2BRGA 2J7TA 5DPVA 5LMKC 3SOAA 2R3KA 4EK8A 3R73A 3VBYA 3JPVA 2W5HA 4C59A 2XEYA 2OIQA 5EH0A 1Z57A 2YZLA 3TZ7A 3FMHA 3EZVA 3FMKA 4NW5A 4U7ZA 3V5PA 2BMCA 2P55A 3AC4A 4W8DA 4YHJA 1U46A 4OW8A 3R7VA 3HUBA 4J53A 4BWPA 2DQ7X 3V5LA 5HCYA 5HD7A 4F1OA 3IS5A 4G9RA 4U3YA 3HV3A 3BYUA 4L53A 3HZTA 3RTPA 5BMMA 4FGRA 5GZ9A 4HVGA 2XARA 4JBPA 2WB8A 3NUAA 4Y46A 3ANRA 3THBA 3VBQA 4C3RA 5B2LA 1OPLA 3Q32A 5AAEA 3ENMA 3KULB 1TQPA 3EQRA 2PVJA 5H2UA 1H1SA 5KMOA 3E8NA 4YURA 4BBFA 3UZTA 3PLSA 4AXDA 4FA2A 4YZCA 2JFLA 3I81A 1J1CA 4KKHA 1W8CA 5AP7A 4CG8A 2HXQA 1REKA 3HAVA 3BPRA 4MXAA 2WIHA 2BRMA 4O0UA 5TOZA 4XMOA 4RBLA 3JYAA 2JAVA 3PE1A 5HX6A 3PWYA 4RRVA 3W0NA 3KK8A 2WQBA 2W4OA 3GNIB 5CNNA 1Y6AA 1U54B 3PJCA 3QD4A 5JH6A 3FSFA 4ZS4A 3NRMA 3TNQB 5HVYA 3QQHA 3RVGA 3MSSA 3QAME 4FYOA 5CU4A 1ERKA 4CTBA 2ESMA 4RVTA 5KZIA 2XIZA 5CENA 4FT0A 3EH9A 2OXXA 4O1OA 5IDPA 1JLUE 2W1ZA 4ANLA 3FMNA 1STCE 3PA4A 4ZZNA 5L6OA 4R7IA 3VBVA 5E1EA 4AGUA 3U6IA 4ID7A 4FKTA 5K4IA 4NWMA 3D5XA 3IONA 4BDBA 4R5SA 4II5A 3QQFA 3PY0A 4HVIA 2YIXA 3QZGA 4ERKA 4W4VA 3DBCA 4EZ7A 4MVFA 3U87A 4FKPA 5ANJA 4L00A 5DE2A 4BDCA 5AWMA 4C34A 4QMYA 4B8MA 3CS9A 2CJMA 3MA3A 5HE3A 1QMZA 2GNHA 3ALOA 4RZWA 3UVQA 4AT5A 5D41A 5IEVA 4BCKA 2ZB1A 4IVCA 4CQGA 3V51A 5JMSA 5BVWA 2H8HA 2VTOA 5DRBA 5EFQA 4RJ4A 5HNGA 4DN5A 3FL5A 4G5JA 2JFMA 4HYIA 2XA4A 4D2SA 2JKQA 3DAKA 3POOA 4DA5A 4GUBA 2ZV2A 4IB0A 4FJVA 2VWYA 1AQ1A 4I6HA 3GCUA 3IGOA 2XK4A 4JX7A 5AR3A 4D9UA 3L9LA 4LV8A 5EOBA 1SZMA 4I21A 1FVRA 1ZARA 4HOKA 5HIBA 4TYJA 4YJQA 3TTJA 2JDOA 3IQ7A 4IWOA 3NNWA 4LOPA 3SRVB 5AV4A 2Q83A 2BDJA 3MB7A 4D5HA 3H0ZA 2C30A 2B52A 2VTHA 3OUKA 3R1QA 3R0TA 2JD5A 5M55A 3ZLXA 4CFUA 3R01A 1OBDA 3ZO1A 2EB2A 4GFGA 3W0RA 5ITAA 3EN4A 4D9TA 3E8CA 2W7XA 3BGPA 3EL7A 2BFYA 4Q5EA 4J8MA 5AAFA 4EHZA 3LIJA 3QFVA 1WBVA 3FC2A 4TYHA 2YDJA 3AT3A 3QCSA 4ALVA 3UGCA 4IAFA 2HZIA 4U44A 5HHWA 3VULA 4NTTA 5M06A 2ONLC 2WAJA 4O0XA 3WIGA 3NVKI 4RX5A 3D7TA 2XJ1A 3WF9A 4Q9SA 1XBBA 4TYGA 3DCVA 3QYWA 1L8TA 5AA9A 4CSVA 4PL4A 5GZAA 2A1AB 2QU6A 3ETAA 1O6LA 4DG3E 5LWNA 4DGNA 4UN0C 4N6YA 4MAOA 4FSTA 4XOYA 2PMNX 4KWPA 5I9WA 2OBJA 5KCVA 2R0UA 5I4NA 4KD1A 2E9NA 1JBPE 3LM5A 4RX8A 3FHIA 5DMZA 1UU9A 2IF8A 3V5JA 5HBEA 3MIYA 4BIBA 3UO6A 3LFFA 4W4WA 5F1ZA 2WMVA 4DFLA 4ANSA 3I0QA 2X1NA 3SHEA 1MQBA 4K18A 2Y0AA 5EM6A 3SD0A 4QP6A 4EOKA 2YM3A 2Z7SA 4Z3VA 4YJSA 3E62A 3UMXA 1BUHA 4LGHA 3GVUA 3MTFA 3DTWA 5IISA 4V0GA 1W2CA 1GZOA 4AW0A 3CY2A 4F6UA 4YC6A 3OXIA 2XK8A 2NRYA 4FOCA 3CGOA 2RFEA 4X21A 3UIBA 4DG2E 2W1HA 3I0OA 2DS1A 3OROA 4RFYA 2GTNA 4FKSA 4WHZA 3FHRA 5EW9A 5HE2A 1ZZ2A 3WOWA 1Q4LA 4ENXA 2VWUA 4R3CA 3LXKA 3TM0A 2ZJWA 4FNXA 3W0MA 4L67A 2I0YA 1JSTA 3A8XA 3A61A 3PJ3A 2EVAA 4I5MA 4OTHA 4MX9A 3MN3A 4IX5A 5DVRA 1GZ8A 2QO7A 3PLAE 2QNJA 2R3LA 2XIKA 4QP4A 3EQFA 1RJBA 3CC6A 3D7TB 3TUDA 4F0IA 3S4QA 3CTHA 4RIXA 3LMGA 2FUMA 3FI3A 3FKOA 5EDRA 4C58A 2AYPA 4QNYA 3UP7A 5IQBA 2PVKA 4AQCA 3KF7A 4BGGA 3TI1A 5HKMA 2C5NA 4FTJA 4PNKA 3WZDA 4KS8A 4JJRA 4PL3A 4B9DA 5E7RA 4XOZA 4DT8A 1LEZA 3CXWA 2IW8A 4C4HA 2J9MA 3OS3A 3HAMA 3QZHA 3W18A 4J8NA 5LOHA 3DKGA 3ERKA 5BYZA 4AXAA 4L3LA 3CIKA 5BX0A 4DEAA 2ZM3A 4CFWA 5IA2A 3WYYA 2OJJA 3W8LA 5E4HA 3NNVA 3ZHPC 4FX3A 3TACA 5DT4A 3C9WA 1PXNA 2UW9A 5IKWA 1H0WA 2Y4PA 4DTBA 3OY1A 3WZKA 4OAUC 5IMXA 3UO5A 2I6LA 2QOLA 4K1BA 5FXRA 4FV0A 3OFMA 2R3FA 3JVSA 3GQIA 2C1BA 4ZS0A 4QMXA 3SG9A 5JQ5A 4GSBA 4ZP5A 3TZ9A 5FBOA 4ZLOA 3E3BX 3VS7A 2WMQA 1H25A 1XBCA 2R64A 3PVBA 3JR1A 3D15A 4RVKA 4E6DA 2YM6A 2VTQA 4EC8A 5DN3A 4IM2A 2WMXA 3LCKA 1Q97A 3FAAA 3I6WA 4UWCA 2Z2WA 3GC9A 2XS0A 2WXVA 4FI1A 4JDJA 4O4EA 3LCTA 3F3WA 3FQSA 4AU8A 2IVUA 2HAKA 4CFXA 4JG6A 5KZ0A 4Z7GA 2VWIA 5B7VA 5HVJA 4JG8A 4PRJA 1FOTA 3R7YA 3R04A 3GU5A 3KVXA 1GOLA 3Q60A 1H01A 2ITYA 5H8GA 3LM0A 3HV4A 5DRDA 1J7UA 4IWPA 2F7EE 3R8UA 2UZEA 3PJ2A 5AR7A 2IJMA 3HUCA 2PHKA 3QTXA 4BC6A 1PY5A 1REJA 2O65A 1B39A 1IAHA 5JRSA 5KHXA 1OUKA 3FMJA 3OF0A 4C2WA 3Q04A 1B6CB 3JS2A 4YGAA 2XUUA 3R9DA 3RPVA 3O8UA 2GQRA 2A4LA 4EHVA 4XUFA 3CPCA 1YI4A 4DEBA 1UNLA 2JDTA 3DK6A 4OTDA 3FSKA 4ITJA 3HV6A 4C8BA 4C02A 1OITA 4I3ZA 5JFVA 3SGCA 3A8WA 4J95A 4KUJA 3K2LA 4IX3A 5L3AA 4GKHA 4TNBA 3COMA 2UZOA 4PTGA 5AV0A 5M4UA 1IA8A 3H4JA 4HYHA 3OWKA 1PW2A 2Z8CA 4GK2A 4ZSLA 1ZWSA 3R28A 3IG7A 2GHMA 2BHEA 2OW3A 4AN3A 4L7SA 1H1RA 2YWVA 2W4KA 4QQCA 4C3PA 4ASZA 3BBTB 4USDA 5ETFA 5A46A 5CALA 3TN8A 2GHLA 2E9VA 2GPHA 2BDWA 3F88A 3QYZA 4GS6A 5FD2A 4YLJA 4W9WA 4DGGA 1KOBA 4EQCA 2P33A 1PXPA 2OJ9A 3CKXA 5AP3A 4GRBA 4QYHA 5EDPA 3W2QA 3ZMMA 3LFCA 3BL7A 4FSZA 4XRJA 3FE3A 2G2FA 4F9CA 1M2PA 5J7HA 2QOCA 5KE0A 3RHKA 3TG1A 5F4NA 3HLLA 2WFYA 3HP5A 4BDFA 2O8YA 1K9AA 2C68A 3NGAA 2YIQA 4J71A 3H3CA 4DBNA 5FG8A 5HX8A 3LFQA 3W2OA 3HKOA 1PMVA 4IVDA 3NMUF 2BTSA 3R30A 4AS0A 4BGQA 3QWKA 4FG7A 3TV6A 4E6QA 4YO4A 3BGZA 3KY2A 2WTIA 1WBNA 5CF4A 3GCSA 5CEIA 5E92A 4C38A 4BJJB 4EK4A 3WI6A 4UMTA 3DNEA 4ZTRA 2VNWA 4M0ZA 1H28A 3SV0A 4CGAA 3H9RA 2BZIB 4O0YA 3R22A 4EONA 4IAZA 3KXHA 4F6SA 3KF4A 4FSUA 4QMNA 5KMMA 4BTJA 3HRBA 4FUXA 4L6QA 3G6GA 5DOSA 5AV2A 5K9IA 2REIA 5EQPA 5HVKA 1P4OA 4FV3A 3R9OA 4TZRA 2QONA 5HGIA 5E8SA 2JIVA 3UP2A 3CBLA 4J98A 1ST4A 5M4CA 3ACKA 3EB0A 2HELA 2Z7RA 4HGEA 4AX8A 2JGZA 4A07A 2C1AA 3TMOA 3W32A 2IZTA 3E5AA 4YZNA 5J9ZA 2Z7QA 1DAYA 3FQEA 3HDNA 5ETIA 3UIXA 2OLCA 3ZH8A 2J0LA 1FGIA 2JIUA 4FKLA 2YABA 3JY9A 5CY3A 3SDJA 4JOAA 4B4LA 5CZIA 1Q41A 1W7HA 3UOKA 2CNQA 3IO7A 3PPKA 3Q9WA 4LUDA 1PJKA 5HCXA 5IA1A 1UWJA 3FXXA 2QI8A 1SM2A 1IRKA 5KMNA 5H8BA 1GNGA 2DUVA 3DJ7A 4FKRA 5AV3A 3ZC5A 2EWAA 4RLLA 3G9NA 3QTSA 4IDVA 5HE0A 3WZUA 3R1YA 4G3DA 3OC1A 3WF8A 4BN1A 3KCFA 3FMLA 4MXCA 4UALA 2UV2A 3RWQA 5HTCA 5IQAA 4X2KA 1XJDA 5AUWA 4RGJA 4Y5HA 2B9HA 4OTWA 3UG1A 4NIFB 2YA9A 2XMYA 1HOWA 4HVDA 1UNHA 3WBLA 3QGYA 3C0HA 4BIDA 3Q9XA 2PZYA 3LHJA 4XV9A 2I0EA 1DS5A 1HCLA 2ITOA 5FEQA 3BV2A 5JZJA 2G2IA 4APCA 4L01A 1H26A 3TUCA 2ITNA 3NFGB 2AC3A 4MEDA 3O96A 3PVGA 1KUTA 4O7TA 5J87A 4IAIA 4O4CA 4E3CA 2W1CA 4Y8DA 5HORA 4PL5A 3BHHA 3ORMA 4FSRA 4F7JA 5HNBA 3KGAA 4W4YA 3VQUA 2CNVA 3GFEA 2J5FA 2V55A 4XHKB 2Z02A 4Q9ZA 4IZAA 4FEVA 3BIZA 2R3QA 4ZTSA 3UNZA 3QZFA 3V5WA 3VS3A 4JS8A 4I0RA 3HMMA 2XNMA 2HY81 3UNKA 1JNKA 3F5UA 5HU9A 5M51A 3C5IA 1CKPA 3TDWA 1UNGA 4MHAA 4FKUA 4FBXA 4U3ZA 4CKRA 2B0QA 1H1WA 4FTRA 3SW4A 1FPUA 3DDQA 3SC1A 4IX6A 5HLPA 3RBWA 4IMYA 3BELA 2P2IA 2GNLA 4U40A 4XV1A 2C47A 5AA8A 3BU3A 2J51A 2VX0A 2O2UA 3GP0A 3MPAA 2ZMDA 2OGVA 2WMSA 3E7OA 3FPMA 1OL5A 4GFMA 3MIAA 2WNTA 3DOGA 5A54A 5C8NA 4RA4A 2Y6OA 5LQFA 3TKHA 4QDEA 3COIA 4QYYA 3DAJA 3PPZA 2FH9A 5CX9A 5DI1A 4EKLA 1OPKA 2BPMA 2QO2A 5CXZA 3GCQA 1H08A 2PVNA 4YTIA 4KSPA 4I0SA 4Z7HA 3B2TA 3MYGA 4IACA 5JFWA 4IH8A 2W17A 4FTLA 4JDKA 3UVRA 3FLQA 1KV2A 3A4PA 4U97A 3FMMA 4OBPA 3GB2A 5IUHA 4M69A 3M1SA 3G0FA 1URWA 1U59A 1XH6A 2BILB 2BZKB 3Q6UA 2AC5A 4M67A 5I0BA 5D7VA 2YCSA 4IQ6A 2BUJA 2PVFA 2RGPA 3BU6A 3Q6WA 1PMUA 5ANIA 2R3GA 1V0PA 3DPKA 3NYOA 2FSMX 4LI5A 3UNJA 3PY1A 4AZVA 3CQWA 4D0WA 3MFUA 4IDTA 3CPBA 3FYJX 4ASXA 3LW0A 4YLLA 4V05A 2BROA 1CM8A 3BQRA 4FUYA 4J1RA 4WG5A 3GXLA 4CXAA 3RPYA 3KIOC 4GK3A 4AW2A 4CEGA 3ZBXA 1XWSA 4GW8A 4AOTA 1H07A 4F0GA 5FRIA 4WA9A 4XYFA 4AZWA 4DFBA 5KNJA 1XO2B 4YTFA 2QODA 4WNKA 3PG1A 3FJQE 3TNIA 3W16A 1XMLA 4BI0A 3DKOA 3A7JA 3U55A 3G33A 4JR7A 1Z5MA 4F63A 4F7LA 3VHKA 5L6PA 1YI6A 4OTIA 4F7SA 4FV1A 2VGOA 2HZNA 3UOJA 5DR9A 2GMXA 3PYYA 4AAYA 4L45A 4E4LA 4ZJJA 4D4VA 4AZTA 3BU5A 3NCZA 2PZIA 3Q9ZA 4XJ0A 3VS5A 4F64A 4ANQA 2BFXA 4V01A 3W0OA 5M09A 4XP0A 1WBOA 3DXPA 5T68A 3DXQA 4C3FA 4DFNA 2O5KA 4G3EA 3OZ6A 4AA0A 3HA8A 4IZ5A 3E92A 2O0UA 3MB6A 3NSZA 2JBPA 5DYJA 3IDBA 5IQHA 4Y83A 3NAYA 3MPTA 5FDPA 4L7FA 4X3FA 4A4LA 1SVEA 4QD6A 3VBXA 3RI1A 2Y7JA 3UPXA 3Q2JA 3TDVA 3E3PA 4I6BA 5DG5A 1TKIA 3ZYAA 3U6HA 3E63A 2FSLX 2VN9A 4GJ3A 3HVCA 5CAPA 1OIUA 5CSWA 3LJ2A 4O7ZA 2J5EA 3CQEA 3D5VA 3DY7A 1Q8ZA 3ORLA 3DKFA 1U5RA 4WUNA 1OKYA 5FM2A 4NM3A 1MRUA 4BDGA 4OT6A 5B2KA 3UODA 1QCFA 3O7LD 4S32A 4FEUA 4JDIA 3P5KA 1M14A 2XNEA 3FUPA 3I5ZA 2YLEA 4MUQA 4HZRA 2I0HA 4ZJIA 2QKWB 5BVOA 1JSUA 2WQNA 4NH1A 4EZ3A 3DGKA 5TKDA 2KULA 5FQDC 2WO6A 1QPJA 4GMYA 4RA5A 3OUNB 3DJ6A 3BLHA 3KULA 4QP8A 3PFYA 4QMVA 1QL6A 2IVVA 5KMKA 1YOMA 2UZBA 3RPRA 3PZEA 4E20A 5M4IA 3AD6A 2XNGA 2X0QA 2JDVA 3GFWA 3KA0A 5CEMA 4CKIA 3A7FA 1Q62A 2BIYA 2UZTA 4N0SA 3COKA 2XRWA 4NJ3A 1OI9A 4P2KA 1KE8A 4U80A 3LCDA 4TPTA 3EL8A 5I3OA 1JQHA 5HESA 4EUUA 3DQXA 2ZB0A 4U41A 3TZ8A 1BI8A 1BLXA 2B53A 5L6WL 4DTAA 3Q53A 2EXEA 1U54A 3F6XA 1PXJA 2VRXA 3HRFA 3KVWA 3QHWA 5L2WA 3ZC6A 1ND4A 2RSVA 4NSTA 4RFZA 2IW9A 5CT7A 2XNBA 4C4GA 3O8TA 2WOTA 4QP3A 4FTIA 5KBRA 1JKSA 2RF9A 3UDSA 3W2CA 4WRGA 2PTKA 1OB3A 2J2IB 3ORNA 4O1PA 1OL6A 2B9IA 3MTLA 2LGCA 4GH2A 4RQVA 4IFGA 2CKEA 4GG7A 5DR2A 2H96A 4C37A 3GQLA 4NJDA 3BBWA 4X6QC 5BVEA 2BRBA 3CQUA 1K3AA 5J9YA 4YSJA 4BFMA 5I9YA 5JKGA 2VWXA 3KFAA 2WHBA 3GUBA 5IUGA 3ROYA 1OECA 4XLVA 4UBAA 3QKMA 4QRCA 2WTCA 3KXGA 4HGLA 4E8AA 4XNEA 4BCMA 2J0IA 2OICA 5E9EA 3DKCA 2QLQA 3DA6A 5AV1A 5IZFA 2WOUA 4YTHA 4MF1A 4EEVA 4KRCA 3PJ1A 1FGKA 2O3PA 1WVWA 2VTTA 1GY3A 2X2KA 3OXTA 4YZBA 3H9FA 4O0TA 4B99A 4FF8A 5M57A 2PYWA 1MUOA 5LVMA 4WSQA 5J9LA 2WMTA 4AWIA 3VONA 2PL0A 3P4KA 3GOKA 5GIPE 5CF8A 3UJGA 2ZAZA 2VTPA 2X9FA 4AACA 4QPMA 3KRJA 3PWDA 2XCHA 4PV0A 4RIYB 3MW1A 3PP1A 1UA2A 2WTKB 4HYUA 3AQVA 4GU6A 4OTFA 4LL0A 3O50A 2OO8X 4D4RA 4CLJA 3VJOA 3OTUA 2X8EA 3WYXA 3SRVA 4BDIA 4N4SA 3TNPC 4WG3A 1P2AA 2J50A 3UIUA 5AX3A 4MCVA 4XG3A 2P3GX 4ACHA 3R8PA 2PMIA 3GBZA 2R5TA 5C27A 4BDJA 3LLAA 3HNGA 3NPCA 4NZWB 1DI9A 1KV1A 3MJ1A 4QMSA 5DHJA 2WMRA 2X7FA 2GS2A 4YO6A 3OEFX 5CI7A 2UUEA 5A4TA 4BZNA 4XEYA 3PIYA 4I94A 3OEZA 3AC2A 3TIZA 3FKNA 1WBTA 2OF2A 4GEOA 3CSVA 4AUAA 3ODYX 2R3MA 4YJNA 3NUNA 1OKVA 3PXYA 4JVGA 4KBCA 3U54A 3DNDA 3I60A 4E1ZA 2JC6A 2WMAA 2ITZA 2OFVA 2YZAA 3OCGA 4I6LA 2BVAA 3V04A 1PYXA 4MK0A 2WMWA 2YM7A 2C6KA 4MWIA 2DWBA 2CLXA 1P4FA 3RP9A 3RPOA 4EHEA 2VO3A 2IG7A 3GEQA 4CT1A 4FV2A 5AUYA 4FODA 3EJ1A 4U43A 3UZRA 4UWYA 3QXPA 4X2FA 4PUZA 4Z16A 1IA9A 3UDZA 1F0QA 3OBGA 3BL9A 4IM3A 2YJRA 4WKQA 2VX1A 4M0YA 1Q24A 1K2PA 2XAOA 1W2FA 4LMNA 3DV3A 5EM8A 3BRBA 1OIQA 5T3QA 2XRUA 4Y72A 4CVAA 2J90A 3DBEA 4I6QA 1JWHA 4D2WA 3O51A 2C3JA 4NFMA 5E8ZA 4E4NA 5J1WA 4C57A 5BMSA 5IQDA 3I7CA 2BALA 4QOXA 4BCGA 3PP0A 3HGKA 4FV7A 3MV5A 4RVMA 2JLDA 3A7IA 4YJUA 3ZEPA 3NR9A 4PWNA 1JOWB 2XK6A 3G0EA 3NW5A 2HY0A 3BHVA 4FKJA 1UKIA 2JKKA 1GIIA 4IHPA 2VWVA 4PMTA 2PE1A 5I9ZA 3R2YA 2UZLA 4GII