4ZJJA

Pak1 in complex with (s)-n-(tert-butyl)-3-((2-chloro-5-ethyl-8-fluoro-dibenzodiazepin-11-yl)amino)pyrrolidine-1-carboxamide
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
291
structure length
280
Chain Sequence
SDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PAK 1
publication title Optimization of a Dibenzodiazepine Hit to a Potent and Selective Allosteric PAK1 Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 280
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zjjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zjjA01
1V0BA 4LV8A 4AFJA 2Y8OA 3BV3A 4XOZA 4UWCA 4BWPA 2ONLC 4FKWA 4KINA 1E9HA 4FT7A 4W8EA 3TJDA 3SG8A 2I7QA 5C8MA 3FXWA 3C0IA 4OTRA 4YZCA 3FLSA 3IPHA 4KIKB 4HGSA 4WRSA 2OXDA 2XF0A 2V7OA 2B9FA 3TL8A 4JR3A 3PLAE 4EEVA 3V3VA 2EVAA 5A4EA 3KB7A 4JS8A 5LXMA 2C0OA 2WHBA 4EZ3A 3COHA 4YHFA 4QP3A 2X39A 5CY3A 3PVWA 3PXQA 4FYNA 4RJ6A 4D4RA 1H4LA 5LCKA 2EB2A 3FYJX 4C02A 2XIRA 4F99A 3HEGA 4ENXA 3TIZA 2BDJA 4DEEA 1XBBA 1TQPA 3H9RA 4O1OA 4TKSA 4FV7A 2V55A 3RMFA 2X1NA 5A6OA 5BVDA 1OKWA 3KRWA 1R78A 4I0TA 4D1ZA 5AP3A 1UNHA 4X3FC 3Q5ZA 3PPZA 3DXQA 3RWQA 3LM0A 5E90A 3HVCA 4M69B 4QMWA 4QPMA 2CCHA 2O64A 3OTVA 2XYUA 4I3ZA 4KIPA 3ZFYA 5GZ9A 5JFXA 3N4TA 4FSZA 1BLXA 3F3ZA 2IW6A 3D7TA 3ZFMA 3PJCA 2FSLX 5IQCA 4MX9A 4CZTA 2UW6A 4NFNA 4OBQA 3RAWA 4EH7A 4CKRA 5I9WA 2VWIA 2WGJA 4II5A 2PVLA 4H58A 1ZOHA 5TR6A 3DKCA 3GOPA 4RA4A 2DUVA 4DFYA 5HTIA 4M68A 1FGIA 3K3IA 2VTTA 4LGGA 3WZJA 5CVGA 2R5TA 5J9ZA 3O51A 5J7BA 4BDCA 3G5DA 2VTHA 3F5XA 3GNIB 3LE6A 3ZM4A 1ZY5A 2G2HA 5CF4A 3POZA 5DT0A 3OWPA 4FL3A 3CEKA 5CAUA 4PRJA 3NNXA 2ITXA 3FMDA 4MF0A 1JVPP 3ZCLA 2WMXA 3P08A 3LFSA 3P79A 3VWAA 2XNOA 2GS2A 2O63A 4IB5A 1YW2A 1OL6A 3UQGA 3ZRMA 1ZYDA 3V5LA 1KE6A 4FV8A 4QQJA 4ZP5A 2YWVA 2O8YA 4HCTA 3GB2A 4U8ZA 1Q5KA 2X7GA 3TKIA 4S31A 4YPSA 5FQDC 3VUIA 4CT2A 5AFVA 5I9UA 2X4FA 5J1VA 4QTBA 4QYFA 3U4WA 4G16A 4GVJA 4MQ1A 4N4SA 1YWVA 5IPJA 4KWPA 4BRXA 4I5HA 3ALNA 2WOTA 3I60A 4EQMA 3PJ3A 4HYUA 2YM7A 4KB8A 1GY3A 3RPOA 3SRVB 5F20A 4EC8A 3T9TA 5AEPA 5D1JA 4RIXB 4TNDA 4F70A 4EHGA 4E3CA 4OTQA 1KV1A 4WOVA 4WG3A 3GU5A 4PP9A 3LXPA 4AOIA 4E5BA 3HV6A 4BIBA 2YM6A 4RIYB 4AZEA 2RFEA 4HOKA 3EYGA 5K5XA 4G6OA 3B2WA 5J9YA 1WBVA 4O7NA 3MH2A 3U8WA 3VUDA 1PXIA 1K3AA 3R7YA 5IH5A 5L6OA 1Q41A 4RVKA 2IVTA 4IJPA 3SAYA 3ORNA 4BCKA 3O71A 4EZ7A 5E8UA 5EM6A 1Q3WA 4FIGA 2IWIA 3D9VA 3R63A 3BHTA 4WNKA 5JN2A 1P5EA 2PVFA 3IK3A 4ERWA 5EW9A 2C6EA 3C0GA 2WEVA 1J1BA 5BMMA 3D15A 1H28A 1W82A 5BYLA 3KY2A 3L9NA 4UYAA 4C8BA 1F5QA 4WD5A 4DT8A 1PXKA 1ZMUA 4LRKA 1PHKA 2OF2A 5H2UA 4RVLA 2EXEA 3DZQA 4MBJA 4IZ5A 3S0OA 1Z9XA 1H1QA 2J90A 4QMMA 4QMNA 5KKRC 4DF3A 2JC6A 1VEBA 2W1FA 4I24A 4ENYA 4IAZA 2F57A 2WTKB 2YM5A 2R3GA 4L68A 4FSUA 3MFTA 1UWJA 4FL2A 4GT4A 4CTBA 2CKOA 4CEGA 4JLCA 5AR7A 5BX0A 5M08A 5GJDA 3I6UA 5L8LA 1OMWA 4BI0A 3GENA 1GOLA 5M53A 3F3TA 1URWA 4BZOA 1CKJA 2BHEA 3EFLA 5L8KA 5M44A 5AJQA 4IVBA 3KXZA 1KE5A 2H34A 4Z3VA 3OW4A 5CALA 3MB7A 4AE9A 4PMTA 4PTEA 2YA9A 4ZY4A 3H30A 3V01A 4K6ZA 2C6OA 3UC3A 4RIWB 5CXZA 1ZYCA 3R7VA 4AW5A 4NSTA 4GJ2A 2ITNA 2PL0A 4NIFA 5ANIA 3MY0A 4K0YA 4O83A 3U54A 3OROA 4XG4A 3NW7A 1A48A 2XCHA 2HZ0A 5T3QA 2C0TA 4RJ4A 2CHLA 3DBFA 3F3WA 3W2PA 3QRTA 3OUKA 3OCGA 3ULIA 2QOFA 3ZXTA 4AT4A 5IEVA 3EZVA 3QTXA 5AIKA 3EFKA 2FSMX 4R78A 4IX4A 4EH2A 2IVVA 4LRJA 2Y4IC 4X21A 1UKHA 4KA3A 1WBPA 1ZXEA 3QRUA 3WYXA 5DPVA 4BCGA 4U9AA 3ZUVA 4HGLA 3LFAA 4U43A 4WT6A 3G9NA 5CNNA 1Y57A 4GG7A 3PFQA 2PUUA 5GINE 4MQ2A 3TUCA 2ZMCA 1XH6A 5ETAA 5DOSA 5D11A 3WF7A 5D10A 2KTYA 3BX5A 4BGQA 3POOA 3SW4A 2UW7A 3CQEA 2V22A 4AOJA 2F7XE 1QPCA 3NNVA 3AC1A 3QYWA 3FC1X 3CY2A 4JVGA 3DQWA 4FI1A 2R3IA 2UW4A 4GSBA 2EB3A 2ZV7A 4NW5A 1AD5A 2H96A 2PZPA 3EN7A 3AG9A 2HZ4A 3R2YA 5IDNA 5FTOA 3FQSA 5H9BA 2ZVAA 4B8MA 4ZLYA 4BCMA 3ZDUA 3IOPA 1QCFA 3ETAA 4HYIA 5JFSA 4IM3A 4H3PA 3MB6A 1URCA 4HZSA 5ANDA 3VUGA 4IVCA 1TKIA 4ZTHA 3DV3A 3OTUA 4ZSLA 5BVKA 3UOHA 3BBTB 2V62A 2X81A 1Q99A 4A9UA 1JOWB 2C6IA 4QMZA 3A7HA 3RHXA 3SKCA 4FSNA 5CU6A 3PA5A 3VHEA 2GHLA 4XP3A 2XM8A 3ZBFA 5CSHA 2CMWA 1FVRA 2WU6A 5CENA 1TQIA 1M14A 3IO7A 3LPBA 2OH4A 4PMSA 2XM9A 4YJOA 1MQBA 4QPSA 3UOLA 2GSFA 2BAKA 5KMOA 4P7EA 4FZAB 4MYGA 3AD5A 4RFZA 4BDKA 4CG9A 1AGWA 2ITWA 4IWQA 4JDIA 5EM8A 4A4OA 4C34A 5DN3A 1K2PA 5J79A 4JIAA 3SXFA 1ZARA 4FTCA 2PMOX 4TNBA 5E7RA 3VUMA 5AA9A 5L3AA 1YXSA 2I0HA 4KIKA 4AS0A 4FKGA 3WZUA 2FA2A 2VWWA 3OXIA 3HA6A 4C33A 4C3PA 3EKKA 1ZOEA 4TL0A 4IVDA 3NYOA 3FZTA 3R7EA 2C30A 4TYIA 3TTIA 2QKRA 2GHMA 4PX6A 2R3FA 2R7BA 4OT6A 4EQCA 5BMSA 1ZMVA 2OJJA 2BROA 4BCNA 4KBKA 3AC8A 3BIZA 3PTGA 1B39A 4P90A 4DG0E 1UU3A 3NNUA 4XYFA 3V5PA 3VS4A 2HY0A 2WMTA 2FUMA 2JKKA 3TEIA 3V6SA 3U6JA 4FE2A 3VS3A 4CGAA 3LFCA 4XCUA 4EUUA 2JAMA 4G6NA 3AD6A 2YDKA 4PWNA 3RZFA 4FZ6A 3EQDA 4BZDA 4EH5A 5CWZA 5IH6A 3KXGA 3SDJA 2Y4PA 4PNIA 5E8SA 5A4TA 4IVAA 4FIFA 5FXRA 5FBOA 4O7VA 5IDPA 3TKHA 4YJRA 2XKEA 4M69A 3C4CA 5I9YA 2X2LA 4I92A 4FOBA 3W2QA 2VTMA 4LOPA 1DAYA 3NUUA 5E1EA 3QRKA 4CLJA 4JG6A 4DLIA 1HCLA 2F2UA 4YTHA 5L2TA 2IN6A 4RG0A 2XKFA 5E9EA 4JRVA 3U55A 3KK9A 2V0DA 3Q4ZA 4UBAA 3VUTA 3ACJA 2C68A 3MSSA 4TY1A 4PPAA 4U41A 2Y0AA 5L6WL 2X6EA 3THBA 4FTNA 2E2BA 3BELA 3LXLA 5FDPA 4EZ5A 2R3JA 2HWOA 4HYHA 4RLLA 5C4KA 1FVTA 4L3LA 5CSPA 3EMGA 5ANEA 5DBXA 1PKDA 4FK3A 4AA4A 1GZ8A 4RQKA 2VD5A 4I0SA 5AUWA 1NVSA 4YZ9A 5HZNA 3UYSA 4AXAA 2QG5A 4AE6A 1J7UA 4GG5A 2YJRA 3QZGA 4D5KA 1XH5A 5JRSA 4XMOA 1A9UA 4RX8A 5C9CA 4EYJA 1VZOA 2BVAA 4EHEA 2Z8CA 1PJKA 2UVXA 3BLHA 3MPAA 1Y91A 4O0XA 3LMGA 3FMMA 2VN9A 3OOGA 4MNFA 1KOAA 2OLCA 2A19B 5CZIA 4CKIA 5K0XA 5IF1A 2QLUA 4KKHA 5EG3A 3DLSA 4QD6A 4XG6A 4CYIA 4E4NA 2F9GA 5C8KA 1XH4A 1WCCA 2W9ZB 3F2AA 3QLFA 1YOMA 4S32A 4ZZMA 1WAKA 4AA0A 4UZHA 4AT5A 4FNZA 2R7IA 5IA5A 5DEWA 4JG7A 3IDCA 3SRVA 1PXNA 4NYEA 3HRBA 3KCKA 2ITYA 4IE9A 4KUJA 4PMMA 4H3BA 4O0UA 4RIXA 5M51A 4BL1A 4H39A 4EOQA 5BVEA 4XP2A 1OKZA 4C38A 4OTPA 4RIYA 4F09A 3DK3A 3LKMA 3PXKA 1QPEA 3DFCB 5AP5A 4ANQA 5KZIA 5KO1A 2OXXA 5CF6A 4CCBA 2GFCA 4OTIA 5I4NA 3HV7A 5HG8A 4F0GA 4LI5A 3ULZA 4X3FB 5CYIA 3RINA 4FOCA 2IJMA 5BUJA 4L7SA 2Z7RA 3GQLA 3N9XA 4UMRA 4IWOA 5IQAA 3DB6A 1ZY4A 4MD9E 2VX3A 3RTPA 4RLKA 4F1TA 3H3CA 4Q9ZA 4KNBA 1AQ1A 3SXSA 3BU5A 4I6HA 3KMMA 4L6QA 4DLJA 2IG7A 4FSTA 4TXCA 2JBPA 5LVNA 2PVJA 2PVKA 4N6YA 4AGUA 5CVFA 4F64A 1FQ1B 4I5CA 5HVKA 3D5WA 1ZAOA 4WNOA 4QQCA 1P4FA 2YWPA 3BU6A 4Q5EA 3D14A 3KFAA 4NM5A 4EK4A 3K54A 4NM0A 2JAVA 2ITPA 2XK4A 2OF4A 4PL4A 4E6DA 1SZMA 3FMLA 3EQPA 2QO7A 3LFFA 3HA8A 3T9IA 3MIYA 3CD8A 2WQBA 3AT4A 2YIXA 3DGKA 2Z2WA 4UXQA 3R1NA 5DT4A 5A3XA 3ENHA 4U40A 3FL4A 5DVRA 2XBAA 1UWHA 2W96B 3IONA 4MBLA 4UEUA 3QD4A 1LPUA 5LVLA 2XVDA 4RIWA 4O2PA 3R8MA 2UZWE 2YIYA 3PXFA 5E91A 4FKVA 5FM2A 4F9BA 2NP8A 4R8QA 1WZYA 1EH4A 5FBNC 4ALVA 4D2RA 4YZBA 2BZHB 4M3QA 5CAPA 1XH9A 4ZEGA 2RG6A 4ZTQA 3TNHA 2IO6A 1WBNA 4L43A 4CFUA 4UWBA 1BX6A 4DBNA 4NCTA 3E62A 1Q4LA 2HCKA 4IM2A 2VZ6A 3N4UA 3A7JA 1GIIA 3AC2A 3BE2A 4JG8A 4JL9A 2PPQA 4IB1A 3VHKA 1OITA 4RX7A 2ZM1A 5FWKK 1YOJA 2QOLA 4EL9A 2ZYBA 3JVSA 4QP6A 4J97A 2IW8A 4DFNA 1O6KA 2VNWA 3RK7A 3LFEA 4O7ZA 5AX3A 3FY0A 1W8CA 2C0IA 5AUXA 4ANOA 1KE9A 4E4LA 2GQSA 3LQ8A 4KRCA 5FD2A 4FR4A 1UNLA 1SVEA 5M57A 3VBWA 3LFQA 3MESA 3P7AA 4YURA 2QOIA 5LMKA 4NWMA 2J51A 3U6IA 5FDXA 4BDBA 3O96A 4CD0A 3R00A 1H8FA 4DC2A 4PUZA 5KMLA 3Q4TA 3R02A 2QVSE 2ERZE 2RGPA 3FMEA 3H0YA 3OXZA 3QD0A 2VTIA 4PDPA 5D7VA 3RKBA 4FTKA 3GFWA 2NRUA 3ZFXA 4E73A 4Z55A 3PVUA 5KKRB 3C5IA 1JWHA 5EI6A 3I0OA 4C4GA 1XR1A 5JK3A 4HYSA 3OG7A 5HBHA 4FKJA 2QR7A 3QGYA 4D9TA 1WBWA 3ORLA 5CF8A 1WBTA 3HMIA 4KIQA 4O21A 1PY5A 1KOBA 2FSTX 4C3RA 3R8PA 5JQ8A 3GCPA 3Q9YA 1YDRE 4QRCA 2VX1A 2W0JA 3SLSA 4GFMA 4JBOA 4PNKA 4D4SA 1PXLA 1JKSA 1UU9A 3DXNA 2G9XA 4I6BA 4L3JA 2KULA 3ZLSA 4YJVA 4AG8A 3NYVA 3AXWA 2J6MA 4QP9A 2BIYA 5DR9A 3EQHA 4Q5HA 4EOMA 1T45A 2QONA 3I1AA 3F9NA 1Q8UA 4F7LA 4EORA 2W1CA 1Q8YA 3QXOA 2PE1A 2OO8X 3KXMA 4NZWB 4I94A 3UO6A 3DCVA 3LCSA 2BILB 4Q2AA 1Y8GA 4KD1A 1KUTA 2JIVA 3PXYA 1KWPA 4WBOA 3ZO1A 4MF1A 4XV9A 3P0MA 2R0UA 4PMPA 1QL6A 4O1PA 4QMQA 2OJ9A 4WA9A 3MPTA 2WQNA 2NO3A 4PQNA 5CX9A 5KBQA 4ALWA 5IQDA 2BKZA 3OCSA 2ZM4A 4FV0A 5E1SA 3SX9A 4FKIA 3V8SA 4ACMA 1L3RE 2Y4IB 3A99A 5AM7A 5B2LA 5CF5A 2HW6A 1MRUA 4B4LA 4W9WA 3SGCA 4QTAA 3NR9A 3P7BA 5AMNA 5LJJA 4HGEA 1OKVA 4FTIA 3QWKA 4TW9A 4R7IA 1SYKA 4WBBB 5EDPA 3UO4A 4E4MA 3VJOA 5EOBA 4GT5A 1MP8A 3C0HA 4YZMA 5H8EA 3I0QA 4R5SA 4XG8A 5D7AA 2R3QA 4RJ8A 4ORKA 1BI8A 5G1XA 4FTLA 5JKGA 3NUSA 5CQUA 2OGVA 3CQUA 3LOKA 2ZV8A 3OF0A 3U9NA 4NKSA 4ACDA 5C26A 1QPDA 5FEEA 2BALA 4G3CA 5IA1A 2R64A 4FSQA 3VF9A 4DG2E 2FO0A 2UZBA 4JIKA 4EONA 2I6LA 4XG3A 4YTIA 3ZMMA 2WPAA 1B6CB 4C2WA 5TO8A 1GZNA 2C6LA 4QMXA 2XS0A 3DAEA 3OS3A 4QYYA 5CI6A 5HICA 4IC7A 2PY3A 3HX4A 4FIJA 4IHPA 5AUVA 5LMAA 3VN9A 4AGWA 4TT7A 4FT5A 4GW8A 4KS8A 1H00A 4U81A 2X2MA 3LQ5A 4L44A 5AUZA 4QQ5A 2PYWA 3MWUA 5EM7A 1H27A 5AR8A 3LCTA 5IQGA 5F9EA 4Y8DA 3WOWA 3LFDA 3MIAA 1BL7A 1TQMA 3LAUA 1GIHA 2BKKA 2GQRA 4EH4A 3BYVA 1JSUA 3LJ1A 4Y95A 3ZO3A 3CGOA 4RA5A 1LEZA 3FKLA 4CKJA 2PE0A 1OIUA 4S30A 1RQQA 1PYXA 4BVUA 2ONLA 3BGZA 4EC9A 4AUAA 5CZHA 1U5RA 1ZOGA 3V6RA 2VX0A 4FSYA 3LJ2A 5IQFA 3H4JA 1YOLA 4BTKA 3EQFA 4FODA 4L53A 5FLFA 4EH6A 4XBUA 4FIEA 4JNWA 4GVAA 4I5PA 5ETFA 3L9MA 3RALA 2BAQA 4ZIMA 2O5KA 5E8WA 4HVDA 2XJ2A 4AGCA 1WBSA 2ACXA 4FT9A 1PXPA 2UVZA 2X6DA 3HKOA 1G3NA 1WFCA 1MUOA 3LFNA 1ERKA 4E6CA 2NPQA 3W16A 4IQ6A 4K9YA 5EOLA 4DAWA 3GU8A 2CCIA 2H6DA 3ZZEA 5EFQA 3EZRA 5AV1A 3WF6A 4X2NA 4MEDA 3ANRA 3TJCA 1OL2A 2G15A 2WIHA 2C69A 4MNEB 4DGGA 2UW0A 3BGPA 4E1ZA 5BVOA 3CD3A 1IAHA 5B7VA 4OTGA 4DTKA 5AV4A 4I41A 2Z7LA 5HESA 3BPRA 4JDKA 2QI8A 3HP2A 5CU0A 5LMBA 1IR3A 2V5QA 2XUUA 4FSWA 5A9UA 2XIKA 1YKRA 4GRBA 5HORA 1GZOA 1NA7A 4FV9A 4L00A 2ITVA 4X3FA 5L2SA 3I5NA 3FJQE 2X9FA 3NCGA 3HMPA 3NAYA 2WMBA 2YCQA 2JDRA 2B53A 4O0WA 1JPAA 3OCTA 4L9IA 5BVFA 3CE3A 3R0TA 3OT3A 3NWWA 4K33A 2YHVA 4AGDA 3AGLA 4F9CA 4DBXA 5ACBC 3S1HA 3BHVA 4FC0A 3RGFA 4BYJA 1XBCA 3LCKA 2WKMA 2OWBA 3RJCA 1XQZA 3L8PA 4QMUA 4R1VA 3CXWA 3VULA 4A4LA 2E9NA 2XRWA 5L2QA 3DAKA 4BCIA 1REKA 4GK2A 3GP0A 3PE1A 2QO9A 3QF9A 2HY81 1GZKA 3DBCA 3V5QA 4ZZOA 2RG5A 2RSVA 4QYGA 3HUCA 2ZDTA 3I7BA 1YI4A 2C47A 1SNUA 4M66A 4PDSA 3ZDIA 2P2IA 3NZ0A 4S2ZA 2RKUA 3I6WA 2WOUA 3UE4A 2PVMA 2P2HA 3PJ8A 1YWNA 1OL5A 2R0IA 3BBWA 4BYIA 5L8JA 1YXVA 2YLFA 4YHJA 3TG1A 5EQEA 3MA3A 3FBVA 4JI9A 4O2ZA 3CR0A 4O96A 1KE8A 3F5UA 2PTKA 4IW0A 3NGAA 2Z02A 3FV8A 4USDA 5I5ZA 4DH7A 4GL9A 5TT7A 4OAVB 3PRIA 5DR2A 3D5VA 2YAAA 3LQ3A 2QG7A 2Z7SA 3A60A 1Y8YA 5CU4A 2HWPA 2OJIA 3R7GA 4ERKA 3ELJA 2XP2A 3FZSA 2ITOA 3TUBA 3VNTA 5AIRA 5F4NA 2W5BA 4GIHA 4ZJJA 3GUBA 1M2PA 4BCFA 5EI2A 5BVNA 4ALUA 1XKKA 2XMYA 3QGWA 4BN1A 4E26A 1O6YA 2IZUA 3GOKA 3NYXA 4FGBA 3FI3A 3MH3A 2GNFA 3EN5A 1OBDA 4EBVA 3BV2A 2BDWA 3PYYA 5DWRA 1S9JA 3ACKA 3VQHA 5ITAA 4FT3A 1OL7A 5M55A 3TT0A 3ZO4A 2GU8A 4ZY5A 3LXNA 2VTQA 4GYGA 3UPZA 3FI4A 1L8TA 5C4LA 4DE4A 3QC9A 5FGKA 1Y6BA 3HUBA 5EHYA 3COMA 2UZUE 5K9IA 3FEGA 1UNGA 2BTRA 3CC6A 4IACA 2CGUA 4D5HA 4DTAA 4IDVA 4ZSJA 4O86A 4NJDA 2VTRA 4BBEA 4K1BA 3MTLA 2PMLX 4IB3A 5CLPA 4ZTMA 1FMOE 4O84A 1BUHA 2JIIA 3ZRLA 3UNZA 3QQKA 4QPAA 2C5NA 3M11A 3OY1A 3PVBA 1UU7A 3VBYA 3QCXA 4Y73A 5DRDA 4NJ3A 3G6GA 3UGCA 5DRBA 4MD7E 5IKWA 2GNLA 1F3MC 4XX9A 4F9WA 2GQGA 5HNIX 3P86A 4YTFA 5D41A 3TUDA 4FTMA 4CMTA 1U54B 3BQRA 2YITA 4RMZA 3K5VA 4G1WA 3P23A 5EQPA 2J0JA 4RWLA 3HP5A 3LCDA 2JGZA 3G6HA 2QOHA 5HO8A 4M15A 3L8XA 4ACCA 3MA6A 3TCPA 2PVHA 2J0KA 3EN9A 4AZSA 1YWRA 4ITJA 4L3PA 5E8TA 5CEIA 1JSTA 4DITA 4MBIA 5IEXA 5IH4A 3IECA 3C51A 5FG8A 4EH9A 2A1AB 2CN8A 4RJ7A 2BPMA 3U9CA 5KMIA 3PZHA 3WBLA 3UZTA 3OT8A 4J7BA 4RVTA 3EL7A 2QHMA 3RP9A 2WO6A 4FKPA 4LRMA 5HOAA 3UIXA 5DG5A 4QYHA 2JBOA 3UZPA 5KUPA 4LL5A 2B0QA 4FG7A 2BHHA 2CLQA 4OTDA 4QTCA 2CN5A 3IW7A 5GJGA 3KA0A 3GU7A 3DLZA 2DYLA 4H1MA 4IZAA 4NTSA 1Q8ZA 3ZEWA 4EOKA 3ORIA 5BVWA 3HDMA 4FVPA 3GVUA 3ZOSA 3C4XA 4A9TA 3HAVA 5H8BA 4BDAA 3PSCA 5AAGA 5L2IA 5B2KA 4DEIA 3CSVA 3O17A 5EH0A 1DI8A 2C6MA 3UBDA 3U4UA 4H1JA 4KIOA 3AT2A 4EOIA 4P4CA 3E8DA 3DNDA 2WFYA 3PE2A 2GCDA 3A61A 4X3JA 3W10A 3BHUA 4UWYA 4IBMA 4IWDA 4F6WA 3EL8A 5HCXA 5H3QA 1Q3DA 4Z7GA 2VWUA 3C1XA 5M4CA 3DJ7A 4YGAA 4CZUA 4R7HA 4XV1A 1DI9A 4CQEA 5E8VA 5KE0A 4RJ3A 1XBAA 4GMYA 2BFXA 3L9PA 4LG4A 3DS6A 2YISA 4IJ9A 2CKPA 1PXJA 3LW0A 3PXRA 4IH8A 4M0ZA 3S4QA 2OFVA 3LCOA 3Q9XA 2QD9A 4V0GB 5EDRA 3SC1A 4O7TA 3DKGA 2R3PA 3D7ZA 4F7NA 3D4QA 5HG5A 5LWMA 4AF3A 3OWLA 3M1SA 4AN9A 4ANMA 4BR3A 5E8ZA 4JQ7A 4X2GA 3WF8A 1CKIA 1DM2A 2WQEA 3P78A 3B8RA 4D0XA 3BYSA 3NVKI 3HZTA 3LZBA 3EKNA 4IC8A 4UMUA 1PMEA 5LQFA 3R22A 5CEKA 2HZNA 2QCSA 4BB4A 2VO6A 3F6XA 5J8IA 2QODA 2IZTA 3GBZA 3O23A 3ORKA 3PIXA 3BYOA 1H0WA 4X6QC 4XH6A 3E64A 2RFSA 4MXYA 2Z7QA 3BU3A 3FMKA 4D1XA 1YHSA 4IMYA 4R3PA 3TWJA 3PXZA 3FXZA 4DH3A 5JQ5A 3QWJA 2ZAZA 1Q62A 3PWYA 3WE4A 2YIQA 5IUIA 1OUYA 1WMKA 2Q83A 4AZTA 3ZS5A 3LIJA 4R1YA 4WNMA 4B99A 3SW7A 5HLPA 5KBRA 3Q52A 2QNJA 4QT1A 4F7SA 2UW9A 2PVRA 3VUKA 3SHEA 3U87A 5DMZA 1OI9A 3HECA 1Q8WA 1PMNA 2BMCA 5A46A 1FGKA 5HVYA 4W9XA 2J9MA 2BRHA 3QQHA 4HNIA 1OL1A 4YU2A 5DI1A 4ZLZA 4BZNA 4X6RA 4CMOA 4MK0A 4AN2A 4OR5A 5E92A 4ZS0A 2YACA 4QTDA 3NAXA 4EK8A 4CZYB 5AM6A 4GT3A 4MNEA 5HI2A 1PW2A 4GFOA 4OUCA 4TWCA 4PPCA 4GK3A 4NU1A 3JY0A 3NX8A 3OXTA 5EI8A 3OWJA 5CQWA 5BUEA 4ANBA 5I9XA 3PY1A 4FKLA 5JZNA 4O7SA 3FPMA 1IA9A 3NSZA 4ANSA 3H10A 2QOKA 3OD6X 4PF4A 4FMQA 1ZYSA 4U5JA 2EU9A 5AR4A 3VIDA 4FEUA 4TN6A 3KXXA 4YBKA 5KMMA 3AMAA 4QTEA 2CNQA 4J53A 2XKCA 5C01A 3PPKA 2H9VA 4RWKA 3HLLA 2VWYA 4RGJA 5DT3A 4LV5A 2HYYA 1ZZ2A 5CS6A 4BDHA 1WVXA 3V51A 3U6HA 1LP4A 2XZSA 3W2SA 4ZTSA 3KL8A 4N6ZA 5CU3A 3JY9A 3ZEPA 4X2JA 4N57A 4BKZA 2GTMA 3QUPA 1STCE 2BRNA 4RC4A 3TNPC 3V5TA 2UVYA 3KRJA 3HV4A 4TWNA 2WTVA 5T68A 3FKOA 4DEBA 4QOXA 4AACA 5BQ0A 2I0VA 1UV5A 4ZTRA 4N70A 4YTCA 3ZO2A 3P5KA 4TPTA 1YVJA 4UALA 2JFLA 4OAUC 1PXMA 3RM6A 3TV4A 4FT0A 3UNKA 3KXNA 2ETMA 4BGHA 3R1QA 4FSRA 2X9EA 1T46A 2R3KA 3JYAA 3CPCA 2CGVA 4OBPA 2CLXA 4OTFA 3KU2A 3ROYA 4XV3A 5JZJA 1YXXA 1OB3A 4CV8A 3BZ3A 3F5PA 4HPUE 2O2UA 4FBXA 2GNGA 2HENA 2F4JA 5JT2A 5M56A 1RDQE 2UZNA 1P2AA 3GU6A 3MI9A 4HPTE 3G51A 4LUDA 4N0SA 3QL8A 1PF8A 4NKAA 3V5JA 4MWHA 5EHLA 4AFEA 3Q9WA 4NUSA 4G31A 3AD4A 2W05A 4NM3A 4WHZA 3KCFA 3CTJA 3V8WA 3QQFA 1PYEA 1YI3A 1J1CA 4EWQA 2FB8A 2YLEA 2AC5A 2XCKA 4QMSA 3PJ1A 3PUPA 3W32A 2ETRA 2E9PA 3UIBA 1HOWA 2QOQA 2IZRA 4RPVA 2J0LA 4FTJA 4RC2A 4DH5A 4AQCA 2YM4A 3MS9A 3UPXA 3E93A 4YC8A 4F08A 2PVNA 2I0EA 4IDTA 4LUEA 4V05A 1H08A 3BCEA 4GS6A 2G01A 3FSFA 3QX4A 3LMIA 4QP4A 3WI6A 3GC7A 3NLBA 5EYCA 1KSWA 1NY3A 3SOAA 5CVHA 4EOSA 2C5XA 4DEHA 4JQ8A 2B4SB 2G2IA 4ACGA 3E7VA 3I4BA 4FYOA 3OCBA 3OWKA 4G5JA 4ZSGA 4LGHA 1Q61A 1VYZA 2C6KA 4QMPA 2GFSA 3AC4A 3DU8A 3MJ2A 4JDHA 2EXCX 4FV4A 2DQ7X 2YJSA 3BEGA 1K9AA 3ZC6A 3O7LB 2PZYA 2W4JA 4RIOA 4YJSA 5FTQA 5IUHA 3VS1A 4A9RA 2VRXA 4G3DA 4EUTA 5A4CA 3AMBA 3LVPA 4BCJA 3A7GA 4O0VA 5EYKA 5DR6A 4D2WA 2QO2A 1H1SA 2W4KA 3BE9A 3UMWA 4DGNA 4IAKA 3RHKA 4BDIA 2JKQA 2W1HA 1MRYA 1WBOA 4V04A 4FEVA 3QXPA 4YJUA 2GDOA 5IQBA 3A7IA 2RF9A 5HE2A 3EIDA 1NVRA 3BLQA 4AZWA 2VU3A 1U54A 1OUKA 2BAJA 5CAOA 2FSOX 3OEFX 4G2FA 4FUYA 3PZEA 3Q53A 3P4KA 5J95A 4EI4A 4PDYA 4D28A 2YEXA 3TM0A 4M0YA 2X7OA 4JQEA 2PUPA 3F88A 3W33A 2X4ZA 1GIJA 4I6QA 4Y72A 1VJYA 4FV2A 3RPVA 4FVRA 4MXCA 4D1SA 2HIWA 2XRUA 3VBTA 5HLWA 4EH3A 4C4JA 3PG3A 2B7AA 2HELA 3NUPA 3W55A 3PDTA 4G9RA 5KMJA 3ZLWA 1OECA 4DEAA 3M42A 4XOYA 4BCPA 1W98A 3KK8A 3OBJA 3QX2A 2FH9A 3PSDA 3W2OA 1P4OA 1ZZLA 4RT7A 3OZ6A 3QBNA 4U44A 1U59A 1F0QA 1H24A 2P3GX 2B55A 4ZMEA 4GU6A 3FZ1A 3TACA 3S3IA 3F3UA 4AWIA 4R6VA 4CFNA 4J8MA 2UUEA 4YJPA 2ZV9A 4PY1A 1CKPA 2YIRA 2JKOA 3KF4A 3QTIA 2WXVA 2XJ0A 4PTCA 4YC3A 2QOBA 4QP7A 5A6NA 1Q8TA 3RK9A 2VWVA 4TRLA 2B54A 2WMWA 3WF5A 5FP5A 3E87A 2WB8A 3VVHA 4BWXA 3F82A 2WTJA 3WZEA 4ANNA 4EKLA 4ZAUA 3ZSGA 2W1GA 4IWPA 4QMVA 4D9UA 3R9RA 2JDSA 4QQTA 4U97A 4DFBA 1IEPA 2G2FA 2O0UA 3TDWA 4DHFA 4EBWA 4DINA 2XNEA 4K77A 3QRIA 4ONAA 5LVPA 4EQUA 5M4UA 2X8EA 4B6LA 3K3JA 5CSWA 2WU7A 3CPBA 4V0GA 4XV2A 3RM7A 3RCDA 4C0TA 4IX3A 2REIA 5HD7A 1X8BA 4CLIA 3OOMA 4EK6A 5LARA 3VJNA 3R7UA 2OK1A 2W99B 3LXKA 4FV5A 2GNJA 2J5FA 3QQJA 4M67A 4ITHA 5EKOA 2XEZA 4YSMA 5A4QA 2HAKA 3QHWA 3WF9A 3CCNA 2GMXA 4FNYA 5F94A 4BIDA 5AUYA 4DFLA 2P4IA 2XJ1A 4MHAA 3ODYX 4H36A 3QC4A 3G0FA 3CIKA 2OJFE 4FV1A 3IGOA 4F9YA 5BYYA 4QP2A 3QA8A 3UO5A 4ZY6A 4F1OA 3KXHA 3TZ8A 4GIIA 3LHJA 1RW8A 2YCSA 5HKMA 3ZC5A 4BI1A 5A4LA 5JEBA 4BBFA 2ZJWA 5FTGA 3VS7A 5EK7A 1YDTE 3MVMA 2XK8A 3NS9A 3FZOA 4J98A 5K5NA 3NVMB 4NT4A 3HAMA 3F66A 5IMEA 4AZVA 2CJMA 4FEWA 4M12A 4W8DA 4OTWA 5LCJA 3KVWA 3SG9A 1R0EA 4IANA 3S95A 4ZMFA 2RFNA 4J99A 3FLZA 3FHIA 5TF9A 3PIYA 4FKQA 1NT2A 1I09A 3LMHA 3DKFA 5J7HA 4IAIA 5AADA 1W83A 3ENMA 1SVHA 3ZTXA 2PZRA 4RWJA 4DFZE 3R04A 5HLNA 1P14A 3TI1A 4MXAA 4EOLA 3VO3A 3F3VA 4BDEA 4BTJA 5CU2A 1H1RA 2WELA 3KF7A 4M13A 3EHAA 2FGIA 5A14A 4WUNA 4W4WA 2UW3A 3Q60A 2XNGA 3F2NA 3VS2A 3ZONA 3TTJA 3NW6A 4BFMA 3CKXA 2J4ZA 3OY3A 4D0WA 2XH5A 1M7NA 3UP7A 4C4EA 2B9IA 3KEXA 3MPMA 3MTFA 1H1PA 4QMYA 4WSQA 5FEQA 3KRXA 4B0GA 4AW2A 1OPJA 1U4DA 4B9DA 4YUQA 1H1WA 1OPKA 3EB0A 3WIKA 2CNUA 3GFEA 4LMUA 4G3EA 2Y6MA 2J5EA 2B1PA 3T3VA 4XJ0A 4JR7A 4BIEA 4Z7HA 1VYWA 4X2KA 5EDQA 4I21A 2GS6A 5C8NA 4M7IA 5G6VA 4KKGA 3A62A 1ZLTA 2XK3A 3H9OA 4XEYA 4I23A 5BUIA 2BZJA 1NVQA 3KQ7A 3KKVA 5DIAA 4FGRA 3ROCA 2C1BA 4L8MA 4J52A 4ACHA 3AGMA 4Y5HA 2ITZA 4I22A 5ETCA 4W4VA 4AU8A 4E4XA 3TN8A 3Q6UA 2QOCA 2GNIA 5K0KA 3DJ5A 4MKCA 4XHKB 3EJ1A 3N51A 5DH3A 3FPQA 3R9OA 4CQGA 3UIMA 2NRYA 4G3FA 4F1MA 1R1WA 2Z60A 2W1ZA 3MBLA 3V04A 4HW7A 3ZRKA 4USEA 5B0XA 4M8TA 3ZSHA 4BDGA 4A06A 3R6XA 3ZU7A 1SVGA 2JDTA 3AT3A 3CY3A 3DZOA 4FKOA 4CFVA 4RWIA 3WZDA 5JRQA 2VV9A 3PLSA 2W7XA 4D2PA 2WMSA 3E3PA 3TZMA 3DK7A 3PRFA 2ZB1A 3GCVA 4YR8A 4OW8A 3CJFA 2BFYA 5HCYA 1Z5MA 5JGDA 3FI8A 4WG4A 3L8VA 3RAKA 5JFVA 5KHXA 2W5AA 2YDIA 3E8CA 1RE8A 2YIWA 3AQVA 3SA0A 2PE2A 4BI2A 3L1SA 2BRGA 4MVFA 5AP4A 5IU2A 4V01A 5IQHA 2UZEA 2ITUA 2OZAB 3A8WA 2CPKE 2OZOA 3FWQA 4W4XA 3Q4UA 3W8LA 2XYNA 2X0GA 2P0CA 3COIA 4J96A 5CEOA 5IQEA 3DB8A 3BKBA 4S34A 3Q6WA 2BZIB 3BEAA 5M07A 2YCRA 4CRSA 4C36A 1ZRZA 4H3QA 2Q0NA 5HE3A 4FV6A 4EOOA 4CFFA 5I9ZA 3HL7A 3OC1A 4BGGA 2IVUA 4Y85A 2PZ5A 2XK7A 2CGXA 5HEZA 3ORZA 4RZWA 3DTCA 3PA3A 3VBQA 4ZSEA 3QU0A 1E1XA 1Z57A 3RPYA 2IW9A 3E88A 2C5VA 4CVAA 3GT8A 4DGLC 3UYTA 3M2WA 4KAOA 3MFRA 3MV5A 3FXXA 1YXTA 2JLDA 1JQHA 4PTGA 4IZYA 4ZZNA 3RAIA 3FL5A 3DTWA 1JKTA 3TNIA 3A8XA 4U80A 4UX9A 2A4LA 4JOAA 4OLIA 1FOTA 2PVYA 4U42A 3C9WA 3SQQA 5AAFA 3RCJA 4G6LA 3A4PA 4FNXA 4GKIA 4TYHA 1ZWSA 3AMYA 4C3FA 5CEMA 1Y6AA 2J0IA 4HNFA 5ACKA 5GIPE 4RSSA 3HV5A 4K8AA 5L4QA 4IM0A 2AC3A 3DA6A 1ZMWA 3Q96A 1MQ4A 4K11A 2VNYA 3FC2A 4L42A 1GAGA 2QURA 3IG7A 4LOQA 3WYYA 4D58A 5KMKA 4MCVA 3UG1A 2EXMA 3CKWA 3P9JA 3FMJA 2B9JA 4FG8A 4YC6A 1J91A 2E9UA 4HCUA 3U51A 2W1DA 3UMXA 4EJ7A 4TYJA 2F49A 3MJ1A 2BRBA 4L7FA 4PL3A 4FEXA 4DFXE 2R4BA 4OTHA 4UMQA 3O2MA 2BZKB 5EHOA 4JJRA 4U6RA 3SXRA 3BWJA 3PA4A 1M2RA 3UVPA 2H8HA 2R3LA 5DE2A 3R1YA 2VTJA 2W5HA 1V0OA 4BHNA 4E93A 4ZTLA 3EH9A 2WMUA 2UZLA 3JUHA 1G8SA 4F7JA 5B2MA 2J2IB 5AX9A 3KRLA 3O0GA 3Q2MA 1BMKA 2BUJA 1J7IA 4JBPA 3ANQA 3PIZA 2J50A 2VO7A 5EYMA 4U3YA 1CSNA 4TWPA 2VWXA 3DY7A 1H07A 2O65A 4UYNA 4ZS4A 3QKLA 4BTFA 1HCKA 2OFUA 3KN5A 5J1WA 3VBXA 2C3IB 4A9YA 1PMVA 3A2CA 3F2RA 3UP2A 1WVYA 2DS1A 3V8TA 3E8NA 2UW5A 4UV0A 2SRCA 1OGUA 1J3HA 2EWAA 5AWMA 3T8OA 5J5TA 3HMOA 3R73A 3QZHA 4PL5A 5C1QB 5HTBA 4FSMA 4JAJA 2UZOA 5E4HA 2OICA 2VAGA 3IQ7A 4LQMA 1IASA 4X0MA 3HV3A 3FMNA 3GCQA 3Q4CA 1REJA 3VQUA 1Q24A 3ZBXA 4KKEA 4A4XA 4I1ZA 3QCQA 4TYGA 5HX6A 4RQVA 4O0RA 5IG1A 2ZDUA 1VR2A 3D2KA 5CT0A 4YSJA 1CTPE 3EYHA 2FVDA 3QA0A 4F0IA 1SM2A 3O7LD 4IB0A 3GU4A 4MTAA 3UOKA 5ANKA 2R3HA 4AA5A 2UZVA 2WQOA 2WEIA 4LM5A 4WUAA 5LVMA 3QKKA 4UZDA 2XK6A 3NCZA 4CG8A 3DNEA 2XB7A 4YZDA 5IQIA 1FINA 4NL0A 2R3OA 4J8NA 2GHGA 5DA3A 4FVQA 3JR1A 1DAWA 3D5XA 3F61A 5AP6A 4DN5A 4PDOA 3TIYA 1GNGA 3MY1A 2QQ7A 3MN3A 4M84A 3KGAA 3VBVA 4WNPA 5I3OA 2JKMA 3QQGA 3VS5A 1JNKA 4LMNA 4EOPA 4DTBA 4K2RA 3C4ZA 4F0FA 4BDFA 2R3NA 4E8AA 5JFWA 4XRJA 3HYHA 3T3UA 2XA4A 1ZYLA 4ITIA 2ESMA 4HJOA 4O27B 1YHVA 5CI7A 1KE7A 1SMHA 4D4VA 3EFJA 5FXSA 5GNKA 5I0BA 2YN8A 4RC3A 4MAOA 2R2PA 3IS5A 1IG1A 4LYNA 3KREA 3KULB 4DCAA 3DBDA 3R9NA 3TKUA 2OIDA 2BRMA 5JSMA 4UMPA 4CFXA 5ANGA 3R8ZA 4R7BA 4I5MA 5BYZA 4UN0C 5K3YA 5AP2A 1YDSE 3A7FA 5ANOA 5HIBA 4CMUA 3NNWA 4E5WA 4FTQA 1OKYA 3FI2A 4QP8A 4C2VA 3E7OA 3FLQA 4CNHA 5JGAA 4JX3A 2JDOA 5HVJA 5LWNA 3O8UA 3IOKA 3R71A 4UXLA 2WTWA 5AV3A 4C61A 5AUUA 1U46A 3KMUA 3ZHPC 2XNMA 4ZXTA 3K5UA 4DGMA 3EN6A 3F69A 3FKNA 2PU8A 1O9UA 1UA2A 5FEDA 5AP1A 4C58A 2GS7A 4Z16A 3IGGA 2HOGA 3Q9ZA 5ANJA 4WIHA 2C1AA 4C35A 2WIPA 2W1EA 1W7HA 4FIHA 1G5SA 4R3RA 2PMIA 3FE3A 1LR4A 2VGPA 4EJNA 5GZ8A 2RFDA 3HGKA 3OEZA 3C5UA 3QD3A 3FLNC 4M97A 1W0XC 4P2KA 4Y5QA 4KBAA 4G17A 4IX6A 5CNOA 1YI6A 4DT9A 4QO9A 5GZAA 5CAQA 3G0EA 1PXOA 3QLGA 2UZTA 3DJ6A 4L52A 4U7ZA 2XEYA 4M14A 3GC0A 2WMQA 1OIQA 2A0CX 4CFWA 3GCUA 3QUDA 5EYDA 3ORXA 2WZJA 2X2KA 4PPBA 2A2AA 5CSVA 1UVRA 4FL1A 4YLKA 1R0PA 2OI4X 4QMTA 5H8GA 4C7TA 3CQWA 1QPJA 3FY2A 3GI3A 4O0SA 3L8SA 1DS5A 5DNRA 2UV2A 4XLIA 4BDDA 3NUAA 2GPHA 2X7FA 2FYSA 3GEQA 1GJOA 2HXQA 3JS2A 4FICA 4OGRA 2QU6A 5HG9A 3FHRA 1XJDA 3RVGA 3QD2B 3VRZA 4NTTA 3FYKX 2J0MB 3H9FA 4B7TA 4MXZA 3CGFA 4DH1A 5J9LA 3P1AA 3CP9A 2LGCA 3H0ZA 4IX5A 4GJ3A 4HVIA 2G1TA 2WTCA 4F9AA 4EK3A 5KZ0A 2IVSA 1LUFA 2OZAA 2LAVA 4YHTA 4FZFB 2YERA 4AW0A 4DA5A 1ZYJA 3QTQA 4LFIA 2XIXA 3FQHA 5AR3A 3QRJA 3OFMA 2Q0BA 4IFCA 2F2CB 5HE0A 3ZUTA 3R7OA 2ZMDA 3C4WA 4IADA 4ZSAA 5HU9A 3R01A 1FMKA 4IAAA 3GQIA 3BQCA 4EH8A 1BL6A 4QNYA 2WMRA 4MXXA 3D94A 4HVHA 4F6UA 5C27A 3NUYA 4ASDA 2QHNA 3LJ0A 3QUEA 3WARA 4GYIA 4FZDB 4QMLA 4ZK5A 3E5AA 3ZSIA 3CTQA 3UTOA 4RX5A 4JRNA 2AUHA 3A4OX 4AX8A 3V5WA 3UIUA 3ZLYA 4WO5A 3NUNA 3UVRA 3DXPA 3G90X 2OH0E 2OU7A 5ICPA 2PSQA 3UODA 3MGYA 3DBEA 3B8QA 4RZVA 5KMNA 2XNPA 4FKSA 2BCJA 2VTSA 4U45A 2XBJA 3NW5A 4C59A 3UQCA 3C4FA 2ZOQA 3CS9A 2PULA 2VTLA 3ERKA 5BNJA 5HG7A 3W1FA 3PY3A 3UDBA 3KVXA 4C4FA 2CDZA 5M4IA 3PPJA 3HMNA 2BIKB 4DH8A 3CJGA 4O82A 3C7QA 4F65A 2JFMA 5JGBA 5IMXA 3G15A 3K2LA 3QTUA 3O8TA 5HIEA 4G3GA 4O7WA 3NDMA 3DOGA 4O0YA 4G34A 1S9IA 4YJTA 3REPA 5D12A 1FVVA 3EQCA 4XS2A 3SV0A 3FSKA 4EOJA 4C37A 4EHZA 3KN6A 4FTAA 4JAIA 1CM8A 3QFVA 5HD4A 3ET7A 1JLUE 3KC3A 2JD5A 3G2FA 3TZ7A 5HO6A 3DFAA 2OKRA 4I6FA 2PWLA 3OMVA 4MD8E 4NK9A 1YXUA 3C50A 4KBCA 5E8YA 4UMTA 3SD0A 3UVQA 4FTTA 4XP0A 4I4FA 2WTDA 3R7IA 3IW5A 2HK5A 4OT5A 1LEWA 2RIOA 5CEQA 5AR5A 4CFMA 3VUHA 5K4JA 4RJ5A 2BTSA 4RFYA 2P33A 4BTMA 3UQFA 2VGOA 4TZRA 3PG1A 3R8UA 2PK9A 3VF8A 3IDBA 5AR2A 3AC3A 3BWFA 4XLVA 3O50A 4YNOA 4LGDA 4O6LA 4NH1A 4UY9A 2UZDA 5GIOE 5KNJA 4HGTA 1PRYA 5FXQA 1APME 3UNJA 2Y6OA 5IA4A 4GU9A 5JH6A 4ANLA 4YO4A 5HIDA 3ZLXA 4O7LA 2YM8A 4J71A 4BF2A 4RRVA 2CNVA 3ODZX 4IAFA 2HW7A 3FLWA 4IZ7A 1ATPE 3PY0A 4FUXA 3ALOA 2P55A 4L46A 4WKQA 1B38A 3VW6A 4RFMA 4RX9A 2C3JA 3OP5A 4CV9A 4USFA 4CTCA 5AUTA 4YP8A 1XO2B 4ASXA 3G9LX 1Q97A 2R3RA 2I1MA 3RPSA 5AA8A 3R1SA 1IA8A 1M17A 1H01A 2QOOA 2OSCA 4YLJA 3NUXA 1M7QA 3WILA 3QQLA 1H0VA 4HVSA 4K18A 3LLTA 4UB7A 2OG8A 4JBVA 4U3ZA 1PKGA 3ATSA 3F7ZA 2XIZA 1OVEA 3C4EA 3IW8A 3DPKA 5AP7A 1IAJA 2QU5A 4QNAA 2OIQA 3SOCA 5IUGA 1U5QA 1JKKA 3NPCA 3W2RA 2C6TA 4G5PA 2X8DA 2YZAA 3WE8A 3Q3BA 4EYMA 4DEGA 5HNBA 4BCHA 2VTAA 4E6AA 2NNWB 4FF8A 2E9OA 4BKJA 3NEWA 4LL0A 5L2WA 1BYGA 4NM7A 4ARKA 5LOHA 5TKDA 3E3BX 3JXWA 3I79A 4XG2A 3R2BA 3HNGA 1RJBA 3S2PA 4JDJA 4CXAA 3ZZWA 2YABA 4BBMA 2VO3A 3TNWA 4TYHB 1OIRA 2GNHA 2IZSA 4TWOA 2HZIA 3I5ZA 5DEYA 4YLLA 2ITTA 5HNGA 1WVWA 4A07A 5CEPA 5M4FA 4B8LA 3NRMA 4CRLA 4TTHB 2PUIA 1CMKE 3QCSA 2YDJA 1QMZA 3AOXA 4Q9SA 2OW3A 5AP0A 5HBEA 2ERKA 2JITA 4FK6A 3D0EA 3KULA 3DQXA 3MDYA 4Y83A 2BR1A 3QALE 2CKQA 3COKA 3EN4A 3NIZA 3II5A 3NMUF 4FTUA 4RBLA 4BICA 5IISA 5TOZA 4O91A 3R8LA 4CCUA 1E1VA 3Q5IA 4JX7A 3W18A 2VTPA 4AZFA 4L67A 4KSQA 1YRPA 3ZYAA 4XG7A 4WG5A 5FRIA 3ZM9A 4XRLA 1XHAA 2XK9A 3ID6C 4L45A 2R3MA 2B52A 3PSBA 4GEOA 5T6KA 1JKLA 3B2TA 3MW1A 4D55A 3ITZA 5AAEA 1BKXA 4LOOA 2OBJA 2C6DA 3RAHA 2WAJA 2XNBA 4F6SA 2WTIA 2XKDA 3AC5A 3MVJA 1W84A 4AP7A 3E92A 4CYJA 5A54A 4BY9E 3UG2A 5CSXA 3VC4A 4IAYA 2WMVA 2PUNA 2ETKA 3QKMA 4GFGA 5I9VA 3O8PA 3TDVA 1R39A 5HCZA 4AN3A 5F95A 3L9LA 3NIEA 5DLSA 2JIUA 3QCYA 5J87A 3RBWA 5IA0A 5CTPA 4HVGA 2WD1A 3MY5A 2DWBA 1UU8A 3D2IA 4U0IA 4W4YA 5EM5A 1M2QA 2CGWA 3FDNA 4J95A 4FKUA 3ORPA 2QR8A 2WMAA 3OVVA 4J1RA 3EQGA 3WZKA 3BHYA 2VO0A 2C5YA 3DBQA 3JVRA 1ND4A 3TNQB 2IPXA 4IXPA 3DKOA 5CANA 2W9FB 3VW8A 4GK4A 4BWKA 1M52A 4FKRA 5IA3A 3ATTA 1A06A 4C62A 3QYZA 3D7TB 4YJQA 4EHVA 3SVVA 3RK5A 4R3CA 3MH1A 3OUNB 3RNIA 2YZLA 2C4GA 4I0RA 5ETIA 5CXHA 3QTWA 4FKTA 3LM5A 4C4IA 3IDPA 4GCJA 5F1ZA 3EQBA 2WTKC 5HX8A 1V1KA 4EKKA 4F63A 2I0YA 2XNNA 2V7AA 4WSYA 3DDPA 3R21A 4P5QA 4YNEA 2VTOA 3E8EA 3VS6A 1R3CA 4E20A 4O81A 3I7CA 4E6QA 3EQIA 4O0TA 4YPDA 2OJGA 3ORMA 1SNXA 1YHWA 3FQEA 3Q04A 4X2FA 3F7WA 4ZTNA 4FEQA 2A27A 4YO6A 3DAJA 3ORTA 4Z9LA 3R9DA 1OZ1A 1TVOA 2JEDA 3OHTA 4HZRA 5E8XA 3VS0A 3BGQA 1NXKA 2GTNA 4EWHA 3VAPA 3HDNA 4G9CA 5DHJA 4FA2A 3QZFA 4CSVA 1XH8A 2ITQA 5LVOA 4BKYA 3TXOA 4QMOA 3NYNA 4XG9A 3QHRA 3EOCA 4APCA 1BI7A 2X8IA 5JMSA 4KS7A 2VTNA 3TV7A 5GHVA 1OIYA 3PJ2A 4NCTC 4ZJVA 1NW1A 3PVGA 3EWHA 4A7CA 1CDKA 1XWSA 4O6EA 4KRDA 2Y7JA 3D5UA 3IW4A 2VWZA 5L6PA 4BDJA 4HCVA 1IRKA 3R28A 4DEDA 4QYEA 5HU3A 5CASA 2BDFA 3FAAA 5HTCA 4ID7A 1YQJA 3QQUA 1OBGA 2ZV2A 2I40A 5FP6A 4I93A 4RVMA 4ZLOA 3ZH8A 2WQMA 5DFPA 3W8QA 4Y46A 1XH7A 4YBJA 3MH0A 4DGOA 3FLYA 2B9HA 4MXOA 3UOJA 4BC6A 4OBOA 4R5YA 5LMKC 4DFUA 3BI6A 3R8VA 3QTSA 3FUPA 4P5ZA 3EQRA 3UZRA 3E63A 4ASEA 4O22A 5CT7A 3GC8A 5M09A 3G33A 3MVLA 4O7YA 4QP1A 2PHKA 3IW6A 1UKIA 1KV2A 2QKWB 4PV0A 4U79A 3PWDA 3W2CA 4NFMA 4APPA 4FV3A 4GKHA 4L01A 4O7RA 5KHWA 3MFSA 3ZUUA 2C3KA 4ZJIA 3QAME 2VUWA 3JPVA 3QTRA 1MRVA 1O6LA 3R9HA 3Q32A 3FZRA 4EK5A 3RI1A 4D4YA 4YMJA 2C5OA 3CBLA 1H26A 4NW6A 4ZOGA 2HXLA 3F5GA 5AV2A 2WNTA 4GH2A 5M06A 3HMMA 3MYGA 4C57A 4NEUA 4D2SA 2JDVA 3C13A 3BYUA 5EW3A 4DCEA 5CAVA 2UW8A 3ZXZA 2F7ZE 4IIRA 5FM3A 4XBRA 3D83A 5IZFA 3MVHA 3KMWA 3FZPA 4IFGA 2Y9QA 3OBGA 3UC4A 3DT1A 2EUFB 3LLAA 4MWIA 4E7WA 5FUTA 4R77A 4NIFB 3BHHA 3GC9A 3N4VA 2OXYA 2VWBA 4JBQA 4FX3A 4FZ7A 3RNYA 4H05A 5KX8A 4AW1A 3P7CA 2RL5A 2W1IA 3KRRA 3QTZA 4YJNA 4MH7A 4DYMA 4BCOA 2W06A 5BPYA 2YM3A 3TZ9A 5HO7A 5HE1A 1PMUA 2PZIA 3VRYA 3WIGA 2CKEA 4GV1A 4X7QA 2YAKA 3MFUA 4DG3E 3IKAA 3RZBA 3GXLA 4YZNA 4XUFA 2YCFA 2QC6A 5GJFA 5KCVA 4AAAA 4AOTA 4XNEA 3DDQA 4GUEA 4JT3A 4A9SA 1OPLA 3HRCA 4BCQA 4S33A 2AYPA 1OM1A 5HBJA 4TYEA 2PMNX 3OW3A 4FTOA 2C3LA 3HRFA 2CSNA 4KSPA 4CT1A 4D2TA 3TV6A 1FBNA 2ZM3A 4F4PA 3CLYA 3GCSA 5AV0A 2QLQA 3PP1A 3UJGA 3CTHA 3FMHA 2O3PA 1JBPE 3DK6A 4FTRA 4D2VA 3BYMA 3Q2JA 4ASZA 3S00A 4FIIA 3GGFA 3I81A 5IA2A 5IEYA 5EW8A 2R9SA 1FPUA 1I44A 1JSVA 2W4OA 4JXFA 4PP7A 4WRGA 4AT3A 2YFXA 3BLRA 3RPRA 4I4EA 1JAMA 2OIBA 4FG9A 3R83A 5C03A 5TE0A 4E5AX 4KABA 2XIYA 4IEBA 3QZIA 1H25A 5K4IA 1V0PA 1J7LA 4FNWA 2F7EE 5DYJA 2ZB0A 5HHWA 3EFWA 5HGIA 4GUBA 5J5SA 2W17A 5EKNA 1G8AA 4BHZA 5HQ0A 4O38A 3LFBA 4C4HA 2J7TA 3PP0A 5DGZA 3RWPA 2E9VA 3R30A 3BRBA 5D9HA 4I20A 5EQYA 5I3RA
chains in the Genus database with same CATH superfamily
1V0BA 4LV8A 4AFJA 2Y8OA 3BV3A 4XOZA 4UWCA 4BWPA 2ONLC 4FKWA 4KINA 1E9HA 4FT7A 4W8EA 3TJDA 3SG8A 2I7QA 5C8MA 3FXWA 3C0IA 4OTRA 4YZCA 3FLSA 3IPHA 4KIKB 4HGSA 4WRSA 2OXDA 2XF0A 2V7OA 2XANA 2B9FA 3TL8A 4JR3A 3PLAE 4EEVA 3V3VA 2EVAA 5A4EA 3KB7A 4JS8A 5LXMA 2C0OA 2WHBA 4EZ3A 3COHA 4YHFA 4QP3A 2X39A 5CY3A 3PVWA 3PXQA 4FYNA 4RJ6A 4D4RA 1H4LA 5LCKA 2EB2A 3FYJX 4C02A 2XIRA 4F99A 3HEGA 4ENXA 3TIZA 2BDJA 4DEEA 1XBBA 1TQPA 3H9RA 4O1OA 4TKSA 4FV7A 2V55A 3RMFA 2X1NA 5A6OA 5BVDA 1OKWA 3KRWA 1R78A 4I0TA 4D1ZA 5AP3A 1UNHA 4DHJA 4X3FC 3Q5ZA 3PPZA 3DXQA 3RWQA 3LM0A 5E90A 3HVCA 4M69B 4QMWA 4QPMA 2CCHA 2O64A 3OTVA 2XYUA 4I3ZA 4KIPA 3ZFYA 5GZ9A 5JFXA 3N4TA 4FSZA 1BLXA 3F3ZA 2IW6A 3D7TA 3ZFMA 3PJCA 2FSLX 5IQCA 4MX9A 4CZTA 2UW6A 4NFNA 4OBQA 3RAWA 4EH7A 4CKRA 5I9WA 2VWIA 2WGJA 4II5A 2PVLA 4H58A 1ZOHA 5TR6A 3DKCA 3GOPA 4RA4A 2DUVA 4DFYA 5HTIA 4M68A 1FGIA 3K3IA 2VTTA 4LGGA 3WZJA 5CVGA 2R5TA 5J9ZA 3O51A 5J7BA 4BDCA 3G5DA 2VTHA 3F5XA 3GNIB 3LE6A 3ZM4A 1ZY5A 2G2HA 5CF4A 3POZA 5DT0A 3OWPA 4FL3A 3CEKA 5CAUA 4PRJA 3NNXA 2ITXA 3FMDA 4MF0A 1JVPP 3ZCLA 2WMXA 3P08A 3LFSA 3P79A 3VWAA 2XNOA 2GS2A 2O63A 4IB5A 1YW2A 1OL6A 3UQGA 3ZRMA 1ZYDA 3V5LA 1KE6A 4FV8A 4QQJA 4ZP5A 2YWVA 2O8YA 4HCTA 3GB2A 4U8ZA 1Q5KA 2X7GA 3TKIA 4S31A 4YPSA 5FQDC 3VUIA 4CT2A 5AFVA 5I9UA 2X4FA 5J1VA 4QTBA 4QYFA 3U4WA 4G16A 4GVJA 4MQ1A 4N4SA 2NYAA 1YWVA 5IPJA 4KWPA 4BRXA 4I5HA 3ALNA 2WOTA 3I60A 4EQMA 3PJ3A 4HYUA 2YM7A 4KB8A 1GY3A 3RPOA 3SRVB 5F20A 4EC8A 3T9TA 5AEPA 5D1JA 4RIXB 4TNDA 4F70A 4EHGA 4E3CA 4OTQA 1KV1A 4WOVA 4WG3A 3GU5A 4PP9A 3LXPA 4AOIA 4E5BA 3HV6A 4BIBA 2YM6A 4RIYB 4AZEA 2RFEA 4HOKA 3EYGA 5K5XA 4G6OA 3B2WA 5J9YA 1WBVA 4O7NA 3MH2A 3U8WA 3VUDA 1PXIA 1K3AA 3R7YA 5IH5A 5L6OA 1Q41A 4RVKA 2IVTA 4IJPA 3SAYA 3ORNA 4BCKA 3O71A 4EZ7A 5E8UA 5EM6A 1Q3WA 4FIGA 2IWIA 3D9VA 3R63A 3BHTA 4WNKA 5JN2A 1P5EA 2PVFA 3IK3A 4ERWA 5EW9A 2C6EA 3C0GA 2WEVA 1J1BA 5BMMA 3D15A 1H28A 1W82A 5BYLA 3KY2A 3L9NA 4UYAA 4C8BA 1F5QA 4WD5A 4DT8A 1PXKA 1ZMUA 4LRKA 1PHKA 2OF2A 5H2UA 4RVLA 2EXEA 3DZQA 4MBJA 4IZ5A 3S0OA 1Z9XA 1H1QA 2J90A 4QMMA 4QMNA 5KKRC 4DF3A 2JC6A 1VEBA 2W1FA 4I24A 4ENYA 4IAZA 2F57A 2WTKB 2YM5A 2R3GA 4L68A 2XAOA 4FSUA 3MFTA 1UWJA 4FL2A 4GT4A 4CTBA 2CKOA 4CEGA 4JLCA 5AR7A 5BX0A 5M08A 5GJDA 3I6UA 5L8LA 1OMWA 4BI0A 3GENA 1GOLA 5M53A 3F3TA 1URWA 4BZOA 1CKJA 2BHEA 3EFLA 5L8KA 5M44A 5AJQA 4IVBA 3KXZA 1KE5A 2H34A 4Z3VA 3OW4A 5CALA 3MB7A 4AE9A 4PMTA 4PTEA 2YA9A 4ZY4A 3H30A 3V01A 4K6ZA 2C6OA 3UC3A 4RIWB 5CXZA 1ZYCA 3R7VA 4AW5A 4NSTA 4GJ2A 2ITNA 2PL0A 4NIFA 5ANIA 3MY0A 4K0YA 4O83A 3U54A 3OROA 4XG4A 3NW7A 1A48A 2XCHA 2HZ0A 5T3QA 2C0TA 4RJ4A 2CHLA 3DBFA 3F3WA 3W2PA 3QRTA 3OUKA 4MUQA 3OCGA 3ULIA 2QOFA 3ZXTA 4AT4A 5IEVA 3EZVA 3QTXA 5AIKA 3EFKA 2FSMX 4R78A 4IX4A 4EH2A 2IVVA 4LRJA 2Y4IC 4X21A 1UKHA 4KA3A 1WBPA 1ZXEA 3QRUA 3WYXA 5DPVA 4BCGA 4U9AA 2A98A 3ZUVA 4HGLA 3LFAA 4U43A 4WT6A 3G9NA 5CNNA 1Y57A 4GG7A 3PFQA 2PUUA 5GINE 4MQ2A 3TUCA 2ZMCA 1XH6A 5ETAA 5DOSA 5D11A 3WF7A 5D10A 2KTYA 3BX5A 4BGQA 3POOA 3SW4A 2UW7A 3CQEA 2V22A 4AOJA 2F7XE 1QPCA 3NNVA 3AC1A 3QYWA 3FC1X 3CY2A 4JVGA 3DQWA 4FI1A 2R3IA 2UW4A 4GSBA 2EB3A 2ZV7A 4NW5A 1AD5A 2H96A 2PZPA 3EN7A 3AG9A 2HZ4A 3R2YA 5IDNA 5FTOA 3FQSA 5H9BA 2ZVAA 4B8MA 4ZLYA 4BCMA 3ZDUA 3IOPA 1QCFA 3ETAA 4HYIA 5JFSA 4IM3A 4H3PA 3MB6A 1URCA 4HZSA 5ANDA 3VUGA 4IVCA 1TKIA 4ZTHA 3DV3A 3OTUA 4ZSLA 5BVKA 3UOHA 3BBTB 2V62A 2X81A 1Q99A 4A9UA 1JOWB 2C6IA 4QMZA 3A7HA 3RHXA 3SKCA 4FSNA 5CU6A 3PA5A 3VHEA 2GHLA 4XP3A 2XM8A 3ZBFA 5CSHA 2CMWA 1FVRA 2WU6A 5CENA 1TQIA 1M14A 3IO7A 3LPBA 2OH4A 4PMSA 2XM9A 4YJOA 1MQBA 4QPSA 3UOLA 2GSFA 2BAKA 5KMOA 4P7EA 4FZAB 4MYGA 3AD5A 4RFZA 4BDKA 4CG9A 1AGWA 2ITWA 4IWQA 4JDIA 5EM8A 4A4OA 4C34A 5DN3A 1K2PA 5J79A 4JIAA 3SXFA 1ZARA 4FTCA 2PMOX 4TNBA 5E7RA 3VUMA 5AA9A 5L3AA 1YXSA 2I0HA 4KIKA 4AS0A 4FKGA 3WZUA 2FA2A 2VWWA 3OXIA 3HA6A 4C33A 4C3PA 3EKKA 1ZOEA 4TL0A 4IVDA 3NYOA 3FZTA 3R7EA 2C30A 4TYIA 3TTIA 2QKRA 2GHMA 4PX6A 2R3FA 2R7BA 4OT6A 4EQCA 5BMSA 1ZMVA 2OJJA 2BROA 4BCNA 4KBKA 3AC8A 3BIZA 3PTGA 1B39A 4P90A 4DG0E 1UU3A 3NNUA 4XYFA 3V5PA 3VS4A 2HY0A 2WMTA 2FUMA 2JKKA 3TEIA 3V6SA 3U6JA 4FE2A 3VS3A 4CGAA 3LFCA 4XCUA 4EUUA 2JAMA 4G6NA 3AD6A 2YDKA 4PWNA 3RZFA 4FZ6A 3EQDA 4BZDA 4EH5A 5CWZA 5IH6A 3KXGA 3SDJA 2Y4PA 4PNIA 5E8SA 5A4TA 4IVAA 4FIFA 5FXRA 5FBOA 4O7VA 5IDPA 3TKHA 4YJRA 3UDTA 2XKEA 4M69A 3C4CA 5I9YA 2X2LA 4I92A 4FOBA 3W2QA 2VTMA 4LOPA 1DAYA 4O4FA 3NUUA 5E1EA 3QRKA 4CLJA 4JG6A 4DLIA 1HCLA 2F2UA 4YTHA 5L2TA 2IN6A 4RG0A 2XKFA 5E9EA 4JRVA 3U55A 3KK9A 2V0DA 3Q4ZA 4UBAA 3VUTA 3ACJA 3TYKA 2C68A 3MSSA 4TY1A 4PPAA 4U41A 2Y0AA 5L6WL 2X6EA 3THBA 1XMLA 4FTNA 2E2BA 3BELA 3LXLA 5FDPA 4EZ5A 2R3JA 2HWOA 4HYHA 4RLLA 5C4KA 1FVTA 4L3LA 5CSPA 3EMGA 5ANEA 5DBXA 1PKDA 4FK3A 4AA4A 1GZ8A 4RQKA 2VD5A 4I0SA 5AUWA 1NVSA 4YZ9A 5HZNA 3UYSA 4AXAA 2QG5A 4AE6A 1J7UA 4GG5A 2YJRA 3QZGA 4D5KA 1XH5A 5JRSA 4XMOA 1A9UA 4RX8A 5C9CA 4EYJA 1VZOA 2BVAA 4EHEA 2AQXA 1PJKA 2UVXA 2Z8CA 3BLHA 3MPAA 1Y91A 4O0XA 3LMGA 3FMMA 2VN9A 3OOGA 4MNFA 1KOAA 2OLCA 2A19B 5CZIA 4CKIA 5K0XA 5IF1A 2QLUA 4KKHA 5EG3A 3DLSA 4QD6A 4XG6A 4CYIA 4E4NA 2F9GA 5C8KA 1XH4A 1WCCA 2W9ZB 3F2AA 3QLFA 1YOMA 4S32A 4ZZMA 1WAKA 4AA0A 4UZHA 4AT5A 4FNZA 2R7IA 5IA5A 5DEWA 4JG7A 3IDCA 3SRVA 1PXNA 4NYEA 3HRBA 3KCKA 2ITYA 4IE9A 4KUJA 4PMMA 4H3BA 4O0UA 4RIXA 5M51A 4BL1A 4H39A 4EOQA 5BVEA 4XP2A 1OKZA 4C38A 4OTPA 4RIYA 4F09A 3DK3A 3LKMA 3PXKA 1QPEA 3DFCB 5AP5A 4ANQA 5KZIA 3W0SA 5KO1A 2OXXA 5CF6A 4CCBA 2GFCA 4OTIA 5I4NA 3HV7A 5HG8A 4F0GA 4LI5A 3ULZA 4X3FB 5CYIA 3RINA 4FOCA 2IJMA 5BUJA 4L7SA 2Z7RA 3GQLA 3N9XA 4QDEA 4UMRA 4IWOA 5IQAA 3DB6A 1ZY4A 4MD9E 2VX3A 3RTPA 4RLKA 4F1TA 3H3CA 4Q9ZA 4KNBA 1AQ1A 3SXSA 3BU5A 4I6HA 3KMMA 4L6QA 4DLJA 2IG7A 4FSTA 4TXCA 2JBPA 5LVNA 2PVJA 2PVKA 4N6YA 4AGUA 5CVFA 4FJVA 4F64A 1FQ1B 4I5CA 5HVKA 3D5WA 1ZAOA 4WNOA 4QQCA 1P4FA 2YWPA 3BU6A 4Q5EA 3D14A 3KFAA 4NM5A 4EK4A 3K54A 4NM0A 2JAVA 2ITPA 2XK4A 2OF4A 4PL4A 4E6DA 1SZMA 3FMLA 3EQPA 2QO7A 3LFFA 3HA8A 3T9IA 3MIYA 3CD8A 2WQBA 3AT4A 2YIXA 3DGKA 2Z2WA 4UXQA 3R1NA 5DT4A 5A3XA 3ENHA 4U40A 3FL4A 5DVRA 2XBAA 1UWHA 2W96B 3IONA 4MBLA 4UEUA 3QD4A 1LPUA 5LVLA 2XVDA 4RIWA 4O2PA 3R8MA 2UZWE 2YIYA 3PXFA 5E91A 4FKVA 5FM2A 4F9BA 2NP8A 4R8QA 4LDTA 1WZYA 1EH4A 5FBNC 4ALVA 4D2RA 4YZBA 2BZHB 4M3QA 5CAPA 1XH9A 4ZEGA 2RG6A 4ZTQA 3TNHA 2IO6A 1WBNA 4L43A 4CFUA 4UWBA 1BX6A 4DBNA 4NCTA 3E62A 1Q4LA 2HCKA 4IM2A 2VZ6A 3N4UA 3A7JA 1GIIA 3AC2A 3BE2A 4JG8A 4JL9A 2PPQA 4IB1A 3VHKA 1OITA 4RX7A 2ZM1A 5FWKK 1YOJA 2QOLA 4EL9A 2ZYBA 3JVSA 4QP6A 4J97A 2IW8A 4DFNA 1O6KA 2VNWA 3RK7A 3LFEA 4O7ZA 5AX3A 3FY0A 1W8CA 2C0IA 5AUXA 4ANOA 1KE9A 4E4LA 2GQSA 3LQ8A 4KRCA 5FD2A 4FR4A 1UNLA 1SVEA 5M57A 3VBWA 3LFQA 3MESA 3P7AA 4YURA 2QOIA 5LMKA 4NWMA 2J51A 3U6IA 5FDXA 4BDBA 3O96A 4CD0A 3R00A 1H8FA 4DC2A 4PUZA 5KMLA 3Q4TA 3R02A 2QVSE 2ERZE 2RGPA 3FMEA 3H0YA 3OXZA 3QD0A 2VTIA 4PDPA 5D7VA 3RKBA 4FTKA 3GFWA 2NRUA 3ZFXA 4E73A 4Z55A 3PVUA 5KKRB 3C5IA 1JWHA 5EI6A 3I0OA 4C4GA 1XR1A 5JK3A 4HYSA 3OG7A 5HBHA 4FKJA 2QR7A 3QGYA 4D9TA 1WBWA 3ORLA 5CF8A 1G8JA 1WBTA 3HMIA 4KIQA 4O21A 1PY5A 1KOBA 2FSTX 4C3RA 3R8PA 5JQ8A 3GCPA 3Q9YA 1YDRE 4QRCA 2VX1A 2W0JA 3SLSA 4GFMA 4JBOA 4PNKA 4D4SA 1PXLA 1JKSA 1UU9A 3DXNA 2G9XA 4I6BA 4L3JA 2KULA 3ZLSA 4YJVA 4AG8A 3NYVA 3AXWA 2J6MA 4QP9A 2BIYA 5DR9A 3EQHA 4Q5HA 4EOMA 1T45A 2QONA 3I1AA 3F9NA 1Q8UA 4F7LA 4EORA 2W1CA 1Q8YA 3QXOA 2PE1A 2OO8X 3KXMA 4NZWB 4I94A 3UO6A 3DCVA 3LCSA 2BILB 4Q2AA 1Y8GA 4KD1A 1KUTA 2JIVA 3W0QA 3PXYA 1KWPA 4WBOA 3ZO1A 4MF1A 4XV9A 3P0MA 2R0UA 4PMPA 1QL6A 4O1PA 4QMQA 2OJ9A 4WA9A 3MPTA 2WQNA 2NO3A 4PQNA 5CX9A 5KBQA 4ALWA 5IQDA 2BKZA 3OCSA 2ZM4A 4FV0A 5E1SA 3SX9A 4FKIA 3V8SA 4ACMA 1L3RE 2Y4IB 3A99A 5AM7A 5B2LA 5CF5A 3BL9A 2HW6A 1MRUA 4AXDA 4B4LA 4W9WA 3SGCA 4QTAA 3NR9A 3P7BA 5AMNA 5LJJA 4HGEA 1OKVA 4FTIA 3QWKA 4TW9A 4R7IA 1SYKA 4WBBB 5EDPA 3UO4A 4E4MA 3VJOA 5EOBA 4GT5A 1MP8A 3C0HA 4YZMA 5H8EA 3I0QA 4R5SA 4XG8A 5D7AA 2R3QA 4RJ8A 4ORKA 1BI8A 5G1XA 4FTLA 5JKGA 3NUSA 5CQUA 2OGVA 3CQUA 3LOKA 2ZV8A 3OF0A 3U9NA 4NKSA 4ACDA 5C26A 1QPDA 5FEEA 2BALA 4G3CA 5IA1A 2R64A 4FSQA 3VF9A 4DG2E 2FO0A 2UZBA 4JIKA 4EONA 2I6LA 4XG3A 4YTIA 3ZMMA 2WPAA 1B6CB 4C2WA 5TO8A 1GZNA 2C6LA 4QMXA 2XS0A 3DAEA 3OS3A 4QYYA 5CI6A 5HICA 4IC7A 2PY3A 3HX4A 4FIJA 4IHPA 5BV3A 5AUVA 5LMAA 3VN9A 4AGWA 4TT7A 4FT5A 4GW8A 4KS8A 1H00A 4U81A 2X2MA 3LQ5A 4L44A 5AUZA 4QQ5A 2PYWA 3MWUA 5EM7A 1H27A 5AR8A 3LCTA 5IQGA 5F9EA 4Y8DA 3WOWA 3LFDA 3MIAA 1BL7A 1TQMA 3LAUA 1GIHA 2BKKA 2GQRA 4EH4A 3BYVA 1JSUA 2AEGA 3LJ1A 4Y95A 3ZO3A 3CGOA 4RA5A 1LEZA 3FKLA 4CKJA 2PE0A 1OIUA 4S30A 1RQQA 1PYXA 4BVUA 2ZFYA 2ONLA 3BGZA 4EC9A 4AUAA 5CZHA 1U5RA 1ZOGA 3V6RA 2VX0A 4FSYA 3LJ2A 5IQFA 3H4JA 1YOLA 4BTKA 3EQFA 4FODA 4L53A 5FLFA 4EH6A 4XBUA 4FIEA 4JNWA 4GVAA 4I5PA 5ETFA 3L9MA 3RALA 2BAQA 4ZIMA 2O5KA 5E8WA 4HVDA 2XJ2A 4AGCA 1WBSA 2ACXA 4FT9A 1PXPA 2UVZA 2X6DA 3HKOA 1G3NA 1WFCA 1MUOA 3LFNA 1ERKA 4E6CA 2NPQA 3W16A 4IQ6A 4K9YA 5EOLA 4DAWA 3GU8A 1G8KA 2CCIA 2H6DA 3ZZEA 3ML1A 5EFQA 3EZRA 5AV1A 3WF6A 4X2NA 4MEDA 3ANRA 3TJCA 1OL2A 2G15A 2WIHA 2C69A 4MNEB 4DGGA 2UW0A 3BGPA 4E1ZA 5BVOA 3CD3A 1IAHA 5B7VA 4OTGA 4DTKA 5AV4A 4I41A 2Z7LA 5HESA 3BPRA 4JDKA 2QI8A 3HP2A 5CU0A 5LMBA 1IR3A 2V5QA 2XUUA 4FSWA 5A9UA 2XIKA 1YKRA 4GRBA 5HORA 1GZOA 1NA7A 4FV9A 4L00A 2ITVA 4X3FA 5L2SA 3I5NA 3FJQE 2X9FA 3NCGA 3HMPA 3NAYA 2WMBA 2YCQA 2JDRA 2B53A 4O0WA 1JPAA 3OCTA 4L9IA 5BVFA 3CE3A 3R0TA 3OT3A 3NWWA 4K33A 2YHVA 4AGDA 3AGLA 4F9CA 4DBXA 5ACBC 3S1HA 3BHVA 4FC0A 3RGFA 4BYJA 1XBCA 3LCKA 2WKMA 2OWBA 3RJCA 1XQZA 3L8PA 4QMUA 4R1VA 3CXWA 3VULA 4A4LA 2E9NA 2XRWA 5L2QA 3DAKA 4BCIA 1REKA 4GK2A 3GP0A 3PE1A 2QO9A 3QF9A 2HY81 1GZKA 3DBCA 3V5QA 4ZZOA 2RG5A 3NFGB 2RSVA 4QYGA 3HUCA 2ZDTA 3I7BA 1YI4A 2C47A 1SNUA 4M66A 4PDSA 3ZDIA 2P2IA 4AXFA 3NZ0A 4S2ZA 2RKUA 3I6WA 2WOUA 3UE4A 2PVMA 2P2HA 3PJ8A 1YWNA 1OL5A 2R0IA 3BBWA 4BYIA 5L8JA 1YXVA 2YLFA 4YHJA 3TG1A 5EQEA 3MA3A 3FBVA 4JI9A 4O2ZA 3CR0A 4O96A 1KE8A 3F5UA 2PTKA 4IW0A 3NGAA 2Z02A 3FV8A 4USDA 5I5ZA 4DH7A 4GL9A 5TT7A 4OAVB 3PRIA 5DR2A 3D5VA 2YAAA 3LQ3A 2QG7A 2Z7SA 3A60A 1Y8YA 5CU4A 2HWPA 2OJIA 3R7GA 4ERKA 3ELJA 2XP2A 3FZSA 2ITOA 3TUBA 3VNTA 5AIRA 5F4NA 2W5BA 4GIHA 4ZJJA 3GUBA 1M2PA 4BCFA 5EI2A 5BVNA 4ALUA 1XKKA 2XMYA 3QGWA 4BN1A 4E26A 1O6YA 2IZUA 3GOKA 3NYXA 4FGBA 3FI3A 3MH3A 2GNFA 3EN5A 1OBDA 4EBVA 3BV2A 2BDWA 3PYYA 5DWRA 1S9JA 3ACKA 3VQHA 5ITAA 4FT3A 1OL7A 5M55A 3TT0A 3ZO4A 2GU8A 4ZY5A 3LXNA 2VTQA 4GYGA 3UPZA 3FI4A 1L8TA 5C4LA 4DE4A 3QC9A 5FGKA 1Y6BA 3HUBA 5EHYA 3COMA 2UZUE 5K9IA 3FEGA 1UNGA 2BTRA 3CC6A 4IACA 2CGUA 4D5HA 4DTAA 4IDVA 4ZSJA 4O86A 3W0OA 4NJDA 2VTRA 4BBEA 4K1BA 3MTLA 2PMLX 4IB3A 5CLPA 4ZTMA 1FMOE 4O84A 1BUHA 2JIIA 3ZRLA 3UNZA 3QQKA 4QPAA 2C5NA 3M11A 3OY1A 3PVBA 1UU7A 3VBYA 3QCXA 4Y73A 5DRDA 1W2FA 4NJ3A 3G6GA 3UGCA 5DRBA 4MD7E 5IKWA 2GNLA 1F3MC 4XX9A 4F9WA 2GQGA 5HNIX 3P86A 4YTFA 5D41A 3TUDA 4FTMA 4CMTA 1U54B 3BQRA 2YITA 4RMZA 3K5VA 4G1WA 3P23A 5EQPA 2J0JA 4RWLA 3HP5A 3LCDA 2JGZA 3G6HA 2QOHA 5HO8A 4M15A 3L8XA 4ACCA 3MA6A 3TCPA 2PVHA 2J0KA 3EN9A 4AZSA 1YWRA 4ITJA 4L3PA 5E8TA 5CEIA 1JSTA 4DITA 4MBIA 5IEXA 1ST0A 5IH4A 3IECA 4DDGA 3C51A 5FG8A 4EH9A 2A1AB 2CN8A 4RJ7A 2BPMA 3U9CA 5KMIA 3PZHA 3WBLA 3UZTA 3OT8A 4J7BA 4RVTA 3EL7A 2QHMA 3RP9A 2WO6A 4FKPA 4LRMA 5HOAA 3UIXA 5DG5A 4QYHA 2JBOA 3UZPA 5KUPA 4LL5A 2B0QA 4FG7A 2BHHA 2CLQA 4OTDA 4QTCA 2CN5A 3IW7A 5GJGA 3KA0A 3GU7A 3DLZA 2DYLA 4H1MA 4IZAA 4NTSA 1Q8ZA 3ZEWA 4EOKA 3ORIA 5BVWA 3HDMA 4FVPA 3GVUA 3ZOSA 3C4XA 4A9TA 3HAVA 5H8BA 4BDAA 3PSCA 5AAGA 5L2IA 5B2KA 4DEIA 3CSVA 3O17A 5EH0A 1DI8A 2C6MA 3UBDA 3U4UA 4H1JA 4KIOA 3AT2A 4EOIA 4P4CA 3E8DA 3DNDA 2WFYA 3PE2A 2GCDA 3A61A 4X3JA 3W10A 3BHUA 4UWYA 4IBMA 4IWDA 4F6WA 3EL8A 5HCXA 5H3QA 1Q3DA 4Z7GA 2VWUA 3C1XA 5M4CA 3DJ7A 4YGAA 4CZUA 4R7HA 4XV1A 1DI9A 4CQEA 5E8VA 5KE0A 4RJ3A 1XBAA 4GMYA 2BFXA 3L9PA 4LG4A 3DS6A 2YISA 4IJ9A 2CKPA 1PXJA 3LW0A 3PXRA 4IH8A 4M0ZA 3S4QA 2OFVA 3LCOA 3Q9XA 2QD9A 4V0GB 5EDRA 3SC1A 4O7TA 3DKGA 2R3PA 3D7ZA 4F7NA 3D4QA 5HG5A 5LWMA 4AF3A 3OWLA 3M1SA 4AN9A 4ANMA 4BR3A 5E8ZA 4JQ7A 4X2GA 3WF8A 1CKIA 1DM2A 3AKKA 2WQEA 3P78A 3B8RA 4D0XA 3BYSA 3NVKI 3HZTA 3LZBA 3EKNA 4IC8A 4UMUA 1PMEA 5LQFA 1W2CA 3R22A 5CEKA 2HZNA 2QCSA 4BB4A 2VO6A 3F6XA 5J8IA 2QODA 2IZTA 3GBZA 3O23A 3ORKA 3PIXA 3BYOA 1H0WA 4X6QC 4XH6A 3E64A 2RFSA 4MXYA 2Z7QA 3BU3A 1XMMA 3FMKA 4D1XA 1YHSA 4IMYA 4R3PA 3TWJA 3PXZA 3FXZA 4DH3A 5JQ5A 3QWJA 2ZAZA 1Q62A 3PWYA 3WE4A 2YIQA 5IUIA 1TZDA 1OUYA 1WMKA 2Q83A 4AZTA 3ZS5A 3LIJA 4R1YA 4WNMA 4B99A 3SW7A 5HLPA 5KBRA 3Q52A 2QNJA 4QT1A 4F7SA 2UW9A 2PVRA 3VUKA 3SHEA 3U87A 5DMZA 1OI9A 3HECA 1Q8WA 1PMNA 2BMCA 5A46A 1FGKA 5HVYA 4W9XA 2J9MA 2BRHA 3QQHA 4HNIA 1OL1A 4YU2A 5DI1A 4ZLZA 4BZNA 4X6RA 4CMOA 4MK0A 4F78A 4AN2A 4OR5A 5E92A 4ZS0A 2YACA 4QTDA 3NAXA 4EK8A 4CZYB 5AM6A 4GT3A 4MNEA 5HI2A 1PW2A 4GFOA 4OUCA 4TWCA 4PPCA 4GK3A 4NU1A 3JY0A 3NX8A 3OXTA 5EI8A 3OWJA 5CQWA 5BUEA 4ANBA 5I9XA 3PY1A 4FKLA 5JZNA 4O7SA 3FPMA 1IA9A 3NSZA 4ANSA 3H10A 2QOKA 3OD6X 4PF4A 4FMQA 1ZYSA 4U5JA 2EU9A 5AR4A 3VIDA 4FEUA 4TN6A 3KXXA 4YBKA 5KMMA 3AMAA 4QTEA 2CNQA 4J53A 2XKCA 5C01A 3PPKA 2H9VA 4RWKA 3HLLA 2VWYA 4RGJA 5DT3A 4LV5A 2HYYA 1ZZ2A 5CS6A 4BDHA 1WVXA 3V51A 3U6HA 1LP4A 2XZSA 3W2SA 4ZTSA 3KL8A 4N6ZA 5CU3A 3JY9A 3ZEPA 4X2JA 4N57A 4BKZA 2GTMA 3QUPA 1STCE 2BRNA 4RC4A 3TNPC 3V5TA 2UVYA 3KRJA 3HV4A 4TWNA 2WTVA 5T68A 3FKOA 4DEBA 4QOXA 4AACA 5BQ0A 2I0VA 1UV5A 4ZTRA 4N70A 4YTCA 3ZO2A 3P5KA 4TPTA 1YVJA 4UALA 2JFLA 4OAUC 1PXMA 3RM6A 3TV4A 4FT0A 3UNKA 3KXNA 2ETMA 4BGHA 3R1QA 4FSRA 2X9EA 1T46A 2R3KA 3JYAA 3CPCA 2CGVA 4OBPA 2CLXA 4OTFA 3KU2A 3ROYA 4XV3A 5JZJA 1YXXA 1OB3A 4CV8A 3BZ3A 3F5PA 4HPUE 2O2UA 4FBXA 2GNGA 2HENA 2F4JA 3PFYA 5JT2A 5M56A 1RDQE 4AXCA 4AXEA 2UZNA 1P2AA 3GU6A 3MI9A 4HPTE 3G51A