4ZJJA

Pak1 in complex with (s)-n-(tert-butyl)-3-((2-chloro-5-ethyl-8-fluoro-dibenzodiazepin-11-yl)amino)pyrrolidine-1-carboxamide
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
291
structure length
280
Chain Sequence
SDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine/threonine-protein kinase PAK 1
publication title Optimization of a Dibenzodiazepine Hit to a Potent and Selective Allosteric PAK1 Inhibitor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 95
structure length 280
sequence length 291
chains with identical sequence B, C, D
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4zjjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4zjjA01
2XIXA 3RVGA 5DVRA 3F3VA 3C4EA 3DPKA 4JBOA 4AA4A 4KIKB 3PA3A 2J0LA 4EYMA 4C7TA 2XH5A 3O96A 2CLQA 2F2CB 4FTQA 4JR3A 2XEZA 3QX4A 4YZMA 4QMQA 1U4DA 4M15A 2WQEA 1HCKA 4F09A 4O0VA 5D11A 2LGCA 5B2KA 2YWVA 1OPLA 1OPKA 3EYHA 2ZM1A 4I24A 2ZV2A 3LFAA 2UZDA 3BHHA 5IH5A 4UEUA 2XIZA 5EHOA 2OFVA 5JT2A 2KULA 3U87A 2W1IA 3BLHA 3KC3A 2FSLX 4IE9A 2VTPA 5GJGA 3VO3A 4BIBA 1IR3A 2E2BA 5CSPA 2XRUA 2YCQA 4F1MA 2Y4PA 1YRPA 3D5VA 3HV3A 3NW5A 4K9YA 4BIEA 2QONA 4BF2A 2IVSA 2XF0A 3EQIA 5HIBA 3PY0A 4G1WA 3TNWA 1DAYA 1FINA 1TKIA 2BAQA 2BRMA 2BRNA 2W1DA 1XBCA 1Y91A 2WTWA 3BWJA 3DAJA 3JYAA 4FKTA 2W96B 4IWDA 3TUBA 4FKSA 4KABA 5A3XA 1YDTE 2QCSA 4JL9A 2BALA 2A4LA 4M0YA 4X6QC 3S4QA 3UVQA 4F63A 4EOQA 4D2SA 5LVNA 1DM2A 2CKEA 2XJ0A 1Q62A 2XK6A 3AGMA 2Y6MA 4N70A 4IC8A 4XG3A 3Q9WA 5H8GA 3NIEA 4G6OA 3ZHPC 1FBNA 1KE7A 3DFCB 4H3BA 2W1ZA 3R30A 4RZVA 3KRRA 2PUNA 1Q8YA 4E5AX 4BYIA 4PPAA 4E6CA 3T9IA 4BWXA 2UW6A 4DT9A 3EN7A 4O7NA 3TZ7A 3EN9A 3PVGA 2GS2A 2QKRA 3R7UA 3QTIA 4HGLA 3A8XA 1JSUA 2XKEA 4X3FA 4YJTA 2WMRA 3MH1A 3OXZA 4HCTA 3VUIA 4C58A 5IPJA 2QO9A 4EBWA 2WHBA 3BPRA 3COHA 4FVQA 4EH7A 5HNBA 4FUYA 4XMOA 2C0OA 2QI8A 5AAEA 1W83A 1XH7A 3ZC5A 2R3RA 2GHGA 1A06A 3F3TA 4TYEA 5HCXA 4YJUA 3PFQA 4QMZA 4QYYA 3ZYAA 5C4KA 3OFMA 3MFRA 3K2LA 4F9AA 3MFUA 1TQIA 3DBEA 4MBJA 4MBIA 3DY7A 4OTWA 4PTCA 3AGLA 3GU4A 1ZZLA 1VYZA 3KEXA 5D12A 4AGDA 3RKBA 2VTTA 3C13A 3PSBA 3FSFA 4IAZA 4NKAA 2GHLA 4QPMA 4RJ4A 3NUPA 4C3FA 3SOCA 4D2TA 4NTTA 4XG9A 4B0GA 3ZONA 5KMJA 4AG8A 5DFPA 3BELA 4KWPA 3ZFXA 2I0YA 3F3WA 2XNNA 5LXMA 4QQTA 2HIWA 5D10A 4DYMA 4XNEA 4C4GA 4EC9A 2F7ZE 2XM9A 5DI1A 3THBA 4AT5A 3QTQA 5CEQA 5CF6A 4LUDA 4M14A 4AA0A 3RZFA 5IA0A 3VHKA 4QTDA 5HVKA 4GKHA 3RHXA 4X2GA 4BTJA 1URWA 3ZO2A 3UODA 1OUYA 2B52A 2VAGA 3WE8A 1T46A 2JKQA 4NWMA 4QP3A 2BDWA 1XJDA 4MBLA 4Y95A 4AF3A 4HNFA 5C26A 2PVRA 1F3MC 3HVCA 4CG9A 3EFLA 4G5PA 4DG0E 3Q52A 4BZOA 5I0BA 3ALNA 1WFCA 1DAWA 4AZTA 1OITA 2ACXA 3R83A 1W82A 3KRXA 4FEXA 3HEGA 4O27B 2OW3A 4D0WA 1LEWA 4S32A 5HE2A 3D5UA 4UMRA 2QHMA 5DT0A 2OJIA 4BCHA 4QMMA 1JAMA 4IHPA 4K77A 2BRBA 2UZTA 3FMHA 3LPBA 4EC8A 4RA5A 3N4VA 4FUXA 1UNLA 3JVRA 4QP4A 4FTMA 5IA3A 4F9BA 5F20A 4WHZA 5JN2A 4TRLA 4WKQA 4E6QA 3HAMA 3EOCA 5FDXA 3NAXA 3LLAA 3BZ3A 4FK6A 4IX6A 5FM3A 5GZ9A 3KCFA 3VF9A 3H4JA 3I81A 3SV0A 4L3PA 3BYMA 2EWAA 3OWJA 5KBQA 3MB6A 5L3AA 4B99A 4I94A 2WIPA 3Q4CA 4IX3A 4M66A 5HE1A 4K2RA 2QOBA 3DKGA 3EH9A 3DKFA 3R8ZA 3C0GA 3ORIA 1H26A 1PXLA 2BILB 4WOVA 3D7TB 2E9VA 3ALOA 4LUEA 5CALA 2CKQA 4FEVA 1MUOA 5F94A 3AC8A 1J7LA 3MIYA 5EDRA 5HBEA 2O0UA 3LIJA 2X2MA 5EI8A 3BRBA 1IA9A 1ZY5A 2R3JA 4LG4A 5IA5A 5CU4A 3VS3A 2C3LA 3FMKA 4FODA 2WKMA 4ARKA 5HIEA 4DCAA 4LOPA 4HYSA 3DAEA 3PG3A 4FZ7A 2X4FA 4D4YA 2R3OA 4O0XA 1CKIA 2QG5A 4L45A 3Q5ZA 3PG1A 1URCA 2ZVAA 4G17A 4JBVA 3SD0A 5E8TA 2QU6A 4TNDA 5HO8A 4BI1A 1YDSE 4H1JA 3GQLA 2Z7RA 4G16A 3R28A 1P4FA 3ACKA 4QPSA 5KZ0A 5BPYA 3LFEA 1PYEA 3D14A 4X3FC 3I0QA 4CQEA 1R3CA 5FWKK 2BKZA 4S2ZA 2YDJA 3P86A 4EQUA 3F3ZA 5HGIA 5HNGA 1VEBA 4KBAA 3KU2A 3RNYA 2CMWA 4C61A 5AR3A 2XNEA 1VZOA 2PE0A 3AD4A 5GINE 1ZMVA 4AZFA 2NRUA 2ITZA 2JBOA 2PMOX 3UTOA 1FMOE 2R64A 3L8PA 4C02A 2ZM4A 4I6BA 1APME 2ESMA 2QO2A 2XNGA 2AUHA 2JBPA 3NUSA 3TNQB 3NUAA 1JNKA 2HWPA 2GNHA 4IM2A 3Q4UA 3OZ6A 5J9ZA 5M44A 2CKPA 2B9HA 4C36A 3UOHA 4FV8A 4S31A 3CTJA 4IZYA 3VBWA 3DXQA 5IH6A 4PWNA 5H8BA 3KKVA 5IF1A 4EH2A 4RMZA 4GJ3A 3DK3A 4DFXE 3HNGA 2XK7A 4FSTA 4OBQA 2WTCA 3OF0A 4U6RA 5KNJA 3HAVA 5I9YA 4KKGA 2REIA 2X81A 4ZTHA 5G1XA 3QCXA 4EZ7A 4J97A 4RC4A 1LP4A 2B7AA 2X1NA 3ENMA 5BYZA 2O65A 3RCDA 2R7IA 3LXLA 4FSQA 3RK7A 4CFMA 1A48A 5A6OA 4KRCA 3P9JA 4XV1A 5JFVA 4H39A 3R9NA 3ZXTA 2JIUA 4MQ2A 4LM5A 4EOMA 4IZ7A 4NM0A 3PIXA 4HZSA 3NW6A 3P79A 2W99B 5CQWA 4U43A 4ZP5A 4BDHA 3SC1A 3ZLXA 3TDVA 2EXCX 1R39A 2VWYA 4FOBA 1H1RA 5M4IA 4F99A 3F69A 5AFVA 5AAFA 2OZAA 4TWPA 4F1TA 4LGHA 3P7AA 5TE0A 3ZDUA 1PMNA 1PXIA 3CD3A 1PHKA 3AD5A 2CDZA 4TT7A 4G5JA 2LAVA 5BYLA 3EWHA 4R6VA 1OUKA 2YN8A 3KL8A 4U44A 5IUIA 2BTSA 3P0MA 3RK5A 2VO3A 2BTRA 4FKOA 3DZOA 1YW2A 4O7YA 4W4WA 3FLZA 5AA8A 4UBAA 3H30A 4PMTA 2WTKC 1K9AA 3DLSA 4J96A 4FIJA 3G90X 5KHWA 3R02A 4EH8A 2V7OA 4MH7A 3NUUA 2OIQA 4MKCA 4IAFA 1U46A 4C4EA 4RIYA 5HX6A 4U9AA 4J7BA 2B9JA 3ELJA 4TYIA 4GK4A 4K6ZA 1ND4A 2R9SA 5C27A 4EH9A 2XKCA 1ZYSA 3G33A 3G9NA 4ZSJA 3NYVA 3TV4A 5FDPA 4XP2A 1OKYA 4QNAA 4O0WA 3ENHA 4D28A 3SW7A 4KSPA 3NS9A 2QKWB 2ZM3A 4XRLA 5AUZA 2ZDUA 4CYJA 1WAKA 1MQBA 3JS2A 5AP7A 4OAUC 4Y8DA 3BU6A 2YAAA 3OHTA 5FQDC 4L7FA 4YSJA 4L3JA 2PVHA 3WIGA 1ZRZA 2R0UA 1SVHA 4O82A 4HVHA 3SRVA 1T45A 4O6LA 3TKIA 3TV6A 4TWNA 3TIYA 3PXKA 3GI3A 5AMNA 5AV3A 3WYXA 4BL1A 2EXEA 4OTQA 5J8IA 3SA0A 3F9NA 4MXAA 1Q8WA 1GZKA 2BRHA 5KKRB 2F9GA 4EHEA 4ENYA 1IG1A 4EHVA 4FG7A 3WZDA 1IAHA 5IQAA 4I5PA 3RCJA 4FSZA 4ITIA 2VX3A 2BAJA 4IX5A 1OL5A 4RPVA 3L8SA 3QQHA 4F64A 4KUJA 2ITYA 4I3ZA 3HYHA 3D7TA 5HORA 5K9IA 3UPZA 3KULA 3QUPA 5KO1A 3PPJA 4XOYA 2RFSA 3CKXA 3I5NA 5HE0A 5JEBA 3ZO3A 3IO7A 4X3FB 3R8VA 3ZEPA 1UA2A 3DKOA 5EDQA 5LWNA 2QU5A 4JBPA 2UZLA 3L9NA 5K3YA 5HI2A 3G0EA 1PXNA 4U0IA 5CWZA 5C01A 3HV7A 5H2UA 5CASA 3E63A 3FLWA 4BDEA 1YI6A 4D2PA 2ERKA 4FZDB 2G9XA 1TVOA 5CXHA 4FTCA 4LL0A 3RPOA 1V0PA 1H1SA 5CEPA 3W16A 4Y5HA 5HTBA 3HL7A 1L3RE 1VYWA 3KMMA 3FMEA 4I4FA 3UP7A 3MVMA 4RWIA 3UMXA 3VUHA 1ZZ2A 2WGJA 3IGOA 3MY1A 4S30A 5M53A 2OIBA 4UYAA 4HGSA 4LFIA 2HENA 4FIFA 4YJOA 3UOLA 4JI9A 3VBXA 1UKIA 4KD1A 4QMLA 3U9NA 4D58A 4RZWA 1Z5MA 3DDQA 5FBOA 4BDKA 2UV2A 2V62A 3FQEA 3JUHA 4QP7A 2IVVA 4NTSA 3R1YA 2UW3A 3AC2A 2A2AA 2OO8X 2P55A 3E8NA 3RMFA 3UVPA 2JDOA 3U8WA 5FP5A 1ZARA 2PUUA 5AP1A 3PXQA 4JX3A 3PJ3A 4RGJA 3DNDA 4U45A 2XCHA 5DGZA 3BX5A 4GT3A 3H9FA 5K5XA 3S0OA 1KUTA 3ZXZA 4CFVA 2BFXA 2C6KA 3OY3A 3W33A 4QMUA 3Q4ZA 3QBNA 4HJOA 3G5DA 4YLLA 4U3ZA 4RIOA 2OKRA 3R7YA 4D1XA 3UO5A 3QTZA 3C7QA 3BV3A 4NIFA 4HCUA 5AUYA 3MYGA 3PWDA 4IJPA 4RJ6A 4X2NA 3RTPA 2WELA 4ONAA 3EKKA 4Y83A 3I6UA 5B7VA 3NSZA 4C4JA 5HG5A 3QTSA 5EQYA 1A9UA 4GRBA 5CU3A 4OTDA 4D2VA 5CEOA 1GIHA 4JIKA 2YITA 1GJOA 4AUAA 3NUXA 4O2ZA 3W18A 2XJ2A 4JIAA 3VUKA 1SVGA 1E9HA 3UZPA 1WVXA 4EYJA 5M09A 4EWHA 4FIHA 3OS3A 2YCFA 2ZOQA 2WQNA 3PY1A 2VWBA 4IVCA 4LGGA 3RM7A 4D2WA 4JG8A 3A7FA 2SRCA 5LVOA 4PP9A 2G2HA 3V6RA 2GMXA 5LMBA 4QP1A 3DKCA 3BKBA 1OKWA 4Z16A 2A19B 3UO6A 5BUJA 2C5XA 3KMWA 4I4EA 2X6EA 1E1XA 2FO0A 2WTVA 3M42A 1WCCA 3ORPA 2Z7LA 4L01A 5HG8A 3N9XA 4RJ7A 2HCKA 4QRCA 3IW7A 5EW9A 4NKSA 1CSNA 5JMSA 4NW6A 1PY5A 2HYYA 2IVTA 3OCTA 3WI6A 1QPCA 5E4HA 3ZBFA 3QZFA 4L3LA 4E4XA 3O0GA 4HVSA 5HLWA 3PJ1A 5J79A 4OUCA 4FKIA 4I0TA 4AS0A 3V5TA 3LFBA 3R01A 4CFUA 1RW8A 4KINA 4IIRA 4JQ8A 4J1RA 2JAVA 3ZC6A 2YA9A 4DGGA 2YCSA 4FKLA 5M06A 5KBRA 3DBFA 3KXGA 3SKCA 3BQRA 4BCJA 4E3CA 3WYYA 2W9ZB 4DN5A 4UV0A 5GIOE 4FTIA 2CCIA 4IXPA 5IQBA 3TUCA 3GQIA 2X7OA 2NP8A 2WO6A 2AYPA 3MS9A 5AUXA 2UVXA 1MQ4A 5GHVA 2VGPA 4I5HA 3NAYA 3O51A 3QQJA 2GNLA 4W8DA 3VJOA 4FA2A 4IZ5A 3CXWA 5ITAA 3C4WA 4YJPA 2EB3A 3BGPA 1OBDA 2BRGA 2GFSA 2GS7A 4EJNA 4YLKA 4BIDA 1ZMWA 2O2UA 2OJFE 5GNKA 3GVUA 4DFUA 1I09A 1S9JA 2GNFA 2J0MB 2J90A 2WMTA 2C0TA 4F65A 4JNWA 1XH5A 3A61A 4PUZA 2VZ6A 4EOIA 5HBJA 3PZEA 1OIUA 3U54A 3F2NA 2WMSA 3LW0A 4E4LA 3IW5A 3EQRA 3RAWA 3SXRA 2WEVA 4D4VA 3IDBA 4FG8A 4JVGA 2JDSA 3OTVA 4U41A 3AD6A 3PVWA 1CDKA 4IB3A 3NCZA 4O96A 4U5JA 4GKIA 3VUMA 4YO6A 2C3KA 5JKGA 2QOHA 1P4OA 3D4QA 4IX4A 4TNBA 3TWJA 3N4UA 4IB1A 3KCKA 1DI8A 4ZTNA 4DTKA 3W2QA 4NSTA 4RWLA 4IANA 1MRUA 4CFXA 4F70A 1VJYA 2JGZA 2OK1A 5KMKA 4H3PA 3OEFX 4JDKA 5TF9A 2W1FA 1ZOHA 3Q3BA 3V5QA 4HCVA 4DH3A 4ID7A 3PXYA 3FKLA 3ERKA 2J4ZA 2CSNA 4J8NA 2PYWA 4FTLA 1V0BA 3HP5A 3TNHA 4J53A 2W17A 5IEVA 3QCYA 4ZAUA 4G6NA 1Q8UA 4ANNA 4KBCA 1XO2B 3K5VA 3VRYA 5IA4A 4APPA 4L7SA 2C0IA 4DEIA 2HAKA 4P5QA 4E4MA 4ZLZA 3MTLA 1QCFA 4EONA 2R5TA 4YTIA 2BMCA 2PZ5A 3OCSA 4BI2A 3E93A 4G3CA 4NJDA 3H9OA 4FTKA 4ACHA 2CNVA 2PMNX 2XP2A 2OZAB 3UE4A 1NT2A 3GC0A 1OIYA 4X2KA 5T6KA 4E1ZA 2C1AA 4AW2A 5E7RA 2XCKA 3D83A 4UMTA 1NW1A 3O2MA 4FYOA 4RWKA 4TL0A 2F57A 5D41A 3NUYA 1NVRA 4IWQA 4QP6A 3EQHA 4FEWA 3QCQA 5EM7A 4DT8A 5E8VA 1H4LA 4EZ5A 1EH4A 5FEQA 4O21A 5JFWA 4CKRA 2VTAA 5FTGA 3HRCA 2O63A 4D1SA 3LXPA 2J5EA 2FGIA 4RJ5A 3V01A 3PDTA 4PF4A 4A9SA 2AC5A 3F2AA 4G3FA 3LLTA 4U80A 3BLQA 4CKJA 3OBGA 5AV1A 4NJ3A 4DEHA 3E88A 4FL3A 2VWXA 2OSCA 1FVVA 3EIDA 4YLJA 5KMLA 4FR4A 2IVUA 4FSRA 4ZEGA 5K0XA 4AAAA 3ORNA 4MHAA 3ZBXA 3SW4A 2X39A 1ERKA 3ZU7A 4BKYA 3G6HA 4FOCA 2IZSA 1OKVA 2WAJA 4ZSEA 3R1QA 3VUGA 5C9CA 5EM6A 5HBHA 3VAPA 3KREA 5LMKA 5HG9A 5LVLA 2R3LA 3QTUA 1XH6A 5JK3A 3ZS5A 1M52A 3KRWA 5J5TA 4QYGA 2UZOA 5F1ZA 1OL1A 3F7WA 4NK9A 3SRVB 3F3UA 1V0OA 4R7HA 2X2KA 3MH0A 2WB8A 4YC3A 3ULZA 1GZ8A 4WG3A 4DGOA 3BYOA 3CBLA 3CQEA 3E62A 4YJRA 5DBXA 4JRVA 5DPVA 5E1EA 4EOSA 3U51A 4JXFA 4QMNA 3W8LA 1KE8A 1YXVA 4V01A 2VTIA 1O9UA 3DV3A 3HECA 5FXQA 5CAPA 3OBJA 4MXOA 3EYGA 5KX8A 4DF3A 5BYYA 2UZUE 3AQVA 4IFGA 1YHWA 3MBLA 5DE2A 1J7IA 1JPAA 4K11A 5EDPA 5HESA 4PPBA 5HKMA 3FLQA 4W4YA 4FTJA 3WF7A 3TTIA 4BDCA 4BGHA 4DC2A 4FV1A 2J2IB 2FYSA 3QKMA 5CTPA 4A9YA 4Z9LA 3MY0A 3BWFA 3ZSIA 2ITTA 3KULB 1JKTA 2GCDA 2WMVA 1XWSA 3MY5A 5IEYA 3H10A 4XLVA 3FMMA 3QKKA 4F7SA 4FZAB 3D5XA 1J1BA 4UY9A 1YHVA 3FMJA 5AJQA 4IAKA 4IAAA 5AR4A 1R0PA 3AC1A 1NA7A 5HG7A 2QR8A 2WMAA 3C0IA 3DZQA 3UC4A 3DB8A 4HOKA 3LCKA 3UYSA 4CMUA 4QQCA 4CCBA 4M67A 1HCLA 4EBVA 5DEYA 5CVGA 4RX7A 2YZAA 2CHLA 3LAUA 3LM5A 4BTMA 4X7QA 4D4SA 2YLEA 3NGAA 3AT3A 4GJ2A 4ANQA 3IOKA 2QOFA 2VTLA 4YNEA 3FZTA 5E8SA 4AZEA 2R4BA 3R8LA 3BHTA 3FHIA 2F4JA 3QHWA 4ZSAA 2V22A 4ZJVA 4C34A 4ZTQA 4JDIA 4R1YA 3QHRA 4AXAA 5FTOA 3RWPA 5AWMA 4IVDA 4NUSA 4XRJA 4BCKA 3UIUA 3DCVA 4AOIA 2VN9A 4GMYA 4H36A 4IAYA 5HTIA 5KE0A 4GIHA 3RBWA 4A4XA 2RSVA 3D94A 3FI3A 3W2RA 1GIJA 3QALE 3ZUVA 3C0HA 5EKOA 3V5LA 4FV3A 5AV4A 5EK7A 3FPQA 2CGUA 4FZFB 4Q5HA 3TUDA 3FZRA 4WT6A 5FBNC 4QNYA 3QUEA 5LARA 2O8YA 5E8WA 2R3HA 1WMKA 2BDJA 2YIWA 2C47A 3GFEA 3LFQA 4G2FA 4AFJA 4BFMA 4BKJA 4NIFB 4WBOA 4ZLYA 3OT3A 4FX3A 4B8MA 4MNEB 4MXYA 1PXKA 5M55A 5I3RA 3G51A 3KF4A 4WIHA 2QNJA 3NIZA 4A06A 4USEA 4JJRA 3TXOA 5K0KA 3V8WA 4ACCA 1JLUE 3CD8A 3P7CA 4FTAA 4XG6A 4YTHA 3TN8A 4YTFA 2Q83A 1XKKA 4BCMA 5KCVA 5FGKA 3ULIA 5AUTA 4O7RA 2CLXA 3B2TA 3LQ5A 3UQGA 4DEEA 4UMUA 4G34A 3MH3A 5ETCA 3ZLYA 4Q5EA 4AZWA 3D0EA 3A99A 3LCSA 1NXKA 4U79A 3WILA 1OMWA 1X8BA 2BHHA 3WF9A 4FEQA 3OT8A 4P4CA 4XP0A 3JXWA 2R3GA 4YSMA 4TPTA 2PVLA 3BU5A 1PKGA 4D2RA 4MWIA 3L8VA 3E8CA 4IVAA 2PK9A 3GEQA 3M2WA 1YXXA 5AUUA 4PNKA 4C3PA 3QD4A 2VRXA 4FI1A 4BBFA 2XYNA 3R2BA 5HLPA 4EZ3A 3E92A 2YEXA 5LMKC 2GPHA 3DJ7A 4N0SA 3DB6A 3E8EA 2JDRA 4LI5A 5E9EA 4I0SA 3UG1A 4EH6A 3GNIB 4ZJIA 2ITWA 3EMGA 3DBDA 4O2PA 3PUPA 2PSQA 2AC3A 1YOLA 3VBQA 4X0MA 4ALWA 3NYNA 4FK3A 4H1MA 3GC9A 5CF4A 3DDPA 2PUPA 3QTXA 4ZIMA 5L6PA 3ORKA 5A46A 3BGQA 3SG8A 3KF7A 3E5AA 2J9MA 2JIVA 3A4OX 4FSMA 3IPHA 4M68A 1GAGA 5ACKA 3FXZA 1I44A 2IJMA 3RAIA 1W84A 1FGIA 4JQ7A 4ENXA 5J95A 3ATTA 4E6AA 3Q32A 4FTTA 1XH4A 2W1HA 2PE2A 4C4IA 4YPDA 4NFNA 5J7BA 4O91A 5JGAA 3U9CA 3ZZEA 5AV2A 3C4CA 1UWHA 3WBLA 1KE6A 3QQLA 3PVUA 4DFZE 4F4PA 4XV3A 2YWPA 3F61A 3FDNA 1H28A 4UZDA 5G6VA 4OAVB 3S00A 4RG0A 5A4CA 1XBAA 4KBKA 2C3IB 3AG9A 2GQGA 3ZM9A 4F6SA 4ASEA 3P4KA 1RJBA 3FJQE 2X8DA 4FKUA 4W4XA 1M17A 3ROCA 4F0GA 3BEAA 5CXZA 5IKWA 4PQNA 1B6CB 2PPQA 2HXQA 4GUEA 2GTMA 4CT1A 5CU0A 4OBPA 4FF8A 5AP6A 4IWOA 1CKJA 2P2IA 3JPVA 3JY0A 5CY3A 5M07A 5H8EA 2JC6A 3DXPA 3PLAE 2B9IA 3UMWA 2E9OA 2FSOX 3QD3A 3F5UA 4GUBA 5L2QA 5BVKA 2PE1A 4DITA 2UZWE 3CPBA 1KV2A 2J7TA 4NZWB 4XG2A 4OT6A 2J50A 3FE3A 4RJ8A 3A2CA 3PXZA 2B54A 3IDPA 3BCEA 4R3PA 4TN6A 4FKVA 3VS5A 5IISA 5KKRC 3DS6A 4WG5A 2E9PA 4YU2A 4DG2E 4R78A 2R3MA 3DGKA 5J9YA 4KKEA 2YM3A 4RIWB 2BROA 3UJGA 4NM3A 4TTHB 4DFYA 2XB7A 3ZLSA 4RWJA 5AEPA 2X8IA 4KNBA 1J91A 3UYTA 3FI8A 2YIQA 4BGGA 5CU2A 4IEBA 2R3PA 2JAMA 3DOGA 4LQMA 4J71A 4IACA 3TNPC 5DRDA 3RM6A 3TT0A 4ANMA 3OWKA 1U54A 4PV0A 4XHKB 2I0HA 3QX2A 2QG7A 2WPAA 2J6MA 3B8RA 4DG3E 4C59A 4R5YA 1IAJA 4P5ZA 3WF6A 5DNRA 4C8BA 4YZCA 3TIZA 2OZOA 3R2YA 4ITJA 4J95A 3AXWA 4FKQA 1U5QA 5CVHA 2VO0A 3BHVA 1MRYA 1ZYJA 2VTOA 4ZZMA 4EHGA 3KRJA 3MPAA 3OY1A 5KMNA 3EN6A 3TDWA 1JKLA 3COMA 2PVKA 4D9UA 3GC7A 3Q96A 3QZHA 3GCUA 1OI9A 3RZBA 5LWMA 2H34A 2VWUA 1JVPP 4ZOGA 4AA5A 3BYVA 3MI9A 3O8TA 3TI1A 3BHUA 4MD8E 3GXLA 4X21A 3LCTA 3UNKA 4YBKA 4TW9A 3MW1A 4TY1A 4UB7A 5GZAA 2YIYA 4OTGA 5TKDA 4YJSA 4EK4A 2W05A 3FC2A 5A4EA 4RQVA 3VBVA 4D5HA 1TQPA 2ZV9A 3NLBA 3KXNA 4FTRA 2ZYBA 4FSNA 5AP0A 4C37A 3IOPA 1BL6A 3GUBA 3Q6WA 3MWUA 2YAKA 2OJ9A 5IQHA 3DXNA 4ZZOA 5I9ZA 5HD4A 3PJ2A 3FQSA 2B9FA 1H24A 4F9WA 4H3QA 3SDJA 3V6SA 1CTPE 3SXFA 4BTFA 2QQ7A 3EZRA 3CTQA 4ITHA 3FXWA 3OXIA 4M97A 3WZJA 3FLNC 4E20A 5CNNA 3EFKA 5ACBC 2JDTA 4NH1A 5HZNA 4AZSA 4LRKA 4QMSA 4XUFA 5HVJA 4WSQA 3UBDA 4KIQA 2GNGA 2BHEA 2CNQA 4GG7A 4ZTLA 4PMMA 3UQFA 3LFCA 5FD2A 4RVTA 4ACMA 2YDIA 3FLYA 3NMUF 3PXFA 4AE6A 5LCKA 3FZOA 4BWKA 3EQBA 4CMTA 5CAUA 1LPUA 1OL6A 2UW0A 3Q2MA 4J52A 1Y8YA 2W5AA 3I7BA 4L53A 3SQQA 3HA8A 2UW7A 4DLIA 1REKA 3CQUA 2XBJA 3AMBA 4M84A 4YTCA 1PXOA 1WBTA 5EW8A 2W1EA 3PE1A 3VUTA 3TKUA 2DQ7X 4FIIA 1LR4A 5ANDA 4FIEA 5E8UA 5CAVA 5KMOA 5J1WA 1PF8A 2B0QA 2XJ1A 1Y6AA 3VS1A 1OVEA 1W98A 2HZ4A 2NRYA 3BEGA 1KOBA 4IQ6A 5LVPA 2NNWB 3LKMA 3R9RA 3PLSA 3ZM4A 2R0IA 2F7EE 1KOAA 3O8PA 4O1OA 1J7UA 4QTBA 2Z02A 4NU1A 3LZBA 4GU6A 2R2PA 2BIYA 4AW5A 4HGEA 4RC3A 2G2FA 1BMKA 3HA6A 5I3OA 4LYNA 4QMVA 5FEDA 1ZOGA 1YXUA 1BLXA 3POOA 1WVWA 1H07A 1ZY4A 2JD5A 2QOOA 4Y46A 1QPEA 3HKOA 5JSMA 3VS0A 2GTNA 4U81A 5EHYA 3QZIA 3WE4A 4YPSA 3NNVA 5DLSA 4CZUA 3GP0A 2PVFA 3IGGA 4CTBA 4GS6A 1FQ1B 4MD7E 3LJ0A 3NNWA 2HY81 3B8QA 4FIGA 4IB5A 4UMQA 5ANEA 3NX8A 5ETIA 5F4NA 4R8QA 1YWNA 3FL5A 4Z7GA 4EK8A 3LFFA 4LV8A 3GT8A 1YKRA 4TZRA 3Q04A 2YCRA 3FPMA 4UXQA 3LM0A 3LMHA 4DTAA 3PP0A 5FEEA 4BCOA 3KB7A 4NL0A 5LQFA 3NYXA 4E93A 1RDQE 3A7JA 4G31A 4HVGA 4RBLA 3BE2A 3T3UA 3P7BA 5EOBA 4PY1A 4IH8A 2W7XA 3KGAA 3GU8A 2CGWA 3FQHA 3IONA 5HQ0A 3EFWA 3ZCLA 3I0OA 5K5NA 1YWRA 4QP8A 5M4CA 3RWQA 3CPCA 2ZV7A 3FMLA 3KRLA 5DH3A 5AX3A 4I22A 2X7FA 3V5PA 5CI6A 2VGOA 2X8EA 1F0QA 4L6QA 4QMOA 3ZSGA 2QURA 3K5UA 3MESA 3ZUUA 3HMIA 4OR5A 4F9CA 4O1PA 3ORZA 1OIRA 4ZTMA 5HO6A 4IADA 3EQPA 4EK6A 4BY9E 2OU7A 3VULA 3OUKA 4WNKA 3QA0A 4CRSA 2IN6A 5HLNA 4RVLA 4XP3A 3TKHA 3CC6A 4XYFA 1XR1A 4XCUA 5EW3A 1SNUA 4BWPA 5FM2A 4EEVA 3EL8A 3L8XA 2W4JA 4TYHA 3W32A 4F7NA 4CQGA 4PMSA 4O86A 2OBJA 4F6WA 2C6LA 2RIOA 4BCPA 2VO6A 3QD2B 3ZLWA 4IB0A 2CN5A 1PMUA 4I93A 3NWWA 4DFNA 4MXCA 2F49A 4FZ6A 2RFDA 3A8WA 3DTWA 3RPVA 1Q41A 2WU7A 4HPTE 4Y73A 3T8OA 4E5BA 5HTCA 3DT1A 3E8DA 3FMNA 3PIZA 3UVRA 3U55A 3HV4A 2YIXA 3BYSA 3KFAA 5CSHA 4HW7A 3W1FA 4CVAA 5M08A 2YISA 3ZUTA 3MVJA 4FSUA 4I0RA 4IM3A 4R7IA 2P2HA 4MNEA 3BLRA 5DHJA 4ANSA 4JQEA 5EOLA 1H27A 5D1JA 3FI4A 3U6IA 3R9DA 4YMJA 1NY3A 2J51A 2XK9A 4PTGA 4HVIA 4ZY4A 2R3FA 3CLYA 4XG8A 2IW6A 3RAKA 5I5ZA 2C5YA 4LOQA 2XS0A 1QL6A 2XNBA 3U6JA 5BVOA 5L2IA 2QO7A 1Q5KA 4FGBA 2XKFA 1Q8ZA 3S95A 4PP7A 2UZVA 1AD5A 5ANIA 3EFJA 3NCGA 2WMBA 4PTEA 2EVAA 4N6ZA 2XIRA 4U3YA 5I4NA 3PA4A 5ANOA 3DFAA 3QTRA 4ZK5A 4R5SA 2HXLA 3BI6A 1GOLA 5FTQA 4C62A 2PUIA 1OZ1A 3SOAA 2P3GX 4WSYA 3BQCA 3CY3A 3QQGA 3UPXA 5L6OA 4FGRA 2W4KA 2HOGA 3OCGA 4K1BA 1BUHA 4WNMA 4FNWA 4GK2A 4AZVA 4S33A 2QOLA 4I6QA 2OF2A 3S1HA 3RALA 2QVSE 2VWZA 3KN5A 3QUDA 2VTMA 4HPUE 5CSWA 2PVJA 4FMQA 3FY2A 4Z7HA 4KS8A 3KVXA 1Y57A 4I20A 4IDTA 3IQ7A 5B2MA 1XHAA 2C4GA 2ETKA 4QO9A 1BKXA 5CZHA 3H0ZA 3L9MA 3R71A 5LCJA 1S9IA 4O7SA 5BVWA 1Z57A 5CAOA 3MV5A 2DS1A 3QRTA 4ANBA 3GC8A 3BBWA 4YHTA 4EKKA 2Q0NA 5IZFA 5BVFA 3F66A 1VR2A 3CQWA 3QKLA 3UP2A 4BDFA 3G6GA 2EU9A 4QQJA 5HCYA 3MTFA 3ZRLA 5DG5A 3R8MA 1OM1A 2JDVA 3PSDA 2H9VA 3RAHA 3PZHA 4G6LA 4IBMA 2OWBA 5C8KA 5HVYA 2CCHA 3HZTA 1PMVA 5ICPA 5L4QA 4JOAA 5AAGA 3K3JA 3HGKA 4F0FA 1R0EA 3ITZA 1IASA 4CLIA 3VBTA 2UW4A 3ET7A 4O0UA 5M4UA 4FBXA 4O7TA 1JKKA 4AW0A 5BNJA 4E6DA 1M14A 5J87A 2QOIA 3P08A 4KB8A 3DAKA 4YHFA 4DH8A 3QGYA 5LJJA 4V0GA 2YZLA 2RG5A 3R7OA 3QLFA 3UOKA 4BDDA 4R7BA 4AOJA 4EUUA 4EK3A 1LEZA 3WARA 3MB7A 4F08A 2FSMX 1U54B 2YM4A 2YFXA 2F7XE 4PRJA 4FT5A 4ZTRA 2E9UA 3V04A 5IQFA 5K4IA 1FGKA 4RVMA 4AGUA 3C51A 3LHJA 3UNZA 3ZMMA 4O7LA 5JZNA 2PU8A 2OH4A 3QLGA 5M4FA 2O5KA 3CSVA 1WVYA 3PY3A 4MXXA 3NPCA 4B4LA 3DQXA 4LRMA 2VTJA 3G2FA 4C38A 1H08A 2PHKA 5J5SA 2W1CA 3I1AA 3NDMA 1GNGA 3QGWA 3K3IA 2JFLA 2PTKA 2UVZA 4W9WA 4C2WA 4X3JA 5IDNA 1UU9A 4OTRA 3FXXA 1BI7A 5AP2A 5C8MA 4ZMEA 4FSYA 4BDGA 1UWJA 2A27A 2PVNA 3KVWA 5ANGA 2XYUA 2CJMA 4BCGA 5A9UA 1HOWA 4J99A 3GCPA 4D55A 1ZYCA 2QHNA 3MPMA 2YM5A 4RIWA 4E7WA 3C1XA 3U4WA 4F0IA 5TT7A 2BKKA 2IWIA 1OGUA 4JDJA 5AUVA 4EOLA 1QPDA 3AMYA 4IMYA 4H05A 4AE9A 2QLUA 5D9HA 3FAAA 4TYGA 5FG8A 2Y4IB 2VTHA 3QC4A 5CI7A 2BAKA 4GT4A 4DH7A 4LGDA 1AQ1A 2ZAZA 3AMAA 5DIAA 3RPSA 3EQFA 4E73A 4R3RA 5J9LA 4WNOA 4QTCA 4ANLA 1U59A 5AIKA 3EZVA 2R3KA 3Q9XA 2VWVA 4PDOA 5LMAA 5I9WA 1CMKE 2R7BA 1H1PA 3HMNA 4U40A 4TWCA 3Q5IA 4CTCA 3TNIA 4D4RA 4IVBA 4JR7A 2PVMA 3FBVA 2ITUA 3FSKA 2UW9A 3DBCA 4FV2A 4BZNA 4EH5A 2WOUA 5BUEA 5L2TA 2WFYA 4V05A 3ORTA 2HZIA 4ZXTA 1OIQA 4NFMA 4EK5A 4EOJA 3JR1A 3I60A 3QD0A 3BHYA 5HU9A 1YWVA 1WBVA 3QRIA 5DA3A 4Z3VA 4NYEA 3MVLA 5AM7A 2IG7A 2IZUA 4E8AA 4JX7A 1STCE 4RC2A 5EKNA 3R9OA 1UVRA 1NVQA 5T3QA 3W10A 2IZTA 4CRLA 3LFNA 3S2PA 4DHFA 3GGFA 2WMXA 4KS7A 2X0GA 4CFWA 2PZIA 2WMUA 4H58A 4CV9A 4IDVA 4PL5A 3WZKA 4YO4A 2XA4A 2C6MA 3BIZA 3DK6A 4FT3A 3MH2A 1FPUA 1F5QA 3NVKI 5FXRA 3MPTA 4EHZA 2C6IA 4WG4A 2QOCA 4MXZA 3VRZA 3ZFMA 3PPZA 5TR6A 3C4XA 5JH6A 1OKZA 5L8JA 2HELA 1BYGA 3CY2A 2NO3A 3R8UA 3POZA 4L42A 2V0DA 2ZB0A 2OXXA 3OW3A 2H6DA 4BCNA 4C33A 4FV0A 4C4FA 4GH2A 4G9RA 4PDYA 4YGAA 4MD9E 3ZH8A 4XG4A 4GFGA 4I6HA 4A7CA 2OLCA 2F2UA 2P4IA 5CYIA 4YHJA 5F95A 4I5MA 3S3IA 4L00A 4APCA 1G3NA 3AC3A 4IAIA 3ZEWA 4DGMA 5GZ8A 3HDNA 5GJDA 2GS6A 4RRVA 5E8ZA 3R22A 3A4PA 4BRXA 2J0IA 4EWQA 3QXOA 5IMXA 4O84A 4I23A 4QMYA 3ZZWA 5KMMA 3IW6A 4FC0A 3GOKA 5D7AA 5EI2A 4WBBB 3HRBA 4OTFA 3OCBA 4K0YA 4GEOA 4FNXA 3D2IA 2R3IA 4KSQA 4FG9A 5AM6A 1YOJA 5AADA 1JQHA 3KXZA 5E8XA 2PULA 4HYHA 3GCVA 4MNFA 2XVDA 3RPRA 1KE9A 3LJ2A 3W2PA 3DK7A 1UV5A 3AOXA 3CS9A 2GNJA 3GU6A 4DEGA 3ID6C 5DT4A 2A1AB 5BMMA 4MQ1A 3TZ8A 1OBGA 2OXDA 2QOKA 4QPAA 2PMIA 4BGQA 3E87A 5I9XA 4OGRA 4RX9A 2WEIA 3DA6A 4CD0A 5CSVA 5L8KA 1UU3A 2X7GA 2ETMA 2X2LA 4TYHB 2YJSA 3SX9A 2X9FA 4FV5A 4ZSGA 2XIKA 4GG5A 4AWIA 4X6RA 2XIYA 3OW4A 4JRNA 4YZDA 2IW9A 4UMPA 2FB8A 4HGTA 4KRDA 5L8LA 3R7GA 3UDBA 4YNOA 3G9LX 3P78A 4BB4A 4CKIA 5JRQA 3AC5A 1FVTA 5BVEA 4DA5A 2HY0A 4O83A 4KA3A 4AQCA 4UWYA 3CGFA 4LV5A 4TWOA 4QTEA 3VW8A 2VUWA 1PYXA 2C68A 1TQMA 4BCFA 3QRKA 4ERKA 4K8AA 1PJKA 1U5RA 2BVAA 3IS5A 4M13A 5DOSA 3UC3A 3KA0A 4Z55A 1PXPA 1YXTA 3UIMA 3KK9A 1ATPE 5CS6A 2BCJA 3BV2A 5HD7A 5LOHA 4GFMA 4O81A 2I1MA 2YERA 2ZMDA 3KXXA 2ITOA 2WQOA 5BMSA 3NNXA 1UNGA 5KUPA 2WNTA 5JGBA 4LMUA 4JG6A 2UVYA 1Q4LA 4J8MA 1PRYA 1O6LA 4C2VA 2Y8OA 3OP5A 4GYGA 3R7VA 3TM0A 5IUHA 2HK5A 3VF8A 4O22A 2G2IA 5JRSA 1O6KA 5AA9A 5HX8A 2OH0E 2Y6OA 5HOAA 4O38A 4YC6A 3U6HA 2OG8A 4EI4A 4A4OA 4EQCA 3PIYA 4WO5A 1M7QA 4GVAA 3UQCA 1CKPA 5EH0A 4II5A 4ZZNA 3NUNA 4DGNA 5M56A 3RJCA 4BBMA 4BCQA 4RX5A 4CFFA 4NW5A 2OFUA 4Y5QA 4BKZA 5L6WL 3FMDA 2V7AA 2WMQA 3FEGA 2VTQA 2V55A 3L1SA 2IW8A 3WIKA 1WBPA 3CE3A 3EHAA 2C5OA 2C6DA 5FXSA 5LVMA 5EQPA 1UKHA 4JAJA 2IO6A 5AR7A 4PPCA 4CLJA 3V3VA 1MP8A 2RGPA 3D7ZA 4AGCA 3IW4A 4A9UA 4PMPA 5BVDA 5HIDA 3OD6X 4AT3A 3EB0A 1P2AA 4XH6A 1ZYDA 3UNJA 5I9VA 2VO7A 4YC8A 4NCTA 2XKDA 3PYYA 3ZOSA 2W1GA 2FA2A 4OW8A 5I9UA 3C50A 1YOMA 2JKKA 4DBNA 2YM6A 2PWLA 5AUWA 3MJ1A 1KV1A 2ZV8A 5IA2A 2VTNA 4RIXA 1PXJA 5GJFA 3ZO1A 2QOQA 4PX6A 5EI6A 4ALVA 1YVJA 1M7NA 2XNPA 3R8PA 1OECA 3QYZA 5IQCA 5IQDA 2GDOA 2OICA 2BFYA 4XV9A 5CZIA 4DCEA 3ATSA 3F88A 4L67A 1WBOA 4LMNA 4ZS0A 3V8TA 3DQWA 3VQUA 5H3QA 5L2SA 5DT3A 3ZSHA 4BCIA 1CM8A 4MCVA 5AP3A 5HE3A 2C5NA 2XBAA 2RL5A 3A7IA 4WD5A 3RPYA 2BIKB 3VS7A 4G3EA 5DWRA 4I21A 5CAQA 4QMXA 4V0GB 2B53A 4IC7A 4D5KA 5A4LA 3OXTA 5K4JA 3ODZX 2ITQA 2X6DA 4FKPA 4F1OA 2W4OA 3F82A 3IECA 4PDPA 4O6EA 5J1VA 3DJ5A 1Q3WA 4ZJJA 1G8SA 3Q4TA 3A7GA 1Y6BA 3P23A 1OB3A 1WBWA 2YLFA 3Q60A 4CMOA 3DJ6A 4TKSA 3MFSA 4CT2A 4Y85A 3Q2JA 3I5ZA 4O7ZA 4JT3A 2Z7SA 3PP1A 1H00A 2XM8A 2JLDA 2C6OA 2KTYA 3PVBA 1NVSA 3GCQA 4G9CA 4JAIA 4JBQA 1W8CA 5DN3A 4EOPA 3MN3A 4M12A 4XV2A 3CCNA 5AX9A 4AGWA 1JSVA 4YURA 1JWHA 3OMVA 3FC1X 2YJRA 4ACGA 3FZSA 3GOPA 5IH4A 3O7LB 4WRSA 2BDFA 1Q61A 3Q9YA 2YABA 5FP6A 2BZIB 3EQGA 3VQHA 2H8HA 2ZB1A 3VHEA 2CGXA 4EH3A 3LMGA 2GU8A 3PJ8A 1IEPA 3FKOA 5CF8A 2WQBA 2Y7JA 3IW8A 3QCSA 3C4ZA 4FKJA 4FL2A 4FV9A 4HZRA 5CU6A 3QTWA 4FV7A 3FWQA 3KXMA 3QZGA 5C4LA 2RFEA 4JDHA 4KIPA 2C5VA 3DU8A 4RFYA 4MF0A 3BBTB 4FVPA 5ETFA 4MK0A 2G01A 3OWPA 3ORXA 5C03A 3FYJX 4E26A 1XBBA 2BPMA 3P1AA 1UU7A 4RT7A 3MIAA 1ZOEA 4NT4A 4G3DA 1DS5A 3CTHA 1PW2A 2JIIA 1GY3A 1Y8GA 4M69A 2JEDA 4BDBA 1SNXA 4O7WA 4YBJA 4FICA 4MWHA 4GL9A 4Q2AA 2ETRA 5AR2A 3HMPA 4NEUA 3CIKA 1ZMUA 2V5QA 1IA8A 1MRVA 2VX0A 2XUUA 1XQZA 3CJFA 2BZKB 3GU5A 3KMUA 5C1QB 3HUCA 3O50A 4CFNA 3MA6A 3FKNA 1OL7A 2BZHB 4CZYB 3O71A 4FNZA 4IM0A 4A07A 3OG7A 4GU9A 3IK3A 3A62A 2GQSA 4C57A 4N57A 4M3QA 3U4UA 5JFSA 3VVHA 3ROYA 2G1TA 3Q53A 4JLCA 4CCUA 5T68A 1YHSA 2B1PA 3W2OA 1K3AA 4QP2A 5EHLA 3FV8A 4OTHA 2ITVA 4B9DA 4CV8A 1H1QA 4U42A 5HCZA 4YJQA 2VU3A 1AGWA 2XZSA 2C69A 2UW8A 2CPKE 2O3PA 3R6XA 3W2SA 3LMIA 3MVHA 3PJCA 2I7QA 1ZAOA 4L9IA 2IPXA 4L43A 5E91A 1Q24A 4O0YA 4I92A 4YZBA 2I40A 4KKHA 3SXSA 2I0VA 4RSSA 3PPKA 2CGVA 3DLZA 1QMZA 4DINA 2P33A 3G0FA 4NCTC 4RLLA 4FT0A 4IJ9A 4DEAA 4AX8A 4BDIA 1JSTA 2Y9QA 3CR0A 3HMMA 4L68A 4X2JA 4UN0C 4ZLOA 2RKUA 4QQ5A 3E3BX 3OROA 3NVMB 1JBPE 1M2QA 4AP7A 4FE2A 2XK3A 5CVFA 5BX0A 4UXLA 3LXKA 4I1ZA 4N6YA 1M2RA 1YQJA 3R9HA 1H1WA 4NM7A 4L52A 3F5PA 4FNYA 4DGLC 2HZ0A 4F9YA 3ZTXA 1YXSA 3LJ1A 3O7LD 3E3PA 3REPA 5FRIA 4EORA 4UX9A 3IKAA 4L8MA 4CG8A 3QQKA 2WXVA 5DMZA 4DFBA 3VJNA 3ODYX 5L2WA 3UZTA 3R00A 4M7IA 5E8YA 3HRFA 3T3VA 1RQQA 5AR5A 5FLFA 3VN9A 4L46A 4OBOA 3NRMA 4C4HA 2WOTA 4EKLA 1G8AA 5H9BA 3Q6UA 3R73A 4GSBA 4O0RA 3M1SA 3ORMA 2ONLA 2R3NA 2EXMA 2VX1A 3RGFA 4IFCA 4C3RA 5JGDA 3SVVA 1UU8A 3TG1A 2W06A 5M57A 4AN9A 3T9TA 2J5FA 2UW5A 3LXNA 4FTUA 1DI9A 3H0YA 1ZLTA 2HWOA 4F7LA 4DTBA 3SG9A 3R7IA 3II5A 2OIDA 2YM8A 2DYLA 3QRUA 3NYOA 3GCSA 1P5EA 4UALA 2FUMA 3OVVA 4USDA 4HVDA 5HICA 4IW0A 4DLJA 3I4BA 4U97A 2CNUA 2I6LA 3QFVA 3JY9A 3COKA 2XMYA 2Y0AA 3GU7A 3KY2A 3E7OA 4ACDA 4PL3A 4QT1A 3VIDA 2J0KA 3TZMA 3COIA 3MGYA 1PMEA 3SHEA 5JZJA 5M51A 4NM5A 4MYGA 4PDSA 5DRBA 4OTPA 3V8SA 4GW8A 2X9EA 3QRJA 5FUTA 3QC9A 4I5CA 4YZNA 5KHXA 3A7HA 5HHWA 3N51A 4WRGA 5IMEA 3TEIA 3QAME 3FL4A 3C5IA 1YI4A 4GV1A 4AT4A 3QQFA 3GFWA 2DWBA 1R78A 3EL7A 3PSCA 3VC4A 2GQRA 5J7HA 1XH8A 4ERWA 5HO7A 3FY0A 2ITPA 4C35A 2UUEA 2XRWA 3EN4A 4F6UA 5KMIA 4BTKA 1O6YA 3FLSA 5E92A 2ERZE 1V1KA 3BGZA 3TACA 1IRKA 4P7EA 3UGCA 4KIKA 1JKSA 4ZY5A 1ZYLA 5AR8A 4V04A 1Q99A 4FTOA 4J98A 3ZFYA 3KXHA 4BDJA 4USFA 3UZRA 3RINA 5AP4A 2WIHA 4BBEA 4WUNA 3HP2A 3LQ8A 2IZRA 4DH1A 2ITNA 3CGOA 2W0JA 4UWBA 2HW6A 2OJJA 4XEYA 1REJA 4YJVA 4QMPA 3RP9A 1OL2A 3WZUA 4AN2A 5CEIA 4EUTA 4YP8A 3GBZA 4DFLA 4FV6A 3D5WA 5HU3A 3KQ7A 3HMOA 4MEDA 3K54A 1LUFA 3RHKA 4EL9A 4DE4A 3MFTA 3SAYA 2YHVA 5ETAA 4FKGA 4B7TA 1H25A 2RF9A 3PRIA 4HNIA 4HYIA 2DUVA 2J0JA 5EFQA 3I7CA 3VWAA 3A60A 3ETAA 2R3QA 3FUPA 4A9RA 4D1ZA 5IG1A 2Y4IC 1SZMA 5CT0A 5DR6A 1SVEA 3D9VA 4PL4A 1Q8TA 3BYUA 3W8QA 3H9RA 2ZDTA 2PZPA 2B55A 5D7VA 3NW7A 2O64A 5AV0A 4QYFA 4CSVA 4CXAA 1ZXEA 3C5UA 4R1VA 4CZTA 1BX6A 3CP9A 3PWYA 3AC4A 3RI1A 4A9TA 5E1SA 4EOOA 3NZ0A 3ZRMA 3EQCA 4RIXB 4RFMA 3CEKA 4K18A 2I0EA 1WBSA 2C30A 3OUNB 1YI3A 1H0VA 3R0TA 4RLKA 3HDMA 4Y72A 3FZPA 4S34A 3ANRA 4OT5A 1P14A 3L9LA 4I41A 4R77A 5A54A 4PNIA 3R21A 3MA3A 3FHRA 3H3CA 3TL8A 3F7ZA 4LL5A 5CENA 4E5WA 5TO8A 2VTSA 3V5WA 3QA8A 4CGAA 2W5HA 2ZMCA 4JS8A 5EYMA 4BVUA 5IQIA 4XG7A 3BE9A 4UWCA 3L9PA 4UZHA 3VS2A 1PXMA 5CSXA 3PE2A 4IZAA 5IEXA 2QC6A 3OEZA 2WQMA 2WTKB 4QTAA 3DTCA 2W5BA 4FV4A 3NR9A 4UYNA 4BHNA 3HX4A 2P0CA 5JQ8A 4CYIA 1BL7A 4LOOA 2ZJWA 2XK4A 2ITXA 3UIBA 4FEUA 1GZOA 1J3HA 4IWPA 3O23A 5HNIX 3UO4A 2UZEA 4LRJA 2ONLC 2WTIA 4WNPA 3LCOA 3LVPA 5DR9A 4QMWA 1BI8A 5F9EA 3PA5A 3C4FA 2C1BA 4KAOA 4EOKA 5IQEA 2VD5A 2WD1A 4BR3A 2VWIA 4WUAA 3QQUA 2WU6A 4BC6A 4BHZA 4B6LA 1H0WA 4AW1A 5CEMA 4U7ZA 3C9WA 4MVFA 3QU0A 3NNUA 3TJCA 3G15A 3V5JA 1UNHA 2XNMA 4E4NA 5DEWA 2GSFA 2WTDA 1ZWSA 4QMTA 5HEZA 3W55A 3WF5A 4CNHA 5A4QA 4OLIA 4R3CA 4M8TA 3VNTA 1PKDA 2E9NA 3R63A 5EYKA 3LE6A 2VNYA 3VUDA 3D15A 2BUJA 1YDRE 5JFXA 2EUFB 2FVDA 2OF4A 4BYJA 4ZS4A 3IG7A 3TTJA 4N4SA 3F5GA 3OC1A 2GNIA 1FVRA 4ASDA 2JFMA 2PL0A 2C3JA 2VWWA 4F7JA 4M69B 3HUBA 4GYIA 1FOTA 2HZNA 5IU2A 2Z8CA 3MDYA 3PTGA 4XX9A 1SM2A 4BI0A 4A4LA 3QYWA 5JQ5A 5CQUA 3ZDIA 4RFZA 3OOMA 2RFNA 5EM5A 2FSTX 5EQEA 4QOXA 4KIOA 3FYKX 3VS4A 2YM7A 2B4SB 4FT7A 3TV7A 1E1VA 3WZEA 2C6TA 3EKNA 1QPJA 3ANQA 3BU3A 3LFSA 3OTUA 3RK9A 4D0XA 5AIRA 5CEKA 4QP9A 4YR8A 4GK3A 5EYDA 2BR1A 4TYJA 5A6NA 4FKWA 2QLQA 4XOZA 2C6EA 4GIIA 2HW7A 3QL8A 4MAOA 5IA1A 4O0SA 2YIRA 4AACA 4AOTA 4FTNA 4W8EA 1M2PA 1OPJA 4DH5A 3I6WA 4AU8A 1Q97A 2VNWA 4YUQA 2Z60A 3QF9A 3QWJA 3DBQA 3LFDA 3UOJA 1RE8A 2UZBA 4QYHA 3R1SA 3WF8A 2GFCA 1R1WA 2VV9A 4MX9A 2PMLX 4ORKA 3FI2A 4K33A 4FVRA 5E90A 5B2LA 2WTJA 3AT4A 4DEBA 3R7EA 2OI4X 1SMHA 4EJ7A 3PRFA 4ZY6A 4ALUA 4ASXA 4O7VA 1GZNA 4EH4A 4QYEA 2OJGA 4XS2A 4XJ0A 2YDKA 5CT7A 2UZNA 3VBYA 4CEGA 4D9TA 5A14A 1GIIA 4XLIA 3OWLA 4BZDA 4P2KA 5CANA 3IDCA 1W7HA 3PXRA 2BZJA 3ORLA 4GT5A 1JOWB 2WZJA 3O8UA 4ZTSA 2WMWA 5KZIA 4YJNA 4RX8A 2PZYA 3MSSA 3AT2A 2JITA 2QD9A 2QR7A 2XNOA 3ACJA 3QWKA 4RA4A 4P90A 4ANOA 5GIPE 2NPQA 1H01A 4Q9SA 4B8LA 4MTAA 5TOZA 4XBUA 4U8ZA 3NEWA 4L44A 3UG2A 4ZMFA 3HV6A 3TCPA 5DR2A 4M0ZA 5ANJA 4FYNA 1XH9A 5CF5A 4TXCA 4I6FA 2VTRA 5IDPA 4DBXA 3CKWA 3F6XA 3EN5A 3CJGA 1Q3DA 3KN6A 4RJ3A 4AN3A 3OOGA 2QODA 4BICA 4W4VA 5A4TA 4FSWA 2YACA 3UIXA 1KE5A 3WOWA 2JKOA 3I79A 5AP5A 3TJDA 2Z7QA 5BQ0A 3MJ2A 5B0XA 4FT9A 3LOKA 4RVKA 4ZSLA 5CNOA 2A0CX 2XEYA 3P5KA 3HV5A 4OTIA 4RIYB 3JVSA 3F5XA 3E7VA 4BN1A 5EM8A 3VS6A 2OXYA 4FL1A 4ASZA 3FZ1A 4GFOA 1H8FA 1B39A 4C0TA 3GENA 3D2KA 2PVYA 1B38A 2X4ZA 3HLLA 5EG3A 1G5SA 3R1NA 4JG7A 3B2WA 4WA9A 4DEDA 1K2PA 3ZO4A 3KK8A 2PZRA 3DNEA 3QXPA 3F2RA 2OGVA 4AFEA 3LQ3A 3EJ1A 4Q9ZA 1Z9XA 4G3GA 5C8NA 4XBRA 4EQMA 3LCDA 2RG6A 1W0XC 4BDAA 3EQDA 3VW6A 1KWPA 2W9FB 2XK8A 3TZ9A 1J1CA 5CLPA 5CX9A 1FMKA 1KSWA 4GCJA 4QD6A 4YZ9A 3GB2A 3W2CA 3SLSA 2GHMA 5EYCA 5IQGA 3O17A 4X2FA 2EB2A 2CN8A 4GVJA 4MF1A 2G15A 3Q9ZA 4FKRA 4HYUA 3RNIA 3V51A 5IUGA 4DAWA 5BUIA 3ZRKA 1WZYA 2CKOA 2JKMA 2PY3A 3E64A 2FH9A 3M11A 4O0TA 3R04A 5BVNA 2Q0BA 1L8TA 3N4TA 5ANKA 4RQKA 1WBNA 2Z2WA 5DYJA 3SGCA 4W9XA 1SYKA 2H96A
chains in the Genus database with same CATH superfamily
2XIXA 3RVGA 5DVRA 3F3VA 3C4EA 3DPKA 4JBOA 4AA4A 4KIKB 3PA3A 2J0LA 4EYMA 4C7TA 2XH5A 3O96A 4DHJA 2CLQA 2F2CB 4FTQA 4JR3A 2XEZA 3QX4A 4YZMA 4QMQA 1U4DA 4M15A 2WQEA 1HCKA 4F09A 4O0VA 5D11A 2LGCA 5B2KA 2YWVA 1OPLA 1OPKA 3EYHA 2ZM1A 4I24A 2ZV2A 3LFAA 2UZDA 3BHHA 5IH5A 4UEUA 2XIZA 5EHOA 2OFVA 5JT2A 2KULA 3U87A 2W1IA 3BLHA 3KC3A 2FSLX 4IE9A 2VTPA 5GJGA 3VO3A 4BIBA 1IR3A 2E2BA 5CSPA 2XRUA 2YCQA 4F1MA 2Y4PA 1YRPA 3D5VA 3HV3A 3NW5A 4K9YA 4BIEA 2QONA 4BF2A 2IVSA 2XF0A 3EQIA 5HIBA 3PY0A 4G1WA 3TNWA 1DAYA 1FINA 1TKIA 2BAQA 2BRMA 2BRNA 2W1DA 1XBCA 1Y91A 2WTWA 3BWJA 3DAJA 3JYAA 4FKTA 2W96B 4IWDA 3TUBA 4FKSA 4KABA 5A3XA 1YDTE 2QCSA 4JL9A 2BALA 2A4LA 4M0YA 4X6QC 3S4QA 3UVQA 4F63A 4EOQA 4D2SA 5LVNA 1DM2A 2CKEA 2XJ0A 1Q62A 2XK6A 3AGMA 2Y6MA 4N70A 4IC8A 4XG3A 3Q9WA 5H8GA 3NIEA 4G6OA 3ZHPC 1FBNA 1KE7A 3DFCB 4H3BA 2W1ZA 3R30A 4RZVA 3KRRA 2PUNA 1Q8YA 4E5AX 4BYIA 4PPAA 4E6CA 3T9IA 4BWXA 2UW6A 4DT9A 3EN7A 4O7NA 3TZ7A 3EN9A 3PVGA 2GS2A 2QKRA 3R7UA 3QTIA 4HGLA 3A8XA 1JSUA 2XKEA 4X3FA 4YJTA 2WMRA 3MH1A 3OXZA 4HCTA 3VUIA 3PFYA 4C58A 5IPJA 2ZFYA 2QO9A 4EBWA 2WHBA 3BPRA 3COHA 4FVQA 4EH7A 5HNBA 4FUYA 4XMOA 2C0OA 2QI8A 5AAEA 1W83A 1XH7A 3ZC5A 2R3RA 2GHGA 1A06A 3F3TA 4TYEA 5HCXA 4YJUA 3PFQA 4QMZA 4QYYA 3ZYAA 5C4KA 3OFMA 3MFRA 3K2LA 4F9AA 3MFUA 1TQIA 3DBEA 4MBJA 4MBIA 3DY7A 4OTWA 4PTCA 3AGLA 3GU4A 1ZZLA 1VYZA 3KEXA 5D12A 4AGDA 3RKBA 2VTTA 3C13A 3PSBA 3FSFA 4IAZA 4NKAA 2GHLA 4QPMA 4RJ4A 3NUPA 4C3FA 3SOCA 4D2TA 4NTTA 4XG9A 4B0GA 3ZONA 5KMJA 4AG8A 5DFPA 3BELA 4KWPA 3ZFXA 2I0YA 3F3WA 2XNNA 5LXMA 4QQTA 2HIWA 5D10A 4DYMA 4XNEA 4C4GA 4EC9A 2F7ZE 2XM9A 5DI1A 3THBA 4AT5A 3QTQA 5CEQA 5CF6A 4LUDA 4M14A 4AA0A 3RZFA 3AKLA 5IA0A 3VHKA 4QTDA 5HVKA 4GKHA 3RHXA 4X2GA 4BTJA 1URWA 3ZO2A 3UODA 1OUYA 2B52A 2VAGA 3WE8A 1T46A 2JKQA 4NWMA 4QP3A 2BDWA 1XJDA 4MBLA 4Y95A 4AF3A 4HNFA 5C26A 2PVRA 1F3MC 3HVCA 4CG9A 3EFLA 4G5PA 4DG0E 3Q52A 4BZOA 5I0BA 4DHZA 3ALNA 1WFCA 4BJJA 1DAWA 4AZTA 1OITA 2ACXA 3R83A 1W82A 3KRXA 4FEXA 3HEGA 4O27B 2OW3A 4D0WA 1LEWA 4S32A 5HE2A 3D5UA 4UMRA 2QHMA 5DT0A 2OJIA 4BCHA 4QMMA 1JAMA 4IHPA 4K77A 2BRBA 2UZTA 3FMHA 3LPBA 4EC8A 4RA5A 3N4VA 4FUXA 1UNLA 3JVRA 4QP4A 4FTMA 5IA3A 4F9BA 5F20A 4WHZA 5JN2A 4TRLA 4WKQA 4E6QA 3HAMA 3EOCA 5FDXA 3NAXA 3LLAA 3BZ3A 4FK6A 4IX6A 5FM3A 5GZ9A 3KCFA 3VF9A 3H4JA 3I81A 3SV0A 4L3PA 3BYMA 2EWAA 3OWJA 5KBQA 3MB6A 5L3AA 4B99A 4I94A 2WIPA 3Q4CA 4IX3A 4M66A 5HE1A 4K2RA 2QOBA 3DKGA 3EH9A 3DKFA 3R8ZA 1W2DA 3C0GA 3ORIA 1H26A 1PXLA 2BILB 4WOVA 3D7TB 2E9VA 4DDGA 3ALOA 4LUEA 5CALA 2CKQA 4FEVA 1MUOA 5F94A 3AC8A 1J7LA 3MIYA 5EDRA 5HBEA 2O0UA 3LIJA 2X2MA 5EI8A 3BRBA 1IA9A 1ZY5A 2R3JA 4LG4A 5IA5A 5CU4A 3VS3A 4O4BB 2C3LA 3FMKA 4FODA 2WKMA 4ARKA 5HIEA 4DCAA 4LOPA 4HYSA 3DAEA 3PG3A 4FZ7A 2X4FA 4D4YA 3W0RA 2R3OA 4O0XA 1CKIA 2QG5A 4L45A 3Q5ZA 3PG1A 1URCA 2ZVAA 4G17A 4JBVA 3SD0A 5E8TA 2QU6A 4TNDA 5HO8A 4BI1A 1YDSE 1VLRA 4H1JA 3GQLA 2Z7RA 4G16A 3R28A 1P4FA 3ACKA 4QPSA 5KZ0A 5BPYA 3LFEA 1PYEA 3D14A 4X3FC 3I0QA 4CQEA 1R3CA 5FWKK 2BKZA 4S2ZA 2YDJA 3P86A 4EQUA 3F3ZA 5HGIA 5HNGA 1VEBA 4KBAA 3KU2A 3RNYA 2CMWA 4C61A 5AR3A 2XNEA 1VZOA 2PE0A 3AD4A 5GINE 1ZMVA 4AZFA 2NRUA 2ITZA 2JBOA 2PMOX 3UTOA 1FMOE 2R64A 3L8PA 4C02A 2ZM4A 4I6BA 1APME 2ESMA 2QO2A 2XNGA 2AUHA 2JBPA 3NUSA 3TNQB 3NUAA 1JNKA 2HWPA 2GNHA 4IM2A 3Q4UA 3OZ6A 5J9ZA 5M44A 2CKPA 2B9HA 4C36A 3UOHA 4FV8A 4S31A 3CTJA 4IZYA 3VBWA 3DXQA 5IH6A 4PWNA 5H8BA 3KKVA 5IF1A 4EH2A 4RMZA 4GJ3A 3DK3A 4DFXE 3HNGA 2XK7A 4FSTA 4OBQA 2WTCA 3OF0A 4U6RA 5KNJA 3HAVA 5I9YA 4KKGA 2REIA 2X81A 4ZTHA 5G1XA 3QCXA 4EZ7A 4J97A 4RC4A 1LP4A 2B7AA 2X1NA 3ENMA 5BYZA 2O65A 3RCDA 2R7IA 3LXLA 4FSQA 3RK7A 4CFMA 1A48A 5A6OA 4KRCA 3P9JA 4XV1A 5JFVA 4H39A 3R9NA 3ZXTA 2JIUA 4MQ2A 4LM5A 4EOMA 4IZ7A 4NM0A 3PIXA 4HZSA 3NW6A 3P79A 2W99B 5CQWA 4U43A 4ZP5A 4BDHA 3SC1A 3ZLXA 3TDVA 2EXCX 1R39A 2VWYA 4FOBA 1H1RA 5M4IA 4F99A 3F69A 5AFVA 5AAFA 2OZAA 4TWPA 4F1TA 4LGHA 3P7AA 5TE0A 3ZDUA 1PMNA 1PXIA 3CD3A 1PHKA 3AD5A 2CDZA 4TT7A 4G5JA 2LAVA 5BYLA 3EWHA 4R6VA 1OUKA 2YN8A 3KL8A 4U44A 5IUIA 2BTSA 3P0MA 3RK5A 2VO3A 2BTRA 4FKOA 3DZOA 1YW2A 4O7YA 4W4WA 3FLZA 5AA8A 4UBAA 3H30A 4PMTA 2WTKC 1K9AA 3DLSA 4J96A 4FIJA 3G90X 5KHWA 3R02A 4EH8A 2V7OA 4MH7A 3NUUA 2OIQA 4MKCA 4IAFA 1U46A 4C4EA 4RIYA 5HX6A 4U9AA 4J7BA 2B9JA 3ELJA 4TYIA 4GK4A 4K6ZA 1ND4A 2R9SA 5C27A 4EH9A 2XKCA 1ZYSA 3G33A 3G9NA 4ZSJA 3NYVA 3TV4A 5FDPA 4XP2A 1OKYA 4QNAA 4O0WA 3ENHA 4D28A 3SW7A 4KSPA 3NS9A 2QKWB 2ZM3A 4XRLA 5AUZA 2ZDUA 4CYJA 1WAKA 1MQBA 3JS2A 5AP7A 4OAUC 4Y8DA 3BU6A 2YAAA 3OHTA 5FQDC 4L7FA 4YSJA 4L3JA 2PVHA 3WIGA 1ZRZA 2R0UA 1SVHA 4O82A 4HVHA 3SRVA 1T45A 4O6LA 3TKIA 3TV6A 4TWNA 3TIYA 4DHIB 3PXKA 3GI3A 5AMNA 5AV3A 3WYXA 4BL1A 2EXEA 4OTQA 5J8IA 3SA0A 3F9NA 4MXAA 3W0PA 1Q8WA 1GZKA 2BRHA 5KKRB 2F9GA 4EHEA 4ENYA 1IG1A 4EHVA 4FG7A 3WZDA 1IAHA 5IQAA 4I5PA 3RCJA 4FSZA 4ITIA 2VX3A 2BAJA 4IX5A 1OL5A 4RPVA 3L8SA 3QQHA 4F64A 4KUJA 2ITYA 4I3ZA 3HYHA 3D7TA 5HORA 5K9IA 3UPZA 3KULA 3QUPA 5KO1A 3PPJA 4XOYA 2RFSA 3CKXA 3I5NA 5HE0A 5JEBA 3ZO3A 3IO7A 4X3FB 3R8VA 3ZEPA 1UA2A 3DKOA 5EDQA 5LWNA 2QU5A 4JBPA 2UZLA 3L9NA 5K3YA 5HI2A 3G0EA 1PXNA 4U0IA 5CWZA 5C01A 3HV7A 5H2UA 5CASA 3E63A 3FLWA 4BDEA 1YI6A 4D2PA 2ERKA 4FZDB 2G9XA 1TVOA 5CXHA 4FTCA 4LL0A 3RPOA 1V0PA 1H1SA 5CEPA 3W16A 4Y5HA 5HTBA 3HL7A 1L3RE 1VYWA 3KMMA 3FMEA 4I4FA 3UP7A 3MVMA 4RWIA 3UMXA 3VUHA 1ZZ2A 2WGJA 3IGOA 3MY1A 4S30A 5M53A 2OIBA 4UYAA 4HGSA 4LFIA 2HENA 4FIFA 4YJOA 3UOLA 4JI9A 3VBXA 1UKIA 4KD1A 4QMLA 3U9NA 4D58A 4RZWA 1Z5MA 3DDQA 5FBOA 4BDKA 2UV2A 2V62A 3FQEA 3JUHA 4QP7A 2IVVA 4NTSA 3R1YA 2UW3A 3AC2A 2A2AA 2OO8X 2P55A 3E8NA 3RMFA 3UVPA 2JDOA 3U8WA 5FP5A 1ZARA 2PUUA 5AP1A 3PXQA 4JX3A 3PJ3A 4RGJA 3DNDA 4U45A 2XCHA 5DGZA 3BX5A 4GT3A 3H9FA 5K5XA 3S0OA 1KUTA 3ZXZA 4CFVA 2BFXA 2C6KA 3OY3A 3W33A 4QMUA 3Q4ZA 3QBNA 4HJOA 3G5DA 4YLLA 4U3ZA 4RIOA 2OKRA 3R7YA 4D1XA 3UO5A 3QTZA 3C7QA 3BV3A 4NIFA 4HCUA 5AUYA 3MYGA 3PWDA 4IJPA 4RJ6A 4X2NA 3RTPA 2WELA 4ONAA 3EKKA 4Y83A 3I6UA 5B7VA 3NSZA 4C4JA 5HG5A 3QTSA 5EQYA 1A9UA 4GRBA 5CU3A 4OTDA 4D2VA 5CEOA 1GIHA 4JIKA 2AQXA 2YITA 1GJOA 4AUAA 3NUXA 4O2ZA 3W18A 2XJ2A 4JIAA 4BJJB 3VUKA 1SVGA 1E9HA 3UZPA 1WVXA 4EYJA 5M09A 4EWHA 4FIHA 3OS3A 2YCFA 2ZOQA 2WQNA 3PY1A 2VWBA 4IVCA 4LGGA 3RM7A 4D2WA 4JG8A 3A7FA 2SRCA 5LVOA 4PP9A 2G2HA 3W0QA 3V6RA 2GMXA 5LMBA 4QP1A 3DKCA 3BKBA 1OKWA 4Z16A 2A19B 3UO6A 5BUJA 2C5XA 3KMWA 4I4EA 2X6EA 1E1XA 2FO0A 2WTVA 3M42A 1WCCA 3ORPA 2Z7LA 4L01A 5HG8A 3N9XA 4RJ7A 3VONA 2HCKA 4QRCA 3IW7A 5EW9A 4NKSA 1CSNA 5JMSA 4NW6A 1PY5A 2HYYA 2IVTA 3OCTA 3WI6A 1QPCA 5E4HA 3ZBFA 3QZFA 4L3LA 4E4XA 3O0GA 4HVSA 5HLWA 3PJ1A 5J79A 4OUCA 4FKIA 4I0TA 4AS0A 3V5TA 3LFBA 3R01A 4CFUA 1RW8A 4KINA 3UDSA 4IIRA 4JQ8A 4J1RA 2JAVA 3ZC6A 2YA9A 4DGGA 2YCSA 4FKLA 5M06A 5KBRA 3DBFA 3KXGA 3SKCA 3BQRA 4BCJA 4E3CA 3WYYA 2W9ZB 4DN5A 4UV0A 5GIOE 4FTIA 2CCIA 4IXPA 1TFFA 5IQBA 3TUCA 3GQIA 2X7OA 2NP8A 2WO6A 2AYPA 3MS9A 5AUXA 2UVXA 1MQ4A 5GHVA 2VGPA 4I5HA 3NAYA 3O51A 3QQJA 2GNLA 4W8DA 3VJOA 4FA2A 2NYAA 4IZ5A 3CXWA 5ITAA 3C4WA 4YJPA 2EB3A 3BGPA 1OBDA 2BRGA 2GFSA 2GS7A 4EJNA 4YLKA 4BIDA 1ZMWA 2O2UA 2OJFE 5GNKA 4DDIA 3GVUA 4DFUA 1I09A 1S9JA 2GNFA 2J0MB 2J90A 2WMTA 2C0TA 4F65A 4JNWA 1XH5A 3A61A 4PUZA 2VZ6A 4EOIA 5HBJA 4AXFA 3PZEA 1OIUA 3U54A 3F2NA 2WMSA 3LW0A 4E4LA 3IW5A 3EQRA 3RAWA 3SXRA 2WEVA 4D4VA 3IDBA 4FG8A 4JVGA 2JDSA 3OTVA 4U41A 3AD6A 3PVWA 1CDKA 4IB3A 3NCZA 4O96A 4U5JA 4GKIA 3VUMA 4YO6A 2C3KA 5JKGA 2QOHA 1P4OA 3D4QA 4IX4A 4TNBA 3TWJA 3N4UA 4IB1A 3KCKA 1DI8A 4ZTNA 4DTKA 3W2QA 4NSTA 4RWLA 4IANA 1MRUA 4CFXA 4F70A 1VJYA 2JGZA 2OK1A 5KMKA 4H3PA 3OEFX 4O4DA 4JDKA 5TF9A 2W1FA 1ZOHA 3Q3BA 3V5QA 4HCVA 4DH3A 4ID7A 3PXYA 3FKLA 3ERKA 2J4ZA 2CSNA 4J8NA 2PYWA 4FTLA 1V0BA 3HP5A 3TNHA 4J53A 2W17A 5IEVA 3QCYA 4ZAUA 4G6NA 1Q8UA 4ANNA 4KBCA 1XO2B 3K5VA 3VRYA 5IA4A 4APPA 4L7SA 2C0IA 4DEIA 2HAKA 4P5QA 4E4MA 4ZLZA 3MTLA 1QCFA 4EONA 2R5TA 4YTIA 2BMCA 2PZ5A 3OCSA 4BI2A 3E93A 4G3CA 4NJDA 3H9OA 4FTKA 4ACHA 2CNVA 2PMNX 2XP2A 2OZAB 3UE4A 1NT2A 3GC0A 1OIYA 4X2KA 5T6KA 4E1ZA 2C1AA 4AW2A 5E7RA 2XCKA 3D83A 3BL9A 2XAOA 4UMTA 1NW1A 3O2MA 4FYOA 4RWKA 4TL0A 2F57A 3O5AA 5D41A 3NUYA 1NVRA 4IWQA 4QP6A 3EQHA 4FEWA 3QCQA 5EM7A 4DT8A 5E8VA 1H4LA 4EZ5A 1EH4A 5FEQA 4O21A 5JFWA 4CKRA 2VTAA 5FTGA 3HRCA 2O63A 4D1SA 3LXPA 2J5EA 2FGIA 4RJ5A 3V01A 3PDTA 4PF4A 4A9SA 2AC5A 3F2AA 4G3FA 3LLTA 4U80A 3BLQA 4CKJA 3OBGA 5AV1A 4NJ3A 4DEHA 3E88A 4FL3A 2VWXA 2OSCA 1FVVA 3EIDA 4YLJA 5KMLA 4FR4A 2IVUA 4FSRA 4ZEGA 5K0XA 4AAAA 3ORNA 4MHAA 3ZBXA 3SW4A 2X0OA 2X39A 1ERKA 3ZU7A 4BKYA 3G6HA 4FOCA 2IZSA 1OKVA 2WAJA 4ZSEA 3R1QA 3VUGA 5C9CA 5EM6A 5HBHA 3VAPA 3KREA 5LMKA 5HG9A 5LVLA 2R3LA 3QTUA 1XH6A 5JK3A 3ZS5A 1M52A 3KRWA 5J5TA 4QYGA 2UZOA 5F1ZA 1OL1A 3F7WA 4NK9A 3SRVB 3F3UA 1V0OA 4R7HA 2X2KA 3MH0A 2WB8A 4YC3A 3ULZA 1GZ8A 4WG3A 4DGOA 3BYOA 3CBLA 3CQEA 3E62A 4YJRA 5DBXA 4JRVA 5DPVA 5E1EA 4EOSA 3U51A 4JXFA 4QMNA 3W8LA 1KE8A 1YXVA 4V01A 2VTIA 1O9UA 3DV3A 3HECA 5FXQA 5CAPA 3OBJA 4MXOA 3EYGA 5KX8A 4DF3A 5BYYA 2UZUE 3AQVA 4IFGA 1YHWA 3MBLA 5DE2A 1J7IA 1JPAA 4K11A 5EDPA 5HESA 4PPBA 5HKMA 3FLQA 4W4YA 4FTJA 3WF7A 3TTIA 4BDCA 4BGHA 4DC2A 4FV1A 2J2IB 2FYSA 3QKMA 5CTPA 4A9YA 4Z9LA 3MY0A 3BWFA 3ZSIA 3P5JC 2ITTA 3KULB 1JKTA 2GCDA 2WMVA 1XWSA 3MY5A 5IEYA 3H10A 4XLVA 3FMMA 3QKKA 4F7SA 4FZAB 3D5XA 1J1BA 4UY9A 1YHVA 3FMJA 5AJQA 4IAKA 4IAAA 5AR4A 1R0PA 3AC1A 1NA7A 5HG7A 2QR8A 2WMAA 3C0IA 3DZQA 3UC4A 2XARA 3DB8A 4HOKA 3LCKA 3UYSA 4CMUA 4QQCA 4CCBA 4M67A 1HCLA 4EBVA 5DEYA 5CVGA 4RX7A 2YZAA 2CHLA 3LAUA 3LM5A 4BTMA 4X7QA 4D4SA 2YLEA 3NGAA 3AT3A 4GJ2A 4ANQA 3IOKA 2QOFA 2VTLA 4YNEA 3FZTA 5E8SA 4AZEA 2R4BA 3R8LA 1TZDA 3BHTA 3FHIA 2F4JA 3QHWA 4ZSAA 2V22A 4ZJVA 4C34A 4ZTQA 4JDIA 4R1YA 3QHRA 2XANA 4AXAA 5FTOA 3RWPA 5AWMA 4IVDA 4NUSA 4XRJA 4BCKA 3UIUA 3DCVA 4AOIA 2VN9A 4GMYA 4H36A 4IAYA 5HTIA 5KE0A 4GIHA 3RBWA 4AQKA 4A4XA 2RSVA 3D94A 3FI3A 3W2RA 1GIJA 3QALE 3ZUVA 3C0HA 5EKOA 3V5LA 4FV3A 5AV4A 5EK7A 3NFFB 3FPQA 2CGUA 4FZFB 4Q5HA 3TUDA 3FZRA 4WT6A 5FBNC 4QNYA 3QUEA 5LARA 2O8YA 5E8WA 2R3HA 1WMKA 2BDJA 2YIWA 2C47A 3GFEA 3LFQA 4G2FA 4AFJA 4BFMA 4BKJA 4NIFB 4WBOA 4ZLYA 3OT3A 4FX3A 4B8MA 4MNEB 4MXYA 1PXKA 5M55A 5I3RA 3G51A 3KF4A 4WIHA 2QNJA 3BL7A 3NIZA 4A06A 4USEA 4JJRA 3TXOA 5K0KA 3V8WA 4ACCA 1JLUE 3CD8A 3P7CA 4FTAA 4XG6A 4YTHA 3TN8A 4YTFA 2Q83A 1XKKA 4BCMA 5KCVA 5FGKA 3ULIA 5AUTA 4O7RA 4O4FA 2CLXA 3B2TA 3LQ5A 3UQGA 4DEEA 4UMUA 4G34A 3MH3A 5ETCA 3ZLYA 1XMLA 4Q5EA 4AZWA 3D0EA 3A99A 3LCSA 4AAYA 1NXKA 4U79A 3WILA 1OMWA 1X8BA 2BHHA 3WF9A 4FEQA 3OT8A 4P4CA 4XP0A 3JXWA 2R3GA 4YSMA 4TPTA 2PVLA 3BU5A 1PKGA 4D2RA 4MWIA 3L8VA 3E8CA 4IVAA 2PK9A 3GEQA 3M2WA 1YXXA 5AUUA 4PNKA 4C3PA 3QD4A 2XAMA 2VRXA 4FI1A 4BBFA 2XYNA 3R2BA 5HLPA 4EZ3A 3E92A 2YEXA 5LMKC 2GPHA 3DJ7A 4N0SA 3DB6A 3E8EA 2JDRA 4LI5A 5E9EA 4I0SA 3UG1A 4EH6A 3GNIB 4ZJIA 2ITWA 3EMGA 3DBDA 4O2PA 3PUPA 2PSQA 2AC3A 1YOLA 3VBQA 4X0MA 4ALWA 3NYNA 4FK3A 4H1MA 4LV7A 3GC9A 5CF4A 3DDPA 2PUPA 3QTXA 4ZIMA 5L6PA 3ORKA 5A46A 3BGQA 3SG8A 3KF7A 3E5AA 2J9MA 2JIVA 3A4OX 4FSMA 3IPHA 4M68A 1GAGA 5ACKA 3FXZA 1I44A 2IJMA 3RAIA 1W84A 1FGIA 4JQ7A 4ENXA 5J95A 3ATTA 4E6AA 3Q32A 4FTTA 1XH4A 2W1HA 2PE2A 4C4IA 4YPDA 4NFNA 5J7BA 4O91A 5JGAA 3U9CA 3ZZEA 5AV2A 3C4CA 1UWHA 3WBLA 1KE6A 3QQLA 3PVUA 4DFZE 4F4PA 4XV3A 2YWPA 3F61A 3FDNA 1H28A 4UZDA 5G6VA 4OAVB 3S00A 4RG0A 5A4CA 1XBAA 4KBKA 2C3IB 3AG9A 2GQGA 3ZM9A 4F6SA 4ASEA 3P4KA 1RJBA 3FJQE 2X8DA 4FKUA 4W4XA 1M17A 3ROCA 4F0GA 3BEAA 5CXZA 5IKWA 4PQNA 1B6CB 2PPQA 2HXQA 4GUEA 2GTMA 4CT1A 5CU0A 4OBPA 4FF8A 5AP6A 4IWOA 1CKJA 2P2IA 3JPVA 3JY0A 5CY3A 5M07A 5H8EA 2JC6A 3DXPA 3PLAE 2B9IA 3UMWA 2E9OA 2FSOX 3QD3A 3F5UA 4GUBA 5L2QA 5BVKA 2PE1A 4DITA 2UZWE 3CPBA 1KV2A 2J7TA 4NZWB 4XG2A 4OT6A 2J50A 3FE3A 4RJ8A 3A2CA 1G8KA 3PXZA 2B54A 3IDPA 3BCEA 4R3PA 4TN6A 4FKVA 3VS5A 5IISA 5KKRC 3DS6A 4WG5A 2E9PA 4YU2A 4DG2E 4R78A 2R3MA 3DGKA 5J9YA 4KKEA 2YM3A 4RIWB 2BROA 3UJGA 4NM3A 4TTHB 4DFYA 2XB7A 3ZLSA 4RWJA 5AEPA 2X8IA 4KNBA 1J91A 3UYTA 3FI8A 2YIQA 4BGGA 5CU2A 4IEBA 2R3PA 2JAMA 3DOGA 4LQMA 4J71A 4IACA 3TNPC 5DRDA 3RM6A 3TT0A 4ANMA 3OWKA 1U54A 4PV0A 4XHKB 2I0HA 3QX2A 2QG7A 2WPAA 2J6MA 3B8RA 4DG3E 4C59A 4R5YA 1IAJA 4P5ZA 3WF6A 5DNRA 4C8BA 4YZCA 3TIZA 2OZOA 3R2YA 4ITJA 4J95A 3AXWA 4FKQA 1U5QA 5CVHA 2VO0A 3BHVA 1ST4A 1MRYA 1ZYJA 2VTOA 4ZZMA 4EHGA 3KRJA 3MPAA 3OY1A 5KMNA 3EN6A 3TDWA 1JKLA 3COMA 2PVKA 4D9UA 3GC7A 3Q96A 3QZHA 3GCUA 1OI9A 3RZBA 5LWMA 2H34A 2VWUA 1JVPP 4ZOGA 4AA5A 3BYVA 3MI9A 3O8TA 3TI1A 3BHUA 4MD8E 3GXLA 4X21A 3LCTA 3UNKA 4YBKA 4TW9A 3MW1A 4TY1A 4UB7A 5GZAA 2YIYA 4OTGA 5TKDA 4YJSA 4EK4A 2W05A 3FC2A 5A4EA 4RQVA 3VBVA 4D5HA 1TQPA 2ZV9A 3NLBA 3KXNA 4FTRA 2ZYBA 4FSNA 5AP0A 4C37A 3IOPA 1BL6A 3GUBA 3Q6WA 3MWUA 2YAKA 1OGYA 2OJ9A 5IQHA 3DXNA 4ZZOA 5I9ZA 5HD4A 3PJ2A 3FQSA 2B9FA 1H24A 4F9WA 4H3QA 3SDJA 3V6SA 1CTPE 3SXFA 4BTFA 2QQ7A 3EZRA 3CTQA 4ITHA 2XALA 3FXWA 3OXIA 4M97A 3WZJA 3FLNC 4E20A 5CNNA 3EFKA 5ACBC 2JDTA 4NH1A 5HZNA 4AZSA 4LRKA 4QMSA 4XUFA 5HVJA 4WSQA 3UBDA 4KIQA 2GNGA 2BHEA 2CNQA 4GG7A 4ZTLA 4PMMA 3UQFA 3ML1A 3LFCA 5FD2A 4RVTA 4ACMA 2YDIA 3FLYA 3NMUF 3PXFA 4AE6A 5LCKA 3FZOA 4BWKA 3EQBA 4CMTA 5CAUA 1LPUA 1OL6A 2UW0A 3Q2MA 4J52A 1Y8YA 2W5AA 3I7BA 4L53A 3SQQA 3HA8A 2UW7A 4DLIA 1REKA 3CQUA 2XBJA 3AMBA 4M84A 4YTCA 1PXOA 1WBTA 5EW8A 2W1EA 3PE1A 3VUTA 3TKUA 2DQ7X 4FIIA 1LR4A 5ANDA 4FIEA 5E8UA 5CAVA 5KMOA 5J1WA 1PF8A 2B0QA 2XJ1A 1Y6AA 3VS1A 1OVEA 1W98A 2HZ4A 2NRYA 3BEGA 1KOBA 4IQ6A 5LVPA 2NNWB 3LKMA 3R9RA 3PLSA 3ZM4A 2R0IA 2F7EE 1KOAA 3O8PA 4O1OA 1J7UA 4O4CA 4QTBA 2Z02A 4NU1A 3LZBA 4GU6A 2R2PA 2BIYA 4AW5A 4HGEA 4RC3A 2G2FA 1BMKA 3HA6A 5I3OA 4LYNA 4QMVA 5FEDA 1ZOGA 1YXUA 1BLXA 3POOA 1WVWA 1H07A 1ZY4A 2JD5A 2QOOA 4Y46A 1QPEA 3HKOA 5JSMA 3VS0A 2GTNA 4U81A 5EHYA 3QZIA 3WE4A 4YPSA 3NNVA 5DLSA