4ZJJA

Pak1 in complex with (s)-n-(tert-butyl)-3-((2-chloro-5-ethyl-8-fluoro-dibenzodiazepin-11-yl)amino)pyrrolidine-1-carboxamide
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
291
structure length
280
Chain Sequence
SDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PAK 1
publication title Optimization of a Dibenzodiazepine Hit to a Potent and Selective Allosteric PAK1 Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
total genus 95
structure length 280
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zjjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zjjA01
4A9RA 4TY1A 3UO6A 4FNXA 3VWAA 2QOBA 4BCOA 4C7TA 5IMXA 3PDTA 2Y4IB 2UZWE 1REKA 2IVVA 1WCCA 2HK5A 1TQMA 2VUWA 3F3UA 4O0RA 4RIXB 2OSCA 5BVNA 2VU3A 4FSWA 4YZDA 2OJGA 2UW4A 3C4ZA 5FDPA 2VWXA 3HAVA 4X3JA 1GY3A 2WMVA 3EFKA 3HZTA 4BCHA 2OBJA 3DAJA 3CTQA 4GUBA 4GFOA 1Z9XA 3RPRA 4Y5HA 3UIMA 2CLQA 5HTBA 4IH8A 4MNEA 3F5GA 4RWJA 1J7UA 3FMLA 1IASA 3LFBA 4FNZA 2WKMA 4C2WA 2QCSA 3LXNA 3R1NA 3FLNC 4PP9A 3TL8A 4MCVA 2GNLA 4FV3A 2ONLC 4WRSA 4DLIA 4F0GA 2QURA 3BBTB 4HCTA 4ITHA 4N4SA 4BCKA 5HORA 5HTIA 3BKBA 2W9ZB 3DJ7A 4I0SA 4XP3A 3RGFA 3EL7A 4TW9A 4UWCA 5A4TA 2J5EA 3NUAA 3GGFA 3P7CA 4IAYA 4AFJA 5A4CA 3SOAA 3HRBA 4O7SA 3Q4ZA 1RQQA 1QL6A 3R7GA 4FVPA 2QOOA 4OBOA 3QQKA 1OZ1A 3NPCA 4LMUA 4MXYA 4L6QA 4J52A 5HE1A 4FGRA 3FMDA 3NS9A 4N6YA 4JAIA 5CT7A 2WAJA 2BRNA 3ZDUA 3A99A 3POZA 4OTWA 4HVSA 3IPHA 2HY0A 4ZEGA 5AP4A 3PG1A 4QMMA 4ALWA 1V0PA 2PVLA 3E62A 2B4SB 4LL5A 1E1XA 2I0HA 1LEWA 2FO0A 2Z7QA 2XNBA 2FUMA 2PMIA 3LHJA 2C3KA 2PMNX 4FKOA 4IB1A 4AXAA 3MH2A 5CSWA 1OBDA 3QKLA 3C13A 1YOJA 3QCSA 2HW6A 3ZUTA 2WO6A 2ZMCA 4IZ7A 3SA0A 1Y6AA 2BILB 3ZC5A 3VULA 4YNEA 4ZY6A 4I5CA 3S3IA 4CG8A 4YZ9A 5IA5A 4R3CA 3DBCA 3WZDA 2CKQA 3QQFA 4JJRA 3MS9A 4C8BA 4AP7A 1CMKE 2UW7A 3A7GA 1H4LA 4DG3E 2PMLX 2WEIA 4EUUA 5K4IA 2F49A 1LUFA 3SXFA 4UWYA 4GYGA 3VUMA 4O2PA 4U6RA 4B0GA 2O8YA 4F6WA 4DE4A 5F20A 3FKLA 1PJKA 3G6GA 3PIZA 2I6LA 4NL0A 5GHVA 3U4UA 4JS8A 4QMWA 3PIXA 3DXQA 4D2TA 4APCA 4D1XA 3FQSA 3F3ZA 4IB5A 2R3HA 3QU0A 4QTCA 5AP0A 2XKCA 4M68A 1ZMVA 4B9DA 3M2WA 2YZAA 4RFYA 4DH3A 4GG5A 4O38A 5HLPA 5AA9A 4NKSA 3H3CA 2V22A 4XG3A 4YPDA 2Z7LA 3S95A 3DXPA 4NJ3A 1A9UA 4QYGA 5IA4A 3O96A 2RFNA 3RPVA 5KZIA 4EH8A 2WMBA 4R1YA 4R5YA 5DMZA 4AF3A 1YWVA 3ZRKA 3DU8A 3HDNA 4FKUA 2YIRA 3I7BA 4MX9A 2PL0A 1REJA 3RK5A 2WMSA 3EQHA 3PSDA 4AWIA 4EYJA 4J97A 1M7NA 5DOSA 5IUIA 5E9EA 4M69A 1O6YA 2VTQA 4FR4A 4W8DA 3R21A 4U81A 3RZBA 2C5VA 5JZJA 4UB7A 2GPHA 4AZWA 1XH9A 2V55A 4HZSA 1FBNA 5F94A 5AX3A 2H6DA 1OPJA 3LCDA 4OTIA 1PMUA 5HG9A 4QMPA 3RM7A 4EH9A 5DFPA 3CXWA 5CEQA 3RAIA 3W55A 4YGAA 3HP5A 3L9NA 3H9FA 1Z57A 3QBNA 4O6EA 3VS6A 4KIQA 5J5SA 2HZIA 4FKJA 5EHOA 2VZ6A 3QGWA 4BF2A 2QD9A 5JN2A 2W1DA 5ANOA 2J0KA 4C4HA 4TPTA 4PDSA 2PTKA 4OTPA 5CVFA 3L9MA 2A4LA 3FLYA 3FZTA 3HKOA 4BWPA 3VUDA 4EOIA 4CQGA 1Q8TA 4O0WA 2G15A 3F82A 3RAHA 5I0BA 4XH6A 1FINA 5E91A 4EOKA 4YU2A 5A9UA 2BDWA 4BZOA 2PU8A 3N4TA 2W1EA 4Z9LA 4O0TA 2YDIA 3CKWA 1KV2A 2R0UA 4FEXA 5HLWA 2PE0A 3VUHA 2CSNA 3BIZA 5KMKA 1JBPE 3UDBA 3CIKA 4W4VA 5T6KA 4FSZA 5CF6A 4H05A 5EW9A 1QPJA 3ROCA 2IZSA 2XJ0A 3CE3A 5BPYA 4FSRA 4LOQA 3SD0A 1UVRA 3ZFMA 4BIEA 3PLAE 4FZ7A 3U51A 3ZEPA 2IJMA 5DVRA 4U3ZA 5CEKA 2GQGA 2YM3A 3GENA 5C8NA 5IPJA 4AOJA 5C8KA 4YZNA 2ZJWA 2YHVA 3ROYA 3BYSA 3OS3A 5CSHA 3AD4A 4DBNA 1O6KA 4O7LA 2I40A 5DR6A 2RF9A 3F7ZA 3FMEA 1STCE 3ZBXA 4RC3A 5CX9A 3VJOA 4UBAA 4YPSA 2AUHA 2J0MB 2O2UA 1K2PA 3ALNA 4M14A 5AA8A 2EXCX 1R0EA 3WIGA 4DEGA 4FVRA 5EHLA 3HDMA 4ZZOA 5I9WA 5BUJA 4IVDA 1OKVA 2W1CA 3Q2MA 3GCSA 5GJDA 4XOYA 3GUBA 3QF9A 4ORKA 3CD3A 4YP8A 2VTRA 4BC6A 4R3PA 3F3WA 2JKMA 4ASEA 4F7NA 5FM2A 4GW8A 2B9HA 3U6IA 3Q4UA 4DEIA 4FSTA 4ACHA 3RM6A 5A14A 2QOHA 3QCYA 4QP9A 5CY3A 2RIOA 5HE2A 4FTAA 2VWWA 1DM2A 3HV5A 4ONAA 1NT2A 4F9BA 1VZOA 3UNKA 1WBNA 2A19B 2EB2A 1PW2A 1JSUA 4NH1A 4UXQA 4KBKA 5EFQA 1IR3A 4ZTNA 3VHKA 4X6QC 1GZOA 5EDRA 5AAGA 4FTNA 4U0IA 4FG7A 4H58A 4HOKA 3D94A 3GCVA 5FXQA 2VX3A 2PZPA 4FUXA 3FSFA 5IH6A 5IQAA 4FV6A 4CXAA 4L46A 4DEDA 4J95A 5TT7A 1F5QA 4QMUA 2QONA 5DH3A 2XNEA 4MD9E 2XNGA 4RVKA 4ZJJA 4BDCA 4PNKA 3CJGA 5BUEA 5ICPA 3PPJA 3I60A 2CDZA 4BDFA 3PP0A 4YHTA 4CFXA 5DEWA 4GV1A 3TT0A 4OTQA 3A7FA 5AMNA 4L68A 3TNIA 2QNJA 3QC4A 3WBLA 2ZM4A 4RJ7A 3TV4A 5JFVA 5I4NA 2BDJA 3ZO4A 4ERKA 1M7QA 1OKYA 5E8ZA 2HCKA 3DLZA 4QQCA 5HCXA 1FGIA 2Y6OA 1VYWA 2IWIA 3JPVA 4JQEA 3V5LA 5L6PA 3SG9A 2UZEA 3R8ZA 3QTWA 2VTTA 3CS9A 2GSFA 4JAJA 4YSMA 5DNRA 5LVMA 3ZRLA 4QQJA 3MDYA 4LFIA 2C6MA 5E8VA 4G2FA 4KBAA 2XZSA 5IUGA 1BUHA 4J99A 4DTKA 2PMOX 4CEGA 4GFGA 1A48A 3TJCA 4KS7A 1KV1A 2R7BA 2IVUA 3R30A 4PF4A 3QLFA 5EYCA 1XKKA 5L6WL 4AW1A 3C7QA 1R0PA 4D2PA 1XHAA 4IWQA 4MXOA 5DG5A 2W5HA 3PLSA 4RIYB 5A6NA 1GZKA 4XNEA 4U9AA 2BZJA 1O6LA 5TF9A 4D2VA 4O83A 2OU7A 1ZOGA 5IEXA 3H10A 3HA6A 4HGLA 1OL6A 4QMNA 1U54A 5J7HA 2KULA 2C3IB 3DNEA 1Y57A 1YXTA 4EH2A 4EZ7A 3CSVA 3ZXZA 4B7TA 4TWPA 3RWQA 5AUXA 3IS5A 5GIOE 5H3QA 3R1SA 4I24A 5EYDA 5M4IA 3PZHA 4K9YA 1RW8A 4DFNA 3QD3A 4CRLA 2ITZA 3H0ZA 2GQSA 2HOGA 3AD6A 3UE4A 3F2AA 2IW9A 4PMSA 5AJQA 5ACBC 4ASZA 2BRGA 3UPXA 5D10A 4F9WA 5C8MA 3V8TA 1ATPE 3DFCB 3QQHA 3CY2A 4TXCA 3RP9A 3O7LD 4RC4A 4FSUA 3ORXA 3P7AA 4FZDB 3ODYX 2J4ZA 3C4CA 4WSQA 5L2SA 4QT1A 5ANJA 3KXMA 4RLLA 2ITXA 4X3FA 3KY2A 4CMOA 3LJ2A 3P78A 2FB8A 5ETFA 2IW8A 3EH9A 2B55A 2CGUA 3OTUA 4L3JA 5FDXA 3V6SA 4EK3A 5K5NA 3N51A 4IJPA 4QNAA 4M8TA 4LYNA 4CFFA 2ITYA 4OTFA 3W2RA 5IEVA 2XIZA 3FHIA 1M17A 4P90A 4C2VA 1XH7A 3OOMA 1IRKA 2V62A 2YFXA 1QMZA 3E92A 5FXSA 4BTKA 1S9IA 1XR1A 3VC4A 3PWYA 3HRFA 2P2HA 1PY5A 2X2MA 5HO8A 1KE7A 5E8WA 3RI1A 4E5BA 3Q9XA 3GC9A 4UZHA 3NUXA 4ACCA 1HOWA 4FV8A 3ZHPC 3R02A 3FXWA 2YWPA 2Z7RA 3CTHA 4GFMA 4L9IA 4E6AA 2VGOA 2X39A 2OIDA 2X2KA 4ITJA 3NW6A 3HRCA 3ORPA 5HBJA 5HG5A 4QYYA 2YCFA 2X9FA 5EI2A 4A4LA 2C0TA 3KC3A 2ITPA 4BKZA 3GEQA 4EYMA 4JR7A 3LLAA 4HGTA 1FPUA 4CKJA 5C01A 5B0XA 2HWOA 3ZRMA 4IBMA 2ACXA 2BRHA 3U8WA 4R5SA 1OUYA 4BYIA 4O81A 2QOFA 3MY5A 3O8PA 4MBIA 2YISA 4W9WA 4USDA 5CU3A 3THBA 2UV2A 1JKLA 2X7GA 4TNBA 5K9IA 2BIYA 2WTKB 3OVVA 2WMUA 2OF2A 5IQCA 5F4NA 3G90X 5J8IA 5FP5A 4AOIA 4YBKA 2C3JA 4PQNA 3UOLA 3GXLA 1YXSA 2VV9A 2JAMA 1B6CB 2J9MA 4NK9A 1BYGA 2VN9A 3EN5A 4AN9A 2OXYA 5JMSA 2ZV7A 4O0XA 4YJOA 1UNLA 4BFMA 2YLEA 3F9NA 1LR4A 4XBUA 4CFMA 5M08A 4IX6A 3GC7A 4RX8A 4F4PA 5A4EA 2VWIA 3LFQA 4FG9A 1P4FA 2XM9A 3OD6X 5BVEA 4ZLOA 5LVPA 1PHKA 3D83A 3EFWA 5M53A 4EK6A 2ETMA 3T9TA 3R28A 4GK2A 4QMXA 4YJSA 2W4JA 3E5AA 5TKDA 4V01A 3KGAA 4Q2AA 3QKKA 3KULB 3D5WA 2YCSA 3NCZA 4JRVA 1H8FA 5L8LA 2ESMA 4IB3A 2C6IA 2X0GA 5JGAA 5M51A 5C1QB 5CALA 4IVAA 4RMZA 3FLQA 3PY3A 1R78A 3NUUA 4BBEA 3ZMMA 4YLKA 5I9YA 4NSTA 3IDBA 5C9CA 5FRIA 4PV0A 5J7BA 2WMRA 5HQ0A 3MH0A 4ZK5A 3M42A 4HW7A 4RLKA 2F7ZE 5DHJA 3SC1A 4C58A 2B54A 3FZOA 3LFCA 4Y83A 4C4EA 4FA2A 2VWBA 4F7JA 5KMOA 4I1ZA 2JFLA 4QMLA 4JL9A 2QHMA 3L8SA 3LQ8A 4X2KA 1DS5A 4E4NA 4F6SA 3D15A 2JGZA 3RZFA 3OUKA 4I6QA 3W1FA 3OCBA 5AR8A 1Q4LA 3UODA 2YIQA 4BTFA 5DEYA 5GINE 4LOPA 5BYZA 3A4OX 1PKDA 2WIPA 2UW6A 3G0EA 4XX9A 4FI1A 3H30A 2Z60A 5GZ8A 3AG9A 4DITA 2CGVA 2BUJA 2HXLA 3LE6A 4I6BA 4G6OA 4QD6A 3FHRA 2E9PA 3VHEA 2CMWA 4H3PA 3VUGA 4PMMA 1PKGA 2QODA 4CTCA 4JRNA 1ZLTA 4BGQA 4CFNA 1BMKA 3OEFX 4CCBA 4CTBA 3MSSA 1G5SA 3BV3A 3R9RA 1Q8YA 2YM6A 4IFCA 1RJBA 4YC3A 4I4FA 3GCPA 4O7NA 5KMMA 5EW8A 3V6RA 5A6OA 5AAEA 5DI1A 4P5QA 4PL3A 4QO9A 5E1SA 3W10A 3ZS5A 2WELA 2WOUA 3QD4A 3LXPA 3UJGA 3E8CA 3UYSA 1GOLA 4I0RA 3COMA 3HMPA 3JYAA 3ACJA 4FTUA 4EHEA 3ZUVA 1I44A 2W05A 1WFCA 3BEAA 4GU9A 4HVHA 2AC3A 4ZY5A 4FOCA 3HVCA 1OGUA 4IACA 4IB0A 3R7VA 3VRYA 1CTPE 3AT3A 3MYGA 4JIAA 2C5XA 4LGGA 3R7OA 4KSQA 3WIKA 5IQEA 3ENHA 2ZMDA 4Y72A 4DTAA 3NNXA 2YJSA 5FQDC 3RAKA 3R83A 3R7IA 3WYXA 3KF7A 4F1OA 3LOKA 2YIYA 4BTJA 2PVKA 3ZLWA 4BHNA 4YUQA 3R9NA 4UX9A 5EKOA 4BCJA 4RIWA 2O63A 5LVLA 1OPLA 3LM0A 2LGCA 3P0MA 3OZ6A 4Q9SA 2CKPA 3SW4A 2IVSA 4GK3A 4U43A 2JFMA 4BCIA 5J5TA 5AV0A 4L43A 3A2CA 3NAYA 5A46A 3QQUA 1FOTA 3SDJA 5CANA 3OY3A 1YKRA 4IC7A 3T3VA 2VO3A 5CSPA 3E8DA 2Y6MA 3R1YA 2BZIB 3LCKA 3QKMA 5H8GA 5HU3A 4FL1A 3C4XA 3DQXA 3NUPA 4EOSA 5JFXA 5JSMA 3EQGA 3CCNA 1R3CA 3UMXA 3BHUA 4KNBA 2AYPA 2WMWA 5L3AA 4HGEA 4CG9A 2HAKA 4X0MA 3L9PA 3DJ5A 3GU7A 4O0YA 4DGGA 5CAUA 3FL5A 1UU3A 2RL5A 4BGHA 3QRIA 4GIIA 4IZYA 2QU6A 1P5EA 1OBGA 3KKVA 2J2IB 3A60A 2F7EE 4AFEA 4E93A 3RAWA 3E63A 2R3RA 3G0FA 3PXKA 4ZSJA 3ZEWA 4BKYA 5CXHA 4RWKA 5CTPA 4YJTA 5CT0A 5IG1A 5K4JA 1J7IA 1SZMA 3KU2A 3KVXA 4W4WA 3QX4A 4YJNA 1QPCA 4C3PA 2C6KA 2PUUA 3AC5A 1NXKA 4NFNA 3UYTA 3CR0A 4FSNA 3OBGA 3LJ0A 2GHMA 3R0TA 3PSCA 3ITZA 3HV7A 3LZBA 4F09A 4D2WA 4OR5A 4QNYA 3FQEA 1ZZLA 4C0TA 4F6UA 4U5JA 4N57A 4K2RA 3TZMA 1FMKA 5CAQA 3LM5A 2GNIA 2NNWB 1KE9A 3Q6WA 3L8VA 1PXJA 2G2IA 1AD5A 3LW0A 3DAKA 3GI3A 3H0YA 1URCA 4RJ4A 3G2FA 4ZTRA 5HCZA 1H25A 1WMKA 3VS0A 3D2KA 3TJDA 4FT5A 2VTLA 1OKWA 4FZFB 4K1BA 4YTHA 4AA0A 3B2WA 2BRMA 4MQ2A 3C4FA 4QQTA 3NYNA 2VO0A 4G1WA 3R8PA 1VEBA 4FX3A 3NVKI 4WNKA 3Q32A 1YWRA 3ORLA 5K0KA 4FEUA 2UVZA 2OJFE 3AGLA 3VW8A 5E1EA 4GSBA 4FTKA 4C4IA 4NFMA 4WT6A 2B9JA 5HIBA 4TYIA 3EHAA 4BB4A 1OMWA 3KMUA 1L8TA 1OB3A 2Q0NA 2EXMA 5LWMA 4V05A 5J79A 5FP6A 3IKAA 3VUKA 2VWVA 4FGBA 1UU9A 4DLJA 4EZ5A 4FKGA 5KX8A 5BX0A 3WYYA 1CM8A 2CNQA 1ND4A 1PXNA 2BTSA 4GIHA 4OBQA 3EZRA 2QO9A 4FC0A 4M15A 3NEWA 4FBXA 3SGCA 4RGJA 3A61A 1W83A 2BFYA 2V0DA 4RX5A 2B1PA 3OWKA 4R7HA 3PPKA 5DIAA 4H1JA 3PJ1A 3PXRA 5TOZA 5B7VA 3PUPA 4ZZNA 2QOLA 4TYHB 3GU5A 4ZY4A 4PTEA 1WBTA 3EQRA 1GZ8A 1M2QA 2OICA 4HZRA 4OLIA 2WU7A 2C6OA 2KTYA 2QI8A 2V7OA 3EQPA 4GJ2A 2G2HA 4GUEA 4AW5A 4FKQA 4BKJA 5JFSA 3U6JA 3WILA 4HVIA 1JKSA 4ZMEA 4K6ZA 5AADA 4LGDA 4U45A 3EQDA 1YRPA 4QP7A 3CJFA 3GCQA 4IX4A 4AW2A 2NPQA 4BI0A 4H36A 4IHPA 1NA7A 2R0IA 4XS2A 5ACKA 3UNZA 5HU9A 1OIRA 4KUJA 4XUFA 4WKQA 2GHGA 3AMBA 1BL7A 4RVTA 4D4VA 3TWJA 1UKHA 4PWNA 3BU5A 3O8TA 3P4KA 5IQGA 4ITIA 5FWKK 5FXRA 4I41A 4RQVA 5CI6A 1W82A 3SRVB 3W2CA 2BMCA 4AT4A 3Q6UA 4E6CA 1M14A 3I0QA 4TWNA 4HGSA 3RKBA 5J9YA 4KS8A 2BZKB 2VTAA 4IX5A 4NTTA 4QPSA 3AD5A 3MIAA 4ZTLA 4DAWA 4M13A 4EOQA 5IF1A 4IM0A 1U46A 4IM3A 5DWRA 4BDJA 4O1OA 2P55A 3C4EA 4A9TA 5JRQA 3DAEA 3KRLA 4I93A 2ERZE 4V0GA 3GFEA 3T9IA 3B8RA 3NYXA 3ATSA 3BHYA 4AGWA 4N70A 2VNYA 5T68A 4AN3A 3R00A 3NUSA 2XUUA 1ZOEA 2VNWA 5E92A 1U54B 4IANA 2WD1A 4PL4A 2X8EA 4LGHA 4YTIA 3RCDA 4HCUA 5C27A 5JZNA 4E26A 3K5UA 4FVQA 3W2OA 4Z3VA 2GNHA 2JIIA 2OW3A 2DQ7X 3GU6A 2SRCA 3BLRA 4RX9A 1NY3A 3E93A 3AXWA 4WBOA 4P2KA 2CCHA 5HD4A 3DGKA 2WGJA 3OOGA 3R63A 4IAZA 5KHXA 2R5TA 2R7IA 3OFMA 4RG0A 2J0LA 1CDKA 1UWJA 4NUSA 3BYMA 3PY0A 4FV2A 1TVOA 4KA3A 1H08A 4KBCA 2QKRA 3LIJA 3TNHA 5CZIA 4MXAA 5EW3A 1U59A 4QP6A 3R04A 1W98A 2HWPA 1YDSE 2JC6A 2C1AA 5ETCA 3D4QA 5KO1A 2RFSA 1JSVA 2YITA 3BWJA 3DKOA 2OFUA 4MEDA 1PRYA 4JNWA 4KABA 4I92A 4G3EA 4D58A 4JDIA 4O0VA 3CTJA 4FV1A 2JKKA 4ANMA 3FKNA 4IAIA 1DAWA 4FOBA 4DFYA 5HNBA 3QTIA 4L3LA 4F9AA 4YTCA 4C34A 4LUEA 5GJGA 4CV9A 1NVSA 3F3TA 4XRJA 4R3RA 3UNJA 3EWHA 3HUCA 4BY9E 1SM2A 5JGDA 5LARA 4D0XA 3IW4A 4JLCA 3RHXA 3OMVA 4ZS4A 3JS2A 3ORKA 5D12A 2BAJA 4NCTC 4AT5A 2J0IA 3OY1A 5IA1A 3DBFA 3MV5A 4DEEA 3AC4A 2PYWA 5CZHA 3NMUF 3ORIA 3UGCA 5M07A 4NM7A 4ACMA 1J1CA 2F2CB 3G9LX 3SHEA 3C0IA 5IA2A 2XK6A 3E7VA 1IAJA 3ORTA 2JLDA 4EBVA 5JH6A 1MQ4A 3VS4A 3NAXA 5A54A 3JXWA 5LMKA 3COIA 1YDTE 3PJCA 3HMIA 4ASDA 4EHZA 3ELJA 4Y8DA 2PULA 3I4BA 4FEQA 4YZCA 4O7VA 1EH4A 2JIVA 2UZDA 3AOXA 4H3QA 2PUNA 3RK9A 5CXZA 5GZAA 2OI4X 3FBVA 4RWIA 4U8ZA 3S0OA 3UZTA 2CCIA 2R3OA 4M67A 2YM4A 3CC6A 3LQ3A 3MA3A 4PY1A 3MTLA 5CU6A 2UZLA 3LFFA 4EC8A 3HEGA 3QTXA 4L53A 2C5OA 5HICA 2JAVA 2ZB1A 5AEPA 3Q9YA 1OPKA 1K3AA 2PZYA 1W84A 4O27B 5I9XA 4O7ZA 2OG8A 4YC6A 2YDJA 3KK8A 4WNMA 4J98A 3POOA 1JKKA 4R8QA 4EK4A 5IEYA 5ANGA 3LVPA 4RA4A 4LM5A 5AR3A 3I5ZA 3GVUA 4I0TA 1SNUA 2BZHB 4OGRA 3RHKA 4BN1A 5KMNA 4FIHA 1ZXEA 3PZEA 4X7QA 2ITOA 3FZ1A 4U97A 2E9VA 4XMOA 4WG4A 3P79A 4ZJIA 2HIWA 3I81A 4BDGA 4GCJA 5EKNA 3BU3A 4MD7E 4KIKB 1JSTA 4ZSEA 3UC4A 2QG7A 4RZWA 1H1PA 4JX7A 1E9HA 5EI8A 1ZYJA 3WARA 5CAVA 2YJRA 4LUDA 4U40A 4XJ0A 3W2SA 4AE9A 2X9EA 3DCVA 3HP2A 3DT1A 3HYHA 4E8AA 3GB2A 3SQQA 1VR2A 4FT0A 3U55A 4EOLA 1Q99A 3R2YA 4IJ9A 1H27A 2YLFA 3C4WA 2X2LA 3MJ2A 4AZVA 3S2PA 4DH7A 2I0YA 3FKOA 5DT4A 2IO6A 4GEOA 2WTDA 2YIXA 4E6QA 4EWQA 4HCVA 4AZFA 2WPAA 4LL0A 5CVHA 4EONA 3GBZA 2PE2A 3QD0A 3QWKA 5HIEA 3U6HA 4YJRA 2R3LA 4I4EA 2BAQA 4S34A 4BDEA 3ZCLA 5LXMA 3EKKA 4EHGA 3ZLXA 4AA5A 3COKA 2I0EA 1JOWB 2EWAA 2ITTA 2QR7A 4M0YA 2YDKA 1B38A 4DGMA 4C4JA 5I9VA 4FKSA 4YJVA 5HO6A 3ZC6A 4D55A 5K0XA 3EMGA 4IWPA 4XCUA 4Q9ZA 4J53A 5EM5A 4JBPA 3ZDIA 4R6VA 1ZYDA 2E9UA 3C50A 4QPMA 2XCHA 3QYWA 4FT9A 3V01A 4D28A 4ENYA 2YWVA 3DDQA 2RFEA 1JWHA 4ZTQA 4AA4A 4AU8A 4EJNA 3QD2B 3FMMA 1BLXA 5CQWA 2I7QA 3C5IA 2O5KA 2OK1A 2QLQA 3TKIA 3E64A 4MBLA 2VRXA 1XH8A 3PXYA 2QOKA 4WNOA 5FBOA 4HYSA 2NRYA 3PIYA 4O96A 4FTCA 4IADA 1KOAA 2JD5A 1PXLA 3FLSA 3UVPA 4A4OA 4E5AX 3B2TA 4F64A 5M57A 4BCGA 3UQCA 2Y0AA 4CLJA 5HLNA 5B2LA 4OTHA 3R8UA 4UYNA 3HX4A 3QRJA 3WZKA 5E8YA 2CHLA 2PK9A 5A4LA 3MWUA 2GS7A 1KE6A 4U3YA 4BDDA 4G16A 1GJOA 1SMHA 5CSVA 4UEUA 5A4QA 4DF3A 5HO7A 3ET7A 5AFVA 3OWJA 4NIFA 2WXVA 3DA6A 2H96A 3FPQA 2ZAZA 5TR6A 3RVGA 4B8MA 1GNGA 2PZIA 5BVWA 4CMUA 4U42A 2UW5A 3TZ9A 4QMSA 3ORZA 5HEZA 4JT3A 1IAHA 3D5XA 3BE9A 3MPTA 5DR2A 4CMTA 3QTQA 4AS0A 5CI7A 5HHWA 4ANBA 4X2FA 3VS3A 1Q62A 2CJMA 3FE3A 4QP2A 5ETAA 4UYAA 5A3XA 3ZZEA 4B6LA 5JQ8A 2W1IA 2V7AA 3V8WA 4CZUA 4FKWA 4JVGA 1A06A 4XG6A 3IGGA 3TEIA 4PPAA 5HIDA 4BCNA 4MK0A 2DYLA 4RIXA 4LRKA 3QA0A 3EN6A 3OTVA 4BICA 4BRXA 1GZNA 4DGLC 1JNKA 3CBLA 3K2LA 4BBMA 4DN5A 3TNQB 5GNKA 4RRVA 4YO6A 3AC2A 4QTAA 4DYMA 2OKRA 1Q3DA 2XNOA 3OROA 3KB7A 3P5KA 3M1SA 3FC1X 4GMYA 2X7OA 2OZAB 5AAFA 5E8XA 3W18A 4MBJA 3BCEA 4EOMA 2QOIA 3ODZX 5AV2A 2XIRA 5KBRA 5KNJA 2IZUA 4IIRA 2JBOA 3WZUA 3JR1A 4O21A 2XH5A 1DAYA 3ACKA 5FGKA 5BVFA 2FSLX 3EB0A 4KSPA 4DTBA 3R73A 4CCUA 1IA8A 3PWDA 1G8SA 1PMVA 3JVSA 4YURA 4OAVB 3KXNA 3G6HA 4GH2A 2QLUA 2QOQA 5BMMA 5EOBA 3CQWA 4O7TA 5BVDA 3PTGA 4BCPA 3U54A 4DFZE 1ZRZA 1BX6A 1M52A 1OKZA 3FC2A 2ETKA 2ONLA 3VS1A 3C9WA 4F9YA 5HOAA 3MIYA 4C4GA 4DH5A 4FF8A 2VAGA 2O65A 2CGWA 3I6WA 5BMSA 2WQBA 2FVDA 4AGUA 4DA5A 2HW7A 2PY3A 3QGYA 5HE0A 3FZPA 4PPCA 2W0JA 3QTSA 4QMOA 3Q5IA 4ZZMA 4OUCA 4IZAA 4R1VA 2PVRA 5EHYA 3SXSA 3HV3A 3I1AA 5HE3A 5C03A 2W9FB 3W2PA 4D0WA 4G6NA 3GOPA 1MRYA 2PVYA 4G3GA 2NP8A 2WQNA 4FMQA 4U7ZA 3IK3A 5CQUA 2G1TA 2QR8A 4ZSGA 5JGBA 3KQ7A 4QP4A 4TYJA 3FY2A 4MXCA 4CSVA 1H1QA 3C0HA 4ZSLA 1PMNA 4HPTE 5I9ZA 4NW6A 3IW5A 1WAKA 4FKIA 5IZFA 5FTGA 1V0BA 4FK3A 3FUPA 2ZV9A 3TCPA 1XH5A 3K5VA 2UZTA 3O71A 1W8CA 4FG8A 3KCFA 4GVAA 2J0JA 3SG8A 4PDOA 5CWZA 4JQ8A 3VBXA 5GZ9A 2XK9A 3MVMA 4EKKA 1M2RA 4PX6A 3TG1A 2UW9A 3PVUA 3ZO1A 4BDKA 2WHBA 5HGIA 3VQUA 4AT3A 1XJDA 3QX2A 3DS6A 5BQ0A 2W5BA 4Y85A 5AIKA 4ALUA 5L2IA 4KIOA 4I21A 2HZNA 4QOXA 2XYNA 3FI4A 1ZYSA 3GU8A 5ANEA 3DNDA 3FZSA 4K8AA 1XO2B 3OF0A 4L7FA 5CEOA 2VTJA 1U5QA 3BPRA 3EJ1A 3O17A 4XEYA 4FYOA 5HVKA 2XRWA 3PA5A 3E3PA 2ITQA 1WVYA 2BR1A 1V1KA 5AR4A 3S4QA 4A9UA 3CLYA 3H9RA 5FTOA 3TKUA 1WBSA 4I3ZA 2B9FA 3DQWA 2PVMA 3D5VA 1RE8A 2OJ9A 3UOHA 3UOKA 4EH7A 3HGKA 4CFWA 4IVBA 3PY1A 5AP1A 3VBQA 2UZNA 5I3OA 1CSNA 2XNMA 4CVAA 1NVRA 3REPA 2XK7A 4MNEB 4F65A 1ZYCA 1H1RA 3F5PA 5DGZA 4ENXA 4JXFA 4L67A 5HKMA 4J71A 2OF4A 5AR7A 1ZMUA 4E20A 4E73A 1HCLA 1K9AA 1Z5MA 2XS0A 4I20A 4MHAA 3QXPA 4B8LA 4C3FA 2BPMA 4JBVA 2WEVA 4IX3A 2WNTA 4C33A 2EXEA 5C26A 3MPMA 5ANIA 1SYKA 3GQIA 4J96A 5CEIA 5GIPE 2XP2A 1XH4A 3F6XA 3GCUA 4XG4A 4G9CA 3EQFA 3F2NA 4F1MA 5G1XA 2BAKA 3ZM4A 2X7FA 3DTCA 5F1ZA 2XEZA 1FQ1B 4QYEA 4FIIA 3JUHA 4QTBA 2ITUA 3F5XA 4BCMA 1KWPA 3NYOA 4FV0A 4BIBA 3KMWA 4NYEA 3DLSA 3A4PA 1JKTA 4FT3A 3G15A 3H4JA 1O9UA 4IZ5A 4MWHA 4ACGA 4FZAB 4JDKA 3Q2JA 3FXXA 1PYEA 1GAGA 3HMNA 4X2GA 3PSBA 1PXPA 4L45A 1H0VA 3QUPA 5EH0A 1BL6A 2WFYA 4XBRA 2XK3A 4W8EA 1YOMA 3QALE 2ITWA 5IQBA 2VTIA 5J9ZA 4IMYA 4IVCA 5AP6A 4ERWA 2GNJA 4XP2A 1KSWA 4DCAA 4N0SA 3LLTA 4O2ZA 4FE2A 4HNFA 2VTOA 4H3BA 3ULZA 3E8NA 1YHWA 3KMMA 3ZSGA 1NW1A 3PVBA 4K0YA 3PRIA 4CKIA 1H01A 5ANDA 2XK4A 2R2PA 3ORMA 5JFWA 1ZYLA 2HY81 3A8WA 5HX6A 3QTUA 4YO4A 2PZRA 4QP8A 4GVJA 3WF5A 2W17A 3BYOA 4C36A 1UU7A 3ANQA 2C69A 1ZMWA 4FKPA 4WG5A 1URWA 3QHRA 1PXIA 3R71A 3OXIA 5C4KA 4U44A 4XV1A 1H26A 3IDCA 2YAKA 3O50A 5I9UA 4ANLA 4F0FA 2CPKE 3UZPA 4FSQA 2B9IA 3MVHA 2GDOA 3O0GA 2C3LA 4LV8A 4HVGA 4LMNA 1HCKA 3ALOA 4RFZA 3TV7A 3DPKA 2C6EA 2R64A 2JBPA 4O6LA 2C6TA 3I79A 4UMPA 4M69B 5CU2A 3C51A 4C37A 3IO7A 3II5A 3COHA 4ANQA 3U87A 4EORA 2XIXA 2PSQA 1FMOE 3V5QA 2BHHA 4NT4A 4JI9A 2R4BA 4O7WA 3RJCA 1J7LA 4R78A 5IQFA 3HMMA 5FM3A 3UIXA 1PF8A 3DB8A 3OCSA 3JY9A 1Q8WA 4M97A 2C0OA 1QPEA 3NZ0A 4I5PA 4IM2A 3QC9A 3VUIA 3VF9A 5JKGA 5D9HA 2HXQA 3Q3BA 3TTJA 4FEWA 5JRSA 3EZVA 1G3NA 4YNOA 3PP1A 1TQPA 2RGPA 3HL7A 3QQJA 4I5HA 3U4WA 4FUYA 4QQ5A 4YHJA 5E7RA 3DK3A 3MFSA 4GU6A 3UMWA 4FIEA 4EOJA 3MVJA 3NDMA 3BHVA 4J7BA 4XG8A 3QAME 4B4LA 3FAAA 3OT3A 3UP2A 4MXXA 2ETRA 4XG7A 1Q5KA 2FSMX 2FSOX 4FV4A 4O91A 3P08A 1S9JA 4F70A 2JDVA 3TM0A 3DTWA 2YAAA 1Y8GA 4L44A 4PTGA 5JEBA 3Q04A 4LOOA 4W9XA 2C47A 4WO5A 4JX3A 4D1ZA 2RFDA 4UALA 4GYIA 2J51A 2QG5A 3MGYA 2VTSA 2WIHA 3ZOSA 5JT2A 5BUIA 5IH4A 1UNGA 2I0VA 3OW4A 4X2JA 3V5TA 4DEAA 2FH9A 4IEBA 1WVWA 3A7HA 4UZDA 1Y91A 2PE1A 2XKEA 4OTGA 5CLPA 4CRSA 4JBQA 4WUNA 5DE2A 4YHFA 4ZTSA 1YI6A 4GS6A 2P4IA 4EK8A 3ZTXA 4FL3A 2F57A 2QU5A 4RIYA 3MY0A 4EJ7A 3O8UA 4AN2A 1OL1A 4O86A 4F0IA 2W1HA 4OTRA 5DT0A 5AP3A 2W7XA 4UXLA 5CNOA 3HAMA 3UZRA 2VWZA 3ENMA 2XIYA 3KXZA 5AIRA 4DFLA 4JG8A 2X8IA 3LFAA 4APPA 4LG4A 3OCGA 4ZOGA 3WE8A 4WBBB 5ITAA 3W8LA 3R9OA 3KEXA 4FEVA 5TE0A 2X6EA 3KXHA 5AWMA 3SX9A 2BALA 2XF0A 2QHNA 3E7OA 5FBNC 4F9CA 2PWLA 3WE4A 4D9UA 4XV3A 1H24A 4WOVA 2X6DA 3EQBA 3R6XA 2BIKB 5KE0A 5IQIA 3PJ2A 3CQUA 1OECA 4WRGA 5H8EA 2FYSA 3KVWA 3QTRA 2IW6A 3V5WA 3GC0A 5AUYA 4D2RA 2EVAA 4YMJA 2CKOA 3R2BA 4IAFA 3IG7A 4H39A 4MF0A 2WMAA 3FDNA 1PMEA 3A8XA 4IXPA 3QLGA 4FL2A 5AUWA 5HNIX 1OIUA 5L6OA 2O3PA 3QQLA 2HYYA 3ULIA 5DRBA 1KE5A 2YA9A 5AP7A 4G6LA 4C59A 5M4FA 1XBBA 3FMKA 4GG7A 3CPCA 2YCQA 3MH3A 3TDWA 4FIJA 2X4FA 5CU4A 4A7CA 4DG0E 3FYJX 2J6MA 5GJFA 4EQMA 5BYYA 2PPQA 2VTMA 4RT7A 5EDQA 4ANNA 3CQEA 2UZOA 2NRUA 2QOCA 4E1ZA 3MTFA 4MAOA 5IUHA 3OXTA 2R3IA 3E8EA 3ZZWA 2UW3A 3LCSA 4D5HA 5K5XA 4LRJA 3PYYA 3R9HA 4ANOA 5IMEA 4K18A 4R77A 3MJ1A 4DFXE 2O64A 1ZWSA 4R7IA 2E9NA 2W99B 3KN6A 3U9CA 4FTRA 2GQRA 3KRRA 4BDIA 5L8KA 2WTWA 2QO7A 4DFUA 3KFAA 3MBLA 3UO5A 3ORNA 4P4CA 3W33A 2CLXA 5EQEA 4OAUC 2OLCA 3BE2A 4BZNA 4FT7A 1ZY5A 4FNWA 2DS1A 2JDRA 2JEDA 1JVPP 5E4HA 1WBOA 4HYIA 1UWHA 1WVXA 4QMVA 4AUAA 3WI6A 5IQHA 2BTRA 3JVRA 4EQUA 3ZBFA 3AMAA 4I94A 4UN0C 2JITA 3OW3A 4GRBA 3DZQA 4XYFA 3QA8A 4RZVA 4IE9A 4FKRA 4E7WA 4GT5A 2XA4A 4M84A 3UP7A 4F1TA 2YM8A 4QYHA 1IA9A 2UZUE 3OWLA 4RIOA 5CEMA 2YN8A 4MYGA 2BKZA 4NKAA 3R8VA 5HCYA 4YLLA 4BZDA 1APME 5BNJA 3AC8A 3MB6A 3QRTA 4AZEA 2G9XA 2YIWA 4PNIA 2C5NA 3W8QA 4FODA 2WU6A 4Z7GA 4DG2E 3VIDA 4Z7HA 5IDPA 4ZXTA 1R1WA 4E5WA 2QKWB 4ACDA 2B0QA 4O7YA 3AMYA 3FQHA 3OWPA 3ZSHA 5KCVA 3LMIA 4USEA 3OHTA 4BI1A 3MFUA 3R7EA 3FSKA 4NEUA 3RINA 3KULA 3KREA 3D0EA 4XP0A 3F2RA 4LI5A 4DGNA 1OITA 1E1VA 2FSTX 2PVFA 3MW1A 2G2FA 2X81A 5CAOA 4O0UA 1SNXA 2EUFB 3AQVA 5HX8A 4RSSA 5EM6A 3LCTA 2P0CA 3NCGA 3D7TA 4DH8A 3FPMA 2CNUA 4GJ3A 2DWBA 4Y46A 3QCQA 3H9OA 4X3FC 3TXOA 2C1BA 3CGFA 2F2UA 4JG7A 4C4FA 3QYZA 1P14A 3HNGA 4FTQA 5AUZA 1IEPA 2ZV2A 4JDHA 4WNPA 5EM7A 2R3JA 3MH1A 1BKXA 4EI4A 5KKRC 3VW6A 3TTIA 5ETIA 2IPXA 3I0OA 3FMJA 4FV9A 3HECA 4Y95A 1ERKA 4RJ5A 4KIPA 3LFDA 4YJQA 2XKDA 1F0QA 4F63A 4JIKA 3KK9A 1CKPA 4Q5HA 4X3FB 4OTDA 2WZJA 3DXNA 3IECA 5AP2A 5EG3A 3VS2A 2JIUA 5KKRB 2YACA 4YSJA 2RG5A 4QMYA 4QMZA 4FSMA 2IZRA 1QCFA 5DBXA 2GNGA 2BRBA 4MNFA 1CKIA 3QL8A 3IDPA 3UIBA 2BCJA 4FTOA 4TRLA 1R39A 4I5MA 1SVGA 4AAAA 3RNIA 3UBDA 3FY0A 3NRMA 5HVJA 3OC1A 3SVVA 1BI7A 4PP7A 5L4QA 4RJ8A 3MA6A 4OBPA 2YM5A 2PVNA 5DT3A 4TKSA 1LPUA 3G5DA 5LJJA 3QXOA 3BQCA 2YCRA 3DFAA 4CV8A 2XJ2A 3Q9WA 4IAAA 3ZFYA 4C02A 4E6DA 4M3QA 4DBXA 3D7ZA 5FD2A 3KXGA 5D7AA 2XBAA 1KUTA 4ALVA 2F4JA 2XVDA 5KHWA 3BLQA 3NW7A 1SVEA 2W1ZA 3LXLA 1Y6BA 2Q0BA 2WOTA 4EL9A 1FVTA 5G6VA 2H9VA 3HMOA 3C0GA 4G31A 3TACA 4NJDA 2OGVA 4NM5A 3TZ7A 5BVOA 4PPBA 4BCQA 3HLLA 3AGMA 4YC8A 2GTNA 2Y7JA 3QHWA 2UZBA 3R8MA 1AGWA 4FTJA 4PDYA 4G3FA 1OIQA 4FIFA 2PUIA 2A0CX 4NW5A 4HPUE 4IDVA 2OO8X 2WQOA 3MB7A 3DY7A 2XRUA 3F61A 3PA4A 4CGAA 4XV9A 4IDTA 3OEZA 5DA3A 3UVRA 3TNWA 3EL8A 3Q5ZA 2B7AA 1W0XC 3BU6A 3R22A 4YLJA 4C35A 3PJ3A 3R9DA 2W1FA 3NUYA 3TIZA 3ZONA 5I3RA 3EN9A 3HV4A 5CENA 4G3DA 3SKCA 3QWJA 3BGZA 3ZLSA 3EKNA 4A06A 4AE6A 4BGGA 2V5QA 3Q4CA 3RWPA 4E4MA 3ZO3A 4UY9A 5E8SA 3A7IA 2QVSE 2C30A 5BVKA 3Q4TA 3D9VA 3WF8A 3ZSIA 4E4LA 3O7LB 4MTAA 2JKQA 4QMTA 5EYKA 3VF8A 5CS6A 5M55A 3SV0A 1TKIA 3TKHA 3JY0A 4A9YA 2IG7A 3HV6A 4UMQA 2VWYA 4BWXA 4EK5A 3V8SA 2FGIA 4G5PA 4MF1A 5E90A 4G3CA 3BHTA 4XG2A 3QZGA 4O1PA 4NTSA 2CNVA 4AGDA 4TT7A 2WMXA 3P1AA 4CNHA 4RFMA 4IC8A 3GT8A 5EI6A 3QCXA 2OIBA 3RBWA 3RCJA 3UTOA 3TN8A 5AV1A 3GC8A 4XV2A 5J1WA 5IQDA 3UIUA 3IGOA 4FKVA 5CU0A 3BI6A 4G5JA 4UWBA 4QTDA 1OIYA 2WTJA 3DKGA 4RC2A 4UMTA 4JG6A 2GS6A 5D1JA 3V5JA 3GFWA 4H1MA 3CEKA 1ZARA 3KRXA 3ZH8A 2UZVA 4FTTA 4EHVA 4U41A 4F08A 2XBJA 1GIJA 1J3HA 3ZUUA 5IKWA 3TNPC 4GT3A 5KMLA 2Z8CA 4CQEA 5LQFA 5EYMA 3GNIB 4BTMA 4AGCA 3EYGA 1MRUA 5AUTA 4BHZA 4RJ3A 2WTCA 4P5ZA 1XWSA 2ZDTA 4LV5A 2WB8A 3VJNA 5FEQA 2XJ1A 4EBWA 3QFVA 3QUDA 3EN7A 2RSVA 5F95A 1YWNA 4F7LA 4XHKB 5EDPA 3F66A 4G34A 4ZJVA 2GCDA 1XBCA 4NU1A 1DI9A 5LVOA 2E2BA 3B8QA 2CN8A 4ZMFA 3PFQA 3VVHA 4BI2A 1G8AA 2OZOA 4DCEA 1FVVA 2WMTA 5ANKA 4G17A 4WUAA 4KKEA 3VN9A 3WZEA 5M44A 1ZZ2A 5LOHA 3LFNA 5DR9A 4HYUA 2GFCA 3IW6A 3LFSA 3SW7A 5M06A 1WZYA 4U80A 1CKJA 3NNWA 4TN6A 3IOPA 1OL5A 1GIHA 4BDBA 2J90A 3E88A 3UG2A 3PPZA 2P3GX 4OW8A 3VS7A 5AM7A 3AT2A 4MVFA 5CASA 4XRLA 3DB6A 3GQLA 3EIDA 4HYHA 4RIWB 4WG3A 2ZVAA 3MPAA 2R3PA 3G33A 4ID7A 4WA9A 3E3BX 2BFXA 3Q96A 4WIHA 4YJPA 1ZOHA 3KCKA 3QRUA 2ZDUA 1I09A 4O82A 4JBOA 4ZLZA 3WOWA 4FICA 3DBQA 4GK4A 3BBWA 2ZOQA 5HVYA 4TYHA 1H28A 2ZM1A 3AT4A 4C57A 5K3YA 4UMRA 2W4OA 3BGPA 5H8BA 3ERKA 3NNVA 3DKCA 2HZ0A 4ZTHA 4O84A 5M4UA 1PXKA 3EQIA 2W5AA 5T3QA 3ZXTA 2W4KA 2EB3A 4TWCA 3QRKA 4EH6A 2J7TA 1NVQA 1OI9A 2PZ5A 4L01A 5KMIA 3M11A 2F9GA 4EC9A 1PXMA 5AR2A 3UC3A 3LAUA 4CT1A 4R7BA 3IQ7A 4BYJA 4YZMA 5AP5A 2JDOA 2P33A 2X8DA 4TL0A 3RALA 3UPZA 2BHEA 3L8XA 3SRVA 2W06A 3MESA 2R3NA 3BV2A 2RG6A 2W1GA 3LMGA 1L3RE 2J50A 3A7JA 1MQBA 3LPBA 3OXZA 3WF9A 4ARKA 3IONA 4K77A 4X2NA 3SOCA 4NM0A 4Z55A 5KBQA 5HBEA 1SVHA 4KWPA 4NZWB 3EOCA 3Q60A 2ERKA 1KE8A 4RQKA 1P4OA 3L9LA 4OT5A 4Y73A 3LQ5A 1YHVA 4BDAA 5AM6A 1F3MC 4M7IA 1GIIA 3HUBA 4KRCA 1IG1A 2ITVA 2FA2A 1YHSA 3BLHA 4Y5QA 3C1XA 5D11A 3ZLYA 3ZYAA 5I5ZA 5CYIA 5LVNA 5CF5A 3BRBA 1TQIA 4E3CA 3PXQA 4II5A 3EFLA 1MUOA 3EQCA 3ZM9A 3CKXA 5FEDA 2YEXA 4O0SA 4L7SA 3FLWA 5AX9A 3VS5A 5AUUA 5HG8A 4PMPA 4HNIA 5EQPA 1UV5A 4AACA 3R01A 4XOZA 3PG3A 5IA0A 4MXZA 4AZSA 4DFBA 3NWWA 3FL4A 3BYUA 4MH7A 2YZLA 4D2SA 5D41A 4QTEA 3DK7A 3LMHA 2BROA 2XIKA 1RDQE 2GNFA 1MRVA 2YERA 4RBLA 5IDNA 2XEYA 1UU8A 3A62A 3R1QA 4BL1A 5IH5A 4P7EA 5B2KA 1OL2A 2UW0A 4GKIA 4GKHA 3NX8A 1KOBA 3PVGA 3S1HA 1ZY4A 2H8HA 5HESA 2R9SA 2WQMA 1YXUA 2OH0E 2VD5A 3NIZA 4KB8A 1OVEA 1U4DA 4X21A 2JKOA 1Q24A 3LFEA 4D4RA 1YQJA 2B52A 1UNHA 3OCTA 2VO7A 4RVMA 2XNNA 4FTLA 2HZ4A 4DHFA 4TTHB 4A4XA 4NM3A 3BHHA 4F7SA 3V51A 4TYEA 5FUTA 3VQHA 3G9NA 2PHKA 3W32A 1FVRA 3ANRA 3VO3A 3FV8A 4DEHA 5J95A 5HTCA 4BCFA 3FXZA 2ZYBA 5HBHA 1JAMA 3VRZA 4FV5A 2B53A 4Z16A 4D4SA 4YR8A 4AW0A 4CT2A 5M09A 1PYXA 1WBVA 1B39A 2GMXA 5AUVA 3TUCA 4RJ6A 4DH1A 2UVYA 4YTFA 5L2TA 2VX0A 3F88A 5IISA 4MWIA 4EH3A 2GTMA 2UUEA 5FEEA 4EUTA 4ZIMA 5IU2A 3DBEA 3TI1A 3LKMA 5M56A 3W16A 1JLUE 2WTKC 3FJQE 4J8MA 2OXXA 4QYFA 2BKKA 4FTIA 3SAYA 4M66A 4EEVA 3W2QA 3N9XA 3KA0A 4JQ7A 1AQ1A 3FMHA 3G51A 2CKEA 3FYKX 4NCTA 4RWLA 1P2AA 2A2AA 4W4XA 4C62A 5CEPA 2ZV8A 3KXXA 3ZO2A 3RPOA 3GOKA 3OT8A 4O7RA 4EOPA 5CAPA 5LMBA 2GS2A 1UKIA 2P2IA 3I7CA 3NIEA 2OFVA 4FNYA 5CSXA 2GU8A 2Z7SA 4WHZA 4KKGA 3F69A 4XLVA 3VNTA 4EQCA 2Q83A 2O0UA 3BQRA 1QPDA 5HI2A 3O2MA 3LCOA 2XNPA 3BZ3A 4DT9A 4DC2A 4HVDA 5J1VA 5C4LA 4PDPA 4AOTA 1YDRE 1YOLA 3R8LA 1M2PA 5CNNA 3MI9A 4V0GB 4F99A 3QZFA 4HJOA 2WTIA 1XQZA 4FZ6A 4CD0A 4EWHA 3KF4A 1XH6A 5FG8A 2Y9QA 5L2WA 4DGOA 1VYZA 5KUPA 2XCKA 1V0OA 3O51A 3CPBA 2J5FA 4KIKA 3ZFXA 4FK6A 2EU9A 3NVMB 2H34A 2C6DA 3CD8A 2R3FA 3FLZA 3TV6A 4D5KA 1Q61A 3D7TB 3K3IA 3VUTA 2C68A 3D5UA 1Y8YA 2OJIA 5DN3A 3PXFA 1JQHA 2OJJA 4JOAA 5EK7A 2QC6A 4LRMA 3P7BA 3MVLA 3OP5A 2JDTA 4FTMA 4MD8E 3VBWA 3WF6A 4AG8A 4MQ1A 3PE2A 3WZJA 4UMUA 3F5UA 4MKCA 5CVGA 4IWOA 5AR5A 2R3KA 3RNYA 2BDFA 3EYHA 5IA3A 4PMTA 3AC1A 3OG7A 3N4VA 4DT8A 3I6UA 5KMJA 1MP8A 4L00A 3L8PA 3R7YA 4FSYA 1PXOA 3LXKA 5DLSA 1WBPA 2R3MA 5D7VA 4NWMA 5DPVA 2F7XE 4YBJA 3I5NA 3QQGA 2VGPA 2REIA 2DUVA 3RK7A 4S32A 4QPAA 3TZ8A 1YXVA 3Q53A 3BELA 4L3PA 3DV3A 5FLFA 2LAVA 3S00A 2XB7A 1YW2A 1Q8ZA 4M12A 4D9TA 1YI3A 2PUPA 3P9JA 4K11A 1X8BA 4DEBA 5J9LA 4RX7A 5TO8A 1ZAOA 1BI8A 3BX5A 4KKHA 3SLSA 3IOKA 1DI8A 3K3JA 3TUDA 1H00A 2X4ZA 4ASXA 2Z2WA 2G01A 5EOLA 4TZRA 4WD5A 3D14A 5CF4A 4TWOA 3Q9ZA 3DDPA 4KRDA 2A1AB 4IAKA 3FEGA 5LMKC 3PJ8A 3PA3A 4QP3A 3R7UA 2R3GA 4EH5A 5HZNA 1OM1A 3TIYA 1H07A 2GFSA 4BDHA 2C5YA 5LCKA 4RPVA 3UG1A 5EQYA 5HG7A 2C0IA 4KINA 1Q3WA 3QZIA 2XYUA 4ANSA 3VBTA 4PUZA 4LQMA 3QUEA 4PRJA 2OIQA 3RMFA 3EFJA 3OUNB 3PVWA 4CYJA 3U9NA 4ZP5A 5J87A 3CY3A 2XM8A 3TUBA 4TYGA 4G9RA 4QP1A 4IW0A 3TDVA 3V5PA 2Y4PA 3C5UA 4CZTA 1H1WA 4FYNA 2NO3A 2HELA 3FZRA 4JR3A 3IW8A 5JK3A 5F9EA 2VX1A 3V04A 3DK6A 4CFUA 2Z02A 3KL8A 1T45A 4I22A 5L2QA 5CF8A 3LJ1A 4K33A 3KRJA 4C3RA 4J1RA 3MN3A 3BEGA 2A27A 3IW7A 5LWNA 4U79A 3BWFA 2WQEA 3GU4A 4GT4A 1VJYA 5LMAA 3HA8A 4PTCA 4I6FA 3T3UA 4I6HA 1H0WA 2XMYA 3DBDA 4KAOA 5H2UA 2UW8A 2YABA 1OUKA 4ZLYA 1YVJA 4I23A 4XLIA 4CLIA 3CP9A 4L52A 3MY1A 2ITNA 3ATTA 4RA5A 3CGOA 4A07A 3ETAA 4EOOA 3DJ6A 4JDJA 1Q41A 3N4UA 3RPYA 2UVXA 2OWBA 5HNGA 2VO6A 3UO4A 4S31A 1UA2A 4EKLA 4D4YA 4ZSAA 5DYJA 4KD1A 2AC5A 3EN4A 5L8JA 1J91A 2IZTA 2CN5A 2X1NA 3VAPA 1JPAA 2R3QA 2JDSA 2VWUA 2YM7A 1YI4A 1J1BA 4E4XA 3AC3A 3FWQA 1U5RA 2OZAA 5E8TA 5AV4A 3UQGA 2VTHA 2HENA 1LEZA 1Q8UA 4IQ6A 3FI3A 3Q52A 4AZTA 4C61A 2XK8A 3QZHA 4BVUA 2QQ7A 4X6RA 1XBAA 3ZU7A 4IFGA 5FTQA 2WTVA 4BBFA 3PRFA 4L42A 2QO2A 3BGQA 4V04A 2OXDA 3NR9A 4J8NA 2RKUA 4QRCA 4AQCA 4GL9A 3RPSA 4PL5A 3L1SA 3NYVA 3KRWA 4FV7A 4QMQA 2WMQA 4S30A 3DZOA 2W96B 3NW5A 3P86A 5DRDA 3VBYA 4AX8A 4BIDA 3UQFA 3OBJA 5JQ5A 1LP4A 3ID6C 4A9SA 4ZS0A 4CFVA 3DKFA 4BWKA 3O23A 4EH4A 2ZB0A 5EM8A 4FKTA 3UVQA 1T46A 4W4YA 1WBWA 1FGKA 5B2MA 2CGXA 1OL7A 2I1MA 3F3VA 3QTZA 3PXZA 5HD7A 5AV3A 3NUNA 5M4CA 1Q97A 3DOGA 5KZ0A 3VBVA 3FMNA 5E8UA 3UOJA 2E9OA 5BYLA 3FI8A 4M0ZA 2GHLA 3K54A 4IWDA 4CKRA 2IN6A 2ZM3A 3GP0A 3NNUA 4Q5EA 3SXRA 4ZAUA 1YXXA 4EZ3A 3D2IA 4CYIA 3KN5A 4O22A 2VTNA 2XKFA 4TNDA 3NSZA 1W7HA 3FI2A 4L8MA 4WSYA 2C4GA 4N6ZA 5H9BA 4DINA 3MFRA 4NIFB 1H1SA 4FIGA 3RTPA 4RVLA 2PVJA 4ZTMA 3MFTA 2C6LA 4C38A 4FKLA 4S33A 4BR3A 2OH4A 4USFA 3NLBA 3T8OA 4B99A 2BVAA 2Y4IC 3V3VA 2PVHA 3F7WA 3E87A 4XG9A 2VTPA 4YZBA 3BYVA 4YJUA 4D1SA 3WF7A 2Y8OA 3PE1A 5LCJA 4UV0A 2IVTA 3NGAA 4OT6A 4S2ZA 4CZYB 3P23A
chains in the Genus database with same CATH superfamily
4A9RA 4TY1A 3UO6A 4FNXA 3VWAA 2QOBA 4BCOA 4C7TA 5IMXA 3PDTA 2Y4IB 2UZWE 3BL9A 1REKA 2IVVA 1WCCA 2HK5A 1TQMA 2VUWA 3F3UA 4O0RA 4RIXB 2OSCA 5BVNA 2VU3A 4FSWA 4YZDA 2OJGA 2UW4A 3C4ZA 5FDPA 2VWXA 3HAVA 4X3JA 1GY3A 2WMVA 3EFKA 3HZTA 4BCHA 2OBJA 3DAJA 3CTQA 4GUBA 4GFOA 1Z9XA 3RPRA 4Y5HA 3UIMA 2CLQA 5HTBA 4IH8A 4MNEA 3F5GA 4RWJA 1J7UA 3FMLA 1IASA 3LFBA 4FNZA 2WKMA 4C2WA 2QCSA 3LXNA 3R1NA 3FLNC 4PP9A 3TL8A 4MCVA 2GNLA 4FV3A 2ONLC 4WRSA 4DLIA 4F0GA 2QURA 3BBTB 4HCTA 4ITHA 4N4SA 4QDEA 4BCKA 5HORA 5HTIA 3BKBA 2W9ZB 3DJ7A 4I0SA 4XP3A 3RGFA 3EL7A 4TW9A 4UWCA 5A4TA 2J5EA 3NUAA 3GGFA 3P7CA 4IAYA 4AFJA 5A4CA 3SOAA 3HRBA 4O7SA 3Q4ZA 1RQQA 1QL6A 3R7GA 4FVPA 2QOOA 4OBOA 3QQKA 1OZ1A 3NPCA 4LMUA 4MXYA 4L6QA 4J52A 5HE1A 4FGRA 3FMDA 3NS9A 4N6YA 4JAIA 5CT7A 2WAJA 2BRNA 3ZDUA 3A99A 3POZA 4OTWA 4HVSA 3IPHA 2HY0A 4ZEGA 5AP4A 3PG1A 4QMMA 4ALWA 1V0PA 2PVLA 3E62A 2B4SB 4LL5A 1E1XA 2I0HA 1LEWA 2FO0A 2Z7QA 2XNBA 2FUMA 2PMIA 3LHJA 2C3KA 2PMNX 4FKOA 4IB1A 4AXAA 3MH2A 5CSWA 1OBDA 3QKLA 3C13A 1YOJA 3QCSA 2HW6A 3ZUTA 2WO6A 2ZMCA 4IZ7A 3SA0A 1Y6AA 2BILB 3ZC5A 3VULA 4YNEA 4ZY6A 4I5CA 3S3IA 4CG8A 4YZ9A 5IA5A 4R3CA 3DBCA 1W2FA 3WZDA 2CKQA 3QQFA 4JJRA 3MS9A 4C8BA 4AP7A 1CMKE 2UW7A 3A7GA 1H4LA 4DG3E 2PMLX 2WEIA 4EUUA 5K4IA 2F49A 1LUFA 3SXFA 4UWYA 4GYGA 3VUMA 4O2PA 4U6RA 4B0GA 2O8YA 4F6WA 4DE4A 5F20A 3FKLA 1PJKA 3G6GA 3PIZA 2I6LA 4NL0A 5GHVA 3U4UA 4JS8A 4QMWA 3PIXA 3DXQA 4D2TA 4APCA 4D1XA 3FQSA 3F3ZA 4IB5A 2R3HA 3QU0A 4QTCA 5AP0A 2XKCA 4M68A 1ZMVA 4B9DA 3M2WA 2YZAA 4RFYA 4DH3A 4GG5A 4O38A 5HLPA 5AA9A 4NKSA 3H3CA 2V22A 4XG3A 4YPDA 2Z7LA 3S95A 3DXPA 4NJ3A 1A9UA 4QYGA 5IA4A 3O96A 2RFNA 3RPVA 5KZIA 4EH8A 2WMBA 4R1YA 4R5YA 5DMZA 4AF3A 1YWVA 3ZRKA 3DU8A 3HDNA 4FKUA 2YIRA 3I7BA 4MX9A 2PL0A 1REJA 3RK5A 2WMSA 3EQHA 3PSDA 4AWIA 4EYJA 4J97A 1M7NA 5DOSA 5IUIA 4AQKA 5E9EA 4M69A 1O6YA 2VTQA 4FR4A 4W8DA 3R21A 4U81A 3RZBA 2C5VA 5JZJA 4UB7A 2GPHA 4AXCA 4AZWA 1XH9A 2V55A 4HZSA 1FBNA 5F94A 5AX3A 2H6DA 1OPJA 3LCDA 4OTIA 1PMUA 5HG9A 4QMPA 3RM7A 4EH9A 3UDZA 5DFPA 3CXWA 5CEQA 3RAIA 3W55A 4YGAA 3HP5A 3L9NA 3H9FA 1Z57A 3QBNA 4O6EA 3VS6A 4KIQA 5J5SA 2HZIA 4FKJA 5EHOA 2VZ6A 3QGWA 4BF2A 2QD9A 5JN2A 2W1DA 5ANOA 2J0KA 4C4HA 4TPTA 4PDSA 2PTKA 4OTPA 5CVFA 3L9MA 2A4LA 3FLYA 3FZTA 3HKOA 4BWPA 3VUDA 4AXDA 4EOIA 4CQGA 3TMOA 1Q8TA 4O0WA 2G15A 3F82A 3RAHA 5I0BA 4XH6A 1FINA 5E91A 4EOKA 4YU2A 5A9UA 2BDWA 4BZOA 2PU8A 3N4TA 2W1EA 4Z9LA 1ST0A 4O0TA 2XAMA 2YDIA 3CKWA 1KV2A 2R0UA 4FEXA 5HLWA 2PE0A 3VUHA 2CSNA 3BIZA 5KMKA 1JBPE 3UDBA 3CIKA 4W4VA 5T6KA 4FSZA 5CF6A 4H05A 5EW9A 1QPJA 3ROCA 2IZSA 2XJ0A 3CE3A 5BPYA 4FSRA 4LOQA 3SD0A 1UVRA 3ZFMA 4BIEA 3W0QA 3PLAE 4FZ7A 3U51A 3ZEPA 2IJMA 5DVRA 4U3ZA 5CEKA 2GQGA 2YM3A 3GENA 5C8NA 5IPJA 4AOJA 5C8KA 4YZNA 2ZJWA 2YHVA 3ROYA 3BYSA 3OS3A 5CSHA 3AD4A 4DBNA 1O6KA 4O7LA 2I40A 2XARA 5DR6A 2RF9A 3F7ZA 3FMEA 1STCE 3ZBXA 4RC3A 5CX9A 3VJOA 4UBAA 4YPSA 2AUHA 2J0MB 2O2UA 1K2PA 3ALNA 4M14A 5AA8A 2EXCX 1R0EA 3WIGA 4DEGA 4FVRA 5EHLA 3HDMA 4ZZOA 5I9WA 5BUJA 4O4BB 4IVDA 1OKVA 2W1CA 3Q2MA 3GCSA 5GJDA 4XOYA 3GUBA 3QF9A 4ORKA 3CD3A 3AKJA 4YP8A 2VTRA 4BC6A 4R3PA 3F3WA 2JKMA 4ASEA 4F7NA 5FM2A 4GW8A 2B9HA 3U6IA 3Q4UA 4DEIA 4FSTA 4ACHA 3RM6A 5A14A 2QOHA 3QCYA 4QP9A 5CY3A 2RIOA 5HE2A 4FTAA 2VWWA 1DM2A 3HV5A 4ONAA 1NT2A 4F9BA 1VZOA 3UNKA 1WBNA 2A19B 2EB2A 1PW2A 1JSUA 4NH1A 4UXQA 4KBKA 5EFQA 1IR3A 4ZTNA 3VHKA 4X6QC 1GZOA 5EDRA 5AAGA 4FTNA 4U0IA 4FG7A 4H58A 4HOKA 3D94A 3UDTA 3GCVA 5FXQA 2VX3A 2PZPA 4FUXA 3FSFA 5IH6A 5IQAA 4FV6A 4CXAA 4L46A 4DEDA 4JMQA 4J95A 5TT7A 1F5QA 4QMUA 2QONA 5DH3A 2XNEA 4MD9E 2XNGA 4RVKA 4ZJJA 4BDCA 4PNKA 3CJGA 5BUEA 5ICPA 3PPJA 3I60A 2CDZA 4BDFA 3PP0A 4YHTA 4CFXA 5DEWA 4GV1A 3TT0A 4OTQA 3A7FA 4FEWA 5AMNA 4L68A 3TNIA 2QNJA 3QC4A 3WBLA 2ZM4A 4RJ7A 3TV4A 5JFVA 3BL7A 5I4NA 2BDJA 3ZO4A 4ERKA 1M7QA 1OKYA 5E8ZA 2HCKA 2X0OA 3DLZA 4QQCA 5HCXA 1FGIA 2Y6OA 1VYWA 2IWIA 3JPVA 4JQEA 3V5LA 5L6PA 3SG9A 2UZEA 3R8ZA 3QTWA 2VTTA 3CS9A 2GSFA 4JAJA 4YSMA 5DNRA 5LVMA 3ZRLA 4QQJA 3MDYA 4LFIA 2C6MA 5E8VA 4G2FA 4KBAA 2XZSA 5IUGA 1BUHA 4J99A 4DTKA 2PMOX 4CEGA 4GFGA 1A48A 3TJCA 4KS7A 1KV1A 2R7BA 2IVUA 3R30A 4PF4A 3QLFA 5EYCA 1XKKA 5L6WL 4AW1A 3C7QA 1R0PA 4D2PA 1XHAA 4IWQA 4MXOA 5DG5A 2W5HA 3PLSA 4RIYB 5A6NA 1GZKA 4XNEA 4U9AA 2BZJA 1O6LA 5TF9A 4D2VA 4O83A 2OU7A 1ZOGA 5IEXA 3H10A 3HA6A 4HGLA 1OL6A 4QMNA 3KIOC 1U54A 5J7HA 2KULA 2C3IB 3DNEA 1Y57A 1YXTA 4EH2A 4EZ7A 3CSVA 3ZXZA 4B7TA 4TWPA 3RWQA 5AUXA 3IS5A 5GIOE 5H3QA 3R1SA 4I24A 5EYDA 5M4IA 3PZHA 4K9YA 1RW8A 4DFNA 3QD3A 4CRLA 2ITZA 3H0ZA 2GQSA 2HOGA 3AD6A 3UE4A 3F2AA 2IW9A 4PMSA 5AJQA 5ACBC 4ASZA 2BRGA 3UPXA 5D10A 4F9WA 4DDIA 5C8MA 3V8TA 1ATPE 3DFCB 3QQHA 3CY2A 4TXCA 3RP9A 3O7LD 4RC4A 4FSUA 3ORXA 3P7AA 4FZDB 3ODYX 3AKLA 2J4ZA 3C4CA 4WSQA 5L2SA 4QT1A 5ANJA 3KXMA 4RLLA 2ITXA 4X3FA 3KY2A 4CMOA 3LJ2A 3P78A 2FB8A 5ETFA 2IW8A 3EH9A 2B55A 2CGUA 3OTUA 4L3JA 5FDXA 3V6SA 4EK3A 5K5NA 3N51A 4IJPA 4QNAA 4M8TA 4LYNA 4CFFA 2ITYA 4OTFA 3W2RA 5IEVA 2XIZA 3FHIA 1M17A 4P90A 4C2VA 1XH7A 3OOMA 1IRKA 2V62A 2YFXA 1QMZA 3E92A 5FXSA 4BTKA 1S9IA 1XR1A 3VC4A 3PWYA 3HRFA 2P2HA 1PY5A 2X2MA 2X0PA 5HO8A 4BJJB 1KE7A 5E8WA 3RI1A 4E5BA 3Q9XA 3GC9A 4UZHA 3NUXA 4ACCA 1HOWA 4AAYA 4FV8A 3ZHPC 3R02A 3FXWA 2YWPA 2Z7RA 3CTHA 4GFMA 4L9IA 4E6AA 2VGOA 2X39A 2OIDA 2X2KA 4ITJA 3NW6A 3HRCA 3ORPA 5HBJA 5HG5A 4QYYA 2YCFA 2X9FA 5EI2A 4A4LA 2C0TA 3KC3A 2ITPA 4BKZA 3GEQA 4EYMA 4JR7A 3LLAA 4HGTA 1FPUA 4CKJA 5C01A 5B0XA 2HWOA 3ZRMA 4IBMA 2ACXA 2BRHA 3U8WA 4R5SA 1OUYA 4BYIA 4O81A 2QOFA 3MY5A 3O8PA 4MBIA 2YISA 4W9WA 4USDA 5CU3A 3THBA 2UV2A 1JKLA 2X7GA 4TNBA 5K9IA 2BIYA 2WTKB 3OVVA 2WMUA 2OF2A 5IQCA 5F4NA 3G90X 5J8IA 5FP5A 4AOIA 4YBKA 2C3JA 4PQNA 3UOLA 3GXLA 1YXSA 2VV9A 2JAMA 1B6CB 2J9MA 4NK9A 1BYGA 2VN9A 3EN5A 4AN9A 2OXYA 5JMSA 2ZV7A 4O0XA 4YJOA 1UNLA 4BFMA 2YLEA 3F9NA 1LR4A 4XBUA 4CFMA 5M08A 4IX6A 3GC7A 4RX8A 4F4PA 5A4EA 2VWIA 3LFQA 4FG9A 1P4FA 2XM9A 3OD6X 5BVEA 4ZLOA 5LVPA 1PHKA 3D83A 3EFWA 4DHJA 5M53A 4EK6A 2ETMA 3T9TA 3R28A 4GK2A 4QMXA 4YJSA 2W4JA 3E5AA 5TKDA 4V01A 3KGAA 4Q2AA 3QKKA 3KULB 3D5WA 2YCSA 3NCZA 4JRVA 1H8FA 5L8LA 2ESMA 4IB3A 2C6IA 2X0GA 5JGAA 5M51A 5C1QB 5CALA 4IVAA 4RMZA 3FLQA 3PY3A 1R78A 3NUUA 4BBEA 3ZMMA 4YLKA 5I9YA 4NSTA 3IDBA 5C9CA 5FRIA 4PV0A 5J7BA 2WMRA 5HQ0A 3MH0A 4ZK5A 3M42A 4HW7A 4RLKA 2F7ZE 5DHJA 3SC1A 4C58A 2B54A 3FZOA 3LFCA 4Y83A 4C4EA 4FA2A 2VWBA 4F7JA 5KMOA 4I1ZA 2JFLA 4QMLA 4JL9A 2QHMA 3L8SA 3LQ8A 4X2KA 1DS5A 4E4NA 4F6SA 3D15A 2JGZA 3RZFA 3OUKA 4I6QA 3W1FA 3OCBA 5AR8A 1Q4LA 3UODA 2YIQA 4BTFA 5DEYA 5GINE 4LOPA 5BYZA 3A4OX 1PKDA 2WIPA 2UW6A 3G0EA 4O4CA 4XX9A 4FI1A 3H30A 2Z60A 5GZ8A 3AG9A 4DITA 2CGVA 2BUJA 2HXLA 3LE6A 4I6BA 4G6OA 4QD6A 3FHRA 2E9PA 3VHEA 2CMWA 4H3PA 3VUGA 4PMMA 1PKGA 2QODA 4CTCA 4JRNA 1ZLTA 4BGQA 4CFNA 1BMKA 3OEFX 4CCBA 4CTBA 3MSSA 1G5SA 3BV3A 3R9RA 1Q8YA 2YM6A 4IFCA 1RJBA 4YC3A 4I4FA 3GCPA 4O7NA 5KMMA 5EW8A 3V6RA 5A6OA 5AAEA 2XANA 5DI1A 4P5QA 4PL3A 4QO9A 5E1SA 3W10A 3ZS5A 4F78A 2WELA 2WOUA 3QD4A 3LXPA 3UJGA 3E8CA 3UYSA 1GOLA 4I0RA 3COMA 3HMPA 3JYAA 3ACJA 4FTUA 4EHEA 3ZUVA 1I44A 2W05A 1WFCA 3BEAA 4GU9A 4HVHA 2AC3A 4ZY5A 4FOCA 3HVCA 1OGUA 4IACA 4IB0A 3R7VA 3VRYA 1CTPE 3AT3A 3MYGA 4JIAA 2C5XA 4LGGA 3R7OA 4KSQA 3WIKA 5IQEA 3ENHA 2ZMDA 4Y72A 4DTAA 3NNXA 2YJSA 5FQDC 3RAKA 3R83A 3R7IA 3WYXA 3KF7A 4F1OA 3LOKA 2YIYA 4BTJA 2PVKA 3ZLWA 4BHNA 4YUQA 3R9NA 4UX9A 5EKOA 4BCJA 4RIWA 2O63A 5LVLA 1OPLA 3LM0A 2LGCA 3P0MA 3OZ6A 4Q9SA 2CKPA 3SW4A 2IVSA 4GK3A 4U43A 2JFMA 4BCIA 5J5TA 5AV0A 4L43A 3A2CA 3NAYA 5A46A 3QQUA 1FOTA 3SDJA 5CANA 3OY3A 1YKRA 4IC7A 3T3VA 2VO3A 5CSPA 3E8DA 2Y6MA 3R1YA 2BZIB 3LCKA 3QKMA 5H8GA 5HU3A 4FL1A 3C4XA 3DQXA 3NUPA 4EOSA 5JFXA 5JSMA 3EQGA 3CCNA 1R3CA 3UMXA 3BHUA 4KNBA 2AYPA 2WMWA 5L3AA 4HGEA 4CG9A 2HAKA 4X0MA 3L9PA 3DJ5A 3GU7A 4O0YA 4DGGA 5CAUA 3FL5A 1UU3A 2RL5A 4BGHA 3QRIA 4GIIA 4IZYA 2QU6A 1P5EA 1OBGA 3KKVA 2J2IB 3A60A 2F7EE 4AFEA 4O4FA 4E93A 3RAWA 3E63A 2R3RA 3G0FA 3PXKA 4ZSJA 3ZEWA 4BKYA 5CXHA 4RWKA 5CTPA 4YJTA 5CT0A 5IG1A 5K4JA 1J7IA 1SZMA 3KU2A 3KVXA 4W4WA 3QX4A 4YJNA 1QPCA 4C3PA 2C6KA 2PUUA 3AC5A 1NXKA 4NFNA 3UYTA 3CR0A 4FSNA 3OBGA 3LJ0A 4FRFA 2GHMA 3R0TA 3PSCA 3ITZA 3HV7A 3LZBA 4F09A 4D2WA 4OR5A 4QNYA 3FQEA 1ZZLA 4C0TA 4F6UA 4U5JA 4N57A 4K2RA 3TZMA 1FMKA 5CAQA 3LM5A 1TZDA 2GNIA 2NNWB 1KE9A 3Q6WA 3L8VA 1PXJA 2G2IA 1AD5A 3LW0A 3DAKA 3GI3A 3H0YA 1URCA 4RJ4A 3G2FA 4ZTRA 5HCZA 1H25A 1WMKA 2AQXA 3VS0A 3D2KA 3TJDA 4FT5A 2VTLA 1OKWA 4FZFB 4K1BA 4YTHA 4AA0A 3B2WA 2BRMA 4MQ2A 3C4FA 4QQTA 3NYNA 1XMMA 2VO0A 4G1WA 3R8PA 1VEBA 4FX3A 3NVKI 4WNKA 3Q32A 1YWRA 3ORLA 5K0KA 4FEUA 2UVZA 2OJFE 3AGLA 3VW8A 5E1EA 4GSBA 4FTKA 4C4IA 4NFMA 4WT6A 2B9JA 5HIBA 4TYIA 3EHAA 4BB4A 1OMWA 3KMUA 1L8TA 1OB3A 2Q0NA 2EXMA 5LWMA 4V05A 5J79A 5FP6A 3IKAA 3VUKA 2VWVA 4FGBA 1UU9A 4DLJA 4EZ5A 4FKGA 5KX8A 5BX0A 3WYYA 1CM8A 2CNQA 1ND4A 1PXNA 2BTSA 4GIHA 4OBQA 3EZRA 2QO9A 4FC0A 4M15A 3NEWA 4FBXA 3SGCA 4RGJA 3A61A 1W83A 2BFYA 2V0DA 4RX5A 2B1PA 3OWKA 4R7HA 3PPKA 5DIAA 4H1JA 3PJ1A 3PXRA 5TOZA 5B7VA 3PUPA 4ZZNA 2QOLA 4TYHB 3GU5A 4ZY4A 4PTEA 1WBTA 3EQRA 1GZ8A 1M2QA 2OICA 4HZRA 4OLIA 2WU7A 2C6OA 2KTYA 2QI8A 2V7OA 3EQPA 4GJ2A 2G2HA 4GUEA 4AW5A 4FKQA 4BKJA 5JFSA 3U6JA 3WILA 4HVIA 1JKSA 4ZMEA 4K6ZA 5AADA 4LGDA 4U45A 3EQDA 1YRPA 4QP7A 3CJFA 3GCQA 4IX4A 4AW2A 2NPQA 4BI0A 4H36A 4IHPA 1NA7A 2R0IA 4XS2A 5ACKA 3UNZA 5HU9A 1OIRA 4KUJA 4XUFA 4WKQA 2GHGA 3AMBA 1BL7A 4RVTA 4D4VA 2X0QA 3TWJA 1UKHA 4PWNA 3BU5A 3O8TA 3P4KA 5IQGA 4ITIA 5FWKK 5FXRA 4I41A 4RQVA 5CI6A 1W82A 3SRVB 3W2CA 2BMCA 4AT4A 3Q6UA 4E6CA 1M14A 3I0QA 4TWNA 4HGSA 3RKBA 5J9YA 4KS8A 2BZKB 2VTAA 4IX5A 4NTTA 4QPSA 3AD5A 3MIAA 4ZTLA 4DAWA 4M13A 4EOQA 5IF1A 4IM0A 1U46A 4IM3A 5DWRA 4BDJA 4O1OA 2P55A 3C4EA 4A9TA 5JRQA 3DAEA 3KRLA 4I93A 2ERZE 4V0GA 3GFEA 3T9IA 3B8RA 3NYXA 3ATSA 3BHYA 4AGWA 4N70A 2VNYA 5T68A 4AN3A 3R00A 3NUSA 2XUUA 1ZOEA 2VNWA 5E92A 1U54B 4IANA 2WD1A 4PL4A 2X8EA 4LGHA 4YTIA 3RCDA 4HCUA 5C27A 5JZNA 4E26A 3K5UA 4FVQA 3W2OA 4Z3VA 2GNHA 2JIIA 2OW3A 2DQ7X 3GU6A 2SRCA 3BLRA 4RX9A 1NY3A 3E93A 3AXWA 4WBOA 4P2KA 2CCHA 5HD4A 3DGKA 2WGJA 3OOGA 3R63A 4IAZA 5KHXA 2R5TA 2R7IA 3OFMA 4RG0A 2J0LA 1CDKA 1UWJA 4NUSA 3BYMA 3PY0A 4FV2A 1TVOA 4KA3A 1H08A 4KBCA 3NFGB 2QKRA 3LIJA 3TNHA 5CZIA 4MXAA 5EW3A 1U59A 4QP6A 3R04A 1W98A 2HWPA 1YDSE 2JC6A 2C1AA 5ETCA 3D4QA 5KO1A 2RFSA 1JSVA 2YITA 3BWJA 3DKOA 2OFUA 4MEDA 1PRYA 4JNWA 4KABA 3ML1A 4I92A 4G3EA 4D58A 4JDIA 4O0VA 3CTJA 4FV1A 3TYKA 2JKKA 4ANMA 3FKNA 4IAIA 1DAWA 4FOBA 4DFYA 5HNBA 3QTIA 4L3LA 4F9AA 4YTCA 4C34A 4LUEA 5GJGA 4CV9A 1NVSA 3F3TA 4XRJA 4R3RA 3UNJA 3EWHA 3HUCA 4BY9E 1SM2A 5JGDA 5LARA 4D0XA 3IW4A 4JLCA 3RHXA 3OMVA 4ZS4A 3JS2A 3ORKA 5D12A 2BAJA 4NCTC 4AT5A 2J0IA 3OY1A 5IA1A 3DBFA 3MV5A 4DEEA 3AC4A 2PYWA 5CZHA 3NMUF 3ORIA 3UGCA 5M07A 4NM7A 4ACMA 1J1CA 2F2CB 3G9LX 3SHEA 3C0IA 5IA2A 2XK6A 3E7VA 1IAJA 3ORTA 2JLDA 4EBVA 5JH6A 1MQ4A 3VS4A 3NAXA 5A54A 3JXWA 5LMKA 3COIA 1YDTE 3PJCA 3HMIA 4ASDA 4EHZA 3ELJA 4Y8DA 2PULA 3I4BA 4FEQA 4YZCA 4O7VA 1EH4A 2JIVA 2UZDA 3AOXA 4H3QA 2PUNA 3RK9A 5CXZA 5GZAA 2OI4X 3FBVA 4RWIA 4U8ZA 3S0OA 3UZTA 2CCIA 2R3OA 4M67A 2YM4A 3CC6A 3LQ3A 3MA3A 4PY1A 3MTLA 5CU6A 2UZLA 3LFFA 4EC8A 3HEGA 3QTXA 4L53A 2C5OA 5HICA 2JAVA 2ZB1A 5AEPA 3Q9YA 1OPKA 1K3AA 2PZYA 1W84A 4O27B 5I9XA 4O7ZA 2OG8A 4YC6A 2YDJA 3KK8A 4WNMA 4J98A 3POOA 1JKKA 4R8QA 4EK4A 5IEYA 5ANGA 3LVPA 4RA4A 4LM5A 5AR3A 3I5ZA 3GVUA 4I0TA 1SNUA 2BZHB 4OGRA 3RHKA 4BN1A 5KMNA 4FIHA 1ZXEA 3PZEA 4X7QA 2ITOA 3FZ1A 4U97A 2E9VA 4XMOA 4WG4A 3P79A 4ZJIA 2HIWA 3I81A 4BDGA 4GCJA 5EKNA 3BU3A 4MD7E 4KIKB 1JSTA 4ZSEA 3UC4A 2QG7A 4RZWA 1H1PA 4JX7A 1E9HA 5EI8A 1ZYJA 3WARA 5CAVA 2YJRA 4LUDA 4U40A 4XJ0A 3W2SA 4AE9A 4AXFA 2X9EA 3DCVA 3HP2A 3DT1A 3HYHA 4E8AA 3GB2A 3SQQA 1VR2A 4FT0A 3U55A 4EOLA 1Q99A 3R2YA 4IJ9A 1H27A 2YLFA 3C4WA 2X2LA 3MJ2A 4AZVA 3S2PA 4DH7A 2I0YA 3FKOA 5DT4A 2IO6A 4GEOA 2WTDA 2YIXA 4E6QA 4EWQA 4HCVA 4AZFA 2WPAA 4LL0A 5CVHA 4EONA 3GBZA 2PE2A 3QD0A 3QWKA 5HIEA 3U6HA 4YJRA 2R3LA 4I4EA 2BAQA 4S34A 4BDEA 3ZCLA 5LXMA 3VONA 3EKKA 4EHGA 3ZLXA 4AA5A 3COKA 2I0EA 1JOWB 2EWAA 2ITTA 2QR7A 4M0YA 2YDKA 1B38A 4DGMA 4C4JA 5I9VA 4FKSA 4YJVA 5HO6A 3ZC6A 4D55A 5K0XA 3EMGA 4IWPA 4XCUA 4Q9ZA 4J53A 5EM5A 4JBPA 3ZDIA 4R6VA 1ZYDA 2E9UA 3C50A 4QPMA 2XCHA 3QYWA 4FT9A 3V01A 4D28A 4ENYA 2YWVA 3DDQA 2RFEA 1JWHA 4ZTQA 4AA4A 4AU8A 4EJNA 3QD2B 3FMMA 1BLXA 5CQWA 2I7QA 3C5IA 2O5KA 2OK1A 2QLQA 3TKIA 3E64A 4MBLA 2VRXA 1XH8A 3PXYA 2QOKA 4WNOA 5FBOA 4HYSA 2NRYA 3PIYA 4O96A 4FTCA 4IADA 1KOAA 2JD5A 1PXLA 3FLSA 3UVPA 4A4OA 4E5AX 3B2TA 4F64A 5M57A 4BCGA 3UQCA 2Y0AA 4CLJA 5HLNA 5B2LA 4OTHA 3R8UA 4UYNA 3HX4A 3QRJA 3WZKA 5E8YA 2CHLA 2PK9A 5A4LA 3MWUA 2GS7A 1KE6A 4U3YA 4BDDA 4G16A 1GJOA 1SMHA 5CSVA 4UEUA 5A4QA 4DF3A 5HO7A 3ET7A 5AFVA 3OWJA 4NIFA 2WXVA 3DA6A 2H96A 3FPQA 2ZAZA 5TR6A 3RVGA 4B8MA 1GNGA 2PZIA 5BVWA 4CMUA 4U42A 2UW5A 3TZ9A 4QMSA 3ORZA 5HEZA 4JT3A 1IAHA 3D5XA 3BE9A 3MPTA 5DR2A 4CMTA 3QTQA 3O5AA 4AS0A 5CI7A 5HHWA 4ANBA 4X2FA 3VS3A 1Q62A 2CJMA 3FE3A 4QP2A 5ETAA 4UYAA 5A3XA 3ZZEA 4B6LA 5JQ8A 2W1IA 2V7AA 3V8WA 4CZUA 4FKWA 4JVGA 1A06A 4XG6A 3IGGA 3TEIA 4PPAA 5HIDA 4BCNA 4MK0A 2DYLA 4RIXA 4LRKA 3QA0A 3EN6A 3OTVA 4BICA 4BRXA 1GZNA 4DGLC 1JNKA 3CBLA 3K2LA 4BBMA 4DN5A 3TNQB 5GNKA 3W0OA 4RRVA 4YO6A 3AC2A 4QTAA 4DYMA 2OKRA 1Q3DA 2XNOA 3OROA 3KB7A 3P5KA 3M1SA 3FC1X 4GMYA 2X7OA 2OZAB 5AAFA 5E8XA 3W18A 4MBJA 3BCEA 4EOMA 2QOIA 3ODZX 5AV2A 2XIRA 5KBRA 5KNJA 2IZUA 4IIRA 2JBOA 3WZUA 3JR1A 4O21A 2XH5A 1DAYA 3ACKA 5FGKA 5BVFA 2FSLX 3EB0A 4KSPA 4DTBA 3R73A 4CCUA 1IA8A 3PWDA 1G8SA 1PMVA 3JVSA 4YURA 4OAVB 3KXNA 3G6HA 4GH2A 2QLUA 2QOQA 5BMMA 5EOBA 3CQWA 4O7TA 5BVDA 3PTGA 4BCPA 1G8JA 3U54A 4DFZE 1ZRZA 1BX6A 1M52A 1OKZA 3FC2A 2ETKA 2ONLA 3VS1A 3C9WA 4F9YA 5HOAA 3MIYA 4C4GA 4DH5A 2IF8A