4KSPA

Crystal structure of human b-raf bound to a dfg-out inhibitor tak-632
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
275
structure length
257
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
publication title Discovery of a Selective Kinase Inhibitor (TAK-632) Targeting Pan-RAF Inhibition: Design, Synthesis, and Biological Evaluation of C-7-Substituted 1,3-Benzothiazole Derivatives.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 257
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4kspA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4kspA01
3LLAA 1XWSA 4XV9A 2YWPA 3O7LB 4TRLA 5M44A 4BBEA 2JDVA 5E8SA 3RCJA 2GHLA 1W83A 3DAJA 4GFGA 4Y83A 4ZZMA 4PMPA 2E9PA 4L44A 3WIKA 5ANDA 1YRPA 4RJ7A 3CTHA 3QALE 4XBRA 4D4RA 5ANJA 3JVSA 2WHBA 4E6QA 5CXZA 4NCTA 1E9HA 3PFQA 3POOA 4QQJA 4AE9A 1KE8A 2PVFA 4YR8A 3HV6A 3LCKA 3JVRA 3LVPA 3FMLA 4K1BA 3C0IA 4WUNA 2RL5A 3UQGA 3WI6A 4DHFA 3FMKA 4ZIMA 5JFWA 4O7NA 3R73A 3ZZWA 3A60A 2XBJA 1YW2A 3BGPA 3CPCA 3PUPA 4K8AA 4MHAA 4UMPA 2VV9A 2VWZA 4FKOA 2PWLA 4FV4A 4PRJA 3R7VA 4FEXA 4IM0A 3PY0A 5CNOA 4K2RA 2VWBA 5D41A 4PV0A 1UVRA 3BHVA 3DXNA 4RQKA 3Q9XA 3D2KA 2YIWA 4IXPA 2P0CA 5HO8A 2WQNA 4CYIA 3QRUA 2R64A 3L8XA 4LRMA 3PXZA 2W4KA 3NUXA 4K9YA 2QHMA 4FV6A 4W4YA 2OO8X 4GCJA 4AA4A 3RKBA 4XX9A 4H58A 4HOKA 3AOXA 4GEOA 4BYIA 3ELJA 4KIOA 3Q6WA 2QOKA 3QTQA 3W33A 2GU8A 5E8YA 4L53A 3AT2A 5D12A 2WU6A 1URCA 3OBGA 2UZNA 2HW7A 1P4OA 4IM2A 3UMWA 4I3ZA 4RIXB 1ZLTA 3VS2A 4LOQA 4HJOA 3F69A 3C4WA 4KRDA 1DM2A 1O6YA 2JLDA 4G34A 3ZTXA 4Z3VA 2YABA 4Z55A 5FUTA 1PXKA 3EQIA 4FZ6A 3NGAA 1XH9A 1GIIA 3TNQB 3KMMA 2W96B 4O7YA 3LMGA 3PJ2A 3UQFA 4PP9A 5A54A 2PUPA 5LVMA 1VR2A 1ZXEA 3A7GA 2EXMA 3F2NA 4FSUA 4YO6A 3VUMA 2WTJA 3U87A 5K5NA 4DCAA 4XG8A 4XLIA 4C2WA 4EUTA 3UODA 3CPBA 4E4NA 4L45A 4EH6A 5E8ZA 2X39A 3GVUA 1MP8A 4QMMA 3WF5A 4L7FA 3FEGA 3U8WA 3IW8A 5CF5A 3VVHA 4BIEA 2XK8A 4U3YA 3K5VA 3L9PA 2B54A 5EM6A 4JQEA 1OBDA 3BKBA 4JNWA 5HCXA 3ZSGA 2YISA 4EKLA 5AV4A 5HHWA 1FQ1B 4NM0A 3RAHA 2GSFA 2FSTX 3WE4A 4GG5A 4F0IA 3KN5A 4HYSA 5HCYA 4FC0A 4W9WA 4UBAA 3OXTA 2BALA 3RINA 3MJ1A 3N4TA 1PKDA 3R7UA 4ALVA 3MPMA 2UZLA 5GIOE 3NIEA 5EW8A 2X4ZA 4USDA 3FJQE 3CP9A 5JFSA 3FI8A 4EK6A 3OW4A 2HXLA 2VO6A 4RX9A 4USFA 5T68A 1GY3A 3PVBA 5AR5A 1SM2A 4EH5A 5AAGA 4BCPA 2WMSA 3SLSA 1NY3A 4C3PA 3SG8A 2B9JA 3EN7A 4L68A 5EI8A 3VC4A 4PDOA 4GK3A 1GZNA 3KULB 3RHXA 2WTWA 3LMHA 1IAJA 3KKVA 2XZSA 2GNIA 3RJCA 1FGKA 1PXNA 1WBOA 3LXLA 4GIHA 4H1MA 3PXQA 4IZAA 4EHEA 4RIYB 5CAQA 4E4XA 3V5JA 4EWQA 3HRCA 2XIXA 4NEUA 1H27A 2GFSA 2UW0A 1TVOA 2BZKB 3NW7A 4Q2AA 4RFYA 3U4WA 4EKKA 4MH7A 5CASA 4FGBA 5AP2A 4BL1A 3ZXZA 3WZKA 2O8YA 4ZY6A 5JMSA 4ZSJA 3OUKA 3DKFA 4X2JA 1IEPA 4FZAB 4LFIA 3QGWA 5I9UA 4A4OA 4C0TA 5LWMA 3DPKA 4QP2A 1ZOGA 5F4NA 5L3AA 2W4JA 3NVKI 4FL1A 2OH0E 4EH9A 2XRWA 4IC7A 3RAIA 3IW6A 3KN6A 1CKJA 3NNXA 3DB8A 4ITIA 2RGPA 4K11A 4GK4A 5J8IA 4CNHA 2YERA 3QKMA 4OBPA 5EI6A 4LMNA 1URWA 4AN2A 3OY1A 3KL8A 4DH8A 3UVRA 5CF6A 5J95A 5M56A 4A4XA 1NXKA 2X6EA 2WTKB 2XKDA 5ETFA 2W1DA 3OVVA 3VBYA 4NSTA 2CKPA 3R71A 4D4YA 2BDWA 4FYOA 1UNGA 2BMCA 3IGGA 4IW0A 4LI5A 3TZMA 2YIQA 2WFYA 3DK7A 3FZPA 5IF1A 1WBNA 2B55A 3F3WA 5IZFA 5AMNA 2V7AA 4WBOA 2J50A 5TOZA 5DT0A 4BZOA 1PXOA 5C1QB 5CENA 4OTWA 2OBJA 5FEDA 2UW4A 2BTRA 2V0DA 5BVEA 1MUOA 3JY0A 3WIGA 4M69A 4ANLA 4BGGA 4D1SA 2G2FA 2ITTA 4RVMA 3HV5A 5K5XA 3QD2B 5KCVA 3Q4ZA 1J7LA 4H1JA 5FRIA 4NZWB 2H34A 5EH0A 5B0XA 3TUBA 1WBWA 3FLYA 2QOHA 2CNVA 3PLSA 3QA8A 4XV1A 3FSKA 3GCVA 4PWNA 4AOTA 4LV8A 4BZNA 3PIXA 5FP6A 2DQ7X 3KMWA 2J2IB 2YFXA 3IPHA 4NM3A 1ATPE 1XHAA 4M7IA 5DVRA 2VD5A 5DE2A 2EB3A 3QXPA 4UMUA 5CSHA 3QA0A 2W4OA 4RA5A 3VW8A 2ZYBA 4KA3A 1R39A 3TUCA 4PTCA 3WF8A 4EI4A 2XNOA 3NNUA 3RPOA 3MJ2A 4EEVA 2PUUA 5J7BA 2BILB 4BIDA 4AT5A 4MXOA 4YUQA 5F20A 1PKGA 3I5ZA 3L8SA 3F5UA 3OY3A 5DOSA 3MB7A 3V51A 4YTFA 3W32A 2J0JA 2UZUE 3HDMA 5AV2A 3WOWA 2CNQA 4R77A 4ZJIA 2ZMDA 3BWFA 3LCDA 3QX2A 4PL5A 2OZAA 5IISA 1ZAOA 3CKWA 4GV1A 4MXXA 3WZUA 4C34A 5L8LA 3C1XA 4EHGA 4E4MA 3K2LA 4O7WA 3O51A 4IVDA 4JS8A 1H0WA 5HBHA 4TYEA 1OL1A 1PXMA 2OF4A 4AUAA 4PNKA 2RG5A 2AC3A 4I93A 2ITUA 3QCQA 3NYNA 5IMXA 4YO4A 2WQEA 2NRUA 5AUUA 2YN8A 3HRBA 3EQRA 4I6FA 5CSXA 4F9AA 5A4QA 4ZOGA 3EQPA 2JKOA 2YDIA 2KTYA 2QC6A 3MVJA 3MTLA 3LW0A 4MYGA 3TZ9A 5BUEA 1XJDA 2OU7A 3SXSA 1PXJA 5KMNA 3ID6C 2W1ZA 2XIYA 3O0GA 3BZ3A 1V1KA 3ZS5A 3CS9A 4TKSA 4B6LA 2YAAA 3RPVA 4AS0A 4F7SA 1GNGA 3TDWA 3MY5A 2C1BA 2Y7JA 4FNZA 4YZNA 3FMMA 4KBKA 2LAVA 3MIYA 3EN6A 2UZDA 3OEFX 5HEZA 4QQTA 5BVNA 1ZMWA 5C4LA 4JI9A 5EHOA 2WQOA 4S2ZA 3AGLA 4M97A 3REPA 5F95A 1UU8A 2XJ1A 3ZH8A 4XUFA 5IQIA 4JQ7A 4LGGA 3LE6A 4LRJA 4FTCA 5EQEA 4KIPA 1U5RA 4BI0A 4QMYA 3JUHA 4OUCA 3ZEWA 3VUTA 4UZDA 4D1XA 4KAOA 5IQGA 2HOGA 4DBXA 4J99A 4ZK5A 3FMDA 4H3BA 2W9FB 1ZYDA 4O38A 4OT6A 5CU6A 3ORPA 4EZ5A 4O0VA 2RFDA 1BX6A 4FZFB 3HV4A 2BRMA 2C6KA 4AOJA 4ZY5A 2DWBA 4XYFA 2UZVA 5CU2A 2C5YA 3FXZA 2QURA 3FY2A 4EK8A 4DFBA 2Q0BA 3VF9A 2OFUA 2UZTA 5LWNA 4BDBA 1ZZ2A 2XP2A 3QTWA 1Q8YA 4ZZNA 2PVJA 2XBAA 3R1YA 4IANA 3OWLA 4FNWA 3RZFA 4E7WA 4UMRA 5AR2A 5FP5A 2Z8CA 3FC2A 4G6OA 4ZJJA 4P2KA 2PMOX 2QOOA 3I6WA 3SVVA 3NW6A 3PVGA 4KABA 4C4IA 5IQEA 3C4CA 4G2FA 3EN9A 4ITJA 1ZOEA 4GJ2A 4BFMA 4CLJA 1XBAA 1JLUE 4F1OA 2I7QA 4AAAA 3O17A 3PG1A 4TXCA 3LFCA 5KMOA 1W7HA 5AR7A 2HYYA 4KIKB 3ZOSA 3QKLA 4G5JA 5C8MA 4BKZA 3U4UA 4O7LA 1DAWA 4FSWA 1YWRA 3HL7A 2W1GA 5A4CA 2QQ7A 3T3VA 2PULA 1G3NA 2VWXA 3TNIA 4QMXA 4GVJA 3PIYA 5ANEA 3PTGA 4W4WA 3SW7A 4A9SA 3DJ7A 3EWHA 2O65A 3Q4UA 2C0IA 4K18A 2O2UA 2XCKA 4D2VA 5ANIA 3COIA 4BCQA 1O9UA 3BWJA 4AFEA 3FQSA 3OUNB 4NUSA 3WARA 3R8MA 5CWZA 4ANMA 1YDSE 2G2IA 1Q8TA 2BRGA 2J5EA 3FLZA 3QXOA 2JITA 2VGOA 2BFYA 3HA8A 3LQ8A 5EG3A 5FTOA 4AW0A 2I0HA 3UO5A 4S31A 3SOCA 3CY2A 4WG4A 1H1WA 2IVTA 2PVNA 4M8TA 4TYHA 2GPHA 4Y95A 5HE3A 3AD6A 4GU6A 3E88A 4GKIA 2PZ5A 4A9RA 4FKWA 2NRYA 5KKRB 5CVHA 4RFMA 4U9AA 5HD7A 1OIRA 2BZHB 2FSOX 2W06A 3AXWA 3F7WA 5AR3A 3V5QA 3B2TA 4A4LA 3V6SA 3KQ7A 1MRYA 5CEPA 4G3DA 4QP9A 4V0GB 5E91A 2WZJA 3UMXA 4FVQA 4CYJA 5BQ0A 4RX7A 2I0YA 5KBQA 4QMPA 1BI8A 4JG6A 2ZDTA 1Y8YA 4D0WA 5HG7A 2OJFE 2R3RA 3G0FA 4FKQA 5CEKA 5HGIA 1KE7A 2JDRA 2JIVA 4P5ZA 4DTKA 5J79A 3GCUA 2ZM1A 4Y73A 1RW8A 1H07A 2XKCA 4LUDA 3UBDA 3ZYAA 4XG7A 4O6EA 1XBCA 5ANKA 4Y5HA 4FV7A 2Z7RA 5DNRA 4L3LA 2PVLA 3VF8A 4BR3A 4FSTA 4FTLA 4L46A 2YWVA 5C26A 4QNYA 3C4ZA 3CQUA 5E1SA 4O7SA 3O8TA 4QMLA 3Q6UA 3WYYA 1YXTA 5IQDA 4C4HA 1BL7A 2R3GA 3LOKA 3Q2JA 5A3XA 2HXQA 3Q9ZA 1S9IA 5BX0A 3MDYA 4NJ3A 5IUHA 1Y6BA 3DQWA 5HG9A 4CQGA 2WIHA 4X3FA 1BYGA 3VUHA 4XMOA 1WBPA 4B0GA 4F99A 2VTOA 3KFAA 4HGTA 2Z02A 2J0MB 3V5PA 4F70A 5AP1A 5EM7A 3RCDA 4J95A 3C5UA 3UOLA 3DTWA 4X2KA 2Z60A 4H05A 4CLIA 3LAUA 3F5GA 4NK9A 1BUHA 3ZSIA 4OTPA 3DNEA 4BI2A 4ZTRA 1Z9XA 1JVPP 5EOBA 2VTRA 4EOPA 4U42A 2XS0A 4EYMA 4YJPA 2X2MA 3GC9A 5A4LA 3Q5ZA 5LCKA 2OH4A 3S3IA 4FX3A 4QYYA 4XV3A 4FOBA 4QPSA 4CKIA 1YDTE 2GS7A 4ZXTA 3RNIA 3TTJA 3GFEA 4MBIA 4C62A 3DFCB 3DA6A 2IVUA 1KUTA 5FLFA 5EYCA 4QMNA 4AW5A 4F64A 2OGVA 3ORLA 4EH4A 3QC4A 4BDAA 2WQBA 2VTQA 5HZNA 5EHLA 4BGQA 2PHKA 4E73A 3RGFA 3QD3A 5HNBA 5I9WA 4Y85A 3UYTA 4JX3A 4W8EA 5EYKA 3KY2A 2OJGA 2Y4PA 5M4CA 1UU9A 3E64A 2J4ZA 5I4NA 2X0GA 3DKGA 2R3KA 3KVWA 1PMVA 3AMAA 1QPCA 2DYLA 4BCIA 5CXHA 3GI3A 2EU9A 2QR7A 3DAKA 5AIRA 4FKUA 4QMVA 4J53A 3V8WA 4I0TA 4Z9LA 2EXCX 4FZDB 4QP3A 5KMJA 5BVFA 3KF4A 2UVXA 4DEEA 3UPXA 2C47A 3Q4TA 5HD4A 3LXNA 4FTOA 4D0XA 1ZARA 3ZHPC 3FZRA 4MKCA 4QP8A 4O0WA 3FWQA 3P86A 4U8ZA 2F7ZE 2GS2A 3P7CA 5HNGA 4OTDA 4YBJA 4BYJA 5KMMA 1H24A 3QHRA 1YHWA 2C6DA 4D1ZA 4UN0C 3D14A 5E8WA 5GZ9A 3EFWA 2AC5A 5AP5A 2BZIB 1Z57A 2J90A 3OCSA 5L8JA 3QZFA 4GYGA 4BDFA 4RWJA 2FSMX 3OCTA 4IH8A 3CCNA 4H3QA 4JXFA 2UW5A 3TUDA 2ZM4A 2J5FA 1JSUA 2IWIA 3FHIA 5HO7A 3LXKA 5M07A 3L8PA 1JPAA 4FF8A 4FT0A 4QTAA 5ETCA 4RC2A 4ZLZA 5CTPA 5I0BA 2A2AA 4G1WA 4C3FA 3W2QA 4PP7A 3KEXA 5I9VA 5HCZA 2VO3A 2Z7QA 3GENA 4WOVA 1GJOA 2X81A 3U9NA 5J9LA 4TYIA 5HQ0A 4V05A 1AGWA 4P90A 4N4SA 3D94A 5H8GA 3R7IA 2VN9A 1WBSA 3Q96A 4CFNA 4C4JA 3I81A 2A4LA 4QRCA 3R9RA 3NUSA 2PZPA 2ZV9A 3UE4A 4EQCA 1FMOE 1WAKA 1YXUA 4BZDA 2GNLA 5GZ8A 3E8CA 4V04A 5FBOA 3R9HA 2YCRA 3VQUA 4ANOA 3NPCA 4PL4A 5KX8A 4LL0A 3F7ZA 2F2UA 4QD6A 3OEZA 3R63A 5CANA 5JEBA 3N4VA 1PYXA 1YKRA 3H0YA 4F09A 3AC2A 3KXHA 4E6AA 3F2RA 1VYZA 3ZMMA 4RC3A 5CX9A 5JSMA 2ETKA 3R7YA 2OXXA 4S30A 1JBPE 3HLLA 2JBOA 1TQMA 1JKSA 3Q9YA 1DS5A 5BVKA 3CXWA 5ETAA 3GU6A 3GOPA 2XCHA 4EUUA 5LMBA 2CSNA 5HI2A 4FV8A 4C36A 5B2MA 4CSVA 5EFQA 4D28A 4I22A 3FAAA 3GCQA 4CTCA 3KRJA 2C6OA 2BFXA 4UZHA 4BTKA 4RRVA 3VJNA 1OIQA 1JKTA 4DH3A 3BHUA 1PF8A 1KOAA 2XNNA 4XV2A 3TNPC 4BF2A 4CT1A 3FQEA 4PY1A 2F49A 2ZV8A 3QTRA 4DGMA 5E90A 4CVAA 5CZIA 3GT8A 5EHYA 3FXWA 4FUXA 2P2IA 4GT3A 1OIYA 4C7TA 3NYXA 5FEEA 4AE6A 2O5KA 3R0TA 4V01A 4WHZA 4RLLA 3RWQA 5IEXA 4YJNA 2GCDA 3QLGA 5CVGA 3F2AA 3EFLA 2C5OA 4GT5A 3VS3A 5DHJA 2J0KA 2QOQA 4LRKA 4ZLOA 5HE2A 2Z2WA 1ZRZA 5A14A 3KRLA 3VULA 4F65A 1LR4A 5DFPA 4RMZA 3LJ0A 5KNJA 4U80A 4AGUA 5DRDA 4D2PA 3ANQA 1CMKE 2BR1A 4ACCA 2ZB1A 5ACBC 3BE9A 4ZS0A 4LL5A 4X6RA 4PMSA 4FV0A 4CGAA 3ERKA 4K6ZA 1LPUA 2JAVA 3BE2A 5FGKA 4CFUA 2PE1A 2ESMA 3UZTA 3HAVA 2PVYA 3UNZA 2WTDA 3CQWA 1JWHA 4I24A 4BCJA 5CALA 3EQBA 4FKJA 4FKSA 1CKPA 4AP7A 2YZAA 4FV5A 4QMTA 4X3FB 3QWJA 4AA5A 2R7BA 3FHRA 4RJ3A 4U81A 4E5AX 4YTCA 3RK7A 1IR3A 4J97A 3PXKA 4TPTA 4XCUA 4ANNA 4OTGA 4E6DA 4FOCA 4XP0A 1W98A 2YM8A 4NT4A 4RFZA 3ZZEA 3E93A 3DXPA 2ZMCA 3EFJA 2QNJA 2HENA 3ZBXA 2W05A 4FIFA 3P9JA 5KMLA 4QPMA 3QAME 2O63A 3OXZA 2BIYA 2B9IA 3CGFA 3G51A 4DC2A 1M2QA 2AYPA 3MH1A 3C7QA 4YC6A 4ALWA 3ZONA 4ERKA 3MPTA 4FT7A 4C57A 3AC4A 1H08A 4TTHB 3Q60A 3ROYA 3PG3A 3ACJA 4YJVA 1H0VA 3PRFA 3NUUA 3QRKA 3VS5A 5FEQA 3EYGA 2C4GA 4XH6A 4EOIA 2YLEA 4DFLA 3BHTA 2WMWA 4DFUA 5DR2A 5CF4A 3ZC6A 4KKGA 3W2CA 4A9TA 1JKLA 3UGCA 4FGRA 1ZOHA 2C68A 4HZRA 2ETMA 3DT1A 4L9IA 3TV4A 2VTJA 4LOPA 5A46A 3AG9A 4BC6A 2OKRA 3WBLA 1CM8A 4ZMFA 1Z5MA 3PZHA 3QHWA 4FG7A 1RE8A 4I4EA 3MFSA 3PP1A 3FL5A 3HECA 3AQVA 4XEYA 3KU2A 5H3QA 3U55A 1SZMA 2CGUA 3E7VA 5I5ZA 3RBWA 5L6WL 4AQCA 4C59A 2ERKA 1YHVA 2BHHA 3OWJA 3LFBA 4WD5A 3GQLA 2QHNA 4JIKA 4I23A 3IDCA 2XUUA 4FTKA 3PXFA 3UO6A 3BYOA 1J7IA 1J7UA 2X2LA 2UW6A 4E20A 1G8AA 1Q61A 4P5QA 5CVFA 3TKIA 1CDKA 3OT8A 3DBCA 3P0MA 3VS1A 4MWIA 5AA9A 4MF1A 3BBTB 3E3BX 1WVWA 3LCSA 4YPSA 1YDRE 3A7IA 3SX9A 4CMTA 2UW7A 1S9JA 3GU4A 4JDHA 4FEVA 5LMAA 3UC4A 3VUDA 2WMRA 5ACKA 3LKMA 3DJ6A 2YIRA 2WQMA 4ITHA 2XKFA 3TACA 5AX9A 5DA3A 2CDZA 2XM9A 4KS7A 2R9SA 3PA3A 2HZIA 4FTUA 5EKNA 4GVAA 4DCEA 2W17A 3HEGA 4MTAA 4U6RA 4I5HA 1OL7A 1REKA 4N70A 5I3RA 1K2PA 3ALOA 3RPSA 3QGYA 5TT7A 4AN3A 3IOPA 4TZRA 4RC4A 3DNDA 5CAUA 4J52A 3RWPA 5KHXA 4WSQA 2R3FA 3VHEA 4AOIA 2XNMA 3I1AA 4IB1A 2UZBA 3A7HA 3R9OA 3ORZA 1Q8UA 2C3KA 3LCOA 3CY3A 5JK3A 1FGIA 3NRMA 5K9IA 4DF3A 5GINE 3EOCA 2XRUA 4UALA 3D4QA 4ENYA 4FV1A 4XNEA 5M09A 3QF9A 4DINA 4DG0E 4NKSA 4N57A 3R21A 4BDDA 4BGHA 3OC1A 3AC8A 4WG3A 4HZSA 4EC9A 3KREA 5HIDA 5AAEA 2C6IA 2XNPA 2YIYA 4ZY4A 4L42A 2VZ6A 4B8MA 2CGVA 2QOFA 4ZTSA 1SVEA 4FV3A 3R8PA 3EN4A 3OCBA 4FTMA 2OXDA 4R3PA 2C30A 4I41A 3VO3A 5IEYA 2YDJA 4RBLA 2C0TA 5L2IA 3EKNA 4I1ZA 4BTJA 2UW9A 2QOBA 3BGQA 4BICA 3VBXA 4D2TA 5G6VA 2JIIA 4M68A 4AG8A 2WTCA 3H4JA 2X6DA 2C1AA 3A2CA 1H1RA 3ITZA 3AMBA 3WF6A 3N9XA 5J9YA 4X21A 5HICA 3MFUA 4O96A 4EH2A 2GQSA 2B0QA 3ZSHA 3D15A 5LXMA 4FSMA 4I5MA 4IB3A 2BCJA 2H96A 3QKKA 1H1QA 2C3IB 3R83A 3TIYA 5E8TA 4GFMA 3U9CA 3ULIA 3DLSA 3UQCA 3Q3BA 3P7AA 2Y4IB 5EOLA 4RWLA 3FDNA 4MQ1A 4ZEGA 4GKHA 4ZTNA 5A9UA 1GAGA 5C4KA 2QO2A 4AT4A 3CGOA 3OWPA 3TIZA 3PWDA 4I20A 5L2WA 4KNBA 2Y6MA 1Q41A 4UY9A 1CKIA 3TN8A 3GCPA 4K77A 1YWNA 3LXPA 4ZSGA 3QD0A 1OIUA 5ICPA 3UIBA 3LFEA 1E1XA 2ITPA 2FYSA 3TT0A 2LGCA 1OL5A 3R7GA 1FBNA 5AUVA 3NEWA 3Q5IA 3DBQA 4Z7HA 2G9XA 3D7ZA 4PQNA 3NZ0A 4QYFA 2J6MA 5CSVA 3OFMA 4MD7E 5D7VA 2WMAA 4TN6A 5IA0A 3EB0A 4FUYA 4QT1A 2FO0A 3SAYA 5L6OA 1BI7A 5F1ZA 2W7XA 3NIZA 4F9YA 3B2WA 4J96A 3COHA 1REJA 4UMTA 1NT2A 2JD5A 4J71A 3O50A 2PPQA 4WUAA 4G5PA 4U79A 2QLQA 5BYZA 4RA4A 1PHKA 4U5JA 1AD5A 1NA7A 3QC9A 2WO6A 4EJNA 3BEAA 5KE0A 4A07A 3Q04A 4ALUA 4L43A 2YA9A 4HNFA 4IAYA 3V8TA 4EONA 4FMQA 2BAJA 3HGKA 3F5PA 3MVLA 4APCA 3PZEA 3SC1A 4X7QA 2XK7A 4DFZE 4JG8A 3UNJA 4TNBA 4WNPA 3F3UA 2CJMA 1UU7A 2JC6A 3EYHA 3SQQA 5DGZA 4AF3A 3NVMB 4JLCA 2PSQA 4FSQA 4KSPA 4XG9A 1P5EA 3OXIA 3BYVA 3QZHA 4R5YA 2YZLA 2B9HA 3W2RA 4OTFA 3FYKX 3HMNA 3FLQA 1CSNA 5K4JA 1H26A 2P33A 3F9NA 2P2HA 3CD8A 2E9VA 4QPAA 4J8MA 4IX5A 3WZJA 4I21A 2WELA 2HWOA 3K54A 3A61A 3QBNA 3LFFA 4QQCA 1OKZA 4WNOA 4C37A 4F7LA 5AA8A 5AUYA 3PJ1A 1PY5A 2W9ZB 3JY9A 4CFFA 5AV1A 1R0PA 5DT3A 5DI1A 4O0SA 1PXIA 2IJMA 2WB8A 4ZSLA 4D2WA 4KB8A 4JRNA 3ZUUA 1L8TA 1YOMA 2BRBA 3C13A 4UMQA 2IZRA 1YI3A 4DT8A 2R3NA 2YJRA 2VWIA 1LEWA 3DOGA 4RVKA 5EYDA 4G6LA 5AP6A 3SXFA 4CXAA 3PPZA 1V0PA 3ZDIA 2VX0A 5TR6A 1LEZA 1DAYA 1K3AA 2RFSA 4IZ5A 1F3MC 2I1MA 4BN1A 3AT3A 4S34A 2ITXA 2WTKC 3HP2A 3I7BA 2E9UA 2VO0A 4MNEA 4AZWA 3TXOA 4CMUA 3RZBA 4EOSA 5L8KA 1G8SA 2R3JA 1MRUA 4GFOA 3CE3A 1I44A 3ULZA 1JAMA 2XK3A 2ZDUA 4Q5HA 1ND4A 5IA1A 2OK1A 4MVFA 5IUIA 1OKWA 3PJ8A 2C0OA 3CTQA 4H39A 3KXGA 2CN5A 3HA6A 3Q52A 4TWOA 3A4OX 3LIJA 3F61A 1DI9A 2V22A 2X8EA 4BKYA 4DEBA 5TO8A 4F0GA 4YSJA 3VBWA 3QTUA 3SDJA 5CI7A 4M3QA 2OIBA 4MX9A 3NDMA 4O84A 4U45A 4R8QA 2UUEA 2VTLA 5ITAA 3SHEA 1PXLA 3PDTA 4DTBA 2VAGA 4EQUA 4NTSA 4WA9A 3VNTA 3ZFMA 4R3CA 4M14A 4CKRA 3BEGA 5L2SA 1GIHA 1W8CA 2HELA 3F88A 4K0YA 4NIFA 1FMKA 2HZ0A 3O2MA 2VNWA 4R7HA 4W4VA 4NL0A 4E6CA 3FI3A 4CV8A 2QU6A 3QCYA 4FIJA 4N6ZA 3PA5A 2J51A 2XK6A 3M11A 1OITA 3PLAE 4FKGA 4I0RA 5JFXA 4D9UA 3R1QA 4YZBA 4IAAA 3VS0A 3WF7A 3ZUTA 1NVRA 4M12A 1OL6A 3IOKA 4JBPA 2R0UA 4BDEA 4G16A 3PY1A 3COKA 4DLIA 3HV7A 3ZM9A 4D5KA 2VTMA 2XIKA 3BCEA 1H28A 5HLPA 3ZRKA 3FUPA 3IG7A 3P08A 3FY0A 2PVKA 4O1PA 2A0CX 2ZB0A 3OBJA 3QTSA 2JDSA 5CT7A 4YJSA 3SOAA 4YMJA 5KBRA 2UVYA 2VUWA 4OBQA 3GU7A 5E1EA 5EDQA 2QOIA 3SRVA 3G15A 3ENHA 5E8UA 4O7RA 2PYWA 5GHVA 2QR8A 3M2WA 2E9OA 3IW5A 3WE8A 4FIGA 2YCFA 4XG3A 2XNGA 3H0ZA 3PWYA 3RK5A 4HPTE 2QKRA 2WIPA 2I6LA 3TL8A 3ACKA 4MXCA 4P7EA 3PVUA 3GXLA 5EM5A 5AM7A 2OICA 3VBVA 3D5WA 2X8IA 4X2FA 4DEGA 3QQHA 3KB7A 2CKQA 5DT4A 5CEMA 3PP0A 2VWUA 4C61A 5HU3A 4DGNA 1UA2A 3FE3A 3BV3A 2Y0AA 2G1TA 4WNMA 1UNHA 4YZDA 3E8EA 1H1PA 3OOMA 4I4FA 4O21A 4UWYA 5C01A 1K9AA 2J0LA 4BBFA 2PUIA 4I94A 1OPLA 3GC8A 2EWAA 2ITVA 3NCZA 4WT6A 5DBXA 4DLJA 4EOLA 5IH6A 4MF0A 3IDPA 4LV5A 4M69B 3QLFA 3NR9A 3BLRA 4PPBA 3EZRA 4F6SA 4I5CA 2QLUA 2WU7A 4USEA 5HX6A 4HGLA 3V5TA 3HUCA 5IQBA 4QOXA 5DEYA 1A48A 1XH7A 4U44A 4L00A 3CBLA 3W1FA 3LQ3A 4O22A 3HP5A 3QQJA 1B39A 2OJIA 5IKWA 3QUEA 1XKKA 2RIOA 1NVSA 5IG1A 3JXWA 3EQFA 4PNIA 3MVHA 2B4SB 4AFJA 4RT7A 3MWUA 4RIWA 4U0IA 5IQAA 3EMGA 3HAMA 4ZS4A 2DUVA 2GTMA 5AP3A 4YHTA 3V8SA 5JQ5A 4IWOA 3RMFA 3S0OA 5I9ZA 4BCGA 4QMZA 2R0IA 4BY9E 3ZCLA 5HVKA 3DKOA 3QQLA 4XOZA 2QCSA 5C03A 3Q32A 2YACA 4KINA 2ERZE 3BPRA 1RJBA 4IAZA 3POZA 4IB5A 4BDIA 4ORKA 3BIZA 2QG7A 3O7LD 5M4UA 2OZAB 4IWQA 2C69A 4IBMA 4PDPA 4R5SA 3RPRA 5AV3A 3H10A 5KMIA 2RFNA 2VX3A 1Q99A 2OXYA 3MIAA 3BU3A 5M08A 1WVXA 5J5TA 4FE2A 4R7IA 3ALNA 3I7CA 4YJOA 4R1YA 3L9MA 4O2ZA 3MH2A 4F9BA 4L6QA 1A9UA 2BROA 3RHKA 4C4GA 2GQGA 3AT4A 4CTBA 3R2YA 5JRSA 1O6LA 4IADA 1OZ1A 5IH5A 3GUBA 4HVSA 1H1SA 3KXMA 3PVWA 3PIZA 3LJ2A 4WRSA 3DKCA 2YM3A 3TKUA 2B7AA 4U41A 5I3OA 4DEHA 4CRLA 4C35A 3R9DA 3V5WA 4NTTA 2BIKB 4IAIA 3ODYX 1F5QA 3MA6A 2WXVA 5AEPA 5JT2A 3VW6A 3I79A 4MNEB 3TG1A 3DBFA 3LHJA 1WCCA 4MBLA 4ANQA 5C27A 3G90X 1JKKA 4KKHA 3OW3A 1V0OA 3M1SA 3TWJA 4F1MA 3QZIA 4RLKA 1JSVA 1WBTA 2XB7A 3T9TA 1PYEA 5AR8A 4CZUA 5EKOA 2PE2A 4D4SA 1BLXA 4FI1A 3DBDA 4FK3A 5AUZA 3VUGA 3GEQA 5I9YA 1SVHA 3R1SA 5AP4A 4IMYA 4LQMA 3FZSA 2PVMA 3K5UA 4L01A 4X6QC 5BMSA 3MYGA 3LM0A 4MD9E 3BGZA 3H9RA 2CGWA 4AGDA 4X3JA 4RWKA 5CQWA 3AD5A 5E92A 4IDTA 1XH8A 1LUFA 2PL0A 3NLBA 2BDFA 3NNVA 4EBWA 4KKEA 4OLIA 2C5XA 2WAJA 3FZ1A 3G5DA 2SRCA 3NX8A 2ITWA 4MXAA 4RVTA 4UWBA 1YOJA 3AMYA 2QOLA 4YJUA 4QP7A 1QPDA 5LARA 5HVJA 3K3JA 4CZTA 4F4PA 1ZYLA 4I5PA 2QVSE 4BI1A 2XEYA 4DTAA 1NVQA 3DLZA 5H2UA 4C4EA 4F9CA 1UV5A 5HIEA 4DH7A 5HNIX 4MD8E 1IRKA 2Y9QA 1I09A 3NAXA 4FK6A 4G3CA 5LQFA 3MGYA 1UKHA 4XRJA 1YVJA 3ZO4A 3SKCA 3O71A 5AV0A 4BBMA 2BTSA 3FXXA 5J1WA 4AU8A 2R3OA 3MH0A 4AXAA 4TL0A 4QQ5A 4IX4A 5FM2A 3R7EA 3IS5A 4DE4A 4HYHA 4CFXA 4P4CA 4RIXA 3GGFA 2XF0A 4W9XA 5E4HA 2RFEA 2VWWA 2IZSA 3BU5A 2H9VA 4IVBA 4E1ZA 2C3JA 1GIJA 2RF9A 2X7OA 2IVSA 1JNKA 2YM5A 3LFNA 4YNOA 3ZFYA 4I6HA 4OGRA 3VHKA 4CRSA 2CCHA 3FKLA 4FR4A 3VJOA 1HCKA 2NO3A 1G5SA 4FL2A 2HY81 4MQ2A 1HOWA 3BU6A 5T6KA 3NUAA 4PDYA 4J8NA 2VTPA 2WD1A 4L7SA 4YNEA 3Q53A 3GU5A 1OECA 3EL7A 1M14A 3UIMA 5HLNA 4FT5A 4M67A 4TYHB 5DEWA 3V04A 3UNKA 4EJ7A 3W16A 3FKNA 2WOUA 2V7OA 4WRGA 4H36A 4JAIA 2WEIA 1M7QA 3HDNA 4IIRA 5KUPA 4GUBA 4XHKB 3ZXTA 4TNDA 4HVIA 3WYXA 4IACA 4XS2A 3VS7A 5EK7A 3GFWA 5HIBA 4YPDA 4QMUA 4BTFA 3UZRA 3QQFA 2JDOA 4UYAA 4OTIA 5JZJA 4FNXA 4PPCA 5J9ZA 3OROA 2P3GX 2IN6A 1KV1A 3P1AA 4YLLA 5HE0A 3RAWA 3VS6A 1GZ8A 3W55A 4QMSA 2HW6A 3KK8A 4F7NA 2FVDA 4FVRA 4APPA 2OWBA 3H9FA 2I0EA 3G2FA 5J87A 3UDBA 3QU0A 3DCVA 4WKQA 3UC3A 3FLNC 2R7IA 5HOAA 3UZPA 2JGZA 3FZTA 2VTAA 4ZTQA 1PXPA 2E2BA 3SD0A 1YOLA 3ZO1A 5JQ8A 2B53A 4UXQA 3A99A 3S95A 3QTIA 5CEOA 4EWHA 2Y8OA 1STCE 2VO7A 3G6GA 4I6BA 3NAYA 4IB0A 4QNAA 3TI1A 2IZUA 2UZWE 2XK9A 3EQDA 5ANGA 2CLXA 3VQHA 4BWPA 3W18A 3B8RA 5EQPA 4EK4A 1P4FA 4RIWB 3FBVA 2HCKA 4JR7A 1WMKA 4D4VA 4E5WA 4EYJA 5CAOA 2NP8A 5CI6A 4AWIA 2F7EE 3JYAA 2J7TA 4I0SA 2BAKA 1VJYA 2P55A 4YLKA 5HU9A 1OKVA 3R1NA 4BDHA 4BHNA 3BQRA 4IQ6A 4QMQA 2X7FA 2CKOA 3KXXA 2GMXA 4FG9A 3CIKA 3BBWA 2ITNA 2WPAA 3D83A 4XLVA 1Y91A 3R7OA 5AM6A 4FIEA 4RPVA 4YZMA 3CR0A 4GYIA 4PL3A 5BYYA 4G3EA 1ZYCA 3JS2A 2XMYA 3I6UA 1KE9A 4EH8A 3BRBA 5LVNA 3L9LA 3ENMA 5LVLA 4O7TA 4BCKA 1BKXA 4B99A 3G33A 3MY1A 4HPUE 4GJ3A 4IAKA 2J0IA 4GRBA 3D7TA 1KE5A 4FNYA 5FDXA 2JEDA 2OW3A 4KUJA 3ET7A 3G9NA 3HX4A 4M66A 3ZO3A 5C8KA 3EL8A 3DB6A 4JRVA 2O64A 3HZTA 1FOTA 2HZNA 4A7CA 2OFVA 4IHPA 3EKKA 3TNWA 2PVRA 3HMOA 3VIDA 2BVAA 2X9EA 1LP4A 2W1EA 1SMHA 3TJCA 4EZ7A 1B38A 3W2SA 1RDQE 2XJ2A 3PSCA 4NFMA 4QYHA 4IFCA 5EDRA 4F9WA 4QTDA 1KSWA 2X4FA 2C5NA 4O7ZA 4ZMEA 1VEBA 1VYWA 3NUNA 1U54A 3DV3A 1M2PA 4QTBA 2BKZA 3C4FA 3DY7A 1J1BA 4ACDA 4D5HA 4ZTMA 2EB2A 3A7FA 5CNNA 4DAWA 4ASXA 2OJ9A 4RX5A 4EORA 4HVHA 4IJ9A 4O0UA 1QL6A 3MV5A 5LVOA 3RTPA 4ZLYA 5G1XA 3OF0A 3QCXA 3EIDA 4IC8A 5IA5A 3QWKA 5CSWA 1P14A 4XOYA 4FT3A 4TT7A 2F2CB 5JN2A 3ETAA 4DGLC 4L8MA 2VRXA 5A6OA 3UYSA 5BUJA 2GNJA 5IPJA 2WOTA 1PW2A 3HRFA 2OF2A 4I6QA 3R02A 5C8NA 5E7RA 3FMEA 4F6WA 4C4FA 3UPZA 1U5QA 5FWKK 2IG7A 3R28A 2YM6A 2YITA 1XH6A 4JJRA 1UNLA 5T3QA 3QYWA 5IQHA 1MQ4A 4O91A 5BVOA 4C38A 2GNHA 3DGKA 4EZ3A 5KMKA 3E7OA 3DDQA 4FKTA 3IKAA 3CC6A 3Q4CA 3VRYA 4DGOA 4TW9A 3EQCA 3HMPA 3VN9A 4O81A 1XH4A 2VU3A 1KE6A 3CKXA 4G31A 4AZEA 3DQXA 4GL9A 4EQMA 2BAQA 4RJ6A 4M84A 2HIWA 3NMUF 3E62A 1ZZLA 1IASA 3E8DA 4FT9A 5IDPA 2QD9A 4X3FC 4D2RA 3EQHA 3LZBA 2GFCA 3QL8A 1ZYSA 4II5A 4CFMA 2E9NA 3BYMA 2BRNA 2OI4X 4HCTA 4MXYA 2B1PA 4FKPA 4EOOA 3ZLSA 5J5SA 3JPVA 4AW2A 4BDCA 4BKJA 2EXEA 5HLWA 1R1WA 4AX8A 4DA5A 3SGCA 2XIZA 3FC1X 1AQ1A 5CEIA 4YTIA 3UOKA 1BMKA 1XO2B 3MSSA 3FQHA 3DDPA 4U43A 1M2RA 4XG4A 3ATTA 3QRJA 3WZEA 3RAKA 1HCLA 1ERKA 5L2QA 3ANRA 4CZYB 2FSLX 4NKAA 1OM1A 3S4QA 3OS3A 5HBJA 3BI6A 4AW1A 3DK3A 2WMUA 2X1NA 3KK9A 3PY3A 1W82A 3WILA 1PMUA 2UZOA 1PJKA 1IG1A 2W5BA 3ZDUA 4C2VA 2XYNA 2CNUA 4FTRA 2WMQA 3EFKA 3IONA 5H8EA 2OIDA 5FQDC 2G01A 2R3PA 2JDTA 2X8DA 1GOLA 1Q3WA 3AC3A 5FXQA 4FTJA 4HCVA 4ENXA 4XP3A 5GZAA 4A9UA 1YQJA 2ITYA 3GB2A 4LGHA 3Q9WA 3ZFXA 4FEUA 1Q97A 3L8VA 4ID7A 1QPEA 5IH4A 2C6EA 3CJGA 5DRBA 3DXQA 4IX6A 2B52A 4OTRA 2A19B 2UVZA 1MRVA 2ONLC 4FKLA 4HNIA 4Y46A 5BPYA 4KRCA 5IA3A 3NUPA 4FTQA 4NWMA 3BV2A 1R78A 2F57A 3I0QA 3TV7A 2XM8A 3W8QA 4BRXA 4IWDA 5E8VA 5AR4A 5C9CA 3FL4A 4HVDA 2BKKA 2KULA 3LFAA 2YJSA 2PU8A 2C3LA 4OT5A 5DR9A 1Q8WA 4W4XA 5FXRA 1W84A 5HG5A 3IQ7A 5D11A 4AZSA 5LOHA 5EQYA 2HK5A 2WKMA 4JDJA 4YBKA 2OG8A 2ITZA 3OG7A 4F6UA 5JFVA 3NS9A 4J98A 2CPKE 4KBAA 4B4LA 4JBQA 2H8HA 3E87A 1YXVA 3BHHA 1WZYA 2R3IA 3SV0A 5B7VA 5IEVA 4KIKA 4QMOA 1YXSA 3OTVA 2YIXA 1WVYA 3KA0A 4GW8A 2WTVA 4IVCA 4EHZA 2H6DA 1FVTA 3MA3A 5B2LA 3G9LX 3OP5A 2WMBA 4RJ4A 3T8OA 3MTFA 3IW7A 4LUEA 3AC5A 4BB4A 2EVAA 4CEGA 1FVRA 3HYHA 3PE1A 4UEUA 2QODA 3G6HA 3KC3A 3Q2MA 5FTQA 4FVPA 5HTIA 3MVMA 2I40A 2R3LA 3IO7A 3L1SA 4FTTA 3GOKA 4MEDA 3KRXA 5A6NA 4AZTA 1Q8ZA 4F08A 2W1FA 4YHFA 5D10A 5CYIA 2JIUA 3UG1A 4OBOA 3PRIA 3ORMA 1H25A 4M15A 3O23A 3CEKA 3II5A 4L3JA 4BWXA 3R30A 4F1TA 2V5QA 3MN3A 1T45A 4IJPA 5DYJA 4IE9A 5LMKC 3OTUA 5HORA 2ZV7A 3FI2A 1UU3A 4RX8A 1E1VA 3GC0A 3R04A 3D7TB 2BUJA 3WF9A 5JGAA 3EQGA 3M42A 4G17A 4K33A 4ZSEA 1PMNA 5E9EA 3VRZA 5AUTA 5K3YA 3OOGA 4EH7A 3DJ5A 4V0GA 5AWMA 2ZAZA 3A8XA 2JFMA 3HVCA 3NSZA 5AUXA 4BCMA 4S33A 4BTMA 4M0ZA 5FG8A 5AP7A 4GK2A 5CU4A 1XBBA 4RZWA 2ZV2A 4JR3A 3OCGA 3TKHA 4MXZA 3HV3A 2OIQA 2YHVA 3CLYA 3AGMA 1U54B 3GC7A 4FYNA 5M55A 3HKOA 2FH9A 1H8FA 2BHEA 1F0QA 4DYMA 3PJ3A 5DPVA 4DEIA 4EBVA 1J1CA 2PZRA 2FGIA 2WMTA 3P23A 5BYLA 4ASZA 2FB8A 3EH9A 5DIAA 2R3MA 3MESA 5E8XA 1PMEA 2R3HA 2G15A 5HG8A 3PSBA 2PZYA 4X2NA 4PUZA 3QYZA 5GNKA 3IDBA 3W2OA 3CTJA 1Q62A 2PMLX 2HY0A 3PXYA 2Y4IC 4O6LA 5J7HA 5GIPE 3MH3A 4WO5A 2QO9A 3PSDA 4RWIA 3NW5A 2QKWB 3N51A 3RK9A 4YC3A 3U54A 1M17A 3MFRA 3EZVA 3T9IA 3BX5A 5CT0A 3NWWA 4FIIA 3D5VA 4YHJA 3RALA 4AZFA 1V0BA 4L52A 3U51A 4DGGA 2GQRA 2W5AA 5AADA 4Y5QA 3C50A 5M4FA 4OTHA 2F7XE 4D9TA 4O2PA 2W0JA 4QO9A 4O0RA 5CQUA 3GNIB 4OTQA 4PMTA 4D55A 3HMMA 4QYGA 2ITOA 3KRRA 3QX4A 4C58A 4M13A 3F5XA 1OBGA 1ZY4A 3R8LA 3B8QA 4G6NA 4LM5A 5CZHA 2YAKA 4TWNA 4DEDA 2NNWB 4Q9ZA 3KRWA 3QD4A 3IW4A 2WMXA 3PE2A 4O0XA 5EW3A 2Y6OA 4BCFA 4BWKA 5HX8A 4LGDA 1Q4LA 3A4PA 2W1HA 1JOWB 2ITQA 4XG2A 3I4BA 4JT3A 3TDVA 1YI6A 5FM3A 5DR6A 3ORXA 2ZM3A 4YJRA 4AZVA 2Q83A 4BIBA 3U6HA 3R00A 3KCKA 3UP7A 1W0XC 3QRTA 4EH3A 4TWPA 5TE0A 5TF9A 2IW8A 4XP2A 4B9DA 5BVWA 1TKIA 3FKOA 3QZGA 4GT4A 2YDKA 2W1IA 4Z7GA 3K3IA 3DBEA 4CD0A 1YXXA 2ETRA 2QOCA 3D9VA 3F6XA 3AD4A 3PXRA 3NYVA 4FTIA 2R3QA 4G9CA 2VTIA 4MBJA 2CCIA 3SW4A 4PPAA 4ANSA 2JKKA 4XJ0A 4G9RA 4C3RA 5IA4A 2RSVA 5L4QA 1OVEA 3RI1A 1U46A 3VAPA 1MQBA 2PMNX 3DFAA 3GBZA 5HESA 4WNKA 3QQUA 4KD1A 5L2TA 4R3RA 4NCTC 4G3GA 3VUIA 3EHAA 2GHMA 3R8ZA 1FVVA 3RM6A 3SXRA 2V55A 2JKMA 5F9EA 3CJFA 3P4KA 1M52A 3BYSA 3THBA 2XA4A 3P79A 3UJGA 4E4LA 5M4IA 1ZMVA 4IFGA 3W10A 3O8PA 4QTCA 3TEIA 4ANBA 4E26A 4D2SA 4O82A 2R2PA 4CG8A 1FINA 3BHYA 3QQGA 3QUDA 3H3CA 4EHVA 3MBLA 4GS6A 4DH1A 5K4IA 3U6IA 2C5VA 3C4EA 3FI4A 1QPJA 2UW8A 3V6RA 3MB6A 2BRHA 4QP4A 4PF4A 4ACHA 3LMIA 4ZTHA 5DWRA 3E63A 3CQEA 2XVDA 4U97A 5HVYA 4BDKA 4L3PA 1R0EA 1DI8A 5HTBA 5K0XA 2GNFA 2WEVA 4CT2A 1ZYJA 3LQ5A 3LLTA 5D9HA 4C33A 2W1CA 4GUEA 4JVGA 4DFNA 4BCNA 1Q5KA 2XNEA 3KXNA 4R1VA 4XBUA 2QU5A 3UG2A 5M57A 4NYEA 4NU1A 4Y8DA 3RPYA 3DK6A 4OAUC 3UOHA 2IW6A 1IA9A 2XH5A 3UTOA 4FTNA 4RZVA 4UYNA 2VNYA 4FTAA 5DG5A 5L6PA 3CD3A 3LFSA 4DT9A 5M53A 2IW9A 4F7JA 2JBPA 4GIIA 4AA0A 2Q0NA 2VGPA 3FYJX 4E3CA 2HWPA 3NCGA 3QCSA 4NW6A 1SNXA 4KS8A 1YHSA 5CF8A 3A8WA 4R78A 4DBNA 4O0TA 4JBVA 3ZLXA 2ACXA 2JAMA 5FDPA 2ZVAA 2PUNA 2XEZA 1R3CA 3R8VA 1GZOA 1UWJA 4NFNA 2PMIA 3TV6A 5IQFA 2EUFB 3DZOA 3FLWA 5CSPA 3ZRLA 4RVLA 3UOJA 1KV2A 2A27A 2AUHA 2P4IA 3P7BA 4JOAA 4O83A 2OZOA 5BMMA 5AUWA 2UZEA 3LPBA 4QMWA 4Y72A 1GZKA 2IPXA 4HGEA 3TZ7A 5AAFA 3A62A 4EK3A 3QQKA 2CKEA 2IVVA 2C6TA 3ORTA 2UW3A 3HNGA 3ZU7A 3FMHA 4DFYA 3FPMA 1OB3A 4ZZOA 4DH5A 3P5KA 4KBCA 3ZBFA 3R2BA 4FEQA 5BVDA 4IZYA 1OUKA 3R9NA 5JH6A 5GJDA 3S2PA 3EN5A 3OMVA 3MI9A 3LCTA 2A1AB 3OT3A 1WFCA 4FZ7A 4RG0A 3VBQA 3CSVA 3TCPA 4EOKA 3F3ZA 3H9OA 3PJCA 4FBXA 4HW7A 5DMZA 2HZ4A 3UP2A 3I5NA 4FSRA 5LVPA 3DAEA 3D5UA 4MWHA 5TKDA 4QYEA 4ASDA 1NW1A 3LFQA 4RIOA 2WNTA 2Z7SA 3ROCA 4DITA 1Q24A 4OW8A 2X7GA 3NNWA 1OI9A 4JBOA 4JDKA 5H9BA 4YJQA 1YI4A 2NPQA 4O86A 3FMJA 2YLFA 4NW5A 1YWVA 2GHGA 4QP6A 4YLJA 1SYKA 3ODZX 3QRIA 4GG7A 4BCOA 3TJDA 2XIRA 3VBTA 3NUYA 5EW9A 3ZM4A 4YURA 3I60A 3FLSA 3GU8A 5D1JA 4NM7A 1A06A 5IDNA 5HKMA 5IQCA 2VTTA 5JGBA 1Y57A 3P78A 2ZOQA 4O1OA 2VWVA 3E92A 3GP0A 4TYGA 4WG5A 4IZ7A 4DFXE 2CMWA 5HBEA 3N4UA 3E3PA 4AT3A 5AIKA 3E5AA 5FD2A 4FV9A 4E5BA 4FA2A 4WBBB 2WGJA 5JZNA 4ACMA 1BL6A 1OPKA 1T46A 4CMOA 4TWCA 3F3TA 5DH3A 3ZLYA 5KHWA 2CN8A 3MW1A 4NJDA 3FSFA 2YCSA 2F9GA 2VTSA 5HE1A 4RJ8A 5KZIA 4DN5A 2PE0A 1FPUA 1EH4A 3MPAA 4JDIA 1SVGA 5KKRC 1JSTA 2PTKA 5CU3A 3W2PA 4UB7A 4AGWA 3W8LA 3COMA 4CQEA 4JQ8A 2HAKA 4EC8A 4N6YA 3FPQA 4EOMA 3DZQA 5DLSA 3G0EA 2V62A 5F94A 5M06A 3MS9A 4FEWA 1X8BA 4R6VA 1L3RE 1JQHA 3GCSA 3QFVA 2VX1A 3DU8A 1ZWSA 2O0UA 3GQIA 3RVGA 2FA2A 3RP9A 4FL3A 4CG9A 5K0KA 2YCQA 3R01A 1SNUA 3SG9A 2VTNA 4ZJVA 2OSCA 4U3ZA 4UXLA 3D2IA 3V3VA 4FG8A 4YTHA 4IAFA 4CCUA 3R8UA 5LJJA 5FXSA 5D7AA 3V5LA 3FV8A 4HVGA 4BHZA 1J91A 5B2KA 1IAHA 5A4TA 5BUIA 3ZO2A 5AP0A 3ZUVA 2DS1A 2REIA 1OUYA 3BLHA 4M0YA 1U59A 3BLQA 2JFLA 3F66A 4Q5EA 4X0MA 4MCVA 3TZ8A 4B7TA 4NIFB 2Z7LA 4LMUA 4UWCA 2ONLA 1H4LA 4LG4A 2BDJA 3C51A 4IX3A 4OAVB 3D0EA 4MAOA 5IA2A 4N0SA 5I9XA 3R6XA 3L9NA 3EJ1A 4KIQA 3F82A 3WZDA 4WSYA 4AGCA 2QONA 3UIUA 4YC8A 4I92A 4ACGA 3TTIA 3OHTA 2X9FA 3TNHA 3KVXA 3F3VA 4HCUA 4OR5A 5EYMA 1B6CB 2ZJWA 3MY0A 2O3PA 4YU2A 1PRYA 4EL9A 4DG2E 4FKVA 4MK0A 2FUMA 5IMEA 3TM0A 3UIXA 4UV0A 2YM7A 2VWYA 4EOQA 2XKEA 3IECA 3IK3A 4GMYA 4UX9A 3ZEPA 3SRVB 2BPMA 4YJTA 4E8AA 1O6KA 4FODA 4PMMA 5FBNC 4KWPA 4A06A 3C0HA 4BVUA 3C9WA 1P2AA 2X2KA 5JKGA 4O7VA 4D58A 3PPKA 2YM4A 4LYNA 4EK5A 4QP1A 2CHLA 2JKQA 2G2HA 3R22A 4RQVA 5ETIA 4ZAUA 4R7BA 3PA4A 1CTPE 4ERWA 5LCJA 4CCBA 2I0VA 1H01A 5ANOA 1QCFA 4O27B 3UVQA 3V01A 3MFTA 5M51A 2UV2A 4IWPA 3ORNA 5HO6A 4YGAA 2R5TA 4JIAA 4IVAA 3LFDA 5AFVA 2XK4A 4FV2A 1OL2A 3U6JA 5LMKA 2PK9A 5EDPA 1KWPA 2WTIA 5CLPA 5CU0A 3E8NA 4H3PA 3OWKA 3KGAA 3ORIA 3ZRMA 2W5HA 3ATSA 4CFVA 3C0GA 3QTZA 5EM8A 2R4BA 5IUGA 4G3FA 3UO4A 1XQZA 4F63A 4FKRA 3FMNA 3PPJA 5IU2A 1KOBA 5GJGA 3C4XA 4YP8A 3UVPA 2GNGA 4AN9A 2QO7A 2CLQA 5KZ0A 3LJ1A 2PY3A 1XH5A 3VWAA 4ARKA 4CFWA 3QUPA 4RSSA 2CGXA 4FKIA 2B9FA 5CY3A 3T3UA 4BDJA 4DEAA 4J7BA 3C5IA 1U4DA 5GJFA 2GDOA 4JX7A 4J1RA 4FIHA 3KF7A 4YZCA 1XR1A 3OD6X 1OPJA 4QTEA 2BZJA 2XJ0A 1TQIA 3DS6A 3QTXA 2YEXA 3KULA 4FICA 2RG6A 4IDVA 4PDSA 4PTGA 4YSMA 4S32A 4ZTLA 4E93A 3A7JA 3ORKA 4NH1A 5KO1A 2F4JA 5DN3A 2OLCA 3BELA 4U40A 3O8UA 2VTHA 1IA8A 3AC1A 4RIYA 4BDGA 1Y8GA 5CAVA 1UKIA 5CS6A 4HGSA 1APME 4F0FA 4W8DA 3VS4A 5AX3A 3BYUA 3FZOA 4GH2A 3KMUA 3HUBA 4X2GA 4Q9SA 1RQQA 2C6MA 2IO6A 4L67A 4C02A 4C8BA 2PZIA 1OKYA 3S00A 1VZOA 3O96A 3DTCA 4ZSAA 3RM7A 4FSYA 3VUKA 4ONAA 4A9YA 2C6LA 2OJJA 4JAJA 1Q3DA 3I0OA 5AJQA 4ASEA 1TQPA 5BNJA 1H00A 4NM5A 2QI8A 2QG5A 3SA0A 1ZY5A 2J9MA 4HYUA 4BCHA 4RJ5A 3KCFA 5JGDA 3NYOA 4GU9A 3HMIA 4IEBA 5CAPA 3KXZA 4U7ZA 4RGJA 4FSZA 2XYUA 2GTNA 4TYJA 1QMZA 4IM3A 5H8BA 5HTCA 4B8LA 1WBVA 4WIHA 2W99B 4JL9A 4XRLA 3ZC5A 5A4EA 1M7NA 3BQCA 4ZP5A 4DG3E 1ZMUA 3JR1A 3D5XA 4EOJA 4GSBA 2IZTA 1OGUA 4FSNA 4CV9A 3PYYA 3LM5A 1Y6AA 4Z16A 5JRQA 4XG6A 4PX6A 4PTEA 5J1VA 2RKUA 3RNYA 3IGOA 5EI2A 5CEQA 4MNFA 3S1HA 4LOOA 2PVHA 2XNBA 3H30A 2WMVA 4HYIA 4KSQA 4AACA 3OZ6A 4TY1A 4CKJA 5FTGA 4JG7A 1OMWA 4O0YA 4YZ9A 1J3HA 2GS6A 3ZLWA 1UWHA
chains in the Genus database with same CATH superfamily
3LLAA 1XWSA 4XV9A 2YWPA 3O7LB 4TRLA 5M44A 4BBEA 2JDVA 5E8SA 3RCJA 2GHLA 1W83A 3DAJA 4GFGA 4Y83A 4ZZMA 4PMPA 2E9PA 4L44A 3WIKA 5ANDA 1YRPA 4RJ7A 3CTHA 3QALE 4XBRA 4D4RA 5ANJA 3JVSA 2WHBA 4E6QA 5CXZA 4NCTA 1E9HA 3PFQA 3POOA 4QQJA 4AE9A 1KE8A 2PVFA 4YR8A 3HV6A 3LCKA 3JVRA 3LVPA 3FMLA 4K1BA 3C0IA 4WUNA 2RL5A 3UQGA 3WI6A 4DHFA 3FMKA 4ZIMA 5JFWA 4O7NA 3R73A 3ZZWA 3A60A 2XBJA 1YW2A 3BGPA 3CPCA 3PUPA 4K8AA 4MHAA 4UMPA 2VV9A 2VWZA 4FKOA 2PWLA 4FV4A 4PRJA 3R7VA 4FEXA 4IM0A 3PY0A 5CNOA 4K2RA 2VWBA 5D41A 4PV0A 1UVRA 3BHVA 3DXNA 4RQKA 3Q9XA 3D2KA 2YIWA 4IXPA 2P0CA 5HO8A 2WQNA 4CYIA 3QRUA 2R64A 3L8XA 4LRMA 3PXZA 2W4KA 3NUXA 4K9YA 2QHMA 4FV6A 4W4YA 2OO8X 4GCJA 4AA4A 3RKBA 4XX9A 4H58A 4HOKA 3AOXA 4GEOA 4BYIA 3ELJA 4KIOA 3Q6WA 2QOKA 3QTQA 3W33A 2GU8A 5E8YA 4L53A 3AT2A 5D12A 2WU6A 1URCA 3OBGA 2UZNA 2HW7A 1P4OA 4IM2A 3UMWA 2XAMA 4I3ZA 4RIXB 1ZLTA 3VS2A 4LOQA 4HJOA 3F69A 3C4WA 4KRDA 1DM2A 1O6YA 2JLDA 4G34A 3ZTXA 4Z3VA 2YABA 4Z55A 5FUTA 1PXKA 3EQIA 4FZ6A 3NGAA 1XH9A 1GIIA 3TNQB 3KMMA 2W96B 4O7YA 3LMGA 3PJ2A 3UQFA 4PP9A 5A54A 2PUPA 5LVMA 1VR2A 1ZXEA 3A7GA 2EXMA 3F2NA 4FSUA 4YO6A 3VUMA 2WTJA 3U87A 5K5NA 4DCAA 4XG8A 4XLIA 4C2WA 4EUTA 3UODA 3CPBA 4E4NA 4L45A 4EH6A 5E8ZA 2X39A 3GVUA 1MP8A 4QMMA 3WF5A 4L7FA 3FEGA 3U8WA 3IW8A 5CF5A 3VVHA 4BIEA 2XK8A 4U3YA 3K5VA 3L9PA 2B54A 5EM6A 4JQEA 1OBDA 3BKBA 4JNWA 5HCXA 3ZSGA 2YISA 4EKLA 5AV4A 5HHWA 1FQ1B 4NM0A 3RAHA 2GSFA 2FSTX 3WE4A 4GG5A 4F0IA 3KN5A 4HYSA 5HCYA 4FC0A 4W9WA 4UBAA 3OXTA 2BALA 3RINA 3MJ1A 3N4TA 1PKDA 3R7UA 4ALVA 3MPMA 2UZLA 5GIOE 3NIEA 5EW8A 2X4ZA 4USDA 3FJQE 3CP9A 5JFSA 3FI8A 4EK6A 3OW4A 2HXLA 2VO6A 4RX9A 4USFA 5T68A 1GY3A 3PVBA 5AR5A 1SM2A 4EH5A 5AAGA 4BCPA 2WMSA 3SLSA 1NY3A 4C3PA 3SG8A 2B9JA 3EN7A 4L68A 5EI8A 3VC4A 4PDOA 4GK3A 1GZNA 3KULB 3RHXA 2WTWA 3LMHA 1IAJA 3KKVA 2XZSA 2GNIA 3RJCA 1FGKA 1PXNA 1WBOA 3LXLA 4GIHA 4H1MA 3PXQA 4IZAA 4EHEA 4RIYB 5CAQA 4E4XA 3V5JA 4EWQA 3HRCA 2XIXA 4NEUA 1H27A 2GFSA 2UW0A 1TVOA 2BZKB 3NW7A 4Q2AA 4RFYA 3U4WA 4EKKA 4MH7A 5CASA 4FGBA 5AP2A 4BL1A 3ZXZA 3WZKA 2O8YA 4ZY6A 5JMSA 4ZSJA 3OUKA 3DKFA 4X2JA 1IEPA 4FZAB 4LFIA 3QGWA 5I9UA 4A4OA 4C0TA 5LWMA 3DPKA 4QP2A 4AXEA 1ZOGA 5F4NA 5L3AA 2W4JA 3NVKI 4FL1A 2OH0E 4EH9A 2XRWA 4IC7A 3RAIA 3IW6A 3KN6A 1CKJA 3NNXA 3DB8A 4ITIA 2RGPA 4K11A 4GK4A 5J8IA 4CNHA 2YERA 3QKMA 4OBPA 5EI6A 4LMNA 1URWA 4AN2A 3OY1A 3KL8A 4DH8A 3UVRA 5CF6A 5J95A 5M56A 4A4XA 1NXKA 2X6EA 2WTKB 2XKDA 5ETFA 2W1DA 3OVVA 3VBYA 4NSTA 2CKPA 3R71A 4D4YA 2BDWA 4FYOA 1UNGA 2BMCA 3IGGA 4IW0A 4LI5A 3TZMA 2YIQA 2WFYA 3DK7A 3FZPA 5IF1A 1WBNA 2B55A 3F3WA 5IZFA 5AMNA 2V7AA 4WBOA 2J50A 5TOZA 5DT0A 4BZOA 1PXOA 5C1QB 5CENA 4OTWA 2OBJA 5FEDA 2UW4A 2BTRA 2V0DA 5BVEA 1MUOA 3JY0A 3WIGA 4M69A 4ANLA 4BGGA 4D1SA 2G2FA 2ITTA 4RVMA 3HV5A 5K5XA 3QD2B 5KCVA 3Q4ZA 1J7LA 4H1JA 5FRIA 4NZWB 2H34A 5EH0A 5B0XA 3TUBA 1WBWA 3FLYA 2QOHA 2CNVA 3PLSA 3QA8A 4XV1A 3FSKA 4QEBA 3GCVA 4PWNA 4AOTA 4LV8A 4BZNA 3PIXA 5FP6A 2DQ7X 3KMWA 2J2IB 2YFXA 3IPHA 4NM3A 1ATPE 1XHAA 4M7IA 5DVRA 2VD5A 5DE2A 2EB3A 3QXPA 4UMUA 5CSHA 3QA0A 2W4OA 4RA5A 3VW8A 2ZYBA 4KA3A 1R39A 3TUCA 4PTCA 3WF8A 4EI4A 2XNOA 3NNUA 3RPOA 3MJ2A 4EEVA 2PUUA 5J7BA 2BILB 4BIDA 4AT5A 4MXOA 4YUQA 5F20A 1PKGA 3I5ZA 3L8SA 3F5UA 3OY3A 5DOSA 3MB7A 3V51A 4YTFA 3W32A 2J0JA 2UZUE 3HDMA 5AV2A 3WOWA 2CNQA 4R77A 4ZJIA 2ZMDA 3BWFA 3LCDA 3QX2A 4PL5A 2OZAA 5IISA 1ZAOA 3CKWA 4GV1A 4MXXA 3WZUA 4C34A 5L8LA 3C1XA 4EHGA 4E4MA 3K2LA 4O7WA 3O51A 4IVDA 4JS8A 1H0WA 5HBHA 4QDVA 4TYEA 1OL1A 1PXMA 2OF4A 4AUAA 4PNKA 2RG5A 2AC3A 4I93A 2ITUA 3QCQA 3NYNA 5IMXA 4YO4A 2WQEA 2NRUA 5AUUA 2YN8A 3HRBA 3EQRA 4I6FA 5CSXA 4F9AA 5A4QA 4ZOGA 3EQPA 2JKOA 2YDIA 2KTYA 2QC6A 3MVJA 3MTLA 3LW0A 4MYGA 3TZ9A 5BUEA 1XJDA 2OU7A 3SXSA 1PXJA 5KMNA 3ID6C 2W1ZA 2XIYA 3O0GA 3BZ3A 1V1KA 3ZS5A 3CS9A 4TKSA 4B6LA 2YAAA 3RPVA 4AS0A 4F7SA 1GNGA 3TDWA 3MY5A 2C1BA 2Y7JA 4FNZA 4YZNA 3FMMA 4KBKA 2LAVA 3MIYA 3EN6A 2UZDA 3OEFX 5HEZA 4QQTA 5BVNA 1ZMWA 5C4LA 4JI9A 5EHOA 2WQOA 4S2ZA 3AGLA 4M97A 3REPA 5F95A 1UU8A 2XJ1A 3ZH8A 4XUFA 5IQIA 4JQ7A 4LGGA 3LE6A 4LRJA 4FTCA 5EQEA 4KIPA 2IEWA 1U5RA 4BI0A 4QMYA 3JUHA 4OUCA 3ZEWA 3VUTA 4UZDA 4D1XA 4KAOA 5IQGA 2HOGA 4DBXA 4J99A 4ZK5A 3FMDA 4H3BA 3VONA 2W9FB 1ZYDA 4O38A 4OT6A 5CU6A 3ORPA 4EZ5A 4O0VA 2RFDA 1BX6A 4FZFB 3HV4A 2BRMA 2C6KA 4AOJA 4ZY5A 2DWBA 4XYFA 2UZVA 5CU2A 2C5YA 3FXZA 2QURA 3FY2A 4EK8A 4DFBA 2Q0BA 3VF9A 2OFUA 2UZTA 4O4CA 5LWNA 4BDBA 1ZZ2A 2XP2A 3QTWA 1Q8YA 4ZZNA 2PVJA 2XBAA 3R1YA 4IANA 3OWLA 4FNWA 3RZFA 4E7WA 4UMRA 5AR2A 5FP5A 2Z8CA 3FC2A 4G6OA 4ZJJA 4P2KA 2PMOX 2QOOA 3I6WA 3SVVA 3NW6A 3PVGA 4KABA 4C4IA 5IQEA 3C4CA 4G2FA 3EN9A 4ITJA 1ZOEA 4GJ2A 4BFMA 4CLJA 1XBAA 1JLUE 4F1OA 2I7QA 4AAAA 3O17A 3PG1A 4TXCA 3LFCA 5KMOA 1W7HA 5AR7A 2HYYA 4KIKB 3ZOSA 3QKLA 4G5JA 5C8MA 4BKZA 3U4UA 4O7LA 1DAWA 4FSWA 3TYKA 1YWRA 3HL7A 2W1GA 5A4CA 2QQ7A 3T3VA 2PULA 1G3NA 2VWXA 3TNIA 4QMXA 4GVJA 3PIYA 5ANEA 3PTGA 4W4WA 3SW7A 3KIOC 4A9SA 3DJ7A 3EWHA 2O65A 3Q4UA 2C0IA 4K18A 2O2UA 2XCKA 4D2VA 5ANIA 3COIA 4BCQA 1O9UA 3BWJA 4AFEA 3FQSA 3OUNB 4NUSA 3WARA 3R8MA 5CWZA 4ANMA 1YDSE 2G2IA 1Q8TA 2BRGA 2J5EA 3FLZA 3QXOA 2JITA 2VGOA 2BFYA 3HA8A 3LQ8A 5EG3A 5FTOA 4AW0A 2I0HA 3UO5A 4S31A 3SOCA 3CY2A 1G8KA 4WG4A 1H1WA 2IVTA 2PVNA 4M8TA 4TYHA 2GPHA 4Y95A 5HE3A 3AD6A 4GU6A 3E88A 4GKIA 2PZ5A 4A9RA 4FKWA 2NRYA 5KKRB 5CVHA 4RFMA 4U9AA 5HD7A 1OIRA 2BZHB 2FSOX 2W06A 3AXWA 3F7WA 5AR3A 3V5QA 3B2TA 4A4LA 3V6SA 3KQ7A 1MRYA 5CEPA 4G3DA 4QP9A 4V0GB 5E91A 2WZJA 3UMXA 4FVQA 4CYJA 5BQ0A 4RX7A 2I0YA 5KBQA 4QMPA 1BI8A 4JG6A 1W2DA 1Y8YA 2ZDTA 4D0WA 5HG7A 2OJFE 2R3RA 3G0FA 4FKQA 5CEKA 5HGIA 1KE7A 2JDRA 2JIVA 4P5ZA 4DTKA 5J79A 3GCUA 2ZM1A 4Y73A 1RW8A 1H07A 2XKCA 4LUDA 3UBDA 3ZYAA 4XG7A 4O6EA 1XBCA 5ANKA 4Y5HA 4FV7A 2Z7RA 5DNRA 4L3LA 2PVLA 3VF8A 4BR3A 4FSTA 4FTLA 4L46A 1ST4A 2YWVA 5C26A 4QNYA 3C4ZA 3CQUA 5E1SA 4O7SA 3O8TA 4QMLA 3Q6UA 3WYYA 1YXTA 5IQDA 4C4HA 1BL7A 2R3GA 3LOKA 3Q2JA 5A3XA 2HXQA 3Q9ZA 1S9IA 5BX0A 3MDYA 4NJ3A 5IUHA 1Y6BA 3DQWA 5HG9A 4CQGA 2WIHA 4X3FA 1BYGA 3VUHA 4XMOA 1WBPA 4B0GA 4F99A 2VTOA 3KFAA 4HGTA 2Z02A 2J0MB 3V5PA 4F70A 5AP1A 5EM7A 3RCDA 4LV7A 4J95A 3C5UA 3UOLA 3DTWA 4X2KA 2Z60A 4H05A 4CLIA 3LAUA 3F5GA 4NK9A 3TMOA 1BUHA 3ZSIA 4OTPA 3DNEA 4BI2A 4ZTRA 1Z9XA 1JVPP 5EOBA 2VTRA 4EOPA 4U42A 2XS0A 4EYMA 4YJPA 2X2MA 3GC9A 5A4LA 3Q5ZA 5LCKA 2OH4A 3S3IA 4FX3A 4QYYA 4XV3A 4FOBA 4QPSA 4CKIA 1YDTE 2GS7A 4ZXTA 3RNIA 3TTJA 3GFEA 4FRFA 4MBIA 3DFCB 4C62A 3DA6A 2IVUA 1KUTA 5FLFA 5EYCA 4QMNA 4AW5A 4F64A 2OGVA 3ORLA 4EH4A 3QC4A 4BDAA 2WQBA 2VTQA 5HZNA 5EHLA 4BGQA 2PHKA 4E73A 3RGFA 4DDIA 3QD3A 5HNBA 5I9WA 4Y85A 3UYTA 4JX3A 4W8EA 5EYKA 3KY2A 2OJGA 2Y4PA 5M4CA 1UU9A 3E64A 2J4ZA 5I4NA 2X0GA 3DKGA 2R3KA 3KVWA 1PMVA 3AMAA 1QPCA 2DYLA 4BCIA 5CXHA 3GI3A 2EU9A 2QR7A 3DAKA 5AIRA 4FKUA 4QMVA 4J53A 3V8WA 4I0TA 4Z9LA 2EXCX 4FZDB 4QP3A 5KMJA 5BVFA 3KF4A 2UVXA 4DEEA 3UPXA 2C47A 3Q4TA 5HD4A 3LXNA 4FTOA 4D0XA 1ZARA 3ZHPC 3FZRA 4MKCA 4QP8A 4O0WA 3FWQA 3P86A 4U8ZA 2F7ZE 2GS2A 3P7CA 5HNGA 4OTDA 4YBJA 4BYJA 5KMMA 1H24A 3QHRA 1YHWA 2C6DA 4D1ZA 4UN0C 3D14A 5E8WA 5GZ9A 3EFWA 2AC5A 5AP5A 2BZIB 1Z57A 2J90A 3OCSA 5L8JA 3QZFA 4GYGA 4BDFA 4RWJA 2FSMX 3OCTA 4IH8A 3CCNA 4H3QA 4JXFA 2UW5A 3TUDA 2ZM4A 2J5FA 1JSUA 2IWIA 3FHIA 5HO7A 3LXKA 5M07A 3L8PA 1JPAA 4FF8A 4FT0A 4QTAA 5ETCA 4RC2A 4ZLZA 5CTPA 5I0BA 2A2AA 4G1WA 4C3FA 3W2QA 4PP7A 3KEXA 5I9VA 5HCZA 2VO3A 2Z7QA 3GENA 4WOVA 1GJOA 2X81A 3U9NA 5J9LA 4TYIA 5HQ0A 4V05A 1AGWA 4JMQA 4P90A 4N4SA 3D94A 5H8GA 3R7IA 2VN9A 1WBSA 3Q96A 4CFNA 4C4JA 3I81A 2A4LA 4QRCA 3R9RA 3NUSA 2PZPA 2ZV9A 3UE4A 4EQCA 1FMOE 1WAKA 1YXUA 4BZDA 2GNLA 5GZ8A 3E8CA 4V04A 5FBOA 3R9HA 2YCRA 3VQUA 4ANOA 3NPCA 4PL4A 5KX8A 4LL0A 3F7ZA 2F2UA 4QD6A 3OEZA 3R63A 5CANA 5JEBA 3N4VA 1PYXA 1YKRA 3H0YA 4F09A 3AC2A 3KXHA 4E6AA 3F2RA 1VYZA 3ZMMA 4RC3A 5CX9A 5JSMA 2ETKA 3R7YA 2OXXA 4S30A 1JBPE 3HLLA 2JBOA 1TQMA 1JKSA 3Q9YA 1DS5A 5BVKA 3CXWA 5ETAA 3GU6A 3GOPA 2XCHA 4EUUA 5LMBA 2CSNA 5HI2A 4AAYA 4FV8A 4C36A 5B2MA 4CSVA 5EFQA 4D28A 4I22A 3FAAA 3GCQA 4CTCA 3KRJA 2C6OA 2BFXA 4UZHA 4BTKA 4RRVA 3VJNA 1OIQA 1JKTA 4DH3A 3BHUA 1PF8A 1KOAA 2XNNA 4XV2A 3TNPC 4BF2A 4CT1A 3FQEA 4PY1A 2F49A 2ZV8A 3QTRA 3BL9A 4DGMA 5E90A 4CVAA 5CZIA 3GT8A 5EHYA 3FXWA 4FUXA 2P2IA 4GT3A 1OIYA 4C7TA 3NYXA 5FEEA 4AE6A 2O5KA 3R0TA 4V01A 4WHZA 4RLLA 3RWQA 5IEXA 4YJNA 2GCDA 3QLGA 5CVGA 3F2AA 3EFLA 2C5OA 4GT5A 3VS3A 5DHJA 2J0KA 2QOQA 4LRKA 4ZLOA 5HE2A 2Z2WA 1ZRZA 5A14A 3KRLA 3VULA 4F65A 1LR4A 5DFPA 4RMZA 3LJ0A 5KNJA 4U80A 4AGUA 5DRDA 4D2PA 3ANQA 1CMKE 2BR1A 4ACCA 2ZB1A 5ACBC 3BE9A 4ZS0A 4LL5A 4X6RA 4PMSA 4FV0A 4CGAA 3ERKA 4K6ZA 1LPUA 2JAVA 3BE2A 5FGKA 4CFUA 3AKJA 2PE1A 2ESMA 3UZTA 3HAVA 2PVYA 3UNZA 2WTDA 3CQWA 1JWHA 4I24A 4BCJA 5CALA 3EQBA 4FKJA 4FKSA 1CKPA 4AP7A 2YZAA 4FV5A 4QMTA 4X3FB 3QWJA 4AA5A 2R7BA 3FHRA 4RJ3A 4U81A 4E5AX 4YTCA 3RK7A 1IR3A 4J97A 3PXKA 4TPTA 4XCUA 4ANNA 4OTGA 4E6DA 4FOCA 4XP0A 1W98A 2YM8A 4NT4A 4RFZA 3ZZEA 3E93A 3DXPA 2ZMCA 3EFJA 2QNJA 2HENA 3ZBXA 2W05A 4FIFA 3P9JA 5KMLA 4QPMA 3QAME 2AEGA 2O63A 3OXZA 2BIYA 2B9IA 3CGFA 3G51A 4DC2A 1M2QA 2AYPA 3MH1A 3C7QA 4YC6A 4ALWA 3ZONA 4ERKA 3MPTA 4FT7A 4C57A 3AC4A 1H08A 4TTHB 3Q60A 3ROYA 3PG3A 3ACJA 4YJVA 1H0VA 3PRFA 3NUUA 3QRKA 3VS5A 5FEQA 3EYGA 2C4GA 4O4DA 4XH6A 4EOIA 2YLEA 4DFLA 3BHTA 2WMWA 4DFUA 5DR2A 5CF4A 3ZC6A 4KKGA 3W2CA 4A9TA 1JKLA 3UGCA 4FGRA 1ZOHA 2C68A 4HZRA 2ETMA 3DT1A 4L9IA 3TV4A 2VTJA 4LOPA 5A46A 3AG9A 4BC6A 2OKRA 3WBLA 1CM8A 4ZMFA 1Z5MA 3PZHA 3QHWA 4FG7A 1RE8A 4I4EA 3MFSA 3PP1A 3FL5A 3HECA 3AQVA 4XEYA 3KU2A 5H3QA 3U55A 1SZMA 2CGUA 3E7VA 5I5ZA 3RBWA 5L6WL 4AQCA 4C59A 2ERKA 1YHVA 2BHHA 3OWJA 3LFBA 4WD5A 3GQLA 2QHNA 4JIKA 4I23A 3IDCA 2XUUA 4FTKA 3PXFA 3UO6A 3BYOA 1J7IA 1J7UA 2X2LA 2UW6A 4E20A 1G8AA 1Q61A 4P5QA 5CVFA 3TKIA 1CDKA 3OT8A 3DBCA 3P0MA 3VS1A 4MWIA 5AA9A 4MF1A 3BBTB 3E3BX 1WVWA 3LCSA 2A98A 1YDRE 3A7IA 4YPSA 3SX9A 4CMTA 2UW7A 1S9JA 3GU4A 4JDHA 4FEVA 5LMAA 3UC4A 3VUDA 2WMRA 5ACKA 3LKMA 3DJ6A 2YIRA 2WQMA 4ITHA 2XKFA 3TACA 5AX9A 5DA3A 2CDZA 2XM9A 4KS7A 2R9SA 3PA3A 2HZIA 4FTUA 5EKNA 4GVAA 4DCEA 2W17A 3HEGA 4MTAA 4U6RA 4I5HA 1OL7A 1REKA 4N70A 5I3RA 3ML1A 1K2PA 3ALOA 3RPSA 3QGYA 5TT7A 4AN3A 3IOPA 4TZRA 4RC4A 3DNDA 5CAUA 4J52A 3RWPA 5KHXA 4WSQA 2R3FA 3VHEA 4AOIA 2XNMA 3I1AA 4IB1A 2UZBA 3A7HA 3R9OA 3ORZA 1Q8UA 2C3KA 3LCOA 3CY3A 5JK3A 1FGIA 3NRMA 5K9IA 4DF3A 5GINE 3EOCA 2XRUA 4UALA 3D4QA 4ENYA 4FV1A 4XNEA 5M09A 3QF9A 4DINA 4DG0E 4NKSA 4N57A 3R21A 4BDDA 4BGHA 3OC1A 3AC8A 4WG3A 4HZSA 4EC9A 3KREA 5HIDA 5AAEA 2C6IA 2XNPA 2YIYA 4ZY4A 4L42A 2VZ6A 4B8MA 2CGVA 2QOFA 4ZTSA 1SVEA 4FV3A 3R8PA 3EN4A 3OCBA 1W2CA 2OXDA 4FTMA 4R3PA 2C30A 4I41A 3VO3A 5IEYA 2YDJA 4RBLA 2C0TA 5L2IA 4DHZA 3EKNA 4I1ZA 4BTJA 2UW9A 2QOBA 3BGQA 4BICA 3VBXA 4D2TA 5G6VA 2JIIA 4M68A 4AG8A 2WTCA 3H4JA 2X6DA 3A2CA 2C1AA 1H1RA 3ITZA 3UDZA 3AMBA 3WF6A 4QDEA 3N9XA 5J9YA 4X21A 5HICA 3MFUA 4O96A 4EH2A 2GQSA 5BV3A 2B0QA 3O5AA 3ZSHA 3D15A 5LXMA 4FSMA 4I5MA 4IB3A 2BCJA 2H96A 3QKKA 1H1QA 2C3IB 3R83A 3TIYA 5E8TA 4GFMA 3U9CA 3ULIA 3DLSA 3UQCA 3Q3BA 3P7AA 2Y4IB 5EOLA 4RWLA 3FDNA 4MQ1A 4ZEGA 4GKHA 4ZTNA 5A9UA 1GAGA 5C4KA 2QO2A 2X0OA 4AT4A 3CGOA 3OWPA 3TIZA 3PWDA 4I20A 5L2WA 4KNBA 2Y6MA 1Q41A 4UY9A 3W0SA 1CKIA 3TN8A 3GCPA 4K77A 1YWNA 3LXPA 4ZSGA 3QD0A 1OIUA 5ICPA 4MUQA 3UIBA 3LFEA 1E1XA 2ITPA 2FYSA 3TT0A 2LGCA 1OL5A 3R7GA 1FBNA 5AUVA 3NEWA 3Q5IA 3DBQA 4Z7HA 2G9XA 3D7ZA 4PQNA 3NZ0A 4QYFA 2J6MA 5CSVA 3OFMA 1OGYA 4MD7E 5D7VA 2WMAA 4TN6A 5IA0A 3EB0A 4FUYA 4QT1A 2FO0A 3SAYA 5L6OA 1BI7A 5F1ZA 2W7XA 3NIZA 4F9YA 3B2WA 4J96A 3COHA 1REJA 4UMTA 1NT2A 1TFFA 2JD5A 4J71A 3O50A 2PPQA 4WUAA 4G5PA 4U79A 2QLQA 5BYZA 4RA4A 3UDSA 1PHKA 4U5JA 1AD5A 1NA7A 3QC9A 2WO6A 4EJNA 3BEAA 5KE0A 4A07A 3Q04A 4ALUA 4L43A 2YA9A 4HNFA 4IAYA 3V8TA 4EONA 4FMQA 2BAJA 3HGKA 3F5PA 3MVLA 4APCA 3PZEA 3SC1A 4X7QA 2XK7A 4DFZE 4JG8A 3UNJA 4TNBA 4WNPA 3F3UA 2CJMA 1UU7A 2JC6A 3EYHA 3SQQA 5DGZA 4AF3A 3NVMB 4JLCA 2PSQA 4FSQA 4KSPA 4XG9A 1P5EA 3OXIA 3BYVA 3QZHA 4R5YA 2YZLA 2B9HA 3W2RA 4OTFA 3FYKX 3HMNA 3FLQA 1CSNA 5K4JA 1H26A 2IF8A 2P33A 3F9NA 2P2HA 3CD8A 2E9VA 4QPAA 4J8MA 4IX5A 3WZJA 4I21A 2WELA 2HWOA 3K54A 3A61A 3QBNA 3LFFA 4QQCA 1OKZA 4WNOA 4C37A 4F7LA 5AA8A 5AUYA 3PJ1A 1PY5A 2W9ZB 3JY9A 4CFFA 5AV1A 1R0PA 5DT3A 5DI1A 4O0SA 1PXIA 2IJMA 2WB8A 4ZSLA 4D2WA 4KB8A 4JRNA 3ZUUA 1L8TA 1YOMA 2BRBA 3C13A 4UMQA 2IZRA 1YI3A 4DT8A 2R3NA 2YJRA 2VWIA 1LEWA 3DOGA 4RVKA 5EYDA 4G6LA 5AP6A 3SXFA 4CXAA 3PPZA 1V0PA 3ZDIA 2VX0A 5TR6A 1LEZA 1DAYA 1K3AA 2RFSA 4IZ5A 1F3MC 2I1MA 4BN1A 3AT3A 4S34A 2ITXA 2WTKC 3HP2A 4F78A 3I7BA 2E9UA 2VO0A 4MNEA 4AZWA 3TXOA 4CMUA 3RZBA 4EOSA 5L8KA 1G8SA 2R3JA 1MRUA 4GFOA 3CE3A 1I44A 3ULZA 1JAMA 2XK3A 2ZDUA 4Q5HA 1ND4A 5IA1A 2OK1A 1TZDA 4MVFA 5IUIA 1OKWA 3PJ8A 2C0OA 3CTQA 4H39A 3KXGA 2CN5A 3HA6A 3Q52A 4TWOA 3A4OX 3LIJA 3F61A 1DI9A 2V22A 2X8EA 4BKYA 4DEBA 5TO8A 4F0GA 4YSJA 3VBWA 4AXFA 3QTUA 3SDJA 5CI7A 4M3QA 2OIBA 4MX9A 3NDMA 4O84A 4U45A 4R8QA 2AQXA 2UUEA 2VTLA 5ITAA 3SHEA 1PXLA 3PDTA 4DTBA 2VAGA 4EQUA 4NTSA 4WA9A 3VNTA 3ZFMA 4R3CA 4M14A 4CKRA 3BEGA 5L2SA 1GIHA 1W8CA 2HELA 3F88A 4K0YA 4NIFA 1FMKA 2HZ0A 3O2MA 2VNWA 4R7HA 4W4VA 4NL0A 4E6CA 3FI3A 4CV8A 2QU6A 3QCYA 4FIJA 4N6ZA 3PA5A 2J51A 2XK6A 3M11A 1OITA 3PLAE 4FKGA 4I0RA 5JFXA 4D9UA 3R1QA 4YZBA 4IAAA 3VS0A 3WF7A 3ZUTA 1NVRA 4M12A 1OL6A 3IOKA 4JBPA 2R0UA 4BDEA 4G16A 3PY1A 3COKA 4DLIA 3HV7A 3ZM9A 4D5KA 2VTMA 2XIKA 3BCEA 1H28A 5HLPA 3ZRKA 3FUPA 3IG7A 3P08A 3FY0A 2PVKA 4O1PA 2A0CX 2ZB0A 3OBJA 3QTSA 2JDSA 5CT7A 4YJSA 3SOAA 4YMJA 5KBRA 2UVYA 2VUWA 4OBQA 3GU7A 5E1EA 5EDQA 4AQKA 2QOIA 3SRVA 3G15A 3ENHA 5E8UA 4O7RA 2PYWA 5GHVA 2QR8A 3M2WA 2E9OA 3IW5A 3WE8A 4FIGA 2YCFA 4XG3A 2XNGA 3H0ZA 3PWYA 3RK5A 4HPTE 2QKRA 2WIPA 2I6LA 3TL8A 3ACKA 4MXCA 4P7EA 3PVUA 3GXLA 5EM5A 5AM7A 2OICA 3VBVA 3D5WA 2X8IA 4X2FA 4DEGA 3QQHA 3KB7A 2CKQA 5DT4A 3W0QA 5CEMA 3PP0A 2VWU