4KSPA

Crystal structure of human b-raf bound to a dfg-out inhibitor tak-632
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
275
structure length
257
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of a Selective Kinase Inhibitor (TAK-632) Targeting Pan-RAF Inhibition: Design, Synthesis, and Biological Evaluation of C-7-Substituted 1,3-Benzothiazole Derivatives.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
total genus 76
structure length 257
sequence length 275
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2013-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4kspA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4kspA01
3KN5A 3NMUF 3ORMA 2GHMA 1XJDA 3VIDA 3PY3A 3R9RA 3M42A 3QD3A 5FEQA 3IW7A 4CZUA 4BN1A 3M1SA 4ZJIA 5ACKA 4TYHA 4YTCA 4CG9A 3PXQA 4I0TA 5CEQA 4RC2A 2Z02A 3JPVA 2YDIA 3LFDA 2QR8A 4I20A 3K5VA 1PRYA 3ORTA 4O27B 5AADA 5M07A 2P4IA 3LQ5A 3PFQA 5CSXA 3R9HA 2X81A 5CU3A 2QQ7A 3C4WA 2F49A 3LM0A 5AA9A 4I92A 4FZ6A 2UZVA 2F7ZE 3OBJA 2BIYA 2I0VA 3EMGA 4L9IA 4NTTA 3Q32A 5C9CA 2X39A 4MNEA 4M14A 4AT3A 4G5JA 3H3CA 5EYMA 2JDRA 3H30A 3G6GA 3VULA 3ZC5A 4CXAA 1JSVA 4LMNA 4RSSA 4XOZA 5IA2A 4HCVA 2J6MA 3ZO2A 4WG3A 2BRMA 2XBJA 4RJ7A 5JZJA 4F7JA 3UZPA 3UYTA 4U5JA 2V22A 4D4SA 5JKGA 4UMQA 4R77A 5F95A 2C69A 3KEXA 4FKPA 5IEVA 2IZRA 1T46A 4RMZA 1H25A 1W83A 5AAGA 3R7OA 3VBTA 2O5KA 3EWHA 5DGZA 2R4BA 4U45A 5AP7A 4JT3A 2UZOA 2ERZE 4G3DA 4QNAA 5AIRA 4I6FA 4U41A 3RAHA 3ZM9A 1JPAA 2YDKA 4DFZE 2XK8A 3SXFA 3RK5A 2WPAA 4YLJA 5HLWA 5IMEA 4FE2A 3E8DA 4YSJA 4L52A 3VN9A 4BZOA 4EQMA 4B8MA 3AD6A 3KMWA 1WVYA 5BYZA 3D7TB 3AG9A 4TL0A 4H1JA 3H4JA 3Q60A 4EK5A 5BVNA 1NT2A 4E4XA 3C4CA 4HGEA 5BMMA 3G6HA 4QOXA 2WZJA 5CZIA 3V51A 4F1TA 3AXWA 3V8SA 4AZWA 4RIYB 5CXZA 3FPMA 1TQMA 2VWYA 4W4VA 2YIWA 3EQHA 3NX8A 3A61A 1WFCA 3IDPA 4P5ZA 1OBGA 5DH3A 2QO9A 4NIFB 4H39A 4PQNA 2B0QA 3N9XA 1RQQA 4F9CA 5AUZA 3DAKA 5HLPA 5DFPA 3EHAA 4I6HA 4AT5A 3TI1A 3A7FA 3CY3A 3VWAA 4U42A 3P4KA 4ACCA 4AW5A 5BVKA 2CGWA 2DYLA 2X8EA 2OO8X 3FHIA 5AV0A 5D12A 2CKEA 2UZTA 4X3FA 5IH6A 5IQAA 4BC6A 4F64A 5AR2A 3QUDA 4AX8A 3MIAA 4IZYA 1XQZA 2PTKA 3QZIA 3AGMA 4ID7A 2XS0A 4NM7A 4U6RA 4P2KA 2OI4X 3VS1A 4PP9A 4AU8A 3ZRKA 3C4ZA 3MH0A 3WE4A 3OEFX 1ZAOA 2DS1A 1ZMWA 2JD5A 3HRCA 2QURA 3DAEA 4EZ7A 1FBNA 3V6RA 1BI7A 3COIA 3TV6A 3GQIA 4JL9A 4BIEA 3ZCLA 3EFKA 4DH8A 3JYAA 1SMHA 3UZTA 1FMKA 3THBA 3CBLA 1OPJA 4GVAA 1OMWA 4RVLA 1H26A 1R0PA 2GS2A 4DLIA 3OOMA 2I7QA 3UVRA 4DGLC 4WNOA 1G8SA 4QMTA 5AEPA 1G8AA 3QQJA 4EH2A 1Q8TA 4JBOA 2Z60A 3BYSA 2V5QA 2W4OA 4KBAA 5I9YA 3ENMA 1XBBA 2FH9A 2O63A 4RT7A 1M2RA 4EBWA 4GT5A 5IEYA 3UMWA 4O86A 2VWWA 3QF9A 1OITA 4LG4A 4YHTA 3ZRLA 3MA3A 1LPUA 4DH5A 4O7WA 4RBLA 4AA0A 4EK4A 1ZZLA 2XMYA 4GCJA 2VO3A 3BPRA 3PVGA 5J8IA 3CKWA 4CCBA 1ZWSA 5LWNA 3VO3A 3R2YA 3P7BA 2WMBA 4FODA 2VZ6A 5EI8A 4QP8A 3W1FA 3NYXA 4O2PA 3FI4A 2C6EA 2XK4A 3FHRA 3BV2A 3D5UA 4U44A 4IJPA 5FBNC 2Y0AA 4YLLA 5ACBC 4DAWA 4AGUA 3LXKA 3PIXA 3NW7A 2PVJA 5LVOA 5IQGA 3NEWA 4G17A 2WEIA 5KX8A 5M4IA 4IX5A 5ETCA 4DGMA 1CMKE 4OT5A 2XJ2A 3IW8A 4OTFA 3HEGA 4JJRA 1ND4A 2H34A 2P33A 1PXOA 4KIKB 2C5YA 4F9AA 1JLUE 1Y8GA 3EN4A 2GHGA 5HNIX 2J4ZA 2XK3A 5DRBA 2YAAA 3Q2JA 4GV1A 3F82A 3DPKA 4D4RA 2IO6A 4GL9A 4OTDA 2Z7QA 2WMUA 4OTHA 4QMNA 2QLUA 3S0OA 1O6KA 2B55A 3IW5A 3HDNA 1OKZA 4L6QA 4YBJA 5E8VA 4IC8A 3NS9A 3Q2MA 4M13A 5CAUA 1CM8A 3KVWA 4FA2A 3BGQA 3KKVA 2IW8A 1UNGA 4XEYA 4BCGA 2C6TA 1OM1A 3E64A 3E8EA 3DT1A 3HA8A 3OUKA 3UE4A 4AOIA 4CFUA 4BY9E 3KF7A 2PPQA 3QXOA 4CYIA 3TNWA 5CWZA 3I6UA 2P55A 3RZFA 4M3QA 2RG6A 4FT5A 4USEA 3OXZA 3II5A 3F5PA 3LE6A 1YXXA 3COKA 5CU2A 3WI6A 2X2LA 3QUEA 3IW6A 2XIZA 3BV3A 1H27A 2J51A 3QQHA 4KD1A 4RX5A 4LMUA 3CD8A 3BQCA 1O9UA 1JSTA 3ZSIA 4EKKA 4DLJA 4JX7A 2BALA 3QTWA 3PA4A 3R1YA 5CXHA 2Y4PA 4JX3A 5L6PA 4FBXA 1JVPP 4CFXA 4WHZA 3O7LB 4AW2A 4YTFA 5E4HA 4YJSA 3NUSA 2ZMDA 4ASZA 5K4IA 1K9AA 4EHEA 3BBWA 5CEMA 4EH5A 3G2FA 2B7AA 5HD4A 3L9LA 5BUIA 1Y57A 3E8NA 3VNTA 5AR8A 2R3JA 4C38A 5IQDA 2XA4A 4DCEA 3IONA 3VS4A 4WIHA 2JBOA 4CMUA 4UV0A 2OKRA 2PL0A 3QCQA 4HOKA 4M69A 5TO8A 1PMUA 2RFDA 2C30A 2NPQA 2HW6A 4N6ZA 4ZIMA 4MH7A 3WZUA 5EQEA 4GUBA 3ZO3A 4O2ZA 2WGJA 2BUJA 4UBAA 1UKIA 3KRRA 3HECA 2C6LA 4QTBA 2PYWA 5IKWA 3P79A 2VNYA 4C57A 1YXSA 3CQWA 4ZLOA 1MQ4A 1R1WA 4KIKA 3V8TA 4E8AA 4K33A 4XRLA 3S1HA 1OKYA 2O0UA 4IX3A 4ZSLA 4O0VA 5HU3A 5EW9A 4LOOA 3LFSA 3QQLA 4FI1A 4YO4A 4M0YA 1QCFA 3B2TA 3EQDA 3QTXA 2ZB1A 5E8XA 3S95A 4X3FC 2W5HA 4JQ7A 1GY3A 1Z9XA 4XLVA 1IRKA 3UIMA 4DFUA 2B9HA 4M68A 4BDBA 5K4JA 4L68A 2QO2A 5IA0A 4FTQA 3QZGA 2PUIA 4ERWA 2A27A 4J53A 2PU8A 1AD5A 4N0SA 3DZOA 3NR9A 3PSDA 4KSPA 3FMNA 2G2IA 2YEXA 4XG3A 1UNHA 4WNPA 4J99A 5H3QA 2E9VA 4FTCA 4QYHA 3U8WA 4FVRA 3TM0A 4I93A 2BRHA 4FV1A 3U87A 3WBLA 4FOCA 3ET7A 4HW7A 5IDNA 4M7IA 4NH1A 4Z9LA 2PVKA 4GK2A 3HGKA 1OL1A 2CJMA 4A9RA 1OBDA 3GEQA 3DY7A 3RJCA 3VUIA 5IH4A 3VS0A 3FMLA 3COHA 3SOAA 3BRBA 3HRFA 3Q6WA 2R3KA 4I6QA 3UPZA 4O22A 3FI3A 4A7CA 2YCFA 4PDSA 4WG5A 5AMNA 4RIOA 2ITNA 1WBWA 4M97A 2JIIA 4ACDA 2C4GA 4MD7E 4YHFA 2YM3A 4IX4A 5HG7A 4FMQA 2VGPA 4D1ZA 5DN3A 3LIJA 3FY2A 3GU6A 3NYNA 4W8DA 2LGCA 1FMOE 3NUPA 2Y7JA 1REKA 4EOLA 4EC8A 2QG7A 2QOBA 4FTNA 2ZV2A 4O0UA 4WBOA 4D2PA 4BWXA 2R3OA 4IFGA 4J8NA 4IM0A 2UZEA 4DTAA 2IG7A 4F09A 4YSMA 2YITA 2I40A 3U9NA 4NEUA 3ERKA 3V3VA 3ZS5A 3IO7A 5GZAA 4I22A 3VC4A 2QG5A 2OH0E 3QC9A 4C34A 2YDJA 2ETKA 3IPHA 4OGRA 2CGXA 4X3FB 3VW8A 4HYSA 5KMNA 2GFCA 2OIBA 4GJ2A 4OW8A 3TJDA 5EYCA 3MB6A 2WQNA 1J1CA 3HYHA 5CQUA 3QZHA 4MKCA 4U7ZA 3TNHA 3UIBA 3LZBA 4LRJA 3WE8A 5JFXA 4OT6A 4NU1A 2R3LA 5CSHA 4KS7A 2ITUA 3R71A 5GHVA 4U0IA 3IKAA 1DI8A 2ITOA 4ZMEA 4FL1A 4LL0A 5HBEA 5JEBA 3LAUA 5C8NA 1VEBA 3D94A 3ZYAA 5M56A 3VF8A 2VTTA 4IJ9A 5C01A 1W84A 4JIKA 2IZSA 2R3IA 2C5XA 3BELA 5AUYA 3BE9A 3LJ2A 4NUSA 3MVMA 4II5A 4PTEA 1NA7A 4H36A 1PF8A 4M15A 4RIWA 2R3FA 2VNWA 3JS2A 5CNNA 3HUCA 4CZTA 4EORA 5AUVA 3MFRA 2PZ5A 5HCYA 4DFBA 3TWJA 2P3GX 2R3GA 4R3RA 3Q4CA 4NTSA 3ZO4A 5LCJA 5BVFA 5B0XA 3NNUA 4IW0A 4XBUA 5DIAA 3FSFA 5J9LA 4BTJA 2J50A 1I44A 3VS3A 4FVPA 4O7SA 5A4EA 4AOJA 2R3PA 4KKHA 2OJIA 4Q2AA 4MXXA 3BLRA 2QU5A 5AP0A 3ELJA 5L2QA 4I4EA 3KXXA 3LMGA 4FVQA 4O82A 3OROA 1ZYSA 2JKKA 1O6YA 3DDQA 4J98A 5A4CA 3HV6A 4QMUA 4CRLA 2WIHA 2OJFE 3Q9XA 4HVIA 1IAJA 3IGGA 1OIYA 5DA3A 1JNKA 4HGLA 2XP2A 3W2CA 1JKLA 4C4FA 3MN3A 2HWOA 5E8YA 3MTLA 3VHEA 3BYMA 3CJFA 1QPJA 4KKEA 2VTPA 3SG9A 3DBDA 3SQQA 5M53A 4YJRA 4V04A 4GFOA 5HO6A 3IECA 4QQTA 2PVLA 3UNZA 4PUZA 4RJ8A 4ZJJA 1V0OA 3PPZA 4MF1A 4PTCA 4ANLA 3IG7A 4F0GA 1H4LA 5KNJA 4ZTRA 2ESMA 2ITYA 2OICA 4PPBA 3W33A 4JBVA 4YTHA 4KBKA 2PVHA 2C1BA 3TNQB 2CNVA 4JRNA 4QMPA 1LP4A 3WARA 4MBIA 5E91A 3OFMA 4AN3A 5H8EA 3DNDA 2YIYA 4IAZA 3P5KA 4FUYA 1W0XC 4YJQA 3UIUA 4BZDA 4A4XA 4F1MA 2NP8A 2FO0A 4XV3A 2BRNA 2YZLA 4RIXB 3CCNA 1YI6A 3VUMA 2HY0A 2OZAA 3KK9A 4ZLYA 2ZMCA 5J1VA 3DB6A 4ANSA 3FMEA 3L8PA 5D1JA 3ZM4A 3G90X 4FZ7A 4BBFA 2BRGA 4IAFA 4C59A 2G15A 1Q61A 2W99B 3PRIA 2XUUA 2QKWB 3QHRA 4HGSA 3ID6C 2OG8A 3QA8A 4EHGA 2X6EA 3NIEA 2J0IA 4Y85A 3P86A 3UYSA 4QYGA 3PWDA 4BI0A 5D9HA 3RALA 3GC9A 2JDOA 3ZHPC 1LEWA 3R2BA 4IZ5A 2ZOQA 1ZYJA 3UG2A 4FL2A 4XCUA 4XMOA 2UW5A 1UU7A 3RM6A 1X8BA 4DEIA 5BYLA 2Y4IB 2QOFA 4FKRA 4L67A 2PUUA 4MYGA 4P5QA 4AQCA 5BVWA 3CC6A 3R1NA 2VAGA 4WSQA 5I3OA 4LUEA 3SDJA 4JQEA 4EZ3A 4FGRA 2YCSA 5J1WA 2Y8OA 4FYOA 5B7VA 3S3IA 4C58A 3KXMA 3FZRA 5K3YA 5LVMA 4XG9A 1CKIA 4IZAA 3ALNA 3FYKX 2XB7A 1MQBA 2V7AA 4IVAA 4BCOA 4AZEA 2XNBA 3RP9A 2YJRA 3DKFA 3HAVA 4FF8A 3O51A 2KULA 4BCFA 4EI4A 4S2ZA 2BIKB 4ACGA 4XUFA 4E5WA 2BHEA 3PA3A 4G9RA 3UNJA 1ZZ2A 4FTRA 2XVDA 1ZYDA 3GU8A 4G3CA 3TN8A 3W18A 4PL3A 4F7NA 3P7CA 4AZVA 5A9UA 2VO0A 2VGOA 2UW7A 4YC8A 2BTSA 4W4XA 1Q41A 2YIQA 3FXWA 3I0OA 5E7RA 5J5TA 3VBXA 1T45A 2BZHB 4FSNA 4AZTA 3ZEPA 4LI5A 3NW5A 2EWAA 4Z55A 3B8RA 2WQOA 4DHFA 3KU2A 3Q52A 4DGOA 3OXTA 4G9CA 4F70A 3MVLA 4PV0A 4O0WA 2VRXA 4DFNA 4OTRA 4MX9A 3AGLA 4K1BA 5IZFA 3M11A 3PXFA 2JDTA 1XH6A 4YJUA 4ONAA 4DC2A 4TYHB 2C3IB 4UWBA 4IAAA 1JSUA 3VUTA 4CLIA 3GCSA 3VQHA 4USFA 5A4LA 1URCA 2VTRA 4OAUC 4BDGA 4AAAA 4XJ0A 2BDJA 4ACMA 1IA8A 4AWIA 2J7TA 5DLSA 3EJ1A 2WXVA 4IB3A 1ZYCA 4IMYA 4NM5A 1XO2B 5E92A 3NVKI 4IVCA 4EK6A 4GEOA 5EYKA 2O8YA 4QMLA 3QALE 2V7OA 3F5XA 4K0YA 4K8AA 2X9EA 3RAIA 4C4HA 4CT2A 1IR3A 4AFJA 2FB8A 4O83A 3TZMA 3HAMA 1R3CA 1YHWA 2OJ9A 4DBNA 4FIHA 4FV3A 3F3TA 4CZYB 2SRCA 5EH0A 5AP2A 3O2MA 4FZDB 4YZDA 3MVJA 5AP6A 3V5PA 3DK3A 5IQCA 4FSUA 4V0GB 5DR9A 3KCKA 4X21A 5F4NA 2W4KA 4ANMA 1RE8A 4EOQA 5M51A 4IWQA 3SOCA 1REJA 2BKKA 2XKCA 4OTGA 3SG8A 4JDKA 4RVTA 4R5SA 4DG2E 4KS8A 3VS6A 3FC1X 2BKZA 2GNJA 2W05A 4U3ZA 5JMSA 3SVVA 3U6HA 3PDTA 3MJ2A 4FKOA 1QPDA 4MBLA 2NO3A 3JY0A 1R0EA 2XNGA 2BDWA 2HENA 3GQLA 4FSTA 1JKTA 5LCKA 5D10A 4YLKA 4C37A 3VW6A 5M57A 2R0IA 3ZDIA 4LYNA 4LOQA 3K2LA 4XG4A 2HW7A 1RDQE 4KABA 3FSKA 1V0BA 4FK6A 3QGWA 4Y5QA 3N4TA 4ZSEA 3TZ8A 2X7FA 1PW2A 3MESA 1GZKA 3UOKA 2WU7A 4FKIA 1Q4LA 1H0VA 3KXHA 4FG8A 4E7WA 3QYZA 3I7CA 1H1WA 3TIZA 3ULZA 3CSVA 3AC5A 4ANBA 3MJ1A 3WF7A 3RMFA 3EIDA 4K6ZA 5IISA 2WB8A 3PY0A 3BYUA 4EHVA 5EKOA 4A4LA 2A1AB 3W55A 2YLEA 3CJGA 3DKGA 4FKUA 1JKKA 4I3ZA 4C4JA 4QPMA 2HXLA 5J87A 4AACA 2BFXA 1STCE 4NKAA 3QXPA 2YM4A 4YNEA 1W82A 4YMJA 2W4JA 3KXZA 4MQ1A 4KA3A 3ORNA 3R63A 4U97A 4O7RA 2VTOA 3LOKA 4IM3A 3E92A 2IN6A 5CEIA 1Q8WA 3DJ5A 3PJ1A 4GKHA 5KBQA 3ANQA 1E1XA 1YXVA 4LGGA 1IAHA 4UZDA 3V5LA 1VZOA 3K3IA 2AC5A 4EZ5A 4GT4A 4I5CA 4U3YA 2JLDA 2BZIB 3R7GA 2XM8A 3GC0A 5HEZA 2GFSA 1YI4A 3QD2B 4BGHA 4RLKA 4ZS4A 4DH3A 1UWHA 3EN6A 3EN7A 2F57A 1QPEA 2VU3A 2YERA 3OUNB 4IANA 4I24A 5EM8A 2GTNA 3LQ8A 3UODA 4HVDA 5KKRB 3E3BX 4JVGA 4ARKA 3KXNA 3Q04A 4OR5A 3KREA 5FTOA 2LAVA 3KULB 4TYGA 5TT7A 3QBNA 5L6WL 2YWVA 5DYJA 4EWHA 3C4FA 3LFEA 2CSNA 1WMKA 3SA0A 2IWIA 3TUCA 3PJ3A 2OZAB 4JQ8A 4WNKA 3MDYA 4YZCA 4UMUA 2O3PA 4AGWA 5TE0A 4C4GA 3ORLA 2J2IB 4FTAA 4X7QA 4BICA 4G6NA 4OTIA 4O7YA 4ZY5A 3EZRA 1RJBA 5I4NA 3COMA 1XR1A 3QYWA 2C0OA 2PMNX 3I7BA 4HNIA 4BIBA 5M09A 4IH8A 5AP4A 5H8GA 3BWFA 4BCPA 3Q53A 4MAOA 1ZY4A 2KTYA 2GTMA 3IW4A 3UQCA 5ANIA 4S32A 2GU8A 1KV2A 4FG9A 3EFJA 2WMSA 4K18A 4RZWA 3W8LA 4D0XA 4ASDA 5IG1A 5HLNA 4JG8A 2DWBA 3EH9A 5KHWA 3ZBXA 3TNPC 4XHKB 3D14A 5E8TA 3BX5A 3Q9ZA 3QQUA 5C26A 3IOKA 2QODA 4R6VA 3WF8A 2H96A 3UBDA 4FKWA 3L8XA 2J5FA 3SKCA 2WMXA 3F9NA 3P1AA 3MWUA 4NKSA 1LEZA 4L45A 4BDCA 1BLXA 3DDPA 3FKNA 5DEWA 5CEOA 1APME 3MS9A 2UZUE 1KUTA 4DEGA 2YAKA 5A4QA 4CV8A 2BR1A 4EYJA 1OGUA 4Y5HA 4HCTA 2C1AA 2GS7A 3CE3A 5I0BA 3BWJA 3ORZA 3S4QA 3ZSHA 2JEDA 3FMKA 1DAWA 4HVHA 1U54A 1NY3A 3GXLA 1XHAA 3PSBA 4F1OA 1OPKA 2V62A 4PL4A 3QTRA 3GI3A 2RL5A 4EOJA 2C3LA 1ZARA 3LFNA 3A4PA 4R3PA 4L44A 3A2CA 4AN2A 4U43A 3FWQA 4LRMA 3RI1A 4RJ4A 3F3WA 4OAVB 3QX2A 4TNBA 5KO1A 2YCRA 2XYUA 1JAMA 2R64A 3A7GA 4PMMA 1PHKA 3R7IA 4ASEA 2C0IA 2B1PA 1PMEA 2I0YA 3Q6UA 3D83A 4BKJA 5BMSA 4H3PA 4R1VA 3MBLA 1G5SA 4ALVA 1DAYA 4DEEA 1A48A 3DBFA 5H9BA 3ZUTA 3FY0A 3W2SA 4Q5EA 2GNLA 3SC1A 4KUJA 2O65A 3FYJX 4IEBA 4NJDA 4UALA 4UN0C 1V1KA 1S9IA 3MPTA 3BYOA 2VX1A 2WU6A 4J97A 3I4BA 3ZBFA 4FKVA 4WRSA 2OK1A 3SRVB 4NJ3A 1YOJA 4GYIA 5FUTA 2FSOX 5HORA 2WFYA 4RA4A 5IMXA 4R1YA 3PWYA 4IAKA 4C3PA 2QLQA 4FV4A 2GQGA 2YISA 2YM6A 4F6UA 3FL4A 5HO7A 2QOIA 4AF3A 3RVGA 4AS0A 3OCTA 3IQ7A 3DA6A 4QTAA 4KB8A 4IB0A 4E6CA 3NIZA 3QTIA 5KMLA 1SVEA 1XBAA 5GNKA 2WELA 5AIKA 4A9UA 3HV5A 3ZFMA 4EEVA 1UVRA 2R3MA 4RVMA 3NNVA 3F2AA 5G6VA 4QTCA 3R7YA 1GOLA 1Q8UA 3HMMA 4GH2A 1H01A 3W16A 5AWMA 3LVPA 3MIYA 4GJ3A 4D55A 3HV3A 4NZWB 4BYJA 3FZ1A 3TTJA 1Z57A 2R7IA 3HNGA 1PJKA 3HA6A 3OXIA 5AM6A 2O2UA 4FL3A 5T3QA 2C6DA 3OCSA 4HJOA 4L43A 4DEAA 2BAQA 3TKIA 5IQEA 4PL5A 3U6JA 3GBZA 3F5UA 3LCKA 1WVWA 5CTPA 3WZJA 4B9DA 3DLSA 3MFUA 4EHZA 2H6DA 4AZFA 2QKRA 3JR1A 2R5TA 4FTLA 4L46A 4F9WA 2W9FB 1YXTA 2HWPA 5IQBA 3SGCA 2VO7A 4U81A 2BFYA 3KL8A 5GJGA 2XK9A 4QMWA 3G0EA 3FC2A 4KSQA 1P4OA 3ROCA 3NRMA 5CEPA 3VUKA 4MXOA 4D9TA 2GNIA 3VF9A 5CAOA 4KRDA 2OXDA 4IAYA 4ACHA 3R7EA 3LM5A 5FEEA 3RTPA 3BHHA 1LUFA 1ZLTA 2A19B 4ZOGA 1S9JA 2WNTA 2X6DA 3VQUA 4EKLA 2CKPA 4LM5A 4YJVA 5HTIA 4ERKA 2C6KA 4FKQA 3R00A 2BPMA 5FLFA 1Q5KA 2BZKB 1UU9A 3PXYA 2IVSA 3AD5A 2XKFA 3N4VA 1U5RA 3OG7A 4O1PA 3V8WA 1SZMA 4FT9A 2PUPA 2PE2A 1OL5A 4O7TA 2IJMA 3C9WA 3IDBA 4FIIA 4IWPA 4QP9A 2VX0A 2E9OA 1P14A 1YW2A 2RFNA 2W1GA 4XV1A 1CDKA 4FTMA 1GZ8A 1L3RE 4FG7A 4D5KA 4DYMA 1SYKA 1M7QA 4X2FA 4C61A 4FV7A 3D0EA 5IUIA 4DE4A 5BUJA 2HY81 3DGKA 5CVGA 3E63A 1Y91A 2OJJA 4M8TA 3SXRA 2QOCA 2H9VA 2PY3A 2RSVA 4RRVA 3CP9A 3O8TA 3EQPA 1FOTA 5EDPA 5AM7A 3LMHA 3P9JA 4V01A 3RK7A 5IQFA 2WTIA 2XIYA 4OTPA 3ZLYA 2B9IA 2W1CA 3FJQE 2REIA 2Y9QA 3PVWA 4B0GA 3NSZA 4BIDA 5EKNA 5FXRA 1EH4A 4JAJA 3R0TA 3GUBA 3ETAA 4HPTE 1ZMVA 5B2LA 1KE9A 3E7OA 2PWLA 4KKGA 3V5TA 2NNWB 3KXGA 4PF4A 2YJSA 5IA3A 3OW3A 5CSVA 5M44A 3FBVA 2VTNA 4EONA 2PZIA 4YPDA 2CHLA 2G9XA 3C4XA 2ONLA 4ITHA 3R28A 3G5DA 3FV8A 3DJ6A 4P7EA 4V0GA 3TTIA 1HCLA 4C2VA 4MD8E 2ZV8A 4OBOA 2E9NA 5HZNA 1K2PA 3O50A 2W17A 4RJ3A 3LCDA 1HOWA 3OY1A 3ATTA 3GOKA 2GHLA 2XBAA 3OY3A 2ITTA 4FNXA 4N70A 3LHJA 4TTHB 4JR7A 4DT9A 3D2KA 4W4YA 5I9UA 4IX6A 4BTFA 1YWRA 3HL7A 3DTCA 4QP2A 5CX9A 5DT4A 3UOHA 3R9OA 3DKCA 5KZIA 3Q4UA 2OLCA 2OF2A 2J5EA 5AV3A 2UW6A 4WKQA 2J9MA 4RGJA 4G3EA 4CQGA 3NYVA 4ALWA 1PXJA 2PVMA 3ORKA 3LJ1A 3A60A 3N4UA 5EQYA 3RHXA 5AA8A 4B8LA 2B52A 5AUTA 4IFCA 4FKGA 4E4LA 3HMOA 4BCNA 4CFMA 2PE0A 3ACKA 4BF2A 5J95A 2ZDUA 1J91A 3HV7A 3R7VA 1OKVA 3F61A 5DT3A 3GFWA 3I5ZA 4O1OA 4L7SA 2CN8A 2Z2WA 2X8DA 4GU9A 4UZHA 4IBMA 4B7TA 1P2AA 4GG5A 4JDIA 4CT1A 3O7LD 4BDKA 2YIRA 4EOIA 4CMTA 2QVSE 3CIKA 4IC7A 4MBJA 4NW5A 3H10A 4JG6A 5FWKK 3BU6A 2FYSA 4LGDA 3FLZA 3TKHA 2JBPA 2XKEA 3O96A 4K2RA 4O0RA 5T6KA 2CLXA 3TACA 3PA5A 4MQ2A 5CSPA 3LJ0A 3EKKA 2HZ0A 4NK9A 4J52A 4O6LA 5AP3A 4ZSJA 1L8TA 2WAJA 2WQEA 4AN9A 3EFWA 1UU3A 4EWQA 4JAIA 3R9NA 3EYGA 5FXQA 2ERKA 2XZSA 4G5PA 4WT6A 4AW1A 4RJ6A 4BHZA 4CSVA 3NUAA 3LFCA 2CN5A 2F2UA 2OW3A 2XIRA 3KK8A 4C33A 1YOMA 3ZH8A 3GU4A 4CTBA 3QWKA 2BRBA 2X7GA 3BEGA 2VTHA 5ANDA 2IVTA 2CCHA 3UQGA 2J0JA 5H8BA 2UZNA 1J7IA 3PPKA 5AP1A 2IW6A 4RPVA 4BVUA 4QRCA 5EK7A 5L8LA 4I5MA 3UO5A 3S2PA 3GFEA 1I09A 1ZMUA 2XK7A 3I5NA 3BIZA 3HX4A 4JRVA 3MFTA 2Y4IC 2C6MA 4BDEA 5L2IA 3I79A 2XNPA 1BMKA 2PVFA 5HI2A 4C2WA 5GIOE 4L3LA 4L01A 3FLQA 4F0FA 3OT3A 1VYZA 4BCIA 4TXCA 1RW8A 2PMLX 3L9MA 5E8SA 4IACA 2G01A 4O96A 4ANQA 1TKIA 2PVNA 3H0ZA 3F2NA 3NPCA 2NRUA 1ZYLA 2FUMA 3BLHA 5HE1A 2UW4A 4QPAA 4Z3VA 2HYYA 4W4WA 3FKLA 4FTIA 4CFFA 5JQ8A 3C0GA 3EQCA 3R22A 4CYJA 4XG7A 1WBNA 5DI1A 3U9CA 5TR6A 4YBKA 2XRWA 4BFMA 4JDJA 3MVHA 5EQPA 3SXSA 4E26A 4NW6A 4FKJA 5K0XA 3PE1A 1B38A 2BILB 1FGIA 2X0GA 3SAYA 2V55A 4QP6A 4PDPA 5AR7A 3FLNC 3ZU7A 2CLQA 1UA2A 3LQ3A 3C7QA 3FLWA 2VWUA 3EFLA 4UMTA 2E9PA 3QTQA 4RWLA 4YZNA 4QMYA 4PPCA 3BU3A 2XEZA 2IZUA 3MY0A 3SLSA 5C8KA 4E93A 4PX6A 4PRJA 2GNGA 3C5UA 4TY1A 5D7AA 5CAQA 3RBWA 4C8BA 4EYMA 2ZM1A 5JFSA 5DBXA 1PKGA 3CGOA 1PXMA 5HHWA 1PYXA 3ZZWA 4O7VA 4DTKA 4OUCA 3GCUA 3FMDA 4H3QA 1GZOA 4H58A 5ITAA 1IA9A 2W0JA 3QQGA 4HZSA 3VBVA 4U40A 1W98A 2XK6A 2WMWA 2IW9A 2WTKB 4AE6A 2QU6A 4EUTA 3R1SA 5L2WA 3T3UA 5CALA 2ITVA 3DLZA 4O7NA 2R3HA 4EBVA 3QQFA 5FDXA 4YO6A 4J71A 4LUDA 4U9AA 2RF9A 2YACA 3F88A 2CGUA 5KMOA 5D41A 3A8XA 3T8OA 3R6XA 4MVFA 4EH8A 4BL1A 3RAKA 4UWYA 4QO9A 1YWVA 4PDOA 4YJPA 1DM2A 4MTAA 4YURA 4E1ZA 2YM5A 4I4FA 1OKWA 4RZVA 5EOBA 2OBJA 3QTZA 4WBBB 1TVOA 3SW4A 4ZTHA 1YDRE 5HE3A 3UTOA 3TNIA 5BQ0A 3QRKA 3A7IA 2FSMX 5FXSA 3REPA 2C6IA 3RPSA 4FEXA 4EJ7A 1J1BA 1SVHA 5K5NA 5LMKA 4TWNA 2QCSA 1MP8A 5ETFA 2ITPA 5LWMA 3ALOA 3PUPA 2ZV9A 2HIWA 4IM2A 4TYJA 2OJGA 4G31A 4FUXA 4BBMA 1H1QA 5JRQA 4I94A 4DFYA 5K5XA 1P4FA 3NCGA 2Y6MA 4ZSGA 3OC1A 4BKZA 4BGGA 4MEDA 2QR7A 2OWBA 5DWRA 4IWOA 3IGOA 5AR5A 4EH6A 2QC6A 5FTQA 1H07A 3LMIA 5C27A 5JK3A 3RWPA 4F7LA 3MPMA 4AOTA 5F20A 1FPUA 4Q9SA 2QOQA 3AMAA 4IDVA 4C7TA 4RFMA 4IQ6A 2QHNA 4YUQA 3AT2A 3EKNA 1F3MC 1NVRA 2X7OA 2R2PA 5CT0A 3E62A 5L4QA 5FM3A 4YTIA 3QRIA 2VTLA 4FK3A 4PNIA 1MRYA 4YZMA 5HIBA 4A07A 4GIHA 2VTSA 5E8UA 3R83A 1B39A 2YCQA 1VR2A 4UXQA 2UW8A 4I0SA 5HBHA 4C35A 5J79A 2C3JA 2J0LA 4ZK5A 3RPRA 2XNMA 4BKYA 3OEZA 3VBWA 2W96B 4GMYA 3KA0A 5CF8A 2GMXA 4NYEA 4QNYA 4TKSA 1M7NA 4X2NA 1TQIA 3NUYA 4NWMA 4YC3A 3W2OA 2I0HA 4AZSA 1UU8A 3AT4A 2QD9A 2WTCA 2XCKA 2YABA 4RFZA 2VTJA 4IE9A 3ZZEA 5JQ5A 3ZRMA 4CG8A 4TYIA 2W1ZA 3P78A 4EOKA 4JG7A 4PDYA 4NL0A 4CNHA 5AFVA 3RAWA 5BVDA 3WYYA 5KBRA 3KY2A 5LJJA 1HCKA 2QHMA 5M4CA 4WUAA 3AD4A 5I5ZA 4Z7HA 4R78A 3FLSA 4KNBA 2VWZA 1BKXA 4ITJA 2WMQA 4C3FA 3FL5A 4A4OA 5HO8A 1FVTA 3TV4A 5CAVA 3MY1A 1GZNA 3OD6X 3FZOA 3R8MA 5LVNA 3BGZA 3DFCB 4GKIA 3VBYA 5HU9A 2Q0NA 5EG3A 4ZZOA 5AUWA 3TZ9A 4BDAA 4XS2A 2VD5A 1NVQA 2FA2A 1M2PA 2A4LA 2QI8A 1K3AA 3NWWA 2PZPA 5A6NA 4MNFA 4O0XA 3PXKA 2BCJA 5EHYA 3WZKA 3RGFA 4O0TA 4NCTC 4UXLA 5D7VA 4O21A 5JN2A 3D5WA 1KWPA 2Q83A 1FGKA 3NDMA 1YQJA 1Y6AA 3D5VA 2UW3A 3C4EA 3E93A 2R3NA 1WAKA 4MWIA 5HNBA 2HCKA 2YZAA 3T9IA 3LCOA 2QO7A 5DE2A 1F5QA 1URWA 3G51A 3DQXA 5LVLA 3GGFA 3RM7A 4BDIA 2X8IA 3CGFA 3A7HA 3WIKA 4QMOA 4MK0A 2ZAZA 3R21A 5CT7A 3F7WA 3QFVA 3W8QA 1H0WA 5L6OA 3UO6A 3CLYA 2BVAA 3QLFA 1J7LA 3VS2A 4BCJA 3EN5A 3C51A 3RPVA 2QONA 3E7VA 3QLGA 3ULIA 3GENA 3RNIA 1BI8A 2ONLC 2G1TA 2R3QA 3DTWA 5C03A 3CPBA 4GK3A 4J95A 5HESA 3O0GA 4AGCA 4J7BA 1U4DA 4MXAA 4GG7A 4BGQA 4DFXE 4D2VA 5HOAA 2P0CA 3QD4A 3TZ7A 3GU5A 3P23A 4HVSA 4LQMA 4QMMA 3OWKA 2WTKC 1WBPA 4M66A 1PXIA 4QD6A 4ANNA 5JFVA 5LMKC 1YHVA 1KOBA 2I1MA 4H1MA 2F7EE 2GQSA 3O8PA 5HIDA 4QPSA 3I81A 2X1NA 4J1RA 1PXKA 4BTKA 3EN9A 2UZDA 1O6LA 4BDDA 1FVRA 2Z7SA 5M4UA 3BYVA 3FZSA 3SW7A 2BHHA 3GOPA 2VTIA 4PNKA 3GCQA 2XJ1A 3MY5A 5AX3A 4FV2A 3Q9YA 4QMZA 3ZMMA 3QUPA 4MXZA 5GZ8A 3VUGA 1MRUA 4FICA 5HTBA 3DCVA 4PTGA 4XV9A 4RIWB 4FR4A 2OXYA 4TZRA 3R8UA 3KGAA 4DGNA 2X9FA 4JDHA 5I9VA 4H3BA 3W10A 3VHKA 5JGDA 5L2TA 2HXQA 3TIYA 3R8LA 4G2FA 4EH3A 2I6LA 3QQKA 2JDVA 4FTJA 5GJDA 4A9YA 5TKDA 3G15A 2RFEA 1Q8ZA 5CVHA 3GP0A 2HAKA 4I0RA 3KRLA 4D4YA 4MXYA 5IH5A 2PZYA 4CEGA 3WILA 3TG1A 4BI2A 5CENA 3GVUA 3PJ2A 4YU2A 4EJNA 1YVJA 2CCIA 5FD2A 2C47A 2JKOA 5FQDC 1SNXA 5GJFA 3MH3A 4BI1A 1NXKA 1H08A 3P08A 5CANA 2RFSA 2OZOA 4F6SA 3PIYA 5EOLA 3FKOA 2VO6A 3UPXA 4AP7A 5J5SA 1CKJA 2GNHA 2FSLX 4ZTNA 4JI9A 1BL6A 2X2KA 3PIZA 4Q5HA 3UOLA 2CPKE 5IPJA 3F6XA 4ANOA 4O81A 4DFLA 3RKBA 3ROYA 5DG5A 3OHTA 3D2IA 2EUFB 4WG4A 2IVUA 1YKRA 4I23A 4ZTLA 5EFQA 4XG2A 4G1WA 4KRCA 3V5QA 3DXQA 3HKOA 3RZBA 3WYXA 4S33A 5IUGA 4CKJA 4LV5A 1XH4A 1KE8A 2C0TA 3LXPA 4R3CA 1GAGA 1PKDA 1JBPE 4YC6A 5BYYA 2WHBA 3UNKA 3QTSA 2UW9A 3C0IA 3RWQA 2ZM3A 4FV8A 2PMOX 3RPOA 5JRSA 4XOYA 2JITA 3BEAA 3KB7A 4DG0E 4RJ5A 4KINA 3C13A 3ZXTA 1OIUA 4FT7A 3Q9WA 4YHJA 1Q62A 5AJQA 5ETAA 2ITQA 3TT0A 5ANEA 3VUDA 2J0MB 4U8ZA 1AGWA 1OPLA 4IAIA 4RX8A 3PZHA 4HYUA 2JDSA 3HUBA 4ZJVA 3OP5A 2Z7LA 3G9LX 3ORPA 4GRBA 2A2AA 4D2WA 2OIQA 2W5AA 3D5XA 2JC6A 2G2HA 4FKSA 4UYAA 3BCEA 2BTRA 1WCCA 5DR2A 2VUWA 4NCTA 1WBVA 5CYIA 4UMPA 3TKUA 4X6RA 4D0WA 4YR8A 4RWJA 3FQHA 3H9OA 4YJTA 2ACXA 4G3GA 5HX8A 2YIXA 3O71A 3OWLA 4A9TA 2IPXA 4DINA 4DT8A 1ZXEA 1DI9A 4FV5A 4DCAA 5ANJA 4X3JA 2PK9A 2RIOA 4BYIA 3NNXA 2C5NA 3CXWA 3OMVA 3TL8A 4AW0A 5CNOA 2B9FA 3DB8A 3QU0A 2XJ0A 3KVXA 3RCDA 3VUHA 4ENXA 4FTUA 5M06A 3OBGA 4JBPA 3E5AA 3IK3A 3ZLWA 1P5EA 4FZFB 3PJCA 4FIEA 4AA4A 4NFNA 1PMNA 2AUHA 4MXCA 2OF4A 2BMCA 4O6EA 4TNDA 3UIXA 4BTMA 4G34A 5FGKA 3U55A 3I1AA 3W2PA 1M14A 4DGGA 3ZFYA 4F4PA 2WMTA 3PSCA 3V04A 2WO6A 1PY5A 2W06A 2WMVA 2XCHA 3EOCA 3U51A 2JAMA 1W7HA 5HE0A 2WTDA 1OI9A 3FEGA 3U54A 2Z8CA 4OBPA 4Z16A 4C3RA 3DQWA 2PHKA 3OWPA 3GT8A 4XYFA 1A06A 4YJOA 4TW9A 3GNIB 4W8EA 2CKQA 2WMAA 3SX9A 4E6DA 4FNYA 5JH6A 3QZFA 4O7ZA 5CF6A 2GNFA 5CQWA 5T68A 3CKXA 2W1IA 1YHSA 3PLAE 4BRXA 3R01A 3UJGA 4NFMA 3A99A 3F3UA 3DBEA 2HZ4A 4S31A 4IXPA 1Q97A 4QYEA 3KRJA 4FYNA 1XH5A 3MH2A 4FOBA 4P90A 4RIXA 5DMZA 4UX9A 4CQEA 4TN6A 2YWPA 2PVRA 3OS3A 5ANOA 4CRSA 4ZEGA 1OUKA 4X0MA 4E4NA 2HOGA 5LQFA 3QCYA 4KIQA 5DRDA 1M2QA 3NZ0A 1WBSA 4K77A 3AMBA 2ZJWA 4Y73A 5CI7A 3KC3A 1H28A 3R02A 4YPSA 1LR4A 2WEVA 3GB2A 4D2RA 3NAXA 3DK6A 5FP6A 5JZNA 4GVJA 1M52A 3DKOA 2BAKA 1PXNA 1Q3DA 3BGPA 5BPYA 2OGVA 5H2UA 3ZC6A 3QAME 2JIVA 3QD0A 4FKLA 3CR0A 1Q8YA 4FIFA 4CGAA 4YNOA 4W9XA 5EDRA 2UZBA 3MTFA 4M0ZA 2OXXA 1J7UA 1Q24A 2IVVA 3TXOA 4D2SA 3FQEA 4EQUA 4RX7A 3TJCA 5IUHA 3F2RA 4RIYA 3UP7A 4EH7A 3ANRA 2C3KA 3P0MA 4YP8A 4DA5A 3PYYA 3KULA 1H1PA 1H1SA 4JXFA 5FBOA 4QMQA 3FPQA 5FG8A 3K3JA 2UZWE 3OOGA 5EW3A 2RGPA 5IA4A 4NM0A 2Y6OA 4YJNA 2XNOA 3LLTA 4XV2A 3C50A 3A7JA 1PXPA 3VBQA 3QKLA 3PPJA 4XNEA 4CFVA 1ZOHA 3SV0A 3SHEA 4E3CA 5I9WA 4ZXTA 4J96A 3EZVA 5L8KA 1KE7A 5JGBA 4QQCA 5CU0A 4ZTSA 1MRVA 3IOPA 3PVBA 2X2MA 4RC4A 4RWKA 5CAPA 5HGIA 4ZY6A 1VJYA 1XH7A 5A14A 2PUNA 4IB1A 2R9SA 3FXXA 3I0QA 2DUVA 1ZOGA 4V05A 4JLCA 1G3NA 3AMYA 3RHKA 4XP3A 5FM2A 4Z7GA 1V0PA 2EXMA 2WOUA 4DTBA 3R1QA 4MF0A 5IQHA 4OTWA 5FRIA 4F65A 4S30A 5C4LA 1GIIA 4PY1A 3E8CA 4F99A 4TRLA 4IIRA 4XG6A 3KRWA 3QKKA 4FSRA 2WIPA 4FSQA 2BDFA 3ODYX 1KOAA 3Q5ZA 4ENYA 5EDQA 3MV5A 4D58A 3G0FA 4Y46A 4LFIA 5HNGA 4L42A 2YM7A 2DQ7X 4P4CA 5E90A 5AV2A 1KV1A 2E9UA 3OTUA 4WNMA 4K9YA 3UC3A 4PP7A 5L3AA 3NVMB 4B99A 3R9DA 4C36A 3DXNA 4FEUA 2JFLA 4FX3A 4W9WA 3D7ZA 4DH1A 1BYGA 3IS5A 1PXLA 3FDNA 3I6WA 4GUEA 5IQIA 3AC2A 2VX3A 5FP5A 3FXZA 2GCDA 3JUHA 3MB7A 3JVRA 4WO5A 3QHWA 2EU9A 4GFMA 5BVOA 2BROA 4MWHA 3QRTA 5J7BA 2B4SB 5CI6A 2ZVAA 3FE3A 2PE1A 4O7LA 4GW8A 1H00A 3EQIA 4IB5A 4PWNA 3TUDA 1WBTA 5HCZA 1BX6A 2Z7RA 3R8VA 3AC1A 4FIGA 2WOTA 3LPBA 4TWCA 4ZSAA 3HLLA 4I5PA 5IDPA 4A9SA 2GDOA 4RVKA 4BCKA 4N57A 1OL7A 1QMZA 3PJ8A 4FV6A 4FZAB 3NCZA 2XH5A 1OIRA 3WF6A 2W5BA 4HYIA 2C5VA 3F3ZA 2OU7A 1IG1A 2XF0A 1XBCA 4QMSA 3KMUA 5EHOA 4U80A 1UV5A 4TWOA 5TOZA 3UVQA 1XWSA 3E87A 3W32A 3GCVA 4FV9A 4D9UA 4ASXA 4EUUA 4E5BA 5LMBA 2VTMA 3L9NA 2XIKA 2C6OA 3Q3BA 2VWVA 1ZY5A 2WTWA 4ZP5A 3T9TA 1W8CA 3QRUA 3DK7A 5JFWA 5LARA 1AQ1A 3MPAA 5L8JA 4PPAA 5EI2A 1OZ1A 2W7XA 3UQFA 4ZTMA 1E9HA 2F7XE 3FUPA 4G3FA 3SRVA 5KZ0A 4H05A 4FEVA 2WD1A 2X4ZA 4ORKA 4GIIA 1ATPE 1Y8YA 2GPHA 4IDTA 4UB7A 3EQGA 3U6IA 3BZ3A 4JS8A 5HKMA 3E3PA 3UP2A 4TYEA 5CS6A 3ZSGA 3FMJA 1OIQA 3WF9A 4C62A 5A4TA 4O0YA 2B9JA 1H1RA 1NVSA 4R7BA 3A4OX 2R7BA 2YM8A 3TV7A 2UVXA 1R78A 3KF4A 5K9IA 1OVEA 1A9UA 5BUEA 4B6LA 3TEIA 2F9GA 1SNUA 3HP5A 4GS6A 4BHNA 2WMRA 3TUBA 5BX0A 3MFSA 4AG8A 3LLAA 2XRUA 4UEUA 4EK3A 4CFNA 3BE2A 5DNRA 2XIXA 2ZM4A 4B4LA 3L9PA 4F9YA 4WA9A 4MHAA 1OECA 4IVBA 2NRYA 4S34A 4XH6A 4CV9A 4U79A 4FV0A 3DNEA 2UW0A 3R30A 3C1XA 4KIPA 1WBOA 4GT3A 5FDPA 5IU2A 4KAOA 4L3PA 1KE5A 3OWJA 2XKDA 3FZPA 3PRFA 1JKSA 3ACJA 3BHYA 4L00A 5AV1A 5HE2A 2YN8A 3FZTA 3A62A 3D7TA 3NLBA 3PE2A 4E6QA 5C4KA 5HTCA 4YGAA 3QX4A 2P2IA 2WKMA 2F4JA 3C0HA 4FGBA 4ZZMA 5CF5A 3MI9A 4AXAA 1J3HA 5KMKA 4QTEA 3JY9A 3ZTXA 4E73A 3UZRA 3D4QA 3FQSA 4WRGA 4EOSA 1B6CB 2YFXA 3HZTA 5KHXA 2EB2A 2VV9A 4QTDA 2ZV7A 5KMIA 4DH7A 2VN9A 3PLSA 3DXPA 4APPA 4R5YA 4CD0A 2WTJA 4HGTA 4CMOA 3C5IA 4FTTA 3V01A 2WQBA 5E8ZA 4DEBA 3WZDA 3OZ6A 1H8FA 4IHPA 4OLIA 5EHLA 3CY2A 5G1XA 5HBJA 2F2CB 3V5WA 2JAVA 4CTCA 4YZ9A 3RCJA 2C5OA 5L2SA 4G6OA 1FQ1B 3AC4A 3CTQA 4M84A 5AUXA 1H24A 3OCGA 3QKMA 3ZLSA 4OBQA 4BWKA 3BHUA 4D1XA 5HG8A 3Q4TA 3V5JA 1VYWA 3AC8A 4Y95A 5DOSA 1Z5MA 5CF4A 1U5QA 3E88A 4R7HA 3HV4A 2JKMA 4FEQA 4DITA 4LV8A 3R8ZA 2EB3A 4RC3A 4CKRA 5CY3A 5J9ZA 3V6SA 5BVEA 2PULA 2W1FA 2J0KA 2UVZA 3DV3A 2VWXA 3TDWA 5GINE 4A06A 2CMWA 4BR3A 1U54B 2XM9A 1GJOA 1GIHA 1JQHA 3MH1A 4XX9A 4OTQA 4BBEA 4GYGA 3ENHA 3DS6A 3M2WA 1XKKA 2FGIA 3H9RA 4EQCA 4JNWA 2JFMA 5HCXA 3DBCA 4M69B 3PG1A 2VWBA 4N6YA 3D9VA 5M55A 5DT0A 5I3RA 3HRBA 4HPUE 2P2HA 3UVPA 4ZLZA 3EYHA 3NYOA 2QOKA 3MGYA 2JKQA 3GC7A 5CEKA 3G9NA 3DBQA 2GQRA 3PXZA 4I41A 5AR4A 5AX9A 4DN5A 3QTUA 2QOLA 3BHVA 1GIJA 3O23A 3PG3A 5LOHA 2AYPA 3FMMA 5AUUA 4O84A 4RQKA 1Q99A 4R8QA 5ANKA 4PMPA 2O64A 4ZY4A 4C4IA 3S00A 3P7AA 4ITIA 5HX6A 3RINA 3WOWA 2OH4A 3WF5A 4EC9A 4ZMFA 4FT0A 1IEPA 3PTGA 3BU5A 4FKTA 2FVDA 2HZNA 3O8UA 3EB0A 3OTVA 1DS5A 4WUNA 4F63A 2JGZA 2EXEA 2V0DA 1YDSE 3BKBA 4ALUA 2R0UA 2OIDA 4O0SA 4HYHA 4BCHA 2Q0BA 4JR3A 3FLYA 3W2QA 4AGDA 3PXRA 3ZDUA 3ZUUA 1R39A 5EI6A 4D4VA 5J7HA 2BAJA 5IA5A 3OF0A 5ANGA 3W2RA 4CCUA 2IZTA 4G6LA 3FMHA 3KCFA 3UO4A 5A46A 4E6AA 2CNQA 3VRYA 2QOOA 3LXLA 2R3RA 3OCBA 3QCXA 4GU6A 5DPVA 3HVCA 2FSTX 3VAPA 3HMPA 4M67A 4GSBA 5E1EA 1YWNA 4CFWA 5B2MA 4HNFA 4F9BA 1UWJA 3NNWA 3CTJA 3R73A 3CPCA 5HG9A 4R7IA 3UG1A 4XRJA 2WTVA 3B2WA 3LFBA 5EW8A 4DG3E 3QCSA 2VTAA 3NUNA 4C02A 4D5HA 5LVPA 2ZDTA 3MW1A 4I1ZA 4E5AX 3WIGA 4FEWA 5KMMA 2PMIA 3EL8A 4X2GA 3EQRA 2PVYA 4AE9A 3D15A 3L8SA 4RFYA 2ITZA 5ICPA 4FTKA 4FIJA 4LRKA 4K11A 1U46A 2HZIA 1E1VA 4L53A 3AT3A 2H8HA 3LFFA 4GFGA 5AP5A 5FTGA 5K0KA 4I21A 3K5UA 5A3XA 4HCUA 2OFUA 4QQJA 3L8VA 2W1DA 1OB3A 3U4UA 4WSYA 4IVDA 5KKRC 3QA0A 4MNEB 1SM2A 3MSSA 3A8WA 3FI8A 5I9ZA 1SVGA 5J9YA 2HELA 4Y8DA 3UOJA 3DFAA 3G33A 4GK4A 4RQVA 2PSQA 2EVAA 1ERKA 3ZEWA 2ZB0A 3KQ7A 3LCTA 4BDFA 4BDHA 4N4SA 4X6QC 3QGYA 5JT2A 4TT7A 3ZXZA 4XP2A 1QL6A 3QC4A 4FT3A 5DEYA 2CGVA 5IA1A 1KE6A 1BL7A 1CTPE 4MCVA 4XG8A 2XNEA 4FSWA 4UY9A 3LFQA 4RA5A 3DJ7A 2B54A 1WZYA 1FVVA 4KBCA 5D11A 3K54A 1WVXA 4PMTA 3IDCA 5AAFA 4LGHA 4L3JA 1ZRZA 3AOXA 5F94A 3VS7A 3ZO1A 5F9EA 5HQ0A 3ZLXA 3FAAA 3POOA 5TF9A 3UDBA 4AT4A 5HVJA 4D1SA 5HVYA 1YRPA 5CVFA 2ETMA 5AR3A 4F08A 2GSFA 2RKUA 4HZRA 4DBXA 4FSMA 2UUEA 4NIFA 4O38A 3EQBA 3DAJA 5CSWA 1GNGA 1Q3WA 3ZOSA 4BZNA 2ZYBA 4QQ5A 3VJNA 2UV2A 5E1SA 2XEYA 2YLFA 5FEDA 4QP7A 5KMJA 3ORXA 5CASA 5KE0A 3CEKA 4M12A 2X4FA 1XH9A 5HD7A 3KMMA 2ITXA 4FSYA 4QYFA 4WD5A 3JVSA 1OUYA 2AC3A 4NSTA 5ETIA 4QP1A 4FNZA 5HICA 3NUUA 4MD9E 1YDTE 2CDZA 3ATSA 5E8WA 1FINA 1YOLA 4D2TA 3ODZX 4QT1A 4FC0A 4BCMA 3BLQA 1YI3A 3N51A 3T3VA 4EH4A 4FSZA 4ZS0A 1OL6A 5M08A 3OVVA 1U59A 3UC4A 4UYNA 4EH9A 5HIEA 5IF1A 3WZEA 4RG0A 4L8MA 4LOPA 1CSNA 4QP4A 3BI6A 4TPTA 2XNNA 4TWPA 4F0IA 4QYYA 4F7SA 4Y83A 3VRZA 3DZQA 4RLLA 5AV4A 4CLJA 1YXUA 1OL2A 4BCQA 4CVAA 3LFAA 4C0TA 3Q96A 3Q5IA 3CQEA 3GCPA 2C68A 5I9XA 4KIOA 4IZ7A 3LW0A 5EM5A 5M4FA 4UWCA 5CLPA 2EXCX 3VJOA 5JSMA 4QMVA 4BWPA 4XLIA 2B53A 4X2KA 3UMXA 1PMVA 4WOVA 2ITWA 1PYEA 3JXWA 3F7ZA 3O17A 5EM6A 5F1ZA 3GU7A 4DEHA 5IEXA 4O91A 4ZAUA 3ITZA 3DOGA 4Y72A 2RG5A 4EOOA 1KSWA 1NW1A 4UMRA 4NM3A 3CTHA 3OT8A 3EQFA 3PP0A 4APCA 4QP3A 4RX9A 3RPYA 4IWDA 4AA5A 2QOHA 3F66A 2CKOA 3KFAA 3L1SA 3U4WA 3HMIA 3R7UA 4EK8A 4FTOA 2CNUA 3RK9A 5CU4A 5E9EA 1JWHA 1Y6BA 4L7FA 4F6WA 4AFEA 3R04A 4CKIA 2J90A 2BZJA 5A54A 5KCVA 3ORIA 2JIUA 5DHJA 3UGCA 3MYGA 4Q9ZA 2W1EA 3Q4ZA 3NUXA 4XP0A 5EYDA 5A6OA 2QNJA 3ZUVA 5GZ9A 2VTQA 3VS5A 4E20A 4EL9A 4HVGA 2A0CX 4C4EA 1TQPA 4I6BA 5JGAA 4PMSA 5GIPE 1M17A 3LXNA 2W9ZB 1JOWB 1QPCA 3VVHA 3I60A 3POZA 3TCPA 3QWJA 4G16A 2GS6A 3QRJA 1IASA 5LXMA 4J8MA 1CKPA 4EOPA 3CD3A 4LL5A 2PZRA 3BHTA 1F0QA 3PY1A 4IADA 5AAEA 3BBTB 3TDVA 2W1HA 4JOAA 1ZOEA 3ZONA 1BUHA 2HK5A 3H0YA 3F3VA 4ZTQA 3FI2A 4X2JA 3PZEA 5CZHA 3EL7A 4KWPA 4I5HA 5HVKA 4USDA 5CU6A 3MA6A 2UZLA 3RNYA 1UKHA 3OW4A 4D28A 4EOMA 5C1QB 3ZFXA 2G2FA 4FNWA 5HG5A 4AUAA 2YA9A 3HMNA 3HP2A 2XYNA 2E2BA 3KRXA 5DR6A 4RWIA 4XBRA 5DVRA 4BB4A 3HDMA 3F69A 1UNLA 3KN6A 3B8QA 3QL8A 4E4MA 3F5GA 3GC8A 3NW6A 1XH8A 4YZBA 3NGAA 2VWIA 5EM7A 1MUOA 3PP1A 4BDJA 2I0EA 4QMXA 2UVYA 3BQRA 2YHVA 2WQMA 3R8PA 4DEDA 4JIAA 5LMAA 2OFVA 3LCSA 3PVUA 4JBQA 5BNJA 5KUPA 3CS9A 2OSCA 4DF3A 4ZZNA 5C8MA 2ETRA 3DU8A 3LKMA 4NT4A 5B2KA 3CQUA 3SD0A 3NAYA 3AC3A 3H9FA 3AQVA
chains in the Genus database with same CATH superfamily
3KN5A 3NMUF 3ORMA 2GHMA 1XJDA 3VIDA 3PY3A 3R9RA 3M42A 3QD3A 5FEQA 3IW7A 4CZUA 4BN1A 3M1SA 4ZJIA 4AQKA 5ACKA 4TYHA 4YTCA 4CG9A 3PXQA 4I0TA 5CEQA 4RC2A 2Z02A 3JPVA 2YDIA 3LFDA 2QR8A 4I20A 3K5VA 1PRYA 3ORTA 4O27B 5AADA 5M07A 2P4IA 3LQ5A 3PFQA 5CSXA 3R9HA 2X81A 5CU3A 2QQ7A 3C4WA 2F49A 3LM0A 5AA9A 4I92A 4FZ6A 2UZVA 2F7ZE 3OBJA 2BIYA 2I0VA 3EMGA 4L9IA 4NTTA 3Q32A 5C9CA 2X39A 4MNEA 4M14A 4AT3A 4G5JA 3H3CA 5EYMA 2JDRA 3H30A 3G6GA 3VULA 3ZC5A 4CXAA 1JSVA 4LMNA 4RSSA 4XOZA 5IA2A 4HCVA 2J6MA 3ZO2A 4WG3A 2BRMA 2XBJA 4RJ7A 5JZJA 4F7JA 3UZPA 3UYTA 4U5JA 2V22A 4D4SA 5JKGA 4UMQA 4R77A 5F95A 2C69A 3KEXA 4FKPA 5IEVA 3PFYA 2IZRA 1T46A 4RMZA 1H25A 1W83A 5AAGA 3R7OA 3VBTA 2O5KA 3EWHA 5DGZA 2R4BA 4U45A 5AP7A 4JT3A 2UZOA 2ERZE 4G3DA 4QNAA 5AIRA 1TFFA 4I6FA 4U41A 3RAHA 3ZM9A 1JPAA 2YDKA 4DFZE 2XK8A 3SXFA 3RK5A 2WPAA 4YLJA 5HLWA 5IMEA 4FE2A 3E8DA 4YSJA 4L52A 3VN9A 4BZOA 4EQMA 4B8MA 3AD6A 3KMWA 1WVYA 5BYZA 3D7TB 3AG9A 4TL0A 4H1JA 3H4JA 3Q60A 4EK5A 5BVNA 1NT2A 4E4XA 3C4CA 4HGEA 5BMMA 3G6HA 4QOXA 2WZJA 5CZIA 3V51A 4F1TA 3AXWA 3V8SA 4AZWA 4RIYB 5CXZA 3FPMA 1TQMA 2VWYA 4W4VA 2YIWA 3EQHA 3NX8A 3A61A 1WFCA 3IDPA 4P5ZA 1OBGA 5DH3A 2QO9A 4NIFB 4H39A 4PQNA 2B0QA 3N9XA 1RQQA 4F9CA 5AUZA 3DAKA 5HLPA 5DFPA 3EHAA 4I6HA 4AT5A 3TI1A 3A7FA 3CY3A 3VWAA 4U42A 4DHIB 3P4KA 4ACCA 4AW5A 5BVKA 2CGWA 2DYLA 2X8EA 2OO8X 3FHIA 5AV0A 5D12A 2CKEA 2UZTA 4X3FA 5IH6A 5IQAA 4BC6A 4F64A 5AR2A 3QUDA 4AX8A 3MIAA 4IZYA 1XQZA 2PTKA 3QZIA 3AGMA 4ID7A 2XS0A 4NM7A 4U6RA 4P2KA 2OI4X 3VS1A 4PP9A 4AU8A 3ZRKA 3C4ZA 3MH0A 3WE4A 3OEFX 1ZAOA 2DS1A 1ZMWA 2JD5A 3HRCA 2QURA 3DAEA 4EZ7A 1FBNA 3V6RA 1BI7A 3COIA 3TV6A 3GQIA 4JL9A 4BIEA 3ZCLA 3EFKA 4DH8A 3JYAA 1SMHA 3UZTA 1FMKA 3THBA 3CBLA 1OPJA 4GVAA 1OMWA 4RVLA 1H26A 1R0PA 2GS2A 4DLIA 3OOMA 2I7QA 3UVRA 4DGLC 4WNOA 1G8SA 4QMTA 5AEPA 1G8AA 3QQJA 4EH2A 1Q8TA 4JBOA 2Z60A 3BYSA 2V5QA 2W4OA 4KBAA 5I9YA 3ENMA 1XBBA 2FH9A 2O63A 4RT7A 1M2RA 4EBWA 4GT5A 5IEYA 3UMWA 4JMQA 2VWWA 3QF9A 1OITA 4LG4A 4O86A 4DDGA 4YHTA 3ZRLA 3MA3A 1LPUA 4DH5A 4O7WA 4RBLA 4AA0A 4EK4A 1ZZLA 2XMYA 4GCJA 2VO3A 3BPRA 3PVGA 5J8IA 3CKWA 4CCBA 1ZWSA 5LWNA 3VO3A 3R2YA 3P7BA 2WMBA 4FODA 2VZ6A 5EI8A 4QP8A 3W1FA 3NYXA 4O2PA 3FI4A 2C6EA 2XK4A 3FHRA 3BV2A 3D5UA 4U44A 4IJPA 5FBNC 2Y0AA 4YLLA 5ACBC 4DAWA 4AGUA 3LXKA 3PIXA 3NW7A 2PVJA 5LVOA 5IQGA 3NEWA 4G17A 2WEIA 5KX8A 5M4IA 4IX5A 4QDEA 5ETCA 4DGMA 1CMKE 4OT5A 2XJ2A 3IW8A 4OTFA 3HEGA 4JJRA 1ND4A 2H34A 2P33A 1PXOA 4KIKB 2C5YA 4F9AA 1JLUE 1Y8GA 3EN4A 2GHGA 5HNIX 2J4ZA 2XK3A 5DRBA 2YAAA 3Q2JA 4GV1A 3F82A 3DPKA 4D4RA 2IO6A 4GL9A 4OTDA 2Z7QA 2WMUA 4OTHA 4QMNA 2QLUA 3S0OA 1O6KA 2B55A 3IW5A 3HDNA 1OKZA 4L6QA 3PUFC 4YBJA 5E8VA 4IC8A 3NS9A 3Q2MA 4M13A 5CAUA 1CM8A 3KVWA 4FA2A 3BGQA 3KKVA 2IW8A 1UNGA 4XEYA 4BCGA 2C6TA 1OM1A 3E64A 3E8EA 3DT1A 3HA8A 3OUKA 3UE4A 4AOIA 4CFUA 4BY9E 3KF7A 2PPQA 3QXOA 4CYIA 3TNWA 5CWZA 3I6UA 2P55A 3RZFA 4M3QA 2RG6A 4FT5A 4USEA 3OXZA 3II5A 3F5PA 3LE6A 1YXXA 3COKA 5CU2A 3WI6A 2X2LA 3QUEA 3IW6A 2XIZA 3BV3A 1H27A 2J51A 3QQHA 4KD1A 4RX5A 4LMUA 3CD8A 3BQCA 1O9UA 1JSTA 3ZSIA 4EKKA 4DLJA 4JX7A 3W0MA 2BALA 3QTWA 3PA4A 3R1YA 5CXHA 2Y4PA 4JX3A 5L6PA 4FBXA 1XMLA 1JVPP 4CFXA 4WHZA 3O7LB 4AW2A 4YTFA 5E4HA 4YJSA 3NUSA 2ZMDA 4ASZA 5K4IA 1K9AA 4EHEA 3BBWA 5CEMA 4EH5A 3G2FA 2B7AA 5HD4A 3L9LA 5BUIA 1Y57A 3E8NA 3VNTA 5AR8A 2R3JA 4C38A 5IQDA 2XA4A 4DCEA 3IONA 3VS4A 4WIHA 2JBOA 4CMUA 4UV0A 2OKRA 2PL0A 3QCQA 4HOKA 4M69A 5TO8A 1PMUA 2RFDA 2C30A 2NPQA 2HW6A 4N6ZA 4ZIMA 4MH7A 3WZUA 5EQEA 4GUBA 3ZO3A 4O2ZA 2WGJA 2BUJA 4UBAA 1UKIA 3KRRA 3HECA 2C6LA 4QTBA 2PYWA 5IKWA 3P79A 2VNYA 4C57A 1YXSA 3CQWA 4ZLOA 1MQ4A 1R1WA 4KIKA 3V8TA 4E8AA 4K33A 4XRLA 3S1HA 1OKYA 2O0UA 4IX3A 4ZSLA 4O0VA 5HU3A 5EW9A 4LOOA 3LFSA 3QQLA 4FI1A 4YO4A 4M0YA 1QCFA 3B2TA 3EQDA 3QTXA 2ZB1A 5E8XA 3S95A 4X3FC 2W5HA 4JQ7A 1GY3A 1Z9XA 4XLVA 1IRKA 3UIMA 4DFUA 2B9HA 4M68A 4BDBA 5K4JA 4L68A 2QO2A 5IA0A 4FTQA 3QZGA 2PUIA 4ERWA 2A27A 4J53A 2PU8A 1AD5A 4N0SA 3DZOA 3NR9A 3PSDA 4KSPA 3FMNA 2G2IA 2YEXA 4XG3A 1UNHA 2X0PA 4WNPA 4J99A 5H3QA 2E9VA 4FTCA 4QYHA 3U8WA 4FVRA 3TM0A 4I93A 2BRHA 4FV1A 3U87A 3WBLA 4FOCA 3ET7A 4HW7A 5IDNA 4M7IA 4NH1A 4Z9LA 2PVKA 4GK2A 3HGKA 1OL1A 2CJMA 4A9RA 1OBDA 3GEQA 3DY7A 3RJCA 3VUIA 5IH4A 3VS0A 4AXFA 3FMLA 3COHA 3SOAA 3BRBA 3HRFA 3Q6WA 2R3KA 4I6QA 3UPZA 4O22A 3FI3A 4A7CA 2YCFA 4PDSA 4WG5A 5AMNA 4RIOA 2ITNA 1WBWA 4M97A 2JIIA 4ACDA 2C4GA 4MD7E 4YHFA 2YM3A 4IX4A 5HG7A 4FMQA 2VGPA 4D1ZA 5DN3A 3LIJA 3FY2A 3GU6A 3NYNA 4W8DA 2LGCA 1FMOE 3NUPA 2Y7JA 1REKA 4AXEA 4EOLA 4EC8A 2QG7A 2QOBA 4FTNA 2ZV2A 4O0UA 4WBOA 4D2PA 4BWXA 2R3OA 4IFGA 4J8NA 4IM0A 2UZEA 4DTAA 2IG7A 4F09A 4YSMA 2YITA 2I40A 3U9NA 4NEUA 3ERKA 3V3VA 3ZS5A 3IO7A 5GZAA 4I22A 3VC4A 2QG5A 2OH0E 3QC9A 4C34A 2YDJA 2ETKA 3IPHA 4OGRA 2CGXA 4X3FB 3VW8A 4HYSA 5KMNA 2GFCA 2OIBA 4GJ2A 4OW8A 3TJDA 5EYCA 3MB6A 2WQNA 1J1CA 3HYHA 5CQUA 3QZHA 4MKCA 4U7ZA 3TNHA 3UIBA 3LZBA 4LRJA 3WE8A 5JFXA 4OT6A 4NU1A 2R3LA 5CSHA 4KS7A 2ITUA 3R71A 5GHVA 4U0IA 3IKAA 1DI8A 2ITOA 4ZMEA 4FL1A 4LL0A 5HBEA 5JEBA 3LAUA 5C8NA 1VEBA 3D94A 3ZYAA 5M56A 3VF8A 2VTTA 4IJ9A 5C01A 1W84A 4JIKA 2IZSA 2R3IA 2C5XA 3BELA 5AUYA 3BE9A 3LJ2A 4NUSA 3MVMA 4II5A 4PTEA 1NA7A 4H36A 1PF8A 4M15A 4RIWA 2R3FA 2VNWA 3JS2A 5CNNA 3HUCA 4CZTA 4EORA 5AUVA 3MFRA 2PZ5A 5HCYA 4DFBA 3TWJA 2P3GX 2R3GA 4R3RA 3Q4CA 4NTSA 3ZO4A 5LCJA 5BVFA 5B0XA 3NNUA 4IW0A 4XBUA 5DIAA 3FSFA 5J9LA 4BTJA 2J50A 1I44A 3VS3A 4FVPA 4O7SA 5A4EA 4AOJA 3BL9A 2R3PA 4KKHA 2OJIA 4Q2AA 4MXXA 3BLRA 2QU5A 5AP0A 3ELJA 5L2QA 4I4EA 3KXXA 3LMGA 4FVQA 4O82A 3OROA 1ZYSA 2JKKA 1O6YA 3DDQA 4J98A 5A4CA 3HV6A 4QMUA 4CRLA 2WIHA 2OJFE 3Q9XA 4HVIA 1IAJA 3IGGA 1OIYA 5DA3A 1JNKA 4HGLA 2XP2A 3W2CA 1JKLA 4C4FA 3MN3A 2HWOA 5E8YA 3MTLA 3VHEA 3BYMA 3CJFA 1QPJA 4KKEA 2VTPA 3SG9A 3DBDA 3SQQA 5M53A 4YJRA 4V04A 4GFOA 5HO6A 3IECA 4QQTA 2PVLA 3UNZA 4PUZA 4RJ8A 4ZJJA 1V0OA 3PPZA 4MF1A 4PTCA 4ANLA 3IG7A 4F0GA 1H4LA 5KNJA 4ZTRA 2ESMA 2ITYA 2OICA 4PPBA 3W33A 4JBVA 4YTHA 4KBKA 2PVHA 2C1BA 3TNQB 2CNVA 4JRNA 4QDVA 4QMPA 1LP4A 3WARA 4MBIA 5E91A 3OFMA 4AN3A 5H8EA 3DNDA 2YIYA 4IAZA 3P5KA 4FUYA 1W0XC 3UDTA 4YJQA 3UIUA 4BZDA 4A4XA 4F1MA 2NP8A 2FO0A 4XV3A 2BRNA 2YZLA 4RIXB 3CCNA 1YI6A 3VUMA 2HY0A 2OZAA 3KK9A 4ZLYA 2ZMCA 5J1VA 3DB6A 4ANSA 3FMEA 3L8PA 5D1JA 3ZM4A 3G90X 4FZ7A 4BBFA 2BRGA 4IAFA 4C59A 2G15A 1Q61A 2W99B 3PRIA 2XUUA 2QKWB 3QHRA 3W0PA 4HGSA 3ID6C 3NFFB 2OG8A 3QA8A 4EHGA 2X6EA 3NIEA 2J0IA 4LDTA 4Y85A 3P86A 3UYSA 4QYGA 3PWDA 4BI0A 5D9HA 3RALA 3GC9A 2JDOA 3ZHPC 1LEWA 3R2BA 4IZ5A 2ZOQA 1ZYJA 3UG2A 4FL2A 4XCUA 4XMOA 2UW5A 1UU7A 3RM6A 1X8BA 4DEIA 5BYLA 2Y4IB 2QOFA 4FKRA 4L67A 2PUUA 4MYGA 4P5QA 4AQCA 5BVWA 3CC6A 3R1NA 2VAGA 4WSQA 5I3OA 4LUEA 3SDJA 4JQEA 4EZ3A 4FGRA 2YCSA 5J1WA 2Y8OA 4FYOA 5B7VA 3S3IA 4C58A 3KXMA 3FZRA 5K3YA 5LVMA 4XG9A 1CKIA 3AKJA 4IZAA 3ALNA 3FYKX 2XB7A 1MQBA 2V7AA 4IVAA 4BCOA 4AZEA 2XNBA 3RP9A 2YJRA 3DKFA 3HAVA 4FF8A 3O51A 2KULA 4BCFA 4EI4A 4S2ZA 2BIKB 4ACGA 4XUFA 4E5WA 2BHEA 3PA3A 4G9RA 3UNJA 1ZZ2A 4FTRA 2XVDA 1ZYDA 3GU8A 4G3CA 3TN8A 3W18A 4PL3A 4F7NA 3P7CA 4AZVA 5A9UA 2VO0A 2VGOA 2UW7A 4YC8A 2BTSA 4W4XA 1Q41A 2YIQA 3FXWA 3I0OA 5E7RA 5J5TA 4DDIA 3VBXA 1T45A 2BZHB 4FSNA 4AZTA 3ZEPA 4LI5A 3NW5A 2EWAA 3O5AA 4Z55A 3B8RA 2WQOA 4DHFA 3KU2A 3Q52A 4DGOA 3OXTA 4G9CA 4F70A 3MVLA 4PV0A 4O0WA 2VRXA 4DFNA 4OTRA 4MX9A 3AGLA 4K1BA 5IZFA 3M11A 3PXFA 2JDTA 1XH6A 4YJUA 4ONAA 4DC2A 4TYHB 2C3IB 4UWBA 4IAAA 1JSUA 3VUTA 4CLIA 3GCSA 3VQHA 4USFA 5A4LA 1URCA 2VTRA 4OAUC 4BDGA 4AAAA 4XJ0A 2BDJA 4ACMA 1IA8A 4AWIA 2J7TA 5DLSA 3EJ1A 2WXVA 4IB3A 1ZYCA 4IMYA 4NM5A 1XO2B 5E92A 3NVKI 4IVCA 4EK6A 4GEOA 5EYKA 2O8YA 4QMLA 3QALE 2V7OA 3F5XA 4K0YA 4K8AA 2X9EA 3RAIA 4C4HA 4CT2A 2XANA 1IR3A 4AFJA 2FB8A 4O83A 3TZMA 3HAMA 1R3CA 1YHWA 2OJ9A 4DBNA 4FIHA 4FV3A 3F3TA 4CZYB 2SRCA 5EH0A 5AP2A 3O2MA 4FZDB 4YZDA 3MVJA 5AP6A 3V5PA 3DK3A 5IQCA 4FSUA 4V0GB 5DR9A 3KCKA 4X21A 5F4NA 2W4KA 4ANMA 1RE8A 4EOQA 5M51A 4IWQA 3SOCA 1REJA 2BKKA 2XKCA 4OTGA 3SG8A 4JDKA 4RVTA 4R5SA 4DG2E 4KS8A 3VS6A 3FC1X 2BKZA 2GNJA 2W05A 4U3ZA 5JMSA 3SVVA 3U6HA 3PDTA 3MJ2A 4FKOA 1QPDA 4MBLA 2NO3A 3JY0A 1R0EA 2XNGA 2BDWA 2HENA 3GQLA 4FSTA 1JKTA 5LCKA 5D10A 4YLKA 4C37A 3VW6A 5M57A 2R0IA 3ZDIA 4LYNA 4LOQA 3K2LA 4XG4A 2HW7A 1RDQE 4KABA 3FSKA 1V0BA 4FK6A 3QGWA 4Y5QA 3N4TA 4ZSEA 3TZ8A 2X7FA 1PW2A 3MESA 1GZKA 4DHJA 3UOKA 2WU7A 4FKIA 1Q4LA 1H0VA 3KXHA 4FG8A 4E7WA 3QYZA 3I7CA 1H1WA 3TIZA 3ULZA 3CSVA 3AC5A 4ANBA 3MJ1A 3WF7A 3RMFA 3EIDA 4K6ZA 5IISA 2WB8A 3PY0A 3BYUA 4EHVA 5EKOA 4A4LA 2A1AB 3W55A 2YLEA 3CJGA 3DKGA 4FKUA 1JKKA 4I3ZA 4C4JA 2A98A 2HXLA 4QPMA 5J87A 4AACA 2BFXA 1STCE 4NKAA 3QXPA 2YM4A 4YNEA 1W82A 2NYAA 4YMJA 2W4JA 3KXZA 4MQ1A 4KA3A 3ORNA 3R63A 4U97A 4O7RA 2VTOA 3LOKA 4IM3A 3E92A 2IN6A 5CEIA 1Q8WA 2X0OA 3DJ5A 3PJ1A 4GKHA 5KBQA 3ANQA 1E1XA 1YXVA 4LGGA 2XALA 1W2FA 1IAHA 4UZDA 3V5LA 1VZOA 3K3IA 2AC5A 4EZ5A 4GT4A 4I5CA 4U3YA 2JLDA 2BZIB 3R7GA 2XM8A 3GC0A 5HEZA 2GFSA 1YI4A 3QD2B 4I6LA 4BGHA 4RLKA 4ZS4A 4DH3A 1UWHA 3EN6A 3EN7A 2F57A 1QPEA 2VU3A 2YERA 3OUNB 4IANA 4I24A 5EM8A 2GTNA 3LQ8A 3UODA 4HVDA 5KKRB 3E3BX 4JVGA 4ARKA 3KXNA 3Q04A 4OR5A 3KREA 5FTOA 2LAVA 3KULB 4TYGA 5TT7A 3QBNA 5L6WL 2YWVA 5DYJA 4EWHA 3C4FA 3LFEA 2CSNA 1WMKA 3SA0A 2IWIA 3TUCA 3PJ3A 2OZAB 4JQ8A 4WNKA 3MDYA 4YZCA 4UMUA 2O3PA 2AQXA 4AGWA 5TE0A 4C4GA 3ORLA 2J2IB 4FTAA 4X7QA 4BICA 4G6NA 4OTIA 4O7YA 4ZY5A 3EZRA 1RJBA 2IF8A 3COMA 1XR1A 3QYWA 5I4NA 2C0OA 2PMNX 3I7BA 4HNIA 4BIBA 5M09A 4IH8A 5AP4A 5H8GA 3BWFA 4BCPA 3Q53A 4MAOA 1ZY4A 2KTYA 2GTMA 3IW4A 3UQCA 5ANIA 4S32A 2GU8A 1KV2A 4FG9A 3EFJA 2WMSA 4K18A 4RZWA 3W8LA 4D0XA 4ASDA 5IG1A 5HLNA 4JG8A 2DWBA 3EH9A 5KHWA 3ZBXA 3TNPC 4XHKB 3D14A 5E8TA 3BX5A 3Q9ZA 3QQUA 5C26A 3IOKA 2QODA 4R6VA 3WF8A 2H96A 3UBDA 4FKWA 3L8XA 2J5FA 3SKCA 2WMXA 3F9NA 3P1AA 3MWUA 4NKSA 1LEZA 4L45A 4BDCA 1BLXA 3DDPA 3FKNA 5DEWA 5CEOA 1APME 3MS9A 2UZUE 1KUTA 2XARA 4DEGA 2YAKA 5A4QA 4CV8A 2BR1A 4EYJA 1OGUA 4Y5HA 4HCTA 2C1AA 2GS7A 3CE3A 5I0BA 3BWJA 3ORZA 3S4QA 3ZSHA 2JEDA 3FMKA 1DAWA 4HVHA 1U54A 1NY3A 3GXLA 1XHAA 3PSBA 4F1OA 1OPKA 2V62A 4PL4A 3QTRA 3GI3A 2RL5A 4EOJA 2C3LA 1ZARA 3LFNA 3A4PA 4R3PA 4L44A 3A2CA 4AN2A 4U43A 3FWQA 4LRMA 3RI1A 4RJ4A 3F3WA 4OAVB 3QX2A 4TNBA 5KO1A 2YCRA 2XYUA 1JAMA 2R64A 3A7GA 4PMMA 1PHKA 3R7IA 4ASEA 2C0IA 2B1PA 1PMEA 2I0YA 3Q6UA 3D83A 4BKJA 5BMSA 4H3PA 4R1VA 3MBLA 1G5SA 4ALVA 1DAYA 4DEEA 1A48A 3DBFA 5H9BA 3ZUTA 3FY0A 3W2SA 4Q5EA 2GNLA 3SC1A 4KUJA 2O65A 3FYJX 4IEBA 4NJDA 4UALA 4UN0C 1V1KA 1S9IA 3MPTA 3BYOA 2VX1A 2WU6A 4J97A 3I4BA 3ZBFA 3UDSA 4FKVA 4WRSA 2OK1A 3SRVB 4NJ3A 1YOJA 4GYIA 5FUTA 2FSOX 5HORA 2WFYA 4RA4A 5IMXA 4R1YA 3PWYA 4IAKA 4C3PA 2QLQA 4FV4A 2GQGA 2YISA 2YM6A 4F6UA 3FL4A 5HO7A 2QOIA 4AF3A 3RVGA 4AS0A 3OCTA 3IQ7A 3DA6A 4QTAA 4KB8A 4IB0A 4E6CA 3NIZA 3QTIA 5KMLA 1SVEA 1XBAA 5GNKA 2WELA 5AIKA 4A9UA 3HV5A 3ZFMA 4EEVA 1UVRA 2R3MA 4RVMA 3NNVA 3F2AA 5G6VA 4QTCA 3R7YA 1GOLA 1Q8UA 3HMMA 4GH2A 1H01A 3W16A 5AWMA 3LVPA 3MIYA 4GJ3A 4D55A 3HV3A 4NZWB 4BYJA 3FZ1A 3TTJA 1Z57A 2R7IA 3HNGA 1PJKA 3HA6A 3OXIA 5AM6A 2O2UA 4FL3A 5T3QA 2C6DA 3OCSA 4HJOA 4L43A 4DEAA 2BAQA 3TKIA 5IQEA 4PL5A 3U6JA 3GBZA 3F5UA 3LCKA 1WVWA 5CTPA 3WZJA 4B9DA 4AXDA 3DLSA 3MFUA 4EHZA 2H6DA 4AZFA 2QKRA 3JR1A 2R5TA 4FTLA 4L46A 4F9WA 2W9FB 1YXTA 2HWPA 5IQBA 3SGCA 2VO7A 4U81A 2BFYA 3KL8A 5GJGA 2XK9A 4QMWA 3G0EA 3FC2A 4KSQA 1P4OA 3ROCA 3NRMA 5CEPA 3VUKA 4MXOA 4D9TA 2GNIA 3VF9A 5CAOA 4KRDA 2OXDA 4IAYA 4ACHA 3R7EA 3LM5A 5FEEA 3RTPA 3BHHA 1LUFA 1ZLTA 2A19B 4ZOGA 1S9JA 2WNTA 2X6DA 3VQUA 4EKLA 2CKPA 4LM5A 4YJVA 5HTIA 4ERKA 4O4FA 2C6KA 4FKQA 3R00A 2BPMA 5FLFA 3AKKA 1Q5KA 2BZKB 1UU9A 3PXYA 2IVSA 3AD5A 2XKFA 3N4VA 1U5RA 3OG7A 4O1PA 3V8WA 1SZMA 4FT9A 2PUPA 2PE2A 1OL5A 4O7TA 2IJMA 3C9WA 3IDBA 4FIIA 4IWPA 4QP9A 2VX0A 2E9OA 1P14A 1YW2A 2RFNA 2W1GA 4XV1A 1CDKA 4FTMA 1GZ8A 1L3RE 4FG7A 4D5KA 4DYMA 1SYKA 1M7QA 4X2FA 4C61A 4FV7A 3D0EA 5IUIA 4DE4A 5BUJA 2HY81 3DGKA 5CVGA 3E63A 1Y91A 2OJJA 4M8TA 3SXRA 2QOCA 2H9VA 2PY3A 2RSVA 4RRVA 3CP9A 3O8TA 3EQPA 1FOTA 5EDPA 5AM7A 3LMHA 3P9JA 4V01A 3RK7A 5IQFA 2WTIA 2XIYA 4OTPA 3ZLYA 2B9IA 2W1CA 3FJQE 2REIA 2Y9QA 3PVWA 4B0GA 3NSZA 4BIDA 5EKNA 5FXRA 1EH4A 4JAJA 3R0TA 3GUBA 3ETAA 4HPTE 1ZMVA 5B2LA 1KE9A 3E7OA 2PWLA 4KKGA 3V5TA 2NNWB 3KXGA 4PF4A 2YJSA 5IA3A 3OW3A 5CSVA 5M44A 3FBVA 2VTNA 4EONA 2PZIA 4YPDA 2CHLA 2G9XA 3C4XA 2ONLA 4ITHA 3R28A 3G5DA 3FV8A 3DJ6A 4P7EA 4V0GA 3TTIA 1HCLA 4C2VA 4MD8E 2ZV8A 4OBOA 2E9NA 5HZNA 1K2PA 3O50A 2W17A 4RJ3A 3LCDA 1HOWA 3OY1A 3ATTA 3GOKA 2GHLA 2XBAA 3AKLA 3OY3A 2ITTA 4FNXA 4N70A 3LHJA 4TTHB 3W0QA 4JR7A 4DT9A 3D2KA 4W4YA 5I9UA 4IX6A 4BTFA 1YWRA 3HL7A 3DTCA 4QP2A 5CX9A 5DT4A 3UOHA 3R9OA 3DKCA 5KZIA 3Q4UA 2OLCA 2OF2A 2J5EA 5AV3A 2UW6A 4WKQA 2J9MA 4RGJA 4G3EA 4CQGA 3NYVA 4ALWA 1PXJA 2PVMA 3ORKA 3LJ1A 3A60A 3N4UA 5EQYA 3RHXA 5AA8A 4B8LA 2B52A 5AUTA 4IFCA 4FKGA 4E4LA 3HMOA 4BCNA 4CFMA 2PE0A 3ACKA 4BF2A 5J95A 2ZDUA 3TYKA 1J91A 3HV7A 3R7VA 1OKVA 3F61A 5DT3A 3GFWA 3I5ZA 4O1OA 4L7SA 2CN8A 2Z2WA 3KIOC 2X8DA 4GU9A 4UZHA 4IBMA 4B7TA 1P2AA 4GG5A 4JDIA 4CT1A 3O7LD 4BDKA 2YIRA 4EOIA 4CMTA 2QVSE 3CIKA 4IC7A 4MBJA 4NW5A 3H10A 4JG6A 5FWKK 3BU6A 2FYSA 4LGDA 3FLZA 3TKHA 2JBPA 2XKEA 3O96A 4K2RA 4O0RA 5T6KA 2CLXA 3TACA 3PA5A 4MQ2A 5CSPA 3LJ0A 3EKKA 2HZ0A 4NK9A 4J52A 4O6LA 5AP3A 4ZSJA 1L8TA 2WAJA 2WQEA 4AN9A 3EFWA 1UU3A 4EWQA 4JAIA 3R9NA 3EYGA 5FXQA 2ERKA 2XZSA 4G5PA 4WT6A 4AW1A 4RJ6A 4BHZA 4CSVA 3NUAA 3LFCA 2CN5A 2F2UA 2OW3A 2XIRA 3KK8A 4C33A 1YOMA 3ZH8A 3GU4A 4CTBA 3QWKA 2BRBA 2X7GA 3BEGA 2VTHA 5ANDA 2IVTA 2CCHA 3UQGA 2J0JA 5H8BA 2UZNA 1J7IA 3PPKA 5AP1A 2IW6A 4RPVA 4BVUA 4QRCA 5EK7A 5L8LA 4I5MA 3UO5A 3S2PA 3GFEA 1I09A 1ZMUA 2XK7A 3NFGB 3I5NA 3BIZA 3HX4A 4JRVA 3MFTA 2Y4IC 2C6MA 4BDEA 5L2IA 3I79A 2XNPA 1BMKA 2PVFA 5HI2A 4C2WA 3ML1A 4L3LA 5GIOE 4L01A 3FLQA 4F0FA 3OT3A 1VYZA 4BCIA 4TXCA 1RW8A 2PMLX 3L9MA 5E8SA 4IACA