4W9WA

Crystal structure of bmp-2-inducible kinase in complex with small molecule azd-7762
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
306
Chain Sequence
VGVRVFAVGRHQVTLEESLAEGGFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAAADCPVSNINNSSIPSALPEPMTAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords BMP-2-inducible protein kinase
publication title Family-wide Structural Analysis of Human Numb-Associated Protein Kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 306
sequence length 306
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4w9wA00
1B6CB 3DK6A 5AAGA 3FSKA 3NEWA 3HRFA 5B0XA 5H3QA 5AEPA 3D94A 3TKIA 2WB8A 3Q3BA 4X6QC 4FTUA 2KULA 4BCHA 4IM3A 1QMZA 2EB2A 4ZZNA 3S1HA 3W1FA 1Q97A 3VULA 4KBKA 2FH9A 2F4JA 5DT0A 3P08A 4RX8A 4YLLA 5K3YA 5CZIA 4FNYA 4XG7A 4EOKA 4DGGA 4E6QA 2OH0E 5CSXA 4PL5A 4BKJA 5HE1A 5DMZA 3RBWA 2ITOA 3P78A 4KBCA 4X2JA 4G6LA 3PA4A 1XH9A 2JFMA 2NP8A 3MI9A 3V5PA 1PKDA 4FKGA 3C9WA 3FMHA 2BILB 4JG8A 2VO7A 4RIYB 3TT0A 2JDSA 4CFUA 3CGFA 3ORLA 2BZKB 4RIYA 5FBOA 1M17A 3KRRA 2ZV9A 4EOJA 4ZSGA 3NYVA 5EW3A 4CQEA 4YJVA 4H3BA 3TIZA 1IG1A 3D5VA 1UNGA 3H3CA 5BPYA 3WIGA 5M4IA 1RDQE 3KF4A 2QLQA 3F5GA 4R3CA 5T3QA 5IZFA 5JFVA 3FWQA 4QMWA 4QMPA 3ZSIA 2VWWA 2QO9A 3JY9A 1PXOA 2QU5A 3KRXA 4CXAA 4RIOA 1YRPA 1NVSA 3A7GA 3I7CA 3U6HA 5IF1A 3FLQA 3ZLSA 3E3PA 1V0BA 4LMNA 4ACGA 4HYUA 5EOLA 5CEIA 4CTBA 3MVJA 3C4XA 5L2WA 5IKWA 3JVSA 3RWPA 4D2TA 3R7GA 3OP5A 3NS9A 3HMPA 4X6RA 3R9DA 3HYHA 3MFTA 4OTPA 5F20A 2W4JA 2Y9QA 4HPTE 3KCKA 1LPUA 4L3JA 4PTCA 5AM6A 5EI2A 5AA9A 1HCKA 1GZNA 4C33A 4QP2A 5BQ0A 2WTIA 3BLRA 3MGYA 3FBVA 1H27A 4FKRA 4YHTA 5EM7A 3LFCA 3LCSA 4FNZA 4O0TA 4TYEA 3RGFA 4QTEA 2J0IA 3G0EA 1QCFA 4AX8A 4Y85A 1ATPE 4HNFA 4ANQA 4UBAA 3MSSA 5JMSA 2VTHA 2X81A 4BICA 4LGDA 2YERA 4ACCA 4KAOA 1FGIA 3AD4A 3BGZA 3DV3A 2UZDA 3P23A 3LFDA 2QO2A 3QX4A 2GNHA 2W1FA 1Y6AA 3ENMA 1OPKA 3RPVA 3F69A 2Z7QA 4U3ZA 4AWIA 2J2IB 2W1HA 2XA4A 4J71A 4N0SA 3A2CA 3PPJA 5CXZA 5AWMA 1RW8A 3EQGA 2F7EE 2QKRA 1RJBA 5J8IA 3HV4A 4IFGA 2ITPA 3PA3A 3VS2A 3ETAA 2O2UA 4BTJA 1WMKA 4BTKA 3BPRA 4QYFA 4YHFA 5ETIA 5DR9A 4BDBA 3NCZA 5D9HA 5LWMA 1KWPA 5HLPA 4K2RA 5AX3A 2GMXA 2YEXA 4AW2A 4ZLYA 2QKWB 3MV5A 2IZRA 3GCUA 4LL0A 4FG7A 4XEYA 5BVKA 4YU2A 3D4QA 3I5NA 1TQMA 5LCKA 1FINA 1XBAA 1R0PA 3MJ2A 4J52A 2I0EA 2YAKA 4PP9A 2GNIA 1JSTA 2UZTA 3WYXA 4J7BA 3KXHA 3I7BA 4QP8A 5AP0A 3EQBA 3E7VA 2QO7A 5FEEA 2O63A 3U9NA 4DEDA 2DYLA 3NUNA 5IA0A 4WO5A 2Q0NA 4Z3VA 4AFJA 3ZS5A 4U41A 4YJSA 1B39A 3FPMA 2WQNA 4IVAA 1MP8A 1SM2A 1B38A 4ZTQA 3LXPA 1OKVA 3PPZA 2YM4A 2C6IA 4MQ2A 4MVFA 2YIQA 3II5A 4ENYA 5GZ9A 2OXXA 2H96A 2WO6A 3NYOA 5I9UA 2W4OA 4X21A 2QD9A 4FKTA 2JDTA 3EL7A 3FSFA 4H3PA 2W1GA 4YLKA 2PVHA 3R28A 1YDRE 5K0XA 5KMOA 2ZV2A 3O8PA 4L67A 4EH9A 4U8ZA 4ZSEA 1Q8ZA 3TJCA 5IDPA 4GMYA 3V8TA 1O9UA 2WKMA 3D7TA 1WBVA 3HMNA 3ODZX 3QA0A 4WBBB 4D4YA 4YJQA 5T6KA 3S4QA 4S30A 2UZOA 3KVWA 2Z7RA 4IE9A 3QKMA 3WOWA 2H6DA 4MH7A 5L6WL 1YWNA 2VX1A 4AQCA 3FI2A 1FQ1B 3FMJA 4QYEA 4R6VA 2CMWA 4HVHA 1XO2B 2JDOA 3P0MA 4NFMA 4FV3A 2HXLA 3HKOA 4BIEA 1R78A 4MQ1A 3Q5ZA 5HLWA 3IG7A 3D9VA 3BU5A 4XBUA 2XYUA 5EDPA 3EQCA 3KRLA 1UU8A 4UB7A 2W17A 4C35A 1ZXEA 5BYYA 4MCVA 1M52A 3TZ8A 1UU7A 1YOMA 4GYGA 4ZZOA 1Q61A 2VAGA 3KB7A 4KSPA 4RJ8A 3VO3A 1ZYLA 3CD8A 1DI9A 2XBAA 3DBCA 4GVJA 4O2PA 2ETMA 4V01A 3A7JA 3OCBA 4ASEA 4QTCA 1O6YA 4FKUA 3VQHA 4K6ZA 3PUPA 4DH8A 2WU6A 5HNIX 4M13A 4GEOA 4RZVA 5KO1A 1E1VA 4FODA 3QTRA 4X3FB 2OZAB 2PK9A 1UKIA 3DXNA 3CTQA 4IAZA 2DWBA 3GC7A 3IKAA 2OZAA 3E8CA 3PLSA 3Q9XA 4UXLA 3QYWA 2GHMA 4M0YA 4ENXA 2AC3A 2BTSA 4IDTA 3C5UA 5L2SA 5CU3A 5BVWA 4F99A 4HVGA 2W5HA 1GIIA 3WE8A 3GC9A 3MIYA 5M4CA 1YI6A 3LCKA 3RPOA 3W2QA 3ORPA 3ZZEA 4BCIA 5F9EA 2WTKB 5CX9A 4TY1A 1H00A 4LOQA 4L44A 3Q4CA 4NIFB 4RLKA 4Z9LA 4EKKA 4BTFA 4NIFA 2ACXA 4A9TA 2QLUA 5LMBA 3UP2A 3G51A 4RJ6A 5KMJA 3FAAA 2CGWA 2WMWA 3NW7A 4FYOA 2PMNX 1L3RE 3KC3A 5M53A 2C4GA 4I0SA 4FTIA 1LR4A 4FSYA 2O5KA 2X4ZA 5HNGA 2XJ2A 5CVHA 4FV9A 5IA2A 5JRQA 4JG6A 3DAJA 3PY1A 3UIUA 1UVRA 4EC8A 5IH6A 2HZNA 1ZMUA 2PE2A 2J0KA 5TO8A 2YN8A 4USEA 3OEZA 3C4FA 5G6VA 2WQBA 4CTCA 3LCOA 3RAKA 4EOIA 5BYZA 2XNMA 1V0OA 5CAQA 3E63A 1YKRA 3DZQA 4JBOA 5F95A 2J90A 4R3RA 4TXCA 4FK6A 4FTCA 5EYMA 5LMKA 4EH6A 5IU2A 3EYGA 5TF9A 5DN3A 5E1SA 3KRJA 2V5QA 1FVVA 4BGGA 3OEFX 3LIJA 2W1ZA 1IEPA 2XNGA 2YDIA 3LCTA 3L8XA 5DVRA 3CCNA 4ACHA 5HO8A 3PG1A 1I44A 4PMMA 5KBQA 4G9RA 4RVLA 5DH3A 4CD0A 3LVPA 3QKLA 3SXFA 5CASA 5AX9A 3KQ7A 3ZO4A 3VIDA 3UODA 3DCVA 2WAJA 5B2KA 2BFYA 4XCUA 5ANJA 3A4PA 3V5JA 5HU9A 4I0RA 3Q4TA 2PUUA 3ORXA 2C6TA 4FBXA 5CSVA 1Q99A 1SMHA 3UC3A 3VW8A 2JGZA 2JBPA 5JQ5A 5LVOA 4CFFA 4F1MA 1KV2A 2P2IA 3C4CA 5CZHA 3UNJA 3WF6A 4J53A 2G15A 3HV3A 1YWRA 1WBWA 3MPTA 2HCKA 4CEGA 4IC7A 5EW9A 3KVXA 2ZJWA 4QYGA 3ZHPC 3G9NA 4K77A 2Y0AA 3NUSA 3OCSA 4C59A 2R3KA 3DJ6A 4KSQA 3KMUA 3NPCA 3OC1A 4FSRA 2YISA 4RWJA 5DEYA 5HG7A 2F57A 4LYNA 3H9RA 3UPXA 3AOXA 5GJGA 2VWXA 4PNIA 4CMOA 5FG8A 4E4NA 4NTTA 3QC4A 2YZAA 3GU4A 4V05A 3NUYA 3V6SA 3LFNA 3HMMA 2BVAA 4CMTA 4OAUC 3DBQA 3R02A 2RL5A 4I92A 4W4VA 5AP3A 4A9YA 2AC5A 4EYJA 2PVRA 4IAAA 3QTXA 2UW9A 4QP4A 2NPQA 3ZM4A 3KULB 5I5ZA 5I9XA 1W84A 4QMNA 1XQZA 3KULA 3PXZA 4JX7A 4Q9ZA 2B9HA 3NW6A 4CVAA 3AG9A 5AR2A 2R3OA 2WMQA 2YWPA 5CEOA 5IG1A 3PPKA 2X1NA 4LRMA 3OMVA 4UEUA 3CJFA 1V1KA 2WOUA 1UU9A 2RG5A 4AZEA 4CCBA 4FIFA 4TYIA 3IECA 1MQ4A 3P1AA 4DN5A 4HCUA 2XK9A 4EYMA 4IM2A 2OICA 3AMYA 1OIUA 5AUYA 5LJJA 5D7AA 4L45A 4IB3A 4JR7A 4RX9A 4RX7A 2XYNA 4F9WA 5JSMA 3DJ5A 2B7AA 1WBSA 4TWPA 4JDKA 1LUFA 4JBQA 3UP7A 2PZRA 3WF5A 5E8SA 5HTBA 4YHJA 4CRLA 1VR2A 3ORMA 4RJ4A 3EN4A 3GC0A 4CLIA 1H1RA 2B9IA 4AF3A 4QQJA 3VNTA 2JEDA 1MRVA 3BLHA 4I5HA 2WIHA 2YFXA 4AXAA 4BB4A 2X2KA 5DR2A 2WEIA 1Q62A 5H8GA 3GCSA 1T45A 2BZJA 3PE1A 4KIOA 4M14A 4I23A 5HX6A 1H25A 1R1WA 3RKBA 4BWXA 3W32A 3ZBFA 1GJOA 3LFQA 4GK2A 4F1OA 3AT4A 2P2HA 3OS3A 2XK3A 4DGMA 4DLJA 2R3QA 2BAQA 1YOLA 3E93A 4FOCA 1GIHA 5L2QA 2PWLA 1PJKA 4B0GA 1BMKA 3ZRMA 1BLXA 2XK4A 4ZZMA 4FA2A 4AT5A 2OJJA 1WBOA 3SXRA 3QTWA 5A4CA 2NO3A 1QPCA 3KN5A 1YHSA 3DOGA 4IVDA 4EC9A 3QQGA 2XIKA 3QZIA 4F64A 2E9NA 4OT6A 5CWZA 2X6DA 3DKGA 3U6IA 3VBYA 4QMQA 3KXNA 3PIZA 4FTAA 3HZTA 4ZP5A 2WXVA 3EQIA 1OKYA 2ETKA 3ZO3A 1S9IA 3DGKA 5FM2A 1E9HA 4EJNA 3D2KA 5AV4A 4QYHA 4D2SA 4A9SA 3DAKA 4O6EA 3DT1A 3KA0A 4JQ8A 4YTIA 2XF0A 2RFNA 2B9FA 3R0TA 4EK6A 5HD4A 3VBXA 2JD5A 2RFSA 1U5RA 4BCQA 2JDVA 2WMUA 3BBTB 3EWHA 3L8SA 4LGGA 4GIHA 3BEGA 3HEGA 3QWKA 2IW6A 3FYKX 3AC2A 4WG5A 4HNIA 4YSMA 2CSNA 2UW5A 1M14A 3S95A 3E88A 3ZLYA 1JBPE 5C8MA 1H0VA 5KKRB 1PMUA 3P7AA 4YP8A 3PJ1A 3PWYA 4I4EA 1QL6A 2VN9A 3H0ZA 2VTPA 4XOZA 3S0OA 4MAOA 4YPSA 3A8WA 4M84A 1CKIA 3H9FA 2PZYA 2W05A 3BE2A 4FTLA 2VWBA 4XV1A 1PYEA 5KMMA 4LG4A 3NX8A 2WTDA 3K3IA 3ZSHA 3HNGA 2JIIA 5EKNA 4FYNA 5KE0A 3QHRA 4RPVA 4DG0E 4BDIA 4FSMA 2SRCA 2OU7A 3ULIA 1V0PA 4FSWA 3ODYX 3SD0A 5D11A 3EFLA 3O71A 3UBDA 3WI6A 4ZY5A 4D4RA 2BR1A 2IN6A 3MJ1A 2W1CA 5AAFA 4ZEGA 1T46A 5L8KA 4FV4A 3BKBA 3KK8A 1LP4A 4N6YA 4W4WA 3GUBA 3GBZA 4NTSA 2HW7A 5FBNC 4NW6A 3FYJX 1OL2A 3DU8A 4LV5A 3BV2A 3DJ7A 4XNEA 4HYHA 1JKLA 5J5TA 2WMXA 3F5PA 5D1JA 2OH4A 2QOLA 4AA5A 1OGUA 5HQ0A 4MXCA 1NA7A 4BBEA 3CD3A 4GSBA 4E5BA 2B1PA 4NW5A 4ZTHA 3BIZA 1CSNA 2A19B 4I21A 5FD2A 2WTVA 2OW3A 2ERZE 4GU6A 4MD8E 4YJNA 3UMXA 4KD1A 4EHZA 3F66A 1ZOEA 3EMGA 4YPDA 4CKIA 3F3TA 3RPYA 2X9EA 2O8YA 4RJ7A 4U42A 3QGWA 2BCJA 2ZB0A 1BI8A 4JRNA 4GV1A 2IJMA 3QTUA 3QUPA 2UVXA 2H8HA 3LJ1A 4ANLA 2Y4IB 3SOCA 3EQPA 4D4SA 3TTJA 5CY3A 4D0WA 2V7AA 4JNWA 1OIQA 3KY2A 3BHUA 2REIA 4IBMA 5TR6A 5LVPA 4B7TA 5DOSA 5GJFA 4EQCA 3DTWA 3FC2A 3S2PA 2Y8OA 3BELA 3GT8A 4WRGA 3UVRA 1Q5KA 3CEKA 3JPVA 4IZ5A 3UYSA 4CFXA 2CGVA 3G2FA 2RGPA 4BYIA 4EOMA 4LRKA 2VTSA 3UJGA 2GFCA 3EQRA 5JEBA 1OI9A 3UOHA 4PX6A 4USFA 1RQQA 2WTWA 5AADA 3O8UA 5J79A 1VYWA 5CSHA 3QCYA 4AW0A 4FNWA 2E9VA 3PG3A 4PPCA 4RMZA 3ZC6A 4PF4A 5M4UA 3ZTXA 2A0CX 4QPSA 2CGUA 3FXXA 3GB2A 4FKOA 4XJ0A 5AMNA 4E7WA 3C4ZA 4HW7A 2P0CA 2VTTA 1PKGA 3UC4A 4O6LA 5FQDC 1OMWA 2WMSA 5CU2A 5E91A 2R3HA 5EFQA 3SW4A 5I9VA 4B8LA 3FKLA 2YM7A 2FGIA 3DQWA 3HV7A 4MTAA 2BMCA 4U43A 4FV8A 4YNEA 5D7VA 5CEPA 5E8XA 5D10A 1H0WA 3HX4A 4XYFA 4AE9A 3PVWA 2QOHA 4O1PA 3CLYA 4XG4A 4D1SA 4RFYA 4DYMA 4Z7HA 3BYMA 1Q8UA 4FKJA 4Y46A 3QQUA 3FY2A 5L3AA 4JQ7A 1GZ8A 5IDNA 2GS2A 4XG9A 3QRUA 3UIMA 5E8TA 3IGGA 4JBVA 1K9AA 4F6UA 4PNKA 2O0UA 5H8EA 3F2NA 4G16A 5M56A 3R7OA 2JIUA 5HVYA 1HCLA 3M11A 3IONA 3LFAA 4FNXA 3WILA 5DA3A 2QODA 1NVRA 2YLEA 5AV2A 4EUUA 4C3RA 1A06A 4JJRA 5FP6A 4IANA 2UV2A 3R1NA 4FZAB 3IO7A 3TNQB 3R63A 3FQEA 4GH2A 4YTHA 3ZLWA 4FV0A 5E8VA 5JKGA 3D15A 2IZTA 4W4YA 4GVAA 4D1XA 4A06A 1M2RA 5KNJA 3E3BX 3KU2A 4CT1A 4M8TA 4OW8A 2ZM4A 3NUUA 3R8UA 1OIRA 2GU8A 3D14A 4M69A 4OT5A 3ROYA 5IUIA 4BBMA 3CE3A 2HIWA 4NEUA 1YW2A 2R3IA 1RE8A 5CVFA 3R21A 4PQNA 3B2TA 4FKPA 2FYSA 3L1SA 4F6WA 4FC0A 1H1WA 2ZB1A 4IB5A 4UYAA 3TZMA 4EI4A 3T3UA 4IWPA 3QUEA 2HZ4A 3PP0A 3W2CA 1ZMWA 3LQ5A 4ZJVA 3PY3A 3W8LA 3A99A 2LGCA 3KGAA 2JKQA 2X4FA 3Q53A 4BBFA 5EI6A 4Y8DA 3MPMA 3DY7A 4OTFA 5HX8A 4JG7A 2JKOA 3A8XA 1OL6A 3VHKA 4AZTA 5I3OA 2ZOQA 2QOOA 4MBIA 4PV0A 3ZXTA 1X8BA 5EW8A 5J1WA 4YMJA 1SVHA 5JGDA 5CAUA 1KE9A 4QP6A 2PVKA 4DLIA 3U51A 3N51A 4HGSA 3OY1A 4YZMA 3RP9A 3SW7A 2IZUA 4PRJA 3QU0A 2XVDA 4RIXB 4KRCA 3HP5A 2VTQA 3HA6A 4RIXA 3DPKA 2QHNA 1YDTE 3MY5A 1M2PA 2C5XA 4GJ3A 5HG9A 5C27A 1K2PA 5FLFA 1J1CA 2J0MB 5C01A 3PXFA 2UZUE 3EKNA 3R00A 1TVOA 5HORA 3R83A 5M4FA 3R30A 3O17A 2F9GA 4APCA 3SDJA 5IISA 1YXTA 3CXWA 3QBNA 4BVUA 4EH8A 3RM6A 1Z9XA 1YQJA 4RA5A 2FUMA 2BIYA 3BI6A 3MH0A 4QMTA 4RSSA 2OF4A 2B54A 4BCFA 3R7UA 3LQ8A 4IAIA 4JAIA 5JH6A 3UOKA 3RM7A 4G3DA 4ZTMA 4AGWA 5T68A 3L8PA 3OD6X 3RHXA 5EYKA 3VS7A 3WZKA 2PVFA 5KMNA 1YVJA 3RWQA 4B8MA 3EFJA 4BN1A 4XOYA 2WQOA 4GIIA 3TI1A 2Q0BA 4QMMA 2VO0A 1WBNA 4E6AA 1TQIA 1P5EA 2R3LA 3G5DA 3IPHA 5L8JA 4ZJIA 4AGCA 4AACA 3B8RA 4QP7A 3R6XA 2VTLA 2R3NA 3DNDA 4X0MA 3PTGA 3QWJA 4FV1A 4OGRA 1R0EA 2WPAA 3BYOA 3UOLA 3Q96A 4NM3A 3QTZA 3QQLA 4XHKB 5A46A 5I9WA 4PMSA 4U80A 4HGLA 2WTKC 4QP3A 4BCJA 2QOCA 2YITA 3BV3A 4W8DA 4EEVA 5AP2A 4FG9A 3RZFA 4NM5A 1ZYCA 2XCHA 4IB1A 5CEMA 4QMXA 5AP4A 3DKOA 3GC8A 5G1XA 4F0GA 3HRBA 4ASZA 3G90X 5AR5A 1YHVA 4DFYA 3LCDA 3CBLA 3ZEPA 4L00A 2F2UA 3ULZA 2BROA 4U3YA 3MFUA 4ANOA 3QTSA 3RPRA 3CQWA 3ZXZA 3EHAA 3R8VA 3MFRA 3TZ7A 1XBCA 3GFEA 4HZRA 2PMLX 4L3PA 3QLGA 3MIAA 4S32A 4BDKA 2XBJA 3TG1A 4A7CA 4Q5HA 5LWNA 5EDQA 4UWCA 1KOBA 1JKSA 3A60A 3LXLA 4J8MA 4ZTSA 3I60A 3TUBA 4EH5A 3R8ZA 1SVGA 3E92A 3IW7A 3MB6A 1U46A 4E4XA 4DG2E 2ITZA 3IW6A 3TEIA 2HW6A 4NT4A 3RHKA 4E1ZA 4D5KA 5ICPA 5LXMA 3THBA 1TKIA 1G5SA 5IPJA 5LMKC 3FV8A 3OTUA 3VUTA 4ZY4A 2QHMA 2WEVA 3EB0A 4WOVA 3VS6A 4YZDA 2C6OA 2FO0A 3MH3A 1H26A 4RC2A 3GU5A 1J91A 2E2BA 5DR6A 4IEBA 3MW1A 5AUVA 3AMBA 2I0HA 3VRYA 5ANOA 5IEXA 5EDRA 4NM7A 1PXPA 3B2WA 3O8TA 3UG1A 3VS4A 4NKAA 1PXLA 3RAWA 4D4VA 2PVNA 3ZO2A 2EXMA 3KF7A 2YAAA 5JRSA 2O64A 4UY9A 3ACKA 4BGQA 2VUWA 4IC8A 4XV9A 4DH3A 2C6KA 2ZDTA 3A61A 5ETAA 3ZUTA 2YM6A 5FXQA 4FTJA 2QI8A 3PSDA 4YBKA 2YCSA 4GK4A 4D2RA 2XMYA 3MBLA 1H07A 3BYSA 3C0IA 4DGLC 5BMMA 3FL4A 4HGTA 1VZOA 2R3MA 1PXJA 2QNJA 5ANGA 2UZVA 4ANMA 4AU8A 4C3PA 4EQMA 5IEVA 5M44A 1P4OA 5A6NA 1Q8WA 4TNBA 5C8KA 3IOPA 2DUVA 1FPUA 2PMIA 3BU6A 3COIA 5DWRA 1ZZLA 3A62A 4JR3A 1XH4A 2R64A 5FGKA 5JN2A 1YI4A 2VGPA 3FQHA 4NUSA 4KKHA 4DEAA 2IZSA 4ANBA 4ZSJA 3V5QA 4E5WA 4R1VA 3HA8A 5AP1A 2ETRA 2I0VA 4BZNA 3HLLA 3NDMA 1PMNA 4GK3A 4XS2A 2RG6A 2BDWA 3RK5A 4ITJA 4BFMA 3OG7A 3A7HA 4M97A 5E8YA 3RAIA 3OW4A 4K33A 3CTJA 4A4LA 2R4BA 3KRWA 3LJ0A 2FSOX 3NLBA 3BLQA 2BZHB 1OUYA 2PVJA 4FIJA 4FUXA 5IUHA 2PMOX 4MF0A 2XEZA 4FSNA 3WBLA 4W4XA 2UZLA 3QZGA 3GP0A 4QMYA 3RNYA 4HCTA 2UZBA 3Q4ZA 2IW8A 2ITNA 3AXWA 3PFQA 1ZWSA 3PYYA 3VS3A 2XM8A 1JPAA 4J97A 3F3UA 4LFIA 4LI5A 2C5NA 5CSPA 2IVVA 4JLCA 4DFZE 4AS0A 4AA0A 2CLXA 4X3FA 4I5CA 3BQCA 5JFSA 2GQGA 3DDPA 4DGNA 3ZYAA 4AG8A 4QT1A 4UV0A 4EQUA 4L43A 4LL5A 5AV0A 3DKFA 3MVMA 3GQIA 4OAVB 4EH2A 4DH7A 2UW4A 3CY2A 1H24A 3O2MA 3Q2MA 3TNWA 3Q6WA 2C3LA 2BRGA 3QTIA 5HI2A 4BF2A 1YWVA 3MY1A 3LLTA 4XG3A 4CFMA 4FTOA 3RMFA 3H4JA 4XV2A 4M3QA 2VX3A 4TWCA 5HO7A 3OOMA 4ZK5A 1F0QA 5LARA 4IZ7A 3REPA 3P4KA 4W8EA 2ONLA 4EK8A 2OJ9A 3CJGA 5DEWA 3ITZA 4U40A 4EOSA 1LEWA 3ALNA 4QD6A 2WFYA 4RVMA 3V8WA 3VUGA 4BZDA 4LRJA 4DFXE 3OWPA 2YACA 3AC1A 4QOXA 2VNYA 3NIEA 4U79A 2VTOA 3UIBA 4TKSA 3LM0A 3KCFA 2F2CB 3PVGA 4Q2AA 4RWKA 2FSMX 4YZCA 3VS0A 4DEHA 4E4MA 1KV1A 1Y8YA 2R7IA 4MBJA 4WSYA 4Y72A 2YCRA 3KFAA 4FSUA 4NK9A 4ZAUA 4BI1A 4XG6A 2PSQA 3BHHA 2JFLA 4CCUA 3JS2A 1GOLA 2YCQA 4S2ZA 3V04A 2PL0A 2OFUA 3NW5A 4CT2A 2R9SA 3BHYA 4EOLA 4RRVA 1BUHA 5CU0A 1JSVA 4GT4A 3QF9A 5FTOA 3JVRA 3NZ0A 3D5XA 1WBTA 2YM5A 4IADA 5J7HA 3CTHA 1XH8A 1XH6A 3DB8A 3UNZA 4RC4A 4CQGA 3R2BA 4J95A 4RVTA 2BRBA 5J5SA 1OL1A 3MTLA 2A4LA 3D7ZA 3PZEA 1ZY5A 4PL4A 4X2GA 1W82A 1KE5A 2R3GA 4HGEA 3G6HA 5JFXA 2GNGA 4FIGA 4W9WA 5E8ZA 2UUEA 2BPMA 3PJ8A 3DKCA 4FSZA 3LFFA 1URCA 4FGBA 1BX6A 4GUBA 4FV6A 4O0VA 4X2KA 3GCQA 3R8MA 2WELA 5FP5A 4ACMA 4HVDA 4U6RA 5KHXA 4PMTA 2IO6A 4PL3A 4BCGA 4IX6A 4HPUE 1Y91A 4GFMA 3JYAA 3UO6A 4AT4A 3IW8A 3F82A 5JFWA 2XJ0A 3BZ3A 1ZMVA 2G01A 4G3FA 1OKWA 1KE6A 4X2NA 4GFOA 4MEDA 2OGVA 4D58A 2XUUA 3FZSA 2R0UA 3V3VA 3WZDA 3R9NA 4CFNA 3VWAA 3ENHA 3TUDA 3RCDA 2VWIA 3ET7A 3RVGA 4NZWB 3MH1A 5ANDA 1CKJA 2C5VA 3QQJA 4FKIA 2ZM3A 2J9MA 3V51A 5FDPA 4AE6A 4CZYB 2F49A 5JGBA 1OL5A 4F4PA 4HJOA 4YC6A 2W1EA 3QQFA 3R1SA 1REKA 2Z60A 4LOPA 4A4XA 1WVXA 4KS8A 4QNYA 2X2MA 3E7OA 3RK9A 2C30A 1MUOA 3QD4A 2UZWE 3ORTA 3VS5A 4EKLA 5HBJA 1HOWA 4BCKA 4K0YA 4L9IA 4MK0A 5J7BA 3AT2A 2G1TA 4WNPA 2FA2A 4B99A 4C57A 2VRXA 4X7QA 4UMRA 2VGOA 3QD0A 3FMMA 3O7LD 4FT0A 3U8WA 4BCPA 2X9FA 3TCPA 4F7JA 2OJGA 3T9IA 2FVDA 5DT3A 5EOBA 2YJRA 4LM5A 4YC3A 4L46A 2R7BA 4H3QA 4XLIA 4DFNA 1JLUE 5IA3A 3D5UA 4DFLA 4IB0A 4O0XA 5HE2A 3UTOA 4BRXA 4AZSA 4BDDA 4EK3A 1JAMA 1STCE 3VF9A 3W16A 2Y4IC 4XUFA 2X8EA 5IEYA 1SVEA 4FKQA 4RGJA 3S00A 1REJA 4H1JA 5CNNA 3IDCA 4JS8A 2OKRA 4YSJA 4Q9SA 1KSWA 4O38A 3DDQA 3PIXA 4EUTA 5FXRA 5ANIA 5I9ZA 3FHRA 4HYSA 1VJYA 3OXTA 4ONAA 4RJ5A 3SV0A 4TYJA 3I0QA 2IW9A 3OWLA 3HDMA 4KINA 3W2PA 3SVVA 5JQ8A 3UQCA 1AQ1A 4IAFA 5DI1A 4OLIA 2W96B 1IR3A 2YA9A 4HOKA 4R3PA 3LXKA 3SC1A 5CI7A 1GZOA 1PMVA 3T8OA 3QRIA 1E1XA 4FIHA 5M57A 2JC6A 5BNJA 2QU6A 4QP9A 5KMKA 2V55A 5ANKA 3QCQA 1P14A 1ZAOA 3Q60A 3FZTA 4BZOA 2WD1A 3ALOA 3DFCB 4FZFB 4XMOA 2PZ5A 4RG0A 3EIDA 4EZ3A 4DINA 3P86A 4AN2A 5CANA 3COHA 4WIHA 4BDEA 3LE6A 3OWJA 4F9BA 1O6LA 2JITA 3AGMA 5DT4A 5AP5A 3WE4A 2HZ0A 3NYXA 4UALA 4AZVA 2R3FA 2QVSE 3CC6A 5F1ZA 3UMWA 4DGOA 3BGPA 3NAXA 4CFVA 3FLNC 5CU6A 3JUHA 2YJSA 3VUDA 3AC3A 3ERKA 1WVWA 2W9FB 2R3PA 2Z7LA 3I1AA 4IAKA 2AYPA 4K11A 3WZJA 4KIPA 5H2UA 4JVGA 2Y7JA 3TWJA 4MNFA 2VX0A 4V0GB 4R1YA 3O23A 2GNJA 3QX2A 4N4SA 4V0GA 4TYGA 1UNLA 3FC1X 4AOJA 3DTCA 3L8VA 3LAUA 2GFSA 2C6MA 3PSCA 3Q6UA 4IFCA 4C36A 2CDZA 1PW2A 3EN6A 4I5MA 3MY0A 4XP3A 2GNLA 3VW6A 2EXCX 5I0BA 5DHJA 4BDGA 5AP6A 5DGZA 2VTAA 4MD7E 5H8BA 4D5HA 5CNOA 1YOJA 4IW0A 3BBWA 1ERKA 2F7ZE 5J1VA 1Q3DA 4NCTA 4UZDA 3U9CA 1XR1A 2UW6A 4IAYA 4LUDA 3OVVA 4C58A 3AD6A 3PWDA 4A4OA 4D0XA 4UMPA 3QQKA 4KBAA 3PVBA 5GJDA 3CKXA 2XIZA 3F6XA 2A1AB 4AOIA 1OKZA 4CNHA 3SAYA 2RIOA 3CPBA 4QQ5A 2ZYBA 4FTNA 2X2LA 3UIXA 3ZSGA 5LQFA 2C0IA 2EXEA 4C2VA 4G1WA 3FZ1A 1IA8A 3EQFA 4GL9A 2C0TA 4I41A 4ARKA 5HIEA 5AUUA 2BDJA 2OZOA 4ANSA 2QQ7A 3DK3A 3H10A 2BHEA 3C13A 3CGOA 2XRWA 1ZLTA 3ZEWA 1K3AA 4LV8A 2J0JA 3D2IA 4JDIA 4BHNA 4IIRA 4O0YA 2E9PA 4OBQA 3E64A 4FTQA 4C38A 2CGXA 4Y5HA 1Y6BA 2JDRA 4G3GA 3ZUUA 2B4SB 4ZLZA 5EG3A 4UMTA 4HYIA 3OHTA 3QCXA 1P2AA 4YGAA 5BVEA 1JSUA 3GU7A 3HRCA 5AR4A 4P4CA 4ITIA 4E3CA 3VUHA 4IJ9A 4QMSA 4P90A 4UWBA 5A9UA 4PDOA 4Y95A 4WHZA 4RWIA 4MXXA 4C4FA 2YABA 1YXSA 4F9YA 4EHGA 3NSZA 1H8FA 3GOKA 5EKOA 5K5NA 2OO8X 5A4QA 5DBXA 2YIRA 3CKWA 4KNBA 3C0HA 1W8CA 3FZOA 3HUBA 4RBLA 3OUKA 4ZY6A 5IA4A 4WT6A 5J9YA 2GNFA 4F9AA 2EU9A 2JAMA 1J3HA 2X7GA 4IX5A 4C4GA 4ZXTA 4D9TA 1JKTA 2WNTA 3OCTA 1Z57A 4MXZA 3TJDA 4C0TA 4E73A 5D12A 4KABA 2UZEA 1VYZA 2OG8A 2QOQA 3KL8A 4BHZA 3W2SA 4BDCA 4E4LA 2C1BA 4IZYA 3W2RA 4WSQA 2HWPA 3QRKA 4FMQA 2C5YA 3KN6A 5CQUA 3QD3A 4P5ZA 5A6OA 5DE2A 5ACKA 2BALA 3AD5A 3QD2B 4F09A 3DBFA 5A3XA 3POZA 4ZTNA 4G3CA 3SRVB 3E8DA 4FT7A 4QP1A 5DPVA 3FZRA 4Y5QA 3W8QA 4QMLA 5FEDA 2WHBA 2RF9A 4NKSA 4XRLA 4TRLA 4O0RA 4UMUA 4OTDA 4BIBA 5BVOA 5DRDA 1QPJA 1J1BA 2I6LA 3LFSA 4I3ZA 2P33A 4UZHA 3ANQA 2C6EA 5DFPA 3CS9A 4WA9A 1M7QA 4EOOA 3OF0A 4I6BA 2O65A 3FKOA 4L6QA 1AD5A 4O1OA 3U4UA 4AGDA 1GY3A 5A4LA 4AN3A 5KMLA 3E62A 5IH5A 2I1MA 4MYGA 3I6WA 4TL0A 5E92A 5L2IA 3QL8A 3W2OA 4CV9A 2BRHA 3VBQA 4MXOA 2ZV8A 3ZMMA 3B8QA 4XRJA 5FM3A 2J5EA 3MB7A 2BUJA 3C7QA 3R7VA 1XWSA 2WU7A 3H0YA 3KMMA 4IMYA 4H1MA 1URWA 4HVIA 3BE9A 3OROA 2HZIA 2UVYA 3OUNB 4K1BA 3EN5A 3GGFA 1YXVA 4AGUA 4EWQA 4I6QA 4YZBA 3KXZA 4N6ZA 3GI3A 5IH4A 1R3CA 3QRJA 3NR9A 5CENA 3GQLA 4EZ7A 2XIXA 3UQFA 4O2ZA 2OWBA 5DIAA 4ZJJA 4GCJA 4JI9A 5C03A 5CYIA 3GXLA 2QOFA 4PPAA 4F0FA 3SA0A 4RWLA 5DRBA 5FDXA 3R9OA 2W7XA 2E9UA 1DM2A 4DTKA 1CMKE 5L6PA 4X2FA 3QALE 4BCNA 2W1DA 1Q3WA 2NRUA 3F9NA 1H28A 5ANEA 2BFXA 4DEEA 5AJQA 3C4EA 3IK3A 2R3JA 2HXQA 5C8NA 4PPBA 2IVTA 2PVLA 2OI4X 4I93A 1OIYA 3OWKA 1DI8A 2WQMA 3FMLA 3BHTA 4K18A 3AGLA 3ZFYA 3BWJA 4QNAA 1MRYA 4FT3A 3VUMA 3C51A 5AUWA 2CN8A 3FLWA 3POOA 2ERKA 3C1XA 4W9XA 4E20A 4RQVA 2OJFE 5I3RA 1TQPA 1CTPE 4NSTA 2ZM1A 4L53A 4M68A 4F0IA 2Z8CA 3ROCA 2X6EA 1U5QA 2VD5A 3VUKA 2JIVA 2WMRA 4O0SA 2C3JA 2R3RA 4ANNA 3P79A 3V8SA 1SNUA 4OTGA 1OL7A 2XKCA 4TT7A 1U4DA 2WOTA 4C4IA 4KWPA 3HUCA 4JQEA 3TUCA 4QQTA 4FV2A 3C4WA 3DB6A 3TKUA 3OBGA 5E90A 3I79A 2CCIA 3KMWA 3VQUA 5C1QB 4RQKA 3ORKA 3MVLA 3R7YA 4PDPA 4AFEA 3GU8A 2UW3A 1UWJA 4E6CA 4G5PA 3UNKA 4NM0A 2WZJA 3HP2A 3OFMA 5HOAA 4EH3A 3A7IA 3NAYA 3ACJA 4IQ6A 4CV8A 4WRSA 3FXWA 3O7LB 4M12A 2IVUA 3KK9A 4I4FA 3P7BA 4ZTRA 3GENA 3K5VA 4V04A 4RIWB 3VJOA 1FVRA 2YIYA 1Z5MA 1APME 3DBEA 5CAOA 5GNKA 2YM3A 4RIWA 2GHLA 5F94A 4R7IA 4WUAA 2C69A 3FJQE 4IH8A 3OXIA 3DNEA 3I81A 4GU9A 1GNGA 5B2MA 3R1YA 2BRMA 2R5TA 3H30A 4IWDA 3PRFA 3ZU7A 4E93A 2BAKA 1PXMA 2VNWA 3QHWA 5JZJA 1PMEA 2C3KA 4RJ3A 4ASDA 5KBRA 5AUTA 3KEXA 3HL7A 5ETCA 4IM0A 4X3FC 3LFEA 5B2LA 2J7TA 2C6DA 3WF9A 4F65A 4EL9A 4BDAA 3IDBA 2ZVAA 3G33A 2ITXA 2O3PA 3HECA 4R5SA 3D0EA 3E5AA 4FZ6A 4MWHA 2PZPA 4QTDA 5FWKK 5CAPA 2RFDA 2BTRA 3PA5A 4YO6A 3UZPA 2VTIA 1H1PA 4LGHA 1DS5A 2Z7SA 1JQHA 2QC6A 1ZYSA 5HIDA 1UA2A 3BX5A 4BL1A 4QMZA 2W5AA 1VEBA 3OW3A 4S33A 1OUKA 3E8NA 4RFMA 2XCKA 3VF8A 3EKKA 4ERKA 2QONA 2QURA 1FMOE 2ITTA 3MN3A 1Q24A 4KKEA 1I09A 1XHAA 1UWHA 3LFBA 3RK7A 3U4WA 4EBVA 4YUQA 3NWWA 2ONLC 3CQUA 3IW4A 4YTFA 5EM5A 4MXYA 4IXPA 1S9JA 2BIKB 4N70A 4CZTA 1OB3A 4O91A 3UVQA 4CFWA 3ELJA 1FOTA 4AW1A 3R2YA 1KOAA 1G3NA 2XRUA 3LXNA 4YC8A 4CMUA 2W0JA 2WMVA 1IRKA 3FDNA 3F7WA 4KB8A 4YZ9A 1Q4LA 4BDJA 4F70A 4GT5A 4D9UA 3R7EA 5HTCA 4DEIA 2VTJA 2BKZA 5A4EA 3RJCA 4OTQA 4YJRA 4HVSA 3PP1A 2RSVA 3QTQA 4Z55A 3R8PA 1OVEA 3JY0A 4M66A 2J51A 1FGKA 3OY3A 4FVRA 4TNDA 4UYNA 1NXKA 3GEQA 3GVUA 4F9CA 4FTTA 3SLSA 5GZ8A 2NRYA 1YHWA 4FK3A 3TNIA 3BCEA 4G17A 4II5A 5KZ0A 4EH4A 4I20A 3MH2A 2V22A 1IASA 4BYJA 5HBEA 1U59A 3SHEA 4GRBA 3C0GA 3PY0A 1PF8A 4ZIMA 4YR8A 3R9HA 2PVYA 3RCJA 4F63A 2CCHA 2XJ1A 2GTMA 3M42A 3TXOA 5HVKA 5K4JA 4P2KA 3GFWA 1FVTA 1OPLA 3IOKA 4D2VA 3O0GA 2QOBA 3K2LA 3BU3A 4MX9A 3QZFA 5CLPA 5KCVA 3PSBA 5J9LA 5JK3A 3FKNA 5CF8A 3D83A 3EZRA 3FMNA 4U5JA 5CSWA 3TV4A 2BAJA 5EI8A 3DAEA 4G2FA 3PXKA 5CEQA 3KXMA 5AIKA 2EWAA 2XKFA 5HG8A 3ZRKA 5CF6A 1F5QA 4R7HA 3WARA 4WUNA 5L4QA 5CVGA 2UW7A 4L68A 5HTIA 5L2TA 4HZSA 2GSFA 2XB7A 2YIXA 3ZCLA 2Y4PA 3FLZA 3ANRA 3Q5IA 4MD9E 2XKDA 3WIKA 5K4IA 4QO9A 4O0WA 4FTKA 4FT9A 4QPMA 1BL7A 5BUEA 3A7FA 4JIAA 5K5XA 4BKZA 3Q9YA 3PJCA 5HEZA 3WYYA 2J50A 2YDJA 3SXSA 3D7TB 4EWHA 2HOGA 3F3ZA 4CLJA 4WNKA 2PZIA 3ZONA 4TPTA 3RTPA 3FMDA 1SZMA 4FKSA 3N9XA 1JWHA 3FQSA 2QCSA 4FL3A 4S31A 3ZUVA 3QFVA 3L9LA 2OF2A 3CIKA 2W06A 3RNIA 3R7IA 4A9RA 2Y6MA 2ZDUA 2H9VA 5KZIA 5LOHA 2GPHA 2DS1A 2G2HA 1H1SA 5DG5A 2C68A 4P5QA 2UZNA 4YO4A 2GTNA 4JAJA 3DFAA 3AC4A 3NYNA 3HV5A 4U0IA 4FICA 3EN9A 1NY3A 5JGAA 3QQHA 3RAHA 4FSQA 5HNBA 3PRIA 5CQWA 4AW5A 2OBJA 1P4FA 4ALVA 3GOPA 3AQVA 2QOIA 3F61A 3F3WA 4J1RA 2HK5A 5IA5A 2XIRA 3LM5A 4YZNA 3NIZA 3TKHA 2P3GX 4O0UA 2UW0A 2VZ6A 4E5AX 3EYHA 3NUPA 4FTMA 2CN5A 4RX5A 4EHVA 4JOAA 3S3IA 1JOWB 4TN6A 4LOOA 1AGWA 5CEKA 2W9ZB 3Q9ZA 3UQGA 2RFEA 5KHWA 4FZDB 4LUEA 2DQ7X 4DEBA 5L8LA 1ZY4A 3VVHA 2BRNA 2XZSA 2JKKA 4C8BA 3QA8A 1WFCA 5AV3A 3ZO1A 4CKRA 1OZ1A 3A4OX 3IQ7A 5LMAA 5GHVA 2R2PA 3BWFA 4Z7GA 4I22A 2X8DA 4E8AA 4C02A 4NWMA 5CXHA 5IA1A 5DNRA 4C4JA 3K5UA 1Q41A 2OIBA 4MF1A 2XNNA 4JRVA 1UV5A 3Q4UA 4F7LA 1UU3A 4BIDA 3QXPA 2A27A 3R22A 4IWQA 5GZAA 3AMAA 3P7CA 2E9OA 3QXOA 4KIKB 2XNPA 5M55A 4GT3A 4AP7A 3DA6A 4KIKA 4RZWA 4WG4A 3PXQA 1BYGA 5EHLA 3G9LX 3UE4A 3QYZA 2AUHA 4ZLOA 3DK7A 3QZHA 3HMOA 5K0KA 4FUYA 4QRCA 2XS0A 1PY5A 2YHVA 4L8MA 4PMPA 4XG2A 1UKHA 5J87A 4AUAA 4BC6A 3P9JA 5F4NA 2C0OA 4L01A 3ZFXA 3O51A 4BI0A 5KMIA 2YLFA 3OXZA 2PHKA 3BHVA 4KA3A 4YBJA 3RINA 4NJDA 4CZUA 4UX9A 4XP2A 4BWKA 4EORA 4OR5A 3M1SA 2VWVA 1Q8YA 1QPEA 5H9BA 2V62A 5HBHA 3V6RA 4AAAA 3R8LA 4CYJA 2ITVA 4KIQA 4PDSA 4YJPA 3UDBA 3Q52A 3FE3A 3V5WA 2XK6A 4FX3A 5EM6A 4I94A 5J95A 5EH0A 3NNUA 3OTVA 2YM8A 2ZV7A 3AT3A 3OOGA 4OBOA 5BVFA 5IMEA 3V5LA 2OIDA 2W99B 4KRDA 5LVMA 3I0OA 4CSVA 2VWUA 2PVMA 4AA4A 5LVNA 2OK1A 4DCEA 3WF7A 4YTCA 2Y6OA 4MNEB 2PE1A 3TNHA 3ZRLA 4ALWA 4PTEA 5KKRC 3PVUA 4MNEA 1CM8A 3COKA 1JNKA 4PWNA 4QMOA 2PE0A 1YDSE 4CKJA 4I0TA 2GCDA 4YLJA 4OBPA 1JVPP 4J8NA 2JAVA 4NCTC 1WZYA 4TTHB 4MWIA 4U44A 1M2QA 5HKMA 5HU3A 4G6NA 4QPAA 4C37A 3ZC5A 5HHWA 3HGKA 4ALUA 5ITAA 4IVCA 3PXYA 3F7ZA 4F1TA 5AP7A 4F08A 3MWUA 4QTBA 3U6JA 2B53A 4WNOA 4A9UA 5DLSA 3MTFA 3NNVA 3PJ2A 3FPQA 1BL6A 3O50A 5CU4A 4M0ZA 3WF8A 4DHFA 2QG5A 4F6SA 4RC3A 3FLSA 4JIKA 4L52A 2HY81 1XJDA 2C6LA 4L3LA 2V0DA 4YURA 3PZHA 5I4NA 4FKWA 2YDKA 4XLVA 3R04A 2X7FA 4RFZA 2CKEA 3DLSA 4C4EA 1PHKA 2ESMA 4L42A 1ZOGA 4IWOA 2VO6A 3MA6A 5AAEA 4EZ5A 4EK5A 1XH7A 3SX9A 4EOQA 3KKVA 4WNMA 1W0XC 2X39A 4X3JA 5CF5A 3BQRA 2CPKE 5EM8A 3FY0A 3FUPA 3COMA 3F3VA 4UWYA 3OT3A 3PE2A 5HG5A 4GJ2A 5A14A 1A9UA 3BYVA 3MA3A 5FXSA 3RPSA 5M51A 4BCOA 4ZS0A 2J6MA 2PTKA 4TWOA 4F7SA 1H4LA 3UO5A 4C2WA 1WAKA 4ITHA 1KE7A 4EBWA 1ZARA 3RZBA 3PJ3A 4ZTLA 3VHEA 4I24A 4BDFA 3HV6A 1YXXA 4OTRA 2I40A 2B9JA 4FZ7A 4QMVA 4FL1A 4EH7A 4FKLA 2XNEA 2C47A 3TV6A 4JX3A 3FL5A 4ZSLA 5FRIA 1UNHA 1GAGA 4QYYA 3O96A 3R01A 3F5UA 4DAWA 4XBRA 3G6GA 4R8QA 4FVQA 4TZRA 4J96A 5HCXA 5ACBC 4NFNA 3GCVA 3EJ1A 5CT0A 2J4ZA 1WBPA 2Z2WA 3ORIA 3V5TA 3OCGA 3LJ2A 2ITUA 2J0LA 3VC4A 3CR0A 3VJNA 2FSLX 4FOBA 5AR8A 4CYIA 2XK7A 2IWIA 3KXGA 1M7NA 5AIRA 4FL2A 1F3MC 5HD7A 4A07A 3HMIA 2CHLA 5EYDA 3H9OA 1PXKA 2P55A 4DG3E 5AM7A 3K54A 5FEQA 2OJIA 5TE0A 3TN8A 4C3FA 2HAKA 2QR8A 3LMGA 5EYCA 2B55A 4NH1A 3RI1A 1LEZA 3L9MA 5BX0A 3LW0A 4DEGA 3NCGA 2EUFB 4PTGA 5TOZA 4YJUA 3VAPA 5AA8A 2HY0A 1EH4A 3D5WA 5AV1A 4J98A 3NGAA 3PIYA 3CY3A 4FT5A 4TW9A 3W55A 4D2WA 5HE3A 5CTPA 2VWZA 3I4BA 3T9TA 3FI4A 3HDNA 4FIIA 3VUIA 1OITA 1Y57A 3C50A 4R5YA 4YJOA 1Y8GA 2X0GA 2V7OA 5LCJA 5HIBA 3EL8A 3MVHA 2W1IA 3PXRA 4USDA 3IW5A 4KS7A 4O22A 5HESA 5FTQA 3OZ6A 1MQBA 3ZZWA 4OUCA 3QGYA 3WZEA 5IUGA 4GW8A 2C5OA 4XG8A 5EK7A 3UGCA 4U45A 2FB8A 4EOPA 4D1ZA 4GG5A 4GFGA 4UMQA 4G5JA 5J9ZA 3R71A 4IJPA 4M15A 2YCFA 3TV7A 1U54B 5EHYA 4BWPA 2BHHA 4FSTA 2WMBA 4KKGA 1U54A 2UVZA 5BUJA 3AC8A 4G9CA 3EFKA 5JZNA 3LHJA 3LOKA 3FI3A 3QUDA 2JKMA 4Y83A 1R39A 3VBVA 5BMSA 3BRBA 2OFVA 3F2AA 3NRMA 2CLQA 3IDPA 5HVJA 4D28A 3FZPA 5HCZA 5HCYA 2ITWA 2OIQA 5HE0A 1KE8A 1H1QA 5BVDA 1CKPA 4S34A 3LZBA 4G34A 2KTYA 3K3JA 4HCVA 4U81A 2OXYA 4ACDA 3BYUA 4PP7A 5AR3A 4Z16A 1H01A 3AC5A 2XP2A 1SNXA 2WMTA 3F88A 4AT3A 1SYKA 3R1QA 5AUZA 3SKCA 3EQDA 3Q32A 5CF4A 4BTMA 1ZOHA 3EOCA 4RLLA 2VU3A 3L9PA 4QMUA 1DAWA 4I1ZA 3W18A 2JBOA 5HZNA 1OECA 2HELA 1CDKA 1FMKA 4CRSA 4L7SA 1PXNA 3MYGA 2XH5A 4AN9A 3OBJA 4JDJA 4OTHA 5KUPA 4O21A 4C61A 4E6DA 1YI3A 2R0IA 1PXIA 4JBPA 5EHOA 3CQEA 1W83A 1JKKA 4U9AA 2FSTX 4XX9A 1BI7A 4WD5A 2WIPA 5B7VA 2HWOA 5CALA 4J99A 3Q04A 4MHAA 2VO3A 3QRTA 3VBTA 3R73A 1ZZ2A 3DLZA 4WG3A 1YXUA 3QKKA 3SOAA 2XKEA 3ZOSA 4ERWA 2ZAZA 2QR7A 4FTRA 4P7EA 2X7OA 4DH1A 2BDFA 4GUEA 4C7TA 2ITQA 4FEQA 2CJMA 5D41A 2RKUA 2F7XE 3G0FA 3MS9A 3NUXA 3T3VA 4C62A 4DITA 2GS6A 3F5XA 4ASXA 3WZUA 1XKKA 2C1AA 2XNOA 4JXFA 2YIWA 3UG2A 2C3IB 4FIEA 4GS6A 4I6FA 5ETFA 3ZBXA 5A4TA 3GNIB 5KX8A 4PUZA 1ZRZA 1OPJA 3I6UA 5JT2A 4YJTA 4U97A 5AR7A 2J5FA 4I6HA 2XNBA 4IX4A 4UN0C 4PY1A 2LAVA 4BDHA 4BI2A 2P4IA 4GG7A 4QQCA 3TTIA 3ZLXA 5HGIA 4D2PA 3UPZA 3JXWA 1Q8TA 1WVYA 3QLFA 4H39A 5TKDA 4EONA 1BKXA 2B52A 4FV5A 3ORZA 3NNWA 3QCSA 3TZ9A 3FXZA 2OSCA 4O27B 3IS5A 1MRUA 3KXXA 1H08A 4IX3A 4LQMA 4YNOA 3ZDUA 3EZVA 3BGQA 3FMEA 3M2WA 4BGHA 1QPDA 3ZDIA 3SRVA 5E8WA 4QTAA 3MFSA 4BCMA 2VWYA 4JT3A 4AZWA 4EK4A 2HENA 2I0YA 4IZAA 1DAYA 3OT8A 1XBBA 3DQXA 4K9YA 3QC9A 4MXAA 4FI1A 3TIYA 3P5KA 3ZFMA 1ZYJA 2GHGA 3ORNA 5L6OA 4B6LA 4IHPA 4H36A 4APPA 2OXDA 4MKCA 4FV7A 4ZOGA 4F7NA 3HVCA 3IGOA 4FF8A 4I5PA 1XH5A 4NJ3A 2PY3A 1W7HA 3CPCA 2IVSA 3I5ZA 1OM1A 4IVBA 4OTIA 4Y73A 2ZMDA 3UYTA 1GIJA 3V01A 3UZTA 2HYYA 2VTMA 4RVKA 4WBOA 5C9CA 2VV9A 4MBLA 5E8UA 4C34A 4JL9A 5AUXA 4E26A 1ZYDA 3RALA 5K9IA 2GS7A 5CAVA 3EQHA 4GYIA 2G2IA 2WTCA 4XH6A 3CP9A 2W4KA 3MDYA 4B9DA 3TACA 2JLDA 2VTNA 1O6KA 3GCPA 3L9NA 4IDVA 3SQQA 2XK8A 2H34A 4G3EA 5HO6A 4TYHB 2EB3A 4RA4A 4TYHA 1NVQA 4DBNA 5HICA 2GDOA 5LVLA 3UOJA 2G9XA 3VRZA 2WQEA 2ITYA 4FVPA 4BKYA 3EFWA 4Q5EA 1WCCA 4WKQA 4DH5A 3DBDA 3TL8A 5A54A 4FKVA 4XV3A 5BUIA 4DC2A 3NNXA 3FLYA 3GU6A 2QOKA 3VS1A 2VTRA 3W33A 4OTWA 4G6OA 1PYXA 4FG8A 4K8AA 5I9YA 5E7RA 4U7ZA 4TWNA 3DS6A 4NU1A 4JDHA 4L7FA 5HLNA 4RT7A 3E8EA 4M67A 4B4LA 3Q9WA 2UW8A 2X8IA 5C26A 5E1EA 2G2FA 2ZMCA 5BVNA 4C4HA 3EN7A 3E87A 5TT7A 2XIYA 4H58A 4ID7A 4XP0A 3BEAA 3VN9A 4LMUA 4M7IA 4O96A 5IMXA 4AZFA 1GZKA 2WGJA 2XEYA 3DZOA 3W10A 4G31A 4IACA 4D55A 3UO4A 3FMKA 4UXQA 3EH9A 3UVPA 4EHEA 3LPBA 5CS6A 2EVAA 3QAME 3TNPC 2WMAA 2WTJA 1W98A 4FR4A 5CT7A 4AOTA 2BZIB 3MPAA 5CI6A 2W5BA 3U87A 4M69B 3ZH8A 4ZSAA 3FHIA 2XM9A 3VBWA 2A2AA
chains in the Genus database with same CATH superfamily
1B6CB 3DK6A 5AAGA 3FSKA 3NEWA 3HRFA 5B0XA 5H3QA 5AEPA 3D94A 3TKIA 2WB8A 3Q3BA 4X6QC 4FTUA 2KULA 4BCHA 4IM3A 1QMZA 2EB2A 4ZZNA 3S1HA 3W1FA 1Q97A 3VULA 4KBKA 2FH9A 2F4JA 5DT0A 3P08A 4RX8A 4YLLA 5K3YA 5CZIA 4FNYA 4XG7A 4EOKA 4DGGA 4E6QA 2OH0E 5CSXA 4PL5A 4BKJA 5HE1A 5DMZA 3RBWA 2ITOA 3P78A 4KBCA 4X2JA 4G6LA 3PA4A 1XH9A 2JFMA 2NP8A 3MI9A 3V5PA 1PKDA 4FKGA 3C9WA 3FMHA 2BILB 4JG8A 2VO7A 4RIYB 3TT0A 2JDSA 4CFUA 3CGFA 3ORLA 2BZKB 4RIYA 5FBOA 1M17A 3KRRA 2ZV9A 4EOJA 4ZSGA 3NYVA 5EW3A 4CQEA 4YJVA 4H3BA 3TIZA 1IG1A 3D5VA 1UNGA 3H3CA 5BPYA 3WIGA 5M4IA 1RDQE 3KF4A 2QLQA 3F5GA 4R3CA 5T3QA 5IZFA 5JFVA 3FWQA 4QMWA 4QMPA 3ZSIA 2VWWA 2QO9A 3JY9A 1PXOA 2QU5A 3KRXA 4CXAA 4RIOA 1YRPA 1NVSA 3A7GA 3I7CA 3U6HA 5IF1A 3FLQA 3ZLSA 3E3PA 1V0BA 4LMNA 4ACGA 4HYUA 5EOLA 5CEIA 4CTBA 3MVJA 3C4XA 5L2WA 5IKWA 3JVSA 3RWPA 4D2TA 3R7GA 3OP5A 3NS9A 3HMPA 4X6RA 3R9DA 3HYHA 3MFTA 4OTPA 5F20A 2W4JA 2Y9QA 4HPTE 3KCKA 1LPUA 4L3JA 4PTCA 5AM6A 5EI2A 5AA9A 1HCKA 1GZNA 4C33A 4QP2A 5BQ0A 2WTIA 3BLRA 3MGYA 3FBVA 1H27A 4FKRA 4YHTA 5EM7A 3LFCA 3LCSA 4FNZA 4O0TA 4TYEA 3RGFA 4QTEA 2J0IA 3G0EA 1QCFA 4AX8A 4Y85A 1ATPE 4HNFA 4ANQA 4UBAA 3MSSA 5JMSA 2VTHA 2X81A 4BICA 4LGDA 2YERA 4ACCA 4KAOA 1FGIA 3AD4A 3BGZA 3DV3A 2UZDA 3P23A 3LFDA 2QO2A 3QX4A 2GNHA 2W1FA 1Y6AA 3ENMA 1OPKA 3RPVA 3F69A 2Z7QA 4U3ZA 4AWIA 2J2IB 2W1HA 2XA4A 4J71A 4N0SA 3A2CA 3PPJA 5CXZA 5AWMA 1RW8A 3EQGA 2F7EE 2QKRA 1RJBA 5J8IA 3HV4A 4IFGA 2ITPA 3PA3A 3VS2A 3ETAA 2O2UA 4BTJA 1WMKA 4BTKA 3BPRA 4QYFA 4YHFA 5ETIA 5DR9A 4BDBA 3NCZA 5D9HA 5LWMA 1KWPA 5HLPA 4K2RA 5AX3A 2GMXA 2YEXA 4AW2A 4ZLYA 2QKWB 3MV5A 2IZRA 3GCUA 4LL0A 4FG7A 4XEYA 5BVKA 4YU2A 3D4QA 3I5NA 1TQMA 5LCKA 1FINA 1XBAA 1R0PA 3MJ2A 4J52A 2I0EA 2YAKA 4PP9A 2GNIA 1JSTA 1W2DA 2UZTA 4J7BA 3KXHA 3I7BA 4QP8A 5AP0A 3EQBA 3WYXA 3E7VA 2QO7A 5FEEA 2O63A 3U9NA 4DEDA 2DYLA 3NUNA 5IA0A 4WO5A 2Q0NA 4Z3VA 4AFJA 3ZS5A 4U41A 4YJSA 1B39A 3FPMA 2WQNA 4IVAA 1MP8A 1SM2A 1B38A 4ZTQA 3LXPA 1OKVA 3PPZA 2YM4A 2C6IA 4MQ2A 4MVFA 2YIQA 3II5A 4ENYA 5GZ9A 2OXXA 2H96A 2WO6A 3NYOA 5I9UA 2W4OA 4X21A 2QD9A 4FKTA 2JDTA 3EL7A 3FSFA 4H3PA 2W1GA 4YLKA 2PVHA 3R28A 1YDRE 5K0XA 5KMOA 2ZV2A 3O8PA 4L67A 4EH9A 4U8ZA 4ZSEA 1Q8ZA 3TJCA 5IDPA 4GMYA 3V8TA 1O9UA 2WKMA 3D7TA 1WBVA 3HMNA 3ODZX 3QA0A 4WBBB 4D4YA 4YJQA 5T6KA 3S4QA 4S30A 2UZOA 3KVWA 2Z7RA 4IE9A 3QKMA 3WOWA 2H6DA 4MH7A 5L6WL 1YWNA 2VX1A 4AQCA 3FI2A 1FQ1B 3FMJA 4QYEA 4R6VA 2CMWA 4HVHA 1XO2B 2JDOA 3P0MA 4NFMA 4FV3A 2HXLA 3HKOA 4BIEA 1R78A 4MQ1A 3Q5ZA 5HLWA 3IG7A 3D9VA 3BU5A 4XBUA 2XYUA 5EDPA 3EQCA 3KRLA 1UU8A 4UB7A 2W17A 4C35A 1ZXEA 5BYYA 4MCVA 1M52A 3TZ8A 1UU7A 1YOMA 4GYGA 4ZZOA 1Q61A 2VAGA 3KB7A 4KSPA 4RJ8A 3VO3A 1ZYLA 3CD8A 1DI9A 2XBAA 3DBCA 4GVJA 4O2PA 2ETMA 4V01A 3A7JA 3OCBA 4ASEA 4QTCA 1O6YA 4FKUA 3VQHA 4K6ZA 3PUPA 4DH8A 2WU6A 5HNIX 4M13A 4GEOA 4RZVA 5KO1A 1E1VA 4FODA 3QTRA 4X3FB 2OZAB 2PK9A 1UKIA 3DXNA 3CTQA 4IAZA 2DWBA 3GC7A 3IKAA 2OZAA 3E8CA 3PLSA 3Q9XA 4UXLA 3QYWA 2GHMA 4M0YA 4ENXA 2AC3A 2BTSA 4IDTA 3C5UA 5L2SA 5CU3A 5BVWA 4F99A 4HVGA 2W5HA 1GIIA 3WE8A 3GC9A 3MIYA 5M4CA 1YI6A 3LCKA 3RPOA 3W2QA 3ORPA 3ZZEA 4BCIA 5F9EA 2WTKB 5CX9A 4TY1A 1H00A 4LOQA 4L44A 3Q4CA 4NIFB 4RLKA 4Z9LA 4EKKA 4BTFA 4NIFA 2ACXA 4A9TA 2QLUA 5LMBA 3UP2A 3G51A 4RJ6A 5KMJA 3FAAA 2CGWA 2WMWA 3NW7A 4FYOA 2PMNX 1L3RE 3KC3A 5M53A 2C4GA 4I0SA 4FTIA 1LR4A 4FSYA 2O5KA 2X4ZA 5HNGA 2XJ2A 5CVHA 4FV9A 5IA2A 5JRQA 4JG6A 3DAJA 3PY1A 3UIUA 1UVRA 4EC8A 5IH6A 2HZNA 1ZMUA 2PE2A 2J0KA 5TO8A 2YN8A 4USEA 3OEZA 3C4FA 5G6VA 2WQBA 4CTCA 3LCOA 3RAKA 4EOIA 5BYZA 2XNMA 1V0OA 5CAQA 3E63A 1YKRA 3DZQA 4JBOA 5F95A 2J90A 4R3RA 4TXCA 4FK6A 4FTCA 5EYMA 5LMKA 4EH6A 5IU2A 3EYGA 5TF9A 5DN3A 5E1SA 3KRJA 2V5QA 1FVVA 4BGGA 3OEFX 3LIJA 2W1ZA 1IEPA 2XNGA 2YDIA 3LCTA 3L8XA 5DVRA 3CCNA 4ACHA 5HO8A 3PG1A 1I44A 4PMMA 5KBQA 4G9RA 4RVLA 5DH3A 4CD0A 3LVPA 3QKLA 3SXFA 5CASA 5AX9A 3KQ7A 3ZO4A 3VIDA 3UODA 3DCVA 2WAJA 5B2KA 2BFYA 4XCUA 5ANJA 3A4PA 3V5JA 5HU9A 4I0RA 3Q4TA 2PUUA 3ORXA 2C6TA 4FBXA 5CSVA 1Q99A 1SMHA 3UC3A 3VW8A 2JGZA 2JBPA 5JQ5A 5LVOA 4CFFA 4F1MA 1KV2A 2P2IA 3C4CA 5CZHA 3UNJA 3WF6A 4J53A 2G15A 3HV3A 1YWRA 1WBWA 3MPTA 2HCKA 4CEGA 4IC7A 5EW9A 3KVXA 2ZJWA 4QYGA 3ZHPC 3G9NA 4K77A 2Y0AA 3NUSA 3OCSA 4C59A 2R3KA 3DJ6A 4KSQA 3KMUA 3NPCA 3OC1A 4FSRA 2YISA 4RWJA 5DEYA 5HG7A 2F57A 4LYNA 3H9RA 3UPXA 3AOXA 5GJGA 2VWXA 4PNIA 4CMOA 5FG8A 4E4NA 4NTTA 3QC4A 2YZAA 3GU4A 4V05A 3NUYA 3V6SA 3LFNA 3HMMA 2BVAA 4CMTA 4OAUC 3DBQA 3R02A 2RL5A 4I92A 4W4VA 5AP3A 4A9YA 2AC5A 4EYJA 2PVRA 4IAAA 3QTXA 2UW9A 4QP4A 2NPQA 3ZM4A 3KULB 5I5ZA 5I9XA 1W84A 4QMNA 1XQZA 3KULA 3PXZA 4JX7A 4Q9ZA 2B9HA 3NW6A 4CVAA 3AG9A 5AR2A 2R3OA 2WMQA 2YWPA 5CEOA 5IG1A 3PPKA 2X1NA 4LRMA 3OMVA 4UEUA 3CJFA 1V1KA 2WOUA 1UU9A 2RG5A 4AZEA 4CCBA 4FIFA 4TYIA 3IECA 1MQ4A 3P1AA 4DN5A 4HCUA 2XK9A 4EYMA 4IM2A 2OICA 3AMYA 1OIUA 5AUYA 5LJJA 5D7AA 4L45A 4IB3A 4JR7A 4RX9A 4RX7A 2XYNA 4F9WA 5JSMA 3DJ5A 2B7AA 1WBSA 4TWPA 4JDKA 1LUFA 4JBQA 3UP7A 2PZRA 3WF5A 5E8SA 5HTBA 4YHJA 4CRLA 1VR2A 3ORMA 4RJ4A 3EN4A 3GC0A 4CLIA 1H1RA 2B9IA 4AF3A 4QQJA 3VNTA 2JEDA 1MRVA 3BLHA 4I5HA 2WIHA 2YFXA 4AXAA 4BB4A 2X2KA 5DR2A 2WEIA 1Q62A 5H8GA 3GCSA 1T45A 2BZJA 3PE1A 4KIOA 4M14A 4I23A 5HX6A 1H25A 1R1WA 3RKBA 4BWXA 3W32A 3ZBFA 1GJOA 3LFQA 4GK2A 4F1OA 3AT4A 2P2HA 3OS3A 2XK3A 4DGMA 4DLJA 2R3QA 2BAQA 1YOLA 3E93A 4FOCA 1GIHA 5L2QA 2PWLA 1PJKA 4B0GA 1BMKA 3ZRMA 1BLXA 2XK4A 4ZZMA 4FA2A 4AT5A 2OJJA 1WBOA 3SXRA 3QTWA 5A4CA 2NO3A 1QPCA 3KN5A 1YHSA 3DOGA 4IVDA 4EC9A 3QQGA 2XIKA 3QZIA 4F64A 2E9NA 4OT6A 5CWZA 2X6DA 3DKGA 3U6IA 3VBYA 4QMQA 3KXNA 3PIZA 4FTAA 3HZTA 4ZP5A 2WXVA 3EQIA 1OKYA 2ETKA 3ZO3A 1S9IA 3DGKA 5FM2A 1E9HA 4EJNA 3D2KA 5AV4A 4QYHA 4D2SA 4A9SA 3DAKA 4O6EA 3DT1A 3KA0A 4JQ8A 4YTIA 2XF0A 2RFNA 2B9FA 3R0TA 4EK6A 5HD4A 3VBXA 2JD5A 2RFSA 1U5RA 4BCQA 2JDVA 2WMUA 3BBTB 3EWHA 3L8SA 4LGGA 4GIHA 3BEGA 3HEGA 3QWKA 2IW6A 3FYKX 3AC2A 4WG5A 4HNIA 4YSMA 2CSNA 2UW5A 1M14A 3S95A 3E88A 3ZLYA 1JBPE 5C8MA 1H0VA 5KKRB 1PMUA 3P7AA 4YP8A 3PJ1A 3PWYA 4I4EA 1QL6A 2VN9A 3H0ZA 2VTPA 4XOZA 3S0OA 4MAOA 4YPSA 3A8WA 1W2FA 4M84A 1CKIA 3H9FA 2PZYA 2W05A 3BE2A 4FTLA 2VWBA 4XV1A 1PYEA 5KMMA 4LG4A 3NX8A 2WTDA 3K3IA 3ZSHA 3HNGA 2JIIA 5EKNA 4FYNA 5KE0A 3QHRA 4RPVA 4DG0E 4BDIA 4FSMA 2SRCA 2OU7A 4FRFA 3ULIA 1V0PA 4FSWA 3ODYX 3SD0A 5D11A 3EFLA 3O71A 3UBDA 3WI6A 4ZY5A 4D4RA 2BR1A 2IN6A 3MJ1A 2W1CA 5AAFA 4ZEGA 1T46A 5L8KA 4FV4A 3BKBA 3KK8A 1LP4A 4N6YA 4W4WA 3GUBA 3GBZA 4NTSA 2HW7A 5FBNC 4NW6A 3FYJX 1OL2A 3DU8A 4LV5A 3BV2A 3DJ7A 4XNEA 4HYHA 1JKLA 5J5TA 2WMXA 3F5PA 5D1JA 2OH4A 2QOLA 4AA5A 1OGUA 5HQ0A 4MXCA 1NA7A 4BBEA 3CD3A 4GSBA 4E5BA 2B1PA 4NW5A 4ZTHA 3BIZA 1CSNA 2A19B 4I21A 5FD2A 2WTVA 2OW3A 2ERZE 4GU6A 4MD8E 4YJNA 3UMXA 4KD1A 4EHZA 3F66A 1ZOEA 3EMGA 4YPDA 4CKIA 3F3TA 3RPYA 2X9EA 2O8YA 4RJ7A 4U42A 3QGWA 2BCJA 2ZB0A 1BI8A 4JRNA 4GV1A 2IJMA 3QTUA 3QUPA 2UVXA 2H8HA 3LJ1A 4ANLA 2Y4IB 3SOCA 3EQPA 4D4SA 3TTJA 5CY3A 4D0WA 2V7AA 4JNWA 1OIQA 3KY2A 3BHUA 2REIA 4IBMA 5TR6A 5LVPA 1W2CA 4B7TA 5DOSA 5GJFA 4EQCA 3DTWA 3FC2A 3S2PA 2Y8OA 3BELA 3GT8A 4WRGA 3UVRA 1Q5KA 3CEKA 3JPVA 4IZ5A 3UYSA 4CFXA 2CGVA 3G2FA 2RGPA 4BYIA 4EOMA 4LRKA 2VTSA 3UJGA 2GFCA 3EQRA 5JEBA 1OI9A 3UOHA 4PX6A 4USFA 1RQQA 2WTWA 5AADA 3O8UA 5J79A 1VYWA 5CSHA 3QCYA 4AW0A 4FNWA 2E9VA 3PG3A 4PPCA 4RMZA 3ZC6A 4PF4A 5M4UA 3ZTXA 2A0CX 4QPSA 2CGUA 3FXXA 3GB2A 4FKOA 4XJ0A 5AMNA 4E7WA 3C4ZA 4HW7A 2P0CA 2VTTA 1PKGA 3UC4A 4O6LA 5FQDC 1OMWA 2WMSA 5CU2A 5E91A 2R3HA 5EFQA 3SW4A 5I9VA 4B8LA 3FKLA 2YM7A 2FGIA 3DQWA 3HV7A 4MTAA 2BMCA 4U43A 4FV8A 4YNEA 5D7VA 5CEPA 5E8XA 5D10A 1H0WA 3HX4A 4XYFA 4AE9A 3PVWA 2QOHA 4O1PA 3CLYA 4XG4A 4D1SA 4RFYA 4DYMA 4Z7HA 3BYMA 1Q8UA 4FKJA 4Y46A 3QQUA 3FY2A 5L3AA 4JQ7A 1GZ8A 5IDNA 2GS2A 4XG9A 3QRUA 3UIMA 5E8TA 3IGGA 4JBVA 1K9AA 4F6UA 4PNKA 2O0UA 5H8EA 3F2NA 4G16A 5M56A 3R7OA 2JIUA 5HVYA 1HCLA 3M11A 3IONA 3LFAA 4FNXA 3WILA 5DA3A 2QODA 1NVRA 2YLEA 5AV2A 4EUUA 4C3RA 1A06A 4JJRA 5FP6A 4IANA 2UV2A 3R1NA 4FZAB 3IO7A 3TNQB 3R63A 3FQEA 4GH2A 4YTHA 3ZLWA 4FV0A 5E8VA 5JKGA 3D15A 2IZTA 4W4YA 4GVAA 4D1XA 4A06A 1M2RA 5KNJA 3E3BX 3KU2A 4CT1A 4M8TA 4OW8A 2ZM4A 3NUUA 3R8UA 1OIRA 2GU8A 3D14A 4M69A 4OT5A 3ROYA 5IUIA 4BBMA 3CE3A 2HIWA 4NEUA 1YW2A 2R3IA 1RE8A 5CVFA 3R21A 4PQNA 3B2TA 4FKPA 2FYSA 4O4EA 3L1SA 4F6WA 4FC0A 1H1WA 2ZB1A 4IB5A 4UYAA 3TZMA 4EI4A 3T3UA 4IWPA 3QUEA 2HZ4A 3PP0A 3W2CA 1ZMWA 3LQ5A 4ZJVA 3PY3A 3W8LA 3A99A 2LGCA 3KGAA 2JKQA 2X4FA 3Q53A 4BBFA 5EI6A 4Y8DA 3MPMA 3DY7A 4OTFA 5HX8A 4JG7A 2JKOA 3A8XA 1OL6A 3VHKA 4AZTA 5I3OA 2ZOQA 2QOOA 4MBIA 4PV0A 3ZXTA 1X8BA 5EW8A 5J1WA 4YMJA 1SVHA 5JGDA 5CAUA 1KE9A 4QP6A 2PVKA 4DLIA 3U51A 3N51A 4HGSA 3OY1A 4YZMA 3RP9A 3SW7A 2IZUA 4PRJA 3QU0A 2XVDA 4RIXB 4KRCA 2AQXA 3HP5A 2VTQA 3HA6A 4RIXA 3DPKA 2QHNA 1YDTE 3MY5A 1M2PA 2C5XA 4GJ3A 5HG9A 5C27A 1K2PA 5FLFA 1J1CA 2J0MB 5C01A 3PXFA 2UZUE 3EKNA 3R00A 1TVOA 5HORA 3R83A 5M4FA 3R30A 3O17A 2F9GA 4APCA 3SDJA 5IISA 1YXTA 3CXWA 3QBNA 4BVUA 4EH8A 3RM6A 1Z9XA 1YQJA 4RA5A 2FUMA 2BIYA 3BI6A 3MH0A 4QMTA 4RSSA 2OF4A 2B54A 4BCFA 3R7UA 3LQ8A 4IAIA 4JAIA 5JH6A 3UOKA 3RM7A 4G3DA 4ZTMA 4AGWA 5T68A 3L8PA 3OD6X 3RHXA 5EYKA 3VS7A 3WZKA 2PVFA 5KMNA 1YVJA 2IEWA 3RWQA 4B8MA 3EFJA 4BN1A 4XOYA 2WQOA 4GIIA 3TI1A 2Q0BA 4QMMA 2VO0A 1WBNA 4E6AA 1TQIA 1P5EA 2R3LA 3G5DA 3IPHA 5L8JA 4ZJIA 4AGCA 4AACA 3B8RA 4QP7A 3R6XA 2VTLA 2R3NA 3DNDA 4X0MA 3PTGA 3QWJA 4FV1A 4OGRA 1R0EA 2WPAA 3BYOA 3UOLA 3Q96A 4NM3A 3QTZA 3QQLA 4XHKB 5A46A 5I9WA 4PMSA 4U80A 4HGLA 2WTKC 4QP3A 4BCJA 2QOCA 2YITA 3BV3A 4W8DA 4EEVA 5AP2A 4FG9A 3RZFA 4NM5A 1ZYCA 2XCHA 4IB1A 5CEMA 4QMXA 5AP4A 3DKOA 3GC8A 5G1XA 4F0GA 3HRBA 4ASZA 3G90X 5AR5A 1YHVA 4DFYA 3LCDA 3CBLA 3ZEPA 4L00A 2F2UA 3ULZA 2BROA 4U3YA 3MFUA 4ANOA 3QTSA 3RPRA 3CQWA 3ZXZA 3EHAA 3R8VA 3MFRA 3TZ7A 1XBCA 3GFEA 4HZRA 2PMLX 4L3PA 3QLGA 3MIAA 4S32A 4BDKA 2XBJA 3TG1A 4A7CA 4Q5HA 5LWNA 5EDQA 4UWCA 1KOBA 1JKSA 3A60A 3LXLA 4J8MA 4ZTSA 3I60A 3TUBA 4EH5A 3R8ZA 1SVGA 3E92A 3IW7A 3MB6A 1U46A 4E4XA 4DG2E 2ITZA 3IW6A 3TEIA 2HW6A 4NT4A 3RHKA 4E1ZA 4D5KA 5ICPA 5LXMA 3THBA 1TKIA 1G5SA 5IPJA 5LMKC 3FV8A 3OTUA 3VUTA 4ZY4A 2QHMA 2WEVA 3EB0A 4WOVA 3VS6A 4YZDA 2C6OA 2FO0A 3MH3A 1H26A 4RC2A 3GU5A 1J91A 2E2BA 5DR6A 4IEBA 3MW1A 5AUVA 3AMBA 2I0HA 3VRYA 5ANOA 5IEXA 5EDRA 4NM7A 1PXPA 3B2WA 3O8TA 3UG1A 3VS4A 4NKAA 1PXLA 3RAWA 4D4VA 2PVNA 3ZO2A 2EXMA 3KF7A 2YAAA 5JRSA 2O64A 4UY9A 3ACKA 4BGQA 2VUWA 4IC8A 4XV9A 4DH3A 2C6KA 2ZDTA 3A61A 5ETAA 3ZUTA 2YM6A 5FXQA 4FTJA 2QI8A 3PSDA 4YBKA 2YCSA 4GK4A 4D2RA 2XMYA 3MBLA 1H07A 3BYSA 3C0IA 4DGLC 5BMMA 3FL4A 4HGTA 1VZOA 2R3MA 1PXJA 2QNJA 5ANGA 2UZVA 4ANMA 4AU8A 4C3PA 4EQMA 5IEVA 5M44A 1P4OA 5A6NA 1Q8WA 4TNBA 5C8KA 3IOPA 2DUVA 1FPUA 2PMIA 3BU6A 3COIA 5DWRA 1ZZLA 3A62A 4JR3A 1XH4A 2R64A 5FGKA 5JN2A 1YI4A 2VGPA 3FQHA 4NUSA 4KKHA 4DEAA 2IZSA 4ANBA 4ZSJA 3V5QA 4E5WA 4R1VA 3HA8A 5AP1A 2ETRA 2I0VA 4BZNA 3HLLA 3NDMA 1PMNA 4GK3A 4XS2A 2RG6A 2BDWA 3RK5A 4ITJA 4BFMA 3OG7A 3A7HA 4M97A 5E8YA 3RAIA 3OW4A 4K33A 3CTJA 4A4LA 2R4BA 3KRWA 3LJ0A 2FSOX 3NLBA 3BLQA 2BZHB 1OUYA 2PVJA 4FIJA 4FUXA 5IUHA 2PMOX 4MF0A 2XEZA 4FSNA 3WBLA 4W4XA 2UZLA 3QZGA 3GP0A 4QMYA 3RNYA 4HCTA 2UZBA 3Q4ZA 2IW8A 2ITNA 3AXWA 3PFQA 1ZWSA 3PYYA 3VS3A 2XM8A 1JPAA 4J97A 3F3UA 4LFIA 4LI5A 2C5NA 5CSPA 2IVVA 4JLCA 4DFZE 4AS0A 4AA0A 2CLXA 4X3FA 4I5CA 3BQCA 5JFSA 2GQGA 3DDPA 4DGNA 3ZYAA 4AG8A 4QT1A 4UV0A 4EQUA 4L43A 4LL5A 5AV0A 3DKFA 3MVMA 3GQIA 4OAVB 4EH2A 4DH7A 2UW4A 3CY2A 1H24A 3O2MA 3Q2MA 3TNWA 3Q6WA 2C3LA 2BRGA 3QTIA 5HI2A 4BF2A 1YWVA 3MY1A 3LLTA 4XG3A 4CFMA 4FTOA 3RMFA 3H4JA 4XV2A 4M3QA 2VX3A 4TWCA 5HO7A 3OOMA 4ZK5A 1F0QA 5LARA 4IZ7A 3REPA 3P4KA 4W8EA 2ONLA 4EK8A 2OJ9A 3CJGA 5DEWA 3ITZA 4U40A 4EOSA 1LEWA 3ALNA 4QD6A 2WFYA 4RVMA 3V8WA 3VUGA 4BZDA 4LRJA 4DFXE 3OWPA 2YACA 3AC1A 4QOXA 2VNYA 3NIEA 4U79A 2VTOA 3UIBA 4TKSA 3LM0A 3KCFA 2F2CB 3PVGA 4O4BB 4Q2AA 2FSMX 4RWKA 4YZCA 3VS0A 4DEHA 4E4MA 1KV1A 1Y8YA 2R7IA 4MBJA 4WSYA 4Y72A 2YCRA 3KFAA 4FSUA 4NK9A 4ZAUA 4BI1A 4XG6A 2PSQA 3BHHA 2JFLA 4CCUA 3JS2A 1GOLA 2YCQA 4S2ZA 3V04A 2PL0A 2OFUA 3NW5A 4CT2A 2R9SA 3BHYA 4EOLA 4RRVA 1BUHA 5CU0A 1JSVA 4GT4A 3QF9A 5FTOA 3JVRA 3NZ0A 3D5XA 1WBTA 2YM5A 4IADA 5J7HA 3CTHA 1XH8A 1XH6A 3DB8A 3UNZA 4RC4A 4CQGA 3R2BA 4J95A 4RVTA 2BRBA 5J5SA 1OL1A 3MTLA 2A4LA 3D7ZA 3PZEA 1ZY5A 4PL4A 4X2GA 1W82A 1KE5A 2R3GA 4HGEA 3G6HA 5JFXA 2GNGA 4FIGA 4W9WA 5E8ZA 2UUEA 2BPMA 3PJ8A 3DKCA 4FSZA 3LFFA 1URCA 4FGBA 1BX6A 4GUBA 4FV6A 4O0VA 4X2KA 3GCQA 3R8MA 2WELA 5FP5A 4ACMA 4HVDA 4U6RA 5KHXA 4PMTA 2IO6A 4PL3A 4BCGA 4IX6A 4HPUE 1Y91A 4GFMA 3JYAA 3UO6A 4AT4A 3IW8A 3F82A 5JFWA 2XJ0A 3BZ3A 1ZMVA 2G01A 4G3FA 1OKWA 1KE6A 4X2NA 4GFOA 4MEDA 2OGVA 4D58A 2XUUA 3FZSA 2R0UA 3V3VA 3WZDA 3R9NA 4CFNA 3VWAA 3ENHA 3TUDA 3RCDA 2VWIA 3ET7A 3RVGA 4NZWB 3MH1A 5ANDA 4O4DA 1CKJA 2C5VA 3QQJA 4FKIA 2ZM3A 2J9MA 3V51A 5FDPA 4AE6A 4CZYB 2F49A 5JGBA 1OL5A 4F4PA 4HJOA 4YC6A 2W1EA 3QQFA 3R1SA 1REKA 2Z60A 4LOPA 4A4XA 1WVXA 4KS8A 4QNYA 2X2MA 3E7OA 3RK9A 2C30A 1MUOA 3QD4A 2UZWE 3ORTA 3VS5A 4EKLA 5HBJA 1HOWA 4BCKA 4K0YA 4L9IA 4MK0A 5J7BA 3AT2A 2G1TA 4WNPA 2FA2A 4B99A 4C57A 2VRXA 4X7QA 4UMRA 2VGOA 3QD0A 3FMMA 3O7LD 4FT0A 3U8WA 4BCPA 2X9FA 3TCPA 4F7JA 2OJGA 3T9IA 2FVDA 5DT3A 5EOBA 2YJRA 4LM5A 4YC3A 4L46A 2R7BA 4H3QA 4XLIA 4DFNA 1JLUE 5IA3A 3D5UA 4DFLA 4IB0A 4O0XA 5HE2A 3UTOA 4BRXA 4AZSA 4BDDA 4EK3A 1JAMA 1STCE 3VF9A 3W16A 2Y4IC 4XUFA 2X8EA 5IEYA 1SVEA 4FKQA 4RGJA 3S00A 1REJA 4H1JA 5CNNA 3IDCA 4JS8A 2OKRA 4YSJA 4Q9SA 1KSWA 4O38A 3DDQA 3PIXA 4EUTA 5FXRA 5ANIA 5I9ZA 3FHRA 4HYSA 1VJYA 3OXTA 4ONAA 4RJ5A 3SV0A 4TYJA 3I0QA 2IW9A 3OWLA 3HDMA 4KINA 3W2PA 3SVVA 5JQ8A 3UQCA 1AQ1A 4IAFA 5DI1A 4OLIA 2W96B 1IR3A 2YA9A 4HOKA 4R3PA 3LXKA 3SC1A 5CI7A 1GZOA 1PMVA 3T8OA 3QRIA 1E1XA 4FIHA 5M57A 2JC6A 5BNJA 2QU6A 4QP9A 5KMKA 2V55A 5ANKA 3QCQA 1P14A 1ZAOA 3Q60A 3FZTA 4BZOA 2WD1A 3ALOA 3DFCB 4FZFB 4XMOA 2PZ5A 4RG0A 3EIDA 4EZ3A 4DINA 3P86A 4AN2A 5CANA 3COHA 4WIHA 4BDEA 3LE6A 3OWJA 4F9BA 1O6LA 2JITA 3AGMA 5DT4A 5AP5A 3WE4A 2HZ0A 3NYXA 4UALA 4AZVA 2R3FA 2QVSE 3CC6A 5F1ZA 3UMWA 4DGOA 3BGPA 3NAXA 4CFVA 3FLNC 5CU6A 3JUHA 2YJSA 3VUDA 3AC3A 3ERKA 1WVWA 2W9FB 2R3PA 2Z7LA 3I1AA 4IAKA 2AYPA 4K11A 3WZJA 4KIPA 5H2UA 4JVGA 2Y7JA 3TWJA 4MNFA 2VX0A 4V0GB 4R1YA 3O23A 2GNJA 3QX2A 4N4SA 4V0GA 4TYGA 1UNLA 3FC1X 4AOJA 3DTCA 3L8VA 3LAUA 2GFSA 2C6MA 3PSCA 3Q6UA 4IFCA 4C36A 2CDZA 1PW2A 3EN6A 4I5MA 3MY0A 4XP3A 2GNLA 3VW6A 2EXCX 5I0BA 5DHJA 4BDGA 5AP6A 5DGZA 2VTAA 4MD7E 5H8BA 4D5HA 5CNOA 1YOJA 4IW0A 3BBWA 1ERKA 2F7ZE 5J1VA 1Q3DA 4NCTA 4UZDA 3U9CA 1XR1A 2UW6A 4IAYA 4LUDA 3OVVA 4C58A 3AD6A 3PWDA 4A4OA 4D0XA 4UMPA 3QQKA 4KBAA 3PVBA 5GJDA 3CKXA 2XIZA 3F6XA 2A1AB 4AOIA 1OKZA 4CNHA 3SAYA 2RIOA 3CPBA 4QQ5A 2ZYBA 4FTNA 2X2LA 3UIXA 3ZSGA 5LQFA 2C0IA 2EXEA 4C2VA 4G1WA 3FZ1A 1IA8A 3EQFA 4GL9A 2C0TA 4I41A 4ARKA 5HIEA 5AUUA 2BDJA 2OZOA 4ANSA 2QQ7A 3DK3A 3H10A 2BHEA 3C13A 3CGOA 2XRWA 1ZLTA 3ZEWA 1K3AA 4LV8A