4O6EA

Discovery of 5,6,7,8-tetrahydropyrido[3,4-d]pyrimidine inhibitors of erk2
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
345
structure length
328
Chain Sequence
MVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPVATRWYRAPEIMLNYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKELDDLPKEKLKELIFEETARFQPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 1
publication title Discovery of 5,6,7,8-tetrahydropyrido[3,4-d]pyrimidine inhibitors of Erk2.
pubmed doi rcsb
source organism Homo sapiens
total genus 105
structure length 328
sequence length 345
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2013-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4o6eA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4o6eA01
4DEHA 4TKSA 1XKKA 3Q5IA 2ZB0A 2XVDA 3QC4A 2UZBA 2W1GA 1Q8ZA 1MRVA 4DH5A 4M3QA 1JKSA 3R6XA 3PY3A 3G51A 3R00A 5H2UA 4QP4A 3KRWA 4X21A 5HLWA 4EBVA 3PP0A 1UU9A 1YI3A 4UYAA 2ZV2A 3WILA 2ITTA 4E6AA 2CGVA 3F5PA 4QNAA 4YZDA 3P08A 5FXRA 4FSYA 4GCJA 3PYYA 5L3AA 3L9LA 4XBUA 4ZY5A 2JITA 3AOXA 4R6VA 2PMNX 3U8WA 4CQEA 1QPEA 2HAKA 3R04A 4UWBA 4RLKA 4CFVA 5JN2A 4G5JA 4C33A 3KFAA 4QRCA 3AC2A 3C9WA 3F2RA 2UZDA 3I79A 3NRMA 4DLJA 4DLIA 4E20A 1Y91A 3CS9A 3ROYA 1UKIA 2GTNA 3VBWA 3FV8A 5LVPA 4DBXA 1KE5A 3BGQA 2P55A 4TYGA 4AZWA 3SW7A 4NM5A 4R3CA 4E26A 5I5ZA 2QG5A 3PTGA 1KV2A 4J71A 4N4SA 4EH8A 3DB8A 3TKIA 4WT6A 4IC7A 3RVGA 2C5NA 5BYLA 4IZYA 4MNEA 3WF8A 4FSWA 2PVKA 5AR7A 1H1RA 3ZTXA 3BEGA 1OKWA 2Y7JA 4HCUA 4ZEGA 1O6LA 4ZTLA 3V01A 2YCFA 3QWKA 4A07A 2YHVA 4GVAA 5DR2A 3QX2A 3VJNA 2WMWA 3RHKA 5DR6A 5HOAA 5DHJA 1XWSA 4X6RA 3OWLA 5IA5A 4ZTMA 4UY9A 3W33A 2WPAA 4CKRA 2YM3A 5DA3A 5AUVA 3ORMA 3A7JA 4FV3A 4RIXB 3VUHA 4BVUA 4E4MA 4EI4A 2IVVA 4ZZNA 5M4IA 2C0OA 1HCKA 2PE2A 3LCTA 3KF7A 2IVSA 2YFXA 4O7TA 4EYMA 4ANQA 5EKNA 3AT4A 4ANOA 4TN6A 3R0TA 4QMQA 2QOFA 5E8XA 2VNWA 3ORLA 3PE1A 4RVLA 3UMXA 4CTBA 1PKGA 2C6DA 4L3LA 4Q5EA 4EHGA 2OJIA 4J96A 4L42A 2FO0A 4MQ1A 4PNIA 2PMOX 3AXWA 4W8DA 4RC4A 1NT2A 4DFZE 2XKEA 3DKOA 2J51A 5HICA 2ZOQA 3DTWA 1GY3A 2QKRA 3BELA 4RIWB 3ZBXA 4N6ZA 3TM0A 2C6KA 4ASDA 1OL2A 2UZOA 3W2PA 4AW1A 4IE9A 3LCOA 3BI6A 4ZTSA 5HIBA 3NYXA 4KS8A 1H24A 3R7OA 3AT3A 4K2RA 4QMZA 3VWAA 2BROA 3OC1A 2P4IA 5AV1A 3I0OA 1PXNA 4L45A 4RA4A 4CT2A 1MRYA 1O9UA 3L8SA 3R9OA 3TKHA 5KUPA 4S32A 3LQ8A 4DFBA 4FKJA 4BTKA 4FKLA 1BUHA 3RK5A 2A19B 2ZB1A 3OFMA 5HU3A 2WTKB 4H3QA 3K2LA 4RJ7A 4QYEA 5CVGA 3A7HA 3NW7A 5CASA 3SLSA 3ZRKA 3MIYA 3ETAA 4PX6A 4ANLA 1BYGA 4O2PA 4WIHA 5AV3A 3U55A 3LZBA 3DU8A 3BE2A 3FBVA 3BWJA 3IOKA 3BYVA 2X81A 5TKDA 1KV1A 3D5WA 4FIHA 2BCJA 2GNJA 3MPMA 5IDPA 2VWBA 3SV0A 4CXAA 3TI1A 4FODA 1PYEA 1OECA 1UNHA 1CM8A 1DAWA 2YZAA 4M84A 2F49A 2O65A 5J79A 3AT2A 2UZUE 4Z7HA 4QMLA 4EK5A 4WKQA 2WQMA 4QTDA 2OH0E 4L7SA 1Q61A 4A9UA 2CJMA 2FVDA 4I93A 2EB3A 3VHKA 1V0BA 3QLGA 4P90A 5JH6A 2VTJA 3LIJA 5K3YA 4MF1A 2ZM3A 3AMAA 1OBDA 2GQGA 3P1AA 3GU8A 3F3UA 3RBWA 2OZOA 5C8NA 4XRJA 4E8AA 4IM3A 3TJDA 3EQRA 3RWQA 4KSQA 4K9YA 3RCJA 4UXLA 3BBTB 4MWHA 3LFNA 2CPKE 3LAUA 2QCSA 1YHVA 5ANKA 2ZV9A 4ANMA 2ERZE 5I0BA 1LPUA 4WUAA 4FEWA 4CZUA 3NUAA 4O7SA 3LFQA 3ATTA 1BLXA 3UTOA 5LVOA 2YCSA 4FZDB 5LMKA 4C8BA 2XBJA 3ANRA 5AP5A 2RFSA 3KL8A 1J7UA 4FTRA 4RPVA 2PUPA 4FV8A 4FKTA 3V8SA 2F4JA 1QCFA 5HLPA 2OK1A 2VTMA 3U51A 3CE3A 3DFCB 1U54A 4LOQA 2IW8A 2OSCA 3FHIA 1MQ4A 4KNBA 4O6LA 4AG8A 4FV4A 2CLXA 2GHLA 2AUHA 5M53A 3DQXA 5IEVA 4ZJIA 3Q4TA 5BVWA 4EZ5A 4BL1A 2O3PA 4KIKA 3QRKA 5HVYA 4CZTA 3NS9A 4BDJA 4JAJA 3OZ6A 4MWIA 4D5HA 3Q2MA 1DS5A 1K3AA 5LJJA 4PPAA 4FC0A 2XEYA 4DFXE 2CGUA 3V04A 2QOIA 5ETAA 3ANQA 3LJ0A 4LV8A 4PUZA 4NFNA 5KBQA 2SRCA 2QVSE 2YM8A 3HKOA 4OTWA 4XNEA 4I6BA 3HZTA 3RPYA 2C6EA 2W4JA 4CEGA 1CKIA 4F9CA 1XO2B 4R5SA 1LR4A 4D28A 2QQ7A 3MH3A 3D5UA 1XH7A 2YDKA 5H3QA 4BIEA 3FL4A 5FLFA 1OM1A 2W0JA 4ANSA 4QP7A 3BHYA 5IQIA 3VS6A 2ETRA 5AAGA 2WXVA 4Y5QA 5L8KA 4UMTA 5AP4A 2WMUA 3ZCLA 5CAUA 2XCHA 5GNKA 3BCEA 3R9RA 3QTIA 1JPAA 2HK5A 3LFAA 1QPDA 2F7ZE 3PSBA 4R3RA 3QTZA 3NAYA 3PVWA 3CC6A 5IZFA 5CLPA 4AP7A 2CDZA 3GT8A 3KK8A 1GJOA 2R5TA 3KMMA 4FKGA 4AXAA 1YOJA 4AUAA 3OW3A 2IZTA 3PPJA 5IEYA 2CCIA 1XHAA 5ANJA 4R1VA 4FIJA 3ZHPC 4EZ7A 2XP2A 4MNEB 2OIDA 1ZY4A 2UZNA 5CY3A 3RAKA 3F3ZA 3MJ2A 4EYJA 2PUIA 5CXZA 2C47A 2UW7A 4BR3A 3Q9YA 3ERKA 3A7IA 3QTRA 4RC3A 4RGJA 4W8EA 2YCQA 4RBLA 4EJNA 2P2HA 1OL5A 5E1SA 4IZ7A 4NIFA 3EQDA 3VS4A 4A4LA 1RQQA 3BU3A 4FT3A 2XZSA 4F7LA 3BQCA 4E5BA 4U42A 3KRRA 5EG3A 4R8QA 4UYNA 3D7ZA 3R73A 2RG6A 2WMVA 3VW6A 4C4GA 3V5WA 2ZM4A 1GOLA 5DPVA 1WVYA 1OPLA 1XBCA 3UZRA 3E88A 5TE0A 4K33A 4TNBA 2BDJA 3RNIA 1REKA 1PMUA 2UW5A 3HV3A 5DLSA 5C8KA 2Y9QA 4JX3A 4I0TA 5CNNA 3RINA 3MVHA 2CN8A 1IA8A 3QTQA 3OT3A 1AQ1A 2GS7A 3COMA 3FDNA 2PL0A 2VV9A 5AAFA 5C8MA 1O6YA 3NIZA 3R01A 2WU7A 4RWKA 4IAYA 2XM9A 5C27A 1M14A 4HVHA 3MA3A 3DY7A 5CSXA 4FMQA 4F0IA 4ACCA 4IJPA 3GU4A 4K6ZA 1URWA 4O82A 5J9YA 2E9VA 3Q52A 3ATSA 3QCYA 3ZRLA 4FT0A 3UP7A 4E4NA 1FVTA 3NNUA 3AC8A 4GEOA 5EYCA 5KMIA 3QYZA 3D9VA 3QALE 4FI1A 4BC6A 4M66A 5IUHA 3W16A 2C68A 3E87A 4X2NA 4BCIA 2E2BA 4LI5A 4F1OA 2J7TA 4LRJA 4OGRA 5J95A 4DFUA 2V7OA 2R0IA 2JGZA 3TWJA 5EDPA 5KHWA 5IH4A 3UOJA 3LJ2A 2BZJA 3Q4UA 5E90A 4MD9E 2Z7SA 1GAGA 2PZ5A 3HUBA 3Q3BA 3PFQA 3AGLA 2AYPA 3OUNB 4RQKA 3TUDA 2ETMA 4WBBB 4FKIA 2J9MA 1UKHA 3GUBA 4LM5A 5EYDA 2PUNA 2HW7A 3Q96A 3VUTA 1CKJA 4XG3A 3UZTA 4UZHA 2QC6A 5CS6A 4C37A 4BCJA 3MI9A 2VWWA 3LHJA 3SGCA 3FI4A 3TEIA 1BMKA 3WF5A 2X9EA 1WBSA 5E92A 1Y6BA 3P4KA 4JT3A 3HRCA 3Q5ZA 4FR4A 2VU3A 3SXSA 3R9NA 4D4VA 3PG1A 1H1PA 3E8CA 4E6DA 4YNEA 2HZNA 5C03A 4YHJA 2QLUA 3UG2A 3TKUA 3EZRA 2W1EA 4FTJA 4IB1A 2HY81 4F08A 1FMOE 3TUCA 5AP6A 3DLSA 3L8VA 4O0XA 5D7VA 5HU9A 5CEPA 1B6CB 4DEBA 4F1TA 2ETKA 4GFOA 4BBMA 2XJ0A 3PA4A 2WOTA 3HP5A 4NTSA 4G6LA 2UW3A 3ET7A 4EH4A 2XYNA 5AR3A 4F64A 3DXQA 5B2KA 5HNGA 2IZRA 2OI4X 4EHVA 2H34A 4XP2A 4AW2A 4QTBA 4CYJA 4EH7A 4DCAA 4K11A 3L9MA 3FMEA 3QZFA 5DBXA 2QLQA 4ANBA 2B4SB 5DT4A 3U4UA 4FT9A 4FT7A 4JDKA 4DG0E 4TT7A 1DM2A 1OMWA 3C13A 2QOLA 4GFMA 3UIXA 4AFJA 3TZ7A 4U81A 3DK3A 5F1ZA 3BV3A 4YLJA 3KCFA 5LMBA 3JXWA 4C58A 4K1BA 4J1RA 5AP7A 2H96A 2J6MA 4YTIA 1P4FA 3NYOA 4EORA 2ZMCA 2NP8A 4U8ZA 4YTHA 4BTJA 4DEAA 3GB2A 1YXVA 4ZZMA 1U54B 3PJ3A 4WD5A 3RPSA 4XOZA 5E9EA 1YW2A 3Q60A 4UWYA 4CLJA 3W8QA 3SAYA 3OUKA 3F7ZA 4C4HA 1RW8A 5LARA 2GFCA 4KIKB 4NWMA 5B7VA 4TYHA 4XS2A 5DFPA 3GCPA 3R22A 5BVDA 2WMXA 4W9WA 2J0KA 3O2MA 4OTHA 4QPSA 4EH5A 2BAQA 2OXDA 3IW4A 4O0TA 1ZOHA 2PVNA 2WTJA 4QQCA 5CYIA 2W99B 3Q6WA 4YBKA 3UDBA 4BZDA 1K2PA 4ERWA 3MJ1A 3C4CA 5JSMA 4FV7A 4JRNA 1YWNA 1OIYA 5A14A 2RSVA 3D2IA 3QGWA 2HWOA 4RFZA 4BGQA 4DEDA 4FZ7A 4U3YA 4IJ9A 3Q6UA 2ITPA 5IQAA 5H8BA 1MP8A 2PVFA 4Q2AA 4FEVA 1YHSA 4X2FA 2X6EA 2YIYA 5KCVA 2JIVA 2QOHA 5AX9A 3A99A 5EI8A 2JFMA 3BYOA 5E8ZA 3UVPA 4QMNA 5DNRA 2I1MA 5C26A 1XBBA 3EQCA 3MY0A 3R8PA 4O38A 2RL5A 2BILB 4FKPA 2ZV8A 4KKHA 4NJ3A 1OL6A 3H0YA 2QI8A 4FEUA 5AUXA 2R3JA 3WZJA 1CSNA 2FGIA 1IG1A 3H3CA 4BI2A 4X2GA 4BCGA 4D2VA 2GQRA 3PY1A 4QTCA 4E73A 5FXSA 3VBXA 2OGVA 2WTDA 4RVKA 3VS7A 4ALVA 1IR3A 5CAQA 4FE2A 3LCKA 1UU3A 5TT7A 1M2RA 1H1SA 3V5QA 2QR7A 4APPA 3QQUA 4IWPA 2JLDA 4GIIA 4C0TA 2XRUA 4MD8E 4CLIA 1KOAA 4S30A 1W83A 3G33A 4I0SA 5E7RA 3WI6A 5A6NA 1YWRA 4YJSA 4NIFB 4KS7A 4O0YA 5CENA 3VUGA 2BAKA 2IPXA 3EOCA 1S9IA 2HCKA 3R1YA 4G3EA 3FC2A 4GT4A 4V05A 2BIYA 3E63A 3VF8A 3FZOA 4RT7A 2BZHB 5HE0A 4ZSAA 1RDQE 4CKIA 2CNQA 5HE3A 1TKIA 3CY2A 4I4FA 4FK6A 4L67A 2WAJA 3CLYA 3R8UA 2C3LA 2AC3A 2XYUA 4OBPA 2HZIA 3TTIA 4GYGA 3R71A 4BCNA 4V01A 5I9YA 4YJVA 3U4WA 2PVMA 1STCE 2BTSA 2W06A 1U5RA 5HI2A 2VWUA 3NNXA 4ZTHA 1WVXA 4FTIA 4YJPA 4AN9A 4AFEA 3DB6A 4BCOA 3PRIA 2VTPA 4WA9A 4BTFA 5K4IA 4L53A 2OJJA 1K9AA 2VTRA 4L44A 1SMHA 2XIYA 5K0XA 3JVSA 4M97A 2HENA 4HVSA 4ZMFA 2QO7A 3GFWA 3D7TA 3MH2A 3O0GA 3M42A 3OVVA 3ORXA 4GV1A 1RE8A 2WTCA 2IVUA 3R7VA 2CCHA 2XIRA 4IAZA 4YSJA 3L1SA 4BIDA 5EM7A 4CFFA 2RFNA 3P7CA 3AD5A 3CTHA 1FVVA 2XJ1A 4PMMA 4PRJA 3HECA 5EH0A 3SVVA 1G8AA 4LV5A 3VIDA 2C0IA 3HA6A 1R0PA 5BVKA 2W1FA 3ROCA 5I9XA 2YIXA 5FP5A 3ALNA 3H9RA 3QZHA 3WF9A 4FT5A 4QYHA 2BPMA 4GG7A 3QBNA 3F3WA 3O23A 2PVYA 4UB7A 3D5VA 2UVZA 1YOMA 3EQHA 5GZAA 1G8SA 4QQJA 5GIPE 3FMLA 4QP1A 5IA1A 4YC6A 1GIIA 3NUUA 3AD6A 4D55A 3TNWA 3COIA 3LMIA 4BCKA 3HAMA 3I81A 4BWXA 2C69A 3VRYA 4XX9A 4B8MA 4EKLA 2Y6MA 4CT1A 3VS2A 5M57A 2YIWA 3OD6X 4QPAA 4CVAA 3EJ1A 1OB3A 4OTIA 3I7BA 4W9XA 1FOTA 4AW0A 4BHZA 2YWPA 2B1PA 3AC4A 1JKTA 3ODZX 2OICA 2ITZA 3UIBA 1OZ1A 2JIUA 3IGGA 2IWIA 3QQKA 3EFWA 2WQNA 2VN9A 4J95A 2R3NA 3QTSA 2C4GA 4BDCA 2A4LA 3PE2A 4FNZA 4H1MA 2WHBA 3CJGA 4YBJA 3WYYA 5IUIA 4A7CA 4DH8A 5IMXA 3S95A 1I44A 2X7FA 5L6OA 2YZLA 4M13A 5JZNA 5LVLA 2NNWB 1Q3WA 3MPTA 2AC5A 2XNPA 2C6IA 4M14A 4FA2A 2C1AA 3QCXA 1URCA 3LXPA 3D14A 4EL9A 4BYIA 2OIQA 4FTTA 4PQNA 3ZFMA 4MX9A 3B8QA 2GHGA 3PPKA 5FM2A 3UIUA 5CU6A 4F6SA 2R3PA 3AC1A 4FV0A 1M17A 4BN1A 1H1QA 4JAIA 4BDFA 4EOKA 3FLYA 5BVOA 4DINA 4GSBA 4GW8A 3KRXA 5DOSA 3W10A 4CD0A 3VBTA 3Q4CA 5CQUA 1WBPA 2OIBA 5EFQA 2G2FA 4YZBA 3COHA 4EZ3A 4AZTA 5LMKC 3GCUA 4EH3A 4XYFA 5T3QA 1PXOA 4YZNA 4IAKA 1XH4A 5IQHA 3RK7A 5L2SA 3ZO1A 5E8TA 3GENA 3FXZA 1QL6A 1APME 5HVKA 4ZS0A 4YSMA 4QYFA 5J1WA 4M68A 4GU6A 4TYHB 2XIKA 4FV6A 3F7WA 4ITJA 1ZMWA 2EB2A 2PTKA 4CTCA 1AGWA 3PWDA 3UC3A 4PV0A 4I5PA 4WRSA 5EQPA 1YOLA 3KRJA 1PXIA 1SNXA 4EOIA 4MF0A 3OWKA 4L00A 1UA2A 4AGCA 3ZONA 3RAIA 1XH9A 4IIRA 2EVAA 4JX7A 3LE6A 4IX4A 3LW0A 1HCLA 3SOAA 3UVQA 5KMKA 3JY9A 5HX8A 2OWBA 1H0VA 4D0WA 3BX5A 3A2CA 3ZM9A 5CU0A 1U4DA 4M69A 4O7YA 1YI4A 3FMDA 2QOQA 5KMJA 1SVEA 2C3KA 4ALWA 2X39A 5AADA 5B2LA 4IVDA 3EKNA 1SM2A 2CSNA 5BMSA 4DG2E 3MGYA 4IHPA 1IRKA 4L6QA 1PJKA 3KULA 4ANNA 5HG7A 2DYLA 4TZRA 2R64A 3ZZWA 3OCSA 1WFCA 1XH8A 2YABA 4PF4A 2W5AA 2QR8A 4EQUA 2GPHA 5D1JA 2QKWB 4ZLOA 2JEDA 2XIXA 4C62A 3FYKX 4C3PA 5HESA 4ARKA 2VTNA 4CV8A 3ZU7A 3IPHA 4MAOA 4BCQA 4FOCA 2OJGA 1KOBA 2FB8A 3HX4A 4JBPA 3W2CA 4EK6A 2XNEA 1IAHA 1FQ1B 3OXIA 3M1SA 5M08A 3AD4A 4IACA 5J9LA 4YJQA 3T9IA 5FTGA 1R0EA 3DS6A 5FDXA 2NRUA 3NVKI 4F9BA 1P2AA 3QUEA 3QTUA 2PYWA 4FEQA 4DC2A 5I9WA 1HOWA 1KE6A 4GH2A 2E9UA 2BALA 2VWVA 3BV2A 2BUJA 3W32A 4J53A 5HTIA 4DH1A 5JQ8A 2OW3A 4IANA 3K54A 1UU8A 4HNIA 4RFYA 5EOBA 3QLFA 5BVEA 3UG1A 3I60A 3UBDA 4YO4A 3UO5A 2XNBA 1QPCA 5T6KA 5HO6A 4DTAA 3I4BA 1GNGA 3QHWA 4KUJA 3N4VA 2WIPA 4FKQA 1P4OA 3QRJA 2ITNA 2C0TA 2IW9A 3DK6A 2FSTX 3N51A 4F4PA 2G2IA 4ACHA 5HZNA 5CEMA 4G5PA 1NVSA 5AA9A 4Y5HA 1ND4A 3HV7A 4PDSA 4PL4A 5DT0A 3D83A 5EHLA 1J1BA 1XBAA 3BLHA 4G1WA 5M4UA 4J7BA 3D7TB 4U41A 2WNTA 3R8VA 3HEGA 5AV4A 1I09A 3JVRA 5JFVA 3EQBA 4WSQA 4GVJA 3RM6A 4LFIA 5JRSA 3MPAA 3QA8A 5I9ZA 2V62A 1W82A 3FI3A 5A4TA 5EI2A 1WZYA 3MS9A 3QC9A 5HD4A 5TF9A 3NX8A 2JBOA 4CG9A 4C3FA 1H07A 3KU2A 4O7VA 3VO3A 3C0GA 2IJMA 5EM6A 3T9TA 3NZ0A 4BCFA 4PL5A 4QD6A 3RHXA 1Q41A 3F5XA 4KKGA 2X7OA 1Q8WA 4GJ2A 4JBQA 2W5HA 3ENHA 3FZ1A 3I7CA 3ZRMA 3A4OX 5L8JA 3ZS5A 4B0GA 5K9IA 3QZGA 3EQFA 4I5CA 5DI1A 4R78A 4BDBA 3ZMMA 2IO6A 2GQSA 3I0QA 4FNWA 4JDHA 1TQMA 5FRIA 4CFUA 5CSPA 3G9LX 2YISA 4Y83A 5L8LA 2PE0A 3GCVA 4WNPA 4XEYA 4BDEA 1YDTE 5CANA 3PLSA 4BKZA 4FG9A 3Q9ZA 5EK7A 4NM3A 3VUMA 3CR0A 2O0UA 4IAFA 4USFA 2QO2A 5HGIA 4QP2A 2R3QA 2XK9A 3G90X 3UQFA 5C1QB 4I94A 1IA9A 3C50A 2PWLA 4GUBA 4NZWB 4PPCA 3ZLSA 2JDRA 3FEGA 2UZEA 2BKZA 3K3JA 3UE4A 3CD8A 4FTLA 1Q8TA 2ACXA 4P7EA 4H39A 5HD7A 4UXQA 4WUNA 2PMIA 3IONA 5FGKA 1L3RE 5HG9A 5C9CA 3TV4A 3WE4A 4C4EA 4DYMA 4IFCA 3G5DA 4BF2A 1MUOA 4CCBA 5HTCA 3W2SA 3NVMB 3RKBA 4MXXA 3WZDA 4XUFA 5FQDC 3IDBA 4II5A 3KN5A 2XKCA 1KE9A 1PW2A 3NW5A 5CXHA 2A1AB 3ZM4A 4AE9A 4AX8A 4FEXA 2PVHA 3MH1A 3JY0A 5IQGA 4BI0A 4U7ZA 4IB0A 3R1SA 5H9BA 3ZO2A 2OU7A 4O27B 4FSMA 3AC5A 3EYGA 3WZUA 3KRLA 4I6HA 1H27A 2YJRA 4IDVA 3FPMA 5BVNA 2BRBA 3BLQA 3VQUA 5IH6A 4U79A 3ZXZA 4O7ZA 3EQIA 2VNYA 1EH4A 1QMZA 2F57A 2JKOA 4JG8A 4XBRA 3S4QA 3KA0A 4EBWA 3R9HA 3NSZA 3K5UA 4O22A 4AA0A 3GGFA 4DAWA 2DUVA 5KBRA 3VUIA 3CP9A 1WAKA 4EK3A 3NCZA 4M15A 1WVWA 3DFAA 2BDWA 2BRHA 3F5UA 3FKOA 4NM7A 5ANGA 3RM7A 4AQCA 4F0GA 5CU4A 4IVBA 3TZMA 1DAYA 3RAHA 4DEEA 1ZWSA 3DBDA 3LM0A 5IQBA 3POOA 4B8LA 5K0KA 4QO9A 3QXPA 5B0XA 3LFFA 1GIHA 5EKOA 3UYTA 4FZFB 4M0ZA 1UWJA 4BGGA 3FC1X 3LPBA 2B55A 3H9OA 4L9IA 2E9OA 3JPVA 4BDDA 2WQOA 4H36A 3IG7A 3ZOSA 5AR5A 4F7SA 2KULA 4I4EA 3OXZA 4D1XA 5LMAA 4RWIA 1U46A 2A2AA 2VGOA 4H3PA 2BRNA 4MBIA 2R7IA 4E93A 2UVYA 5DEYA 4PNKA 3QX4A 4NM0A 3OMVA 4XG9A 3SHEA 3O71A 3O7LD 4EUUA 4JQ7A 1JNKA 3L9NA 3P79A 3LFCA 4NEUA 5DT3A 5H8GA 3ZFXA 4EJ7A 4D1SA 4DGOA 4E6CA 4Z7GA 3B2TA 2NO3A 1QPJA 3CCNA 4FIGA 4XG6A 4Y73A 5HLNA 3GCSA 2WQBA 3BHUA 3KULB 1ZMVA 1FBNA 3COKA 4GT3A 2UW4A 1VYZA 4LQMA 5C4KA 4PTGA 3RAWA 2R3LA 4D2PA 4ZIMA 4O7WA 5LWNA 1BI7A 5JFXA 5IQCA 3GQIA 2WIHA 3D5XA 5EM5A 3UZPA 4QMVA 4FTUA 3C0HA 1LP4A 1Q8YA 2QOOA 3VS0A 3OWPA 5AR2A 4C36A 5CF8A 1YHWA 5CI7A 3SKCA 2F7XE 4NW5A 4YJOA 4WG3A 1GZ8A 3PXZA 3EFKA 5D11A 2Z7QA 3RZBA 3RGFA 3FZSA 4HYSA 4OTQA 2UW9A 4QMXA 2QG7A 4JVGA 2ONLA 2ITQA 4BYJA 2CKOA 3LCSA 5AUWA 2XBAA 3FZRA 4G6OA 4K18A 2HZ0A 3VBQA 1Y6AA 3FXWA 5LWMA 4RJ5A 3CPBA 5EW8A 1JKKA 5CZIA 3DDQA 4HYUA 3VUDA 5A9UA 3T3VA 3LCDA 3W18A 4FNYA 5IPJA 4QMOA 2WB8A 2XK8A 1VEBA 1FMKA 2WTVA 1ATPE 1Q4LA 1X8BA 1Q24A 3D0EA 2CGWA 3HMNA 3OROA 4KB8A 4QP9A 5FD2A 2KTYA 4BCPA 2PK9A 4CMTA 3ZC6A 2PVJA 5JZJA 2VUWA 2C1BA 3UPXA 3CKXA 4NCTC 4O83A 2OF2A 4NU1A 2QHNA 2WD1A 3ZO3A 2VTLA 2XKDA 3OW4A 2UZVA 3DJ7A 2XS0A 4FV9A 1JLUE 2XNOA 3FLZA 5JMSA 2YAKA 3SG9A 3JUHA 2ZDTA 4IAAA 5HTBA 4XG4A 3G0EA 4X2JA 2YAAA 4RIOA 5BPYA 3IW8A 2XF0A 4FVPA 3GC9A 3QUPA 3UO4A 2VTHA 3Q2JA 5HBHA 3R2BA 2W1CA 5F95A 3FY2A 4FTMA 4RJ4A 3MA6A 2XCKA 3OEZA 3QRUA 4RRVA 3O50A 3FKLA 4HGLA 3CJFA 4BDHA 2NPQA 4Y46A 5KKRC 2X6DA 3HYHA 1U59A 5TOZA 3ZXTA 2W7XA 3QCQA 1IEPA 5L2IA 4G3DA 4FIIA 3ZUTA 4OTFA 2JC6A 3E5AA 4X3JA 4FG7A 5M4FA 4KIOA 4F6UA 4RJ6A 3C0IA 1UWHA 1R3CA 2YLFA 1J91A 3Q53A 3RK9A 5EQEA 4WG4A 4P5ZA 2R3HA 3DQWA 3BKBA 3LMGA 3PXQA 4Y8DA 3BWFA 2I40A 3KEXA 2C5VA 2YERA 2YM5A 3OP5A 4YZCA 5ANDA 1YXSA 3RJCA 3DNDA 3AQVA 2XH5A 3Q04A 4HGEA 4BCHA 3HLLA 4X3FC 4HGTA 5G1XA 2JKQA 5DYJA 5FUTA 2JD5A 2YEXA 4IH8A 2WMSA 2O8YA 1PY5A 2QNJA 3LFEA 3MY1A 5IA0A 4N57A 1PXJA 3HP2A 1NY3A 3P23A 2VO0A 4XOYA 4AZFA 4J99A 3U9NA 3NNWA 5JQ5A 4OTRA 4U80A 5CT0A 3TV6A 3P5KA 4YHTA 3C4WA 3G15A 3G9NA 3UGCA 1E9HA 3SG8A 3Q9XA 2XK7A 2JIIA 3A7GA 1OVEA 4XCUA 5CTPA 3R7GA 2X8EA 3P0MA 3QUDA 2F7EE 3ALOA 5FBNC 4EQMA 3FI8A 3VN9A 4C4JA 3MESA 3BYSA 3MN3A 3MWUA 3OBGA 5T68A 1ZYSA 2J90A 3DCVA 3TT0A 5M55A 4AACA 4AZSA 4HVDA 4ZMEA 3UNJA 2OJFE 4TYJA 1SNUA 2F2UA 3CGOA 4JBOA 5I3OA 3ID6C 4IB5A 4XLIA 3ZSGA 5KO1A 4DH3A 2Z8CA 4L3JA 1T46A 5CQWA 5ICPA 5JFSA 1YKRA 4EH2A 5M4CA 3G6HA 4RFMA 2PZIA 2G1TA 5AP2A 5E4HA 1G5SA 4XG8A 3TDWA 4XV9A 5CZHA 4C4IA 4MBJA 4FGRA 4FZAB 1TQIA 3RP9A 3V5JA 2B0QA 3MVLA 4RZWA 4FBXA 3LFSA 4H1JA 3U6JA 3KREA 3JYAA 2FA2A 3KN6A 1JOWB 4KBCA 4W4XA 3DZQA 3QRTA 2VTSA 3TIYA 3F2NA 5HCZA 4UN0C 3OG7A 3E8NA 1E1XA 1MRUA 3QU0A 3ZDIA 3FWQA 1P14A 3LXLA 5G6VA 3CTQA 3KMUA 3CQWA 3KXXA 2VWZA 3PG3A 2R9SA 1KUTA 4XG2A 4YR8A 5C4LA 4FKWA 2JDVA 3DBFA 5ANOA 3R30A 4Y95A 3HV5A 2HW6A 5CSVA 4DF3A 3FSKA 3R83A 3QD3A 4U97A 3NAXA 3HV4A 4O91A 3F5GA 3V5TA 5CSWA 3KXNA 3HA8A 5ACKA 4CRSA 5A4CA 3LOKA 2X4ZA 3PRFA 4A9YA 3LQ3A 4ASZA 2YACA 1YDSE 2P3GX 2X1NA 4UMPA 2X2LA 4JQ8A 4O0RA 3TXOA 4AU8A 3QD0A 3SRVA 1S9JA 4KRCA 1FPUA 4MKCA 4QMWA 2B9JA 5AR4A 3DDPA 1XQZA 4CFNA 3S0OA 4U40A 1U5QA 2J0LA 1ZZ2A 4OT6A 3KVXA 4C02A 4O0WA 3KK9A 5BUJA 1E1VA 3PSCA 5L4QA 2WO6A 1GIJA 3V8WA 4JBVA 2I7QA 4TWCA 2RF9A 3QAME 1JWHA 2X4FA 1BKXA 2O2UA 3S2PA 3DZOA 1VYWA 4U6RA 5HCXA 3ODYX 4G34A 1JQHA 3BIZA 5HE2A 3TDVA 4U3ZA 3I1AA 4D0XA 3MTLA 4EOSA 3EFJA 1R39A 4O86A 2Z7LA 2JDSA 3QQJA 2RG5A 4S33A 4IWQA 5EYMA 4PPBA 3S3IA 4CMUA 2R3GA 3AGMA 2G9XA 3BGZA 2W1DA 3QA0A 3MW1A 1NVRA 3RPOA 2Y4IB 1B39A 4IWDA 3CXWA 4O84A 4QPMA 3D94A 4M7IA 5I9UA 4UMUA 3HGKA 4QMUA 2I0VA 4C2VA 5GJDA 4DN5A 3EWHA 4BY9E 2PULA 1UNLA 2RFEA 2J0MB 3FMMA 2QU6A 2X7GA 4MXZA 4C59A 1PMEA 4FTOA 1OKVA 1WMKA 2VZ6A 4I22A 5L6WL 4FF8A 4K77A 4YTFA 5IEXA 4RSSA 2OO8X 5DRBA 3P86A 3TNIA 2YDJA 5JEBA 3SXFA 3UNKA 5AFVA 3MV5A 1TQPA 2P33A 4HZRA 4XHKB 4L7FA 4XV1A 2QODA 4EKKA 5IISA 2OF4A 3GEQA 4GK2A 5M07A 3THBA 3R02A 4R5YA 1H1WA 4G16A 2XNNA 4DHFA 5ACBC 3BZ3A 3ZLXA 1M52A 3H0ZA 4RIYA 5GZ8A 4YLLA 2GSFA 4MXYA 3MBLA 5EYKA 1SYKA 5AIKA 3SW4A 2EXCX 4NKAA 2R7BA 2IN6A 4C4FA 1PXPA 1F0QA 4NCTA 5AMNA 3ZEWA 1LUFA 5LVNA 4JL9A 5J7HA 2BMCA 5TR6A 4TWPA 1CDKA 3VJOA 3FLSA 3CKWA 1M7NA 4EUTA 3W2QA 3KMWA 3OOMA 3TG1A 5HNIX 3UIMA 2CNVA 4FSUA 4ZY4A 3E3BX 3MFUA 4FX3A 3MSSA 4Y85A 3KXZA 5D12A 2QOBA 2XK6A 1ZRZA 5FEEA 3FY0A 5D10A 3AG9A 4AF3A 3DT1A 2CLQA 3BLRA 4YJNA 3VS3A 2XB7A 1YDRE 4J97A 4KBKA 3IOPA 4UALA 3FZPA 4FIEA 4O1OA 2VWYA 2XUUA 3LJ1A 3UJGA 4BWPA 4DH7A 3F3VA 1PKDA 3TTJA 2F2CB 2VAGA 1H8FA 2X2MA 1W0XC 4FOBA 3DAEA 1A06A 4F99A 2RGPA 1MQBA 3RWPA 3IECA 3GC8A 2X8IA 4GT5A 5LCJA 1PXKA 2Q0BA 4IZ5A 4DT9A 2JDTA 4RIXA 3R7IA 1PMVA 3R21A 4EWHA 4Z16A 4RWLA 4X2KA 2RFDA 1ZXEA 4NL0A 3HNGA 5J1VA 1PXMA 4GK3A 2OXYA 3RMFA 5GZ9A 3BHHA 4N0SA 3EN5A 5HVJA 4D2TA 3BYUA 5A4LA 2J4ZA 2OG8A 2GNHA 5AV2A 3F88A 3FI2A 1ZYJA 4X3FA 4TW9A 3CSVA 5IQFA 2QHMA 3DXPA 4D4SA 4RIWA 3EFLA 4MQ2A 4YU2A 3PZEA 4R7HA 4X6QC 3UOLA 3AMYA 5IH5A 4JR3A 4KRDA 3KXGA 3FYJX 2PPQA 1JSTA 1ZARA 3KVWA 5H8EA 5AUTA 2C3IB 5D7AA 3REPA 2YCRA 4E6QA 4R1YA 2FSMX 4CG8A 4IW0A 4BDGA 4NH1A 4QP6A 5DVRA 2E9PA 3MFSA 4TWNA 4CCUA 4ZJVA 2BTRA 3GP0A 5A6OA 2XRWA 5DG5A 4UV0A 5M56A 4BZNA 4PMSA 4HYHA 5KMLA 3UC4A 2GU8A 3R1QA 4ITHA 5CWZA 1OPJA 5FM3A 4XH6A 3C7QA 3PJ1A 2XM8A 4O0SA 1NW1A 3EN6A 4P5QA 2CHLA 4PTCA 1REJA 1OPKA 5E91A 1OL1A 1W98A 5HHWA 4MXAA 4AA5A 2JBPA 3UOHA 1PF8A 2C6MA 3GU5A 3B8RA 3NUSA 4ENYA 4FTQA 4GK4A 2NRYA 1WBTA 3GI3A 3H10A 4OR5A 4UEUA 4FL1A 4G2FA 4JS8A 2WU6A 3LMHA 3SQQA 5K4JA 2XMYA 5E8SA 3WE8A 4DITA 3O8UA 5BUIA 5J9ZA 2GHMA 4JOAA 3QL8A 3WIKA 3UVRA 4GUEA 4RC2A 4ZTNA 2VTQA 3QXOA 4MBLA 4RVMA 4FTCA 4EK8A 3RPVA 1V1KA 4FICA 5AR8A 3NUXA 4V04A 5CU2A 5AP0A 3LM5A 4IADA 4IVCA 4FTNA 4K0YA 3EIDA 3NDMA 3U87A 2W9FB 4LGDA 4ALUA 3PPZA 3DK7A 2Q83A 3NCGA 3GU6A 3V6RA 3VQHA 4MVFA 3DXNA 4JJRA 1NVQA 3EH9A 5KE0A 3S00A 3SRVB 3BBWA 3OCBA 4RLLA 2OKRA 3PIXA 5JGAA 1M7QA 2PE1A 4JR7A 4F7NA 2VWXA 4L68A 3DBQA 5ETFA 3PVBA 4D4RA 3ORZA 2JAVA 3PVUA 3PXRA 4YJUA 4AA4A 3R8ZA 4EOPA 4QTEA 4A06A 5LOHA 2W1ZA 2WMAA 1JKLA 2A0CX 4FKSA 5CU3A 4BDIA 5FWKK 4IM2A 5BMMA 5TO8A 3RALA 5HIEA 1A48A 4YJTA 3GBZA 2C5YA 4A9RA 5K5NA 1M2PA 3IS5A 4IM0A 2R3OA 3DBEA 4HZSA 5HNBA 5GJGA 2VGPA 5CT7A 2HOGA 2UZWE 4RQVA 4PP7A 1UU7A 5IA4A 4JG6A 3ZO4A 2XNGA 3F3TA 2ZAZA 2G01A 2J0IA 3MFRA 3TCPA 4OW8A 4AN2A 5LVMA 2Y4IC 3B2WA 5KMOA 2XK3A 2ZMDA 3LXKA 3NYVA 4AS0A 3CPCA 2ONLC 4F70A 3ZLWA 3BE9A 3GOKA 3QTXA 5I9VA 4YNOA 3Q9WA 1ZZLA 2GNIA 4D5KA 4IZAA 2BFYA 5CEIA 3R63A 2CGXA 4FV5A 4KSPA 3FPQA 2B53A 3IGOA 3Q32A 3RPRA 4FVQA 5JGDA 1OIRA 1Q62A 3E8DA 3V6SA 5DEWA 3CY3A 3ZDUA 2Z02A 3ORPA 4LL0A 4QOXA 2VX3A 4EOOA 3WBLA 3ZFYA 3IW5A 3ZSIA 3GVUA 4G3FA 3DAKA 4RIYB 3PZHA 3LLTA 3R7YA 2Z7RA 4IEBA 3P7AA 1JVPP 4Z9LA 3ORNA 4TRLA 4IWOA 1Q8UA 4EEVA 3VUKA 3FQSA 5L2QA 3R1NA 2UV2A 2X9FA 4AWIA 2QURA 1IASA 4GYIA 3C1XA 3HDNA 4Q9SA 3QQHA 2UW0A 2BKKA 2WGJA 5AWMA 1J1CA 4IXPA 3O17A 3F6XA 3HUCA 4KIQA 2V22A 2RIOA 4GFGA 3PP1A 5ETIA 4YZ9A 4F6WA 4DA5A 4ZXTA 3NMUF 2FSLX 2IZUA 2YN8A 4BBFA 4Q9ZA 3NUPA 5M51A 2IVTA 2UZTA 3U54A 3DV3A 3E93A 1UVRA 4FV2A 2ESMA 5IDNA 4ORKA 1JAMA 4WNOA 3HL7A 4O7RA 1XH5A 5KZ0A 5KMNA 3TUBA 3QQFA 4XJ0A 1YXXA 4BICA 3F66A 3RCDA 1G3NA 3QTWA 3A8WA 3TACA 2QO9A 5KKRB 2GMXA 4I6QA 5DRDA 4G6NA 4C2WA 3EQPA 4E4XA 1GZNA 3V3VA 3A60A 3OTUA 2CNUA 4C34A 2R2PA 4IX5A 1Z5MA 3W8LA 5BYZA 2GNGA 1H01A 3VBVA 1Z9XA 3VHEA 5CX9A 3OCTA 4OTGA 1BL7A 3BU5A 3OXTA 4L01A 3SC1A 3EN7A 3T3UA 2JDOA 4WG5A 3EZVA 1CMKE 5B2MA 2OZAA 3RTPA 3IO7A 1WBWA 2ITVA 2PHKA 4FV1A 4RX9A 1NA7A 3I6UA 2XJ2A 2BZIB 3BQRA 3R7UA 5DE2A 2ERKA 4S34A 4RG0A 4HYIA 4X3FB 3V8TA 1PRYA 2UW6A 4EWQA 3U6HA 2I0HA 3C51A 4N70A 2B9IA 4HNFA 5IUGA 4MXCA 3TNPC 5F9EA 4B99A 3O8TA 3HAVA 3PA5A 4O7NA 3KY2A 2BVAA 4AGUA 1FGKA 5AJQA 4ZK5A 3FMJA 5BYYA 1BX6A 5LXMA 4LMNA 4M8TA 1VR2A 4L46A 1VJYA 4NTTA 4TY1A 3C4XA 4OLIA 2C30A 2VTTA 1OUYA 2YIQA 5GIOE 3RNYA 5JRQA 5D41A 2HIWA 4I21A 5BNJA 3BPRA 5CI6A 1H25A 1Q99A 3VW8A 3FUPA 3QFVA 5J5SA 1H4LA 1JSUA 3CEKA 5AUYA 4WNMA 4NSTA 2EU9A 1J7IA 4E4LA 4I20A 2GFSA 4G9RA 4NK9A 3A61A 3GFEA 3HMMA 4ZSLA 3ORTA 3F2AA 4F7JA 1OGUA 2I6LA 3F69A 2LAVA 2FSOX 4CZYB 3A8XA 5EDQA 4LGGA 3HVCA 4FVRA 4F9AA 2BRMA 4ACMA 4PL3A 4F1MA 4DGGA 3EN9A 2Z60A 4I5MA 4BRXA 5GINE 3TNQB 5LQFA 1KWPA 4FYNA 5M06A 4J8NA 2HELA 5AEPA 2B9FA 3A7FA 3BGPA 4FTAA 4O96A 4XP0A 4JRVA 2PZPA 5EW9A 1R1WA 1F3MC 2X0GA 1Q3DA 3FKNA 4HW7A 1WBNA 4O7LA 3IQ7A 2PU8A 1F5QA 2LGCA 3L8PA 3QKKA 4PDOA 4XV2A 3KXHA 5HKMA 3OY1A 2A27A 4CFMA 4YC8A 3DKFA 4BIBA 4FNXA 3VF9A 3HMOA 3ZSHA 3H4JA 3OCGA 3NWWA 4NFMA 4BTMA 3HMPA 1L8TA 2CKPA 4L3PA 3TIZA 4LGHA 4RJ3A 5EI6A 3PVGA 1OI9A 3L8XA 4OTPA 2BIKB 2YM7A 3QZIA 4YC3A 3UP2A 5J8IA 5BQ0A 3H9FA 3R7EA 5IA3A 2B7AA 5HBJA 3DOGA 5IU2A 4IQ6A 4GL9A 4FSNA 2GNLA 2W4KA 2WKMA 4M69B 1W8CA 1FVRA 3PUPA 2HY0A 3TZ8A 4LL5A 2YWVA 3C5UA 4GKHA 5IG1A 4AOTA 4QMMA 2HZ4A 2HYYA 5AUZA 4F65A 2VX1A 4EOMA 2WTIA 5BVFA 3V5LA 4J52A 3UQCA 5HQ0A 4GRBA 1W84A 3MTFA 4YURA 2W05A 4YGAA 4WRGA 4YUQA 3FQHA 2REIA 1CTPE 1FINA 3FMKA 5FDPA 3DGKA 4CFXA 4H58A 5HO7A 3ZLYA 3U9CA 1RJBA 3VBYA 3U6IA 1GZOA 2Q0NA 3LXNA 4FSZA 4I41A 4YHFA 4BWKA 5JT2A 1CKPA 3NPCA 4MYGA 4RX8A 3VAPA 3N4UA 5FEDA 4QP8A 4QQ5A 4TWOA 4EONA 4AT5A 3O8PA 4DGMA 4TPTA 2YIRA 4L8MA 3KGAA 2R4BA 1ZLTA 4O1PA 3WF7A 4UBAA 4PWNA 4PP9A 5FP6A 2W17A 5DR9A 3ORIA 4LOPA 3H30A 5GJFA 3MVJA 3BHVA 3GOPA 4DEIA 4R3PA 1P5EA 5KHXA 4G17A 4WBOA 2JKMA 3EL7A 2HXLA 2YA9A 4NKSA 3O51A 4OBQA 5HEZA 3PLAE 3E3PA 2IW6A 4AT3A 3PJ8A 3ORKA 1LEZA 1YXTA 3MFTA 1DI9A 3WF6A 3QF9A 4Z3VA 3MB7A 1ZYLA 5L2TA 3E92A 3OOGA 4BKJA 4C38A 5HO8A 3R8LA 3WZKA 3VS1A 3DAJA 2OFVA 3V51A 4O0VA 3T8OA 2C6LA 4NW6A 3UOKA 4V0GA 3VNTA 2GNFA 5EQYA 2V5QA 5EHYA 2C5OA 4D9UA 2BZKB 3EN4A 4FUXA 3RZFA 4Z55A 4QMTA 2GTMA 4PY1A 4CGAA 4MXOA 2QD9A 1O6KA 2J2IB 3EL8A 2VX0A 4IBMA 4JDIA 4JNWA 4F9WA 2BRGA 4EOQA 2R3RA 4MNFA 4YJRA 4FKRA 3QCSA 5EDRA 1XR1A 3FE3A 4DEGA 4EHEA 4ZLZA 3PDTA 3MB6A 1ZAOA 4AAAA 2YDIA 3R2YA 5F20A 4HGSA 4RJ8A 1ZMUA 3P78A 4C57A 4CFWA 4ERKA 4E7WA 2HXQA 4YTCA 1YI6A 5HX6A 4DG3E 3ZUVA 2BFXA 2EXEA 4X0MA 5E8UA 2VRXA 4BZOA 2I0EA 4BKYA 3K3IA 4KAOA 1XJDA 4D58A 2BR1A 4C35A 2OZAB 5F4NA 2R3KA 5JKGA 4UZDA 5LCKA 1YXUA 3KXMA 1V0PA 4AZVA 3O96A 4PTEA 2W1HA 4JG7A 5E8YA 2C6TA 5KMMA 2UUEA 4ZOGA 1GZKA 5J7BA 2ITYA 4EC9A 5FTQA 4TTHB 3ZUUA 2B52A 5AP3A 3WZEA 3HMIA 3NEWA 5HG8A 4KIPA 3CQUA 3ZZEA 3E7OA 3FZTA 1W7HA 4FTKA 5AX3A 3GC7A 4MH7A 3LVPA 3SX9A 3W1FA 1J7LA 3E64A 2EXMA 2ITUA 4ASXA 4WHZA 5I4NA 3AC3A 4FSRA 4DFNA 3UYSA 5E1EA 2W9ZB 4F09A 3NR9A 2YM6A 4ID7A 4D1ZA 2PZYA 4D2SA 3OHTA 2V55A 2WQEA 5AM6A 3R8MA 1PXLA 3ZYAA 5A4QA 4DFLA 2CMWA 2W4OA 3LLAA 3NLBA 3NUNA 2H6DA 3CQEA 5EHOA 3O7LB 3OTVA 1ZYCA 3IKAA 3TNHA 3I5NA 2WTKC 4GG5A 2VO7A 4G9CA 3PXKA 5L2WA 3UPZA 5AM7A 5HG5A 4EH9A 4EQCA 5IQEA 2Y8OA 2WMRA 3W2RA 4LG4A 2PVRA 2OH4A 1R78A 1AD5A 5DN3A 2V7AA 2XA4A 4IC8A 4LRMA 3QD2B 2DWBA 5BUEA 3TJCA 1OUKA 1WBOA 5DMZA 2PZRA 3DTCA 3C4ZA 5HCYA 2Y4PA 4G3GA 3OY3A 3G0FA 4NJDA 5EOLA 2J50A 2G2HA 4ZTRA 3ZBFA 3SA0A 3PXYA 3WARA 4HPUE 1LEWA 3MIAA 3LFDA 2QONA 3LFBA 3CGFA 4M67A 5CVHA 3UO6A 3ZH8A 4KD1A 1XH6A 3NIEA 4IDTA 5FG8A 4NYEA 3GC0A 3IDPA 4FL2A 5EW3A 4LYNA 4QMPA 1YWVA 2CKEA 3BU6A 3DPKA 4KBAA 4ONAA 4ENXA 5C01A 4GS6A 4JQEA 4RVTA 1KE8A 1BI8A 3W55A 3WIGA 4B9DA 3FLNC 2UW8A 3DBCA 1OKYA 4K8AA 3MDYA 2JFLA 4AE6A 2DS1A 5CSHA 3CIKA 1UNGA 3SXRA 3L9PA 3FAAA 2PVLA 3OEFX 5A4EA 4RX5A 2J5EA 1SZMA 2O64A 2WOUA 4D4YA 4AZEA 4ZY6A 2GCDA 4HVIA 4UMRA 1SVGA 4DT8A 2YLEA 5D9HA 4I6FA 4EOLA 4P4CA 3V5PA 3KC3A 4EHZA 4CNHA 4TYIA 5CF4A 4XG7A 5ITAA 1M2QA 3UODA 5CEKA 1JBPE 2EWAA 3R28A 4P2KA 4W4WA 3G2FA 4EC8A 5E8WA 2BHEA 4CYIA 5HE1A 3NYNA 4YPSA 3FLQA 1DI8A 2PUUA 2QOKA 2C3JA 3SD0A 4I0RA 3AMBA 3BHTA 3EQGA 2X2KA 4ZAUA 2CKQA 2H8HA 5BX0A 4FUYA 4DCEA 4GKIA 4MD7E 4IX6A 4BBEA 3QQLA 3NUYA 3PJCA 4GIHA 5AAEA 4HJOA 4TXCA 3ZEPA 3PWYA 3DKGA 4FK3A 4YP8A 3POZA 4PDPA 2W1IA 4HPTE 4YPDA 4C7TA 4IX3A 2YITA 4YZMA 2OBJA 3UQGA 3II5A 4HCTA 4FG8A 4RWJA 3SOCA 2FYSA 3MY5A 5CF5A 4ASEA 2ZDUA 3UNZA 4UX9A 1IAJA 4KWPA 1WCCA 3DJ5A 4PMTA 4JDJA 3VULA 1J3HA 4M12A 3FJQE 4DBNA 4DFYA 3ZC5A 4E5AX 5DGZA 5IKWA 3CD3A 4QMSA 1Y8YA 2XK4A 5FXQA 3I6WA 4CSVA 4JLCA 3N4TA 2ZJWA 2XIZA 3QWJA 3FLWA 3TN8A 1ZY5A 4LOOA 2F9GA 3PJ2A 4F9YA 2C5XA 3FQEA 4QT1A 4RX7A 1H08A 4D2RA 3IW6A 3ULZA 1OIQA 3VS5A 4CMOA 4OAUC 1OITA 4DE4A 5CEQA 4E3CA 2JKKA 5CALA 4ZJJA 4AGWA 4W4YA 4I23A 2WELA 4CRLA 4V0GB 4FYOA 3M11A 4C61A 3HRFA 2Y6OA 4AOIA 5CAOA 1OBGA 1PYXA 3DJ6A 2XEZA 2PMLX 1OL7A 3D2KA 3KF4A 2O5KA 4JXFA 4L52A 5EM8A 2QU5A 4BCMA 2GS2A 4TL0A 2VTOA 4ACDA 2VWIA 5E8VA 4F0FA 4G3CA 4U43A 4MCVA 5JFWA 1OIUA 1TVOA 4KINA 3TL8A 4OUCA 4AT4A 1YQJA 5AA8A 1YRPA 2RKUA 4ZSJA 4FGBA 4Y72A 2DQ7X 3A4PA 3PIZA 3GXLA 4QQTA 5CEOA 1B38A 2HWPA 5KNJA 3C4EA 1KE7A 4GMYA 4I5HA 4DGNA 5GHVA 4DTKA 3QKLA 4CKJA 3GNIB 3FXXA 1ZYDA 4IVAA 2IZSA 2PSQA 3EHAA 4FKUA 4BHNA 3MYGA 3CBLA 1ZOEA 3KB7A 4H3BA 2FUMA 4QMYA 4A4OA 3C5IA 4JIAA 4WO5A 4IFGA 2BDFA 2WMTA 4CQGA 4XMOA 3UMWA 4DTBA 4IAIA 3DLZA 5AP1A 4WNKA 2UZLA 4BB4A 3GQLA 4Q5HA 2ZYBA 3E62A 5AUUA 4ZLYA 2VTIA 4PDYA 3S1HA 3FMHA 3OBJA 5FEQA 1Q97A 5DWRA 4YO6A 4A9SA 2YJSA 4MEDA 3MVMA 4GU9A 1OKZA 2ITOA 1SVHA 3FHRA 2P0CA 4IMYA 3NGAA 4O2ZA 5FTOA 5KZIA 4KKEA 3RI1A 3IDCA 4DGLC 2Y0AA 3IK3A 4MTAA 4R7IA 3EYHA 4UWCA 4APCA 4EK4A 3QRIA 4LUDA 3DKCA 4ZSEA 3PA3A 2ITWA 1KSWA 5HBEA 3N9XA 4R7BA 3W2OA 5L6PA 2EUFB 3QYWA 4CV9A 3D15A 1Y57A 2X8DA 3JS2A 3KQ7A 3BRBA 4QP3A 3SDJA 4HVGA 3GU7A 4GJ3A 5AIRA 5CNOA 2WTWA 4D2WA 5FBOA 4OTDA 3VRZA 3TV7A 1VZOA 4FZ6A 1PHKA 4UMQA 4EOJA 2QOCA 2ZVAA 1Q5KA 5ANIA 1ZOGA 2WFYA 4TNDA 4FKOA 2FH9A 3ACJA 4L43A 4ZP5A 4G31A 3QHRA 1BL6A 5AV0A 4U44A 5J5TA 3OT8A 3CTJA 3PY0A 1T45A 1Z57A 4ZTQA 3FMNA 4O21A 4B6LA 5CF6A 4AW5A 4BDAA 4QNYA 2G15A 4WOVA 2PY3A 4AOJA 4I3ZA 5ANEA 4TYEA 3JR1A 4C3RA 3NW6A 3R9DA 1H0WA 3E8EA 4JIKA 2ZM1A 2ITXA 3FL5A 4ITIA 4JI9A 3EKKA 4KA3A 4U5JA 5ETCA 3QKMA 3BEAA 2ZV7A 4OAVB 3FSFA 5HIDA 2B54A 2R0UA 2XKFA 2J5FA 3K5VA 4RMZA 1JSVA 1NXKA 2E9NA 1PMNA 1WBVA 3MH0A 5JK3A 5M09A 2WMQA 2BAJA 3A62A 4I24A 5DH3A 2R3IA 4W4VA 2JAMA 5KX8A 4LMUA 2H9VA 5CVFA 1Y8GA 2WEVA 3VVHA 5IQDA 2B9HA 4QYGA 5JGBA 2VTAA 2GS6A 4WSYA 4OBOA 4A4XA 5IA2A 3P9JA 4QTAA 4S2ZA 4IB3A 2GDOA 2YM4A 4F63A 3I5ZA 4FSQA 5A54A 3GCQA 4M0YA 4B7TA 3WOWA 4NT4A 3HV6A 5DIAA 3OF0A 4NUSA 4J8MA 4XRLA 4YLKA 4RA5A 4HOKA 5A46A 3F61A 4E1ZA 1YVJA 3KCKA 2J0JA 3E7VA 2C6OA 3HRBA 3QQGA 4U45A 4U9AA 2W5BA 3DNEA 3F9NA 4FIFA 4FSTA 4X7QA 4BFMA 5K5XA 3Q4ZA 3OWJA 2R3MA 2W96B 3G6GA 4OT5A 3IW7A 2VO6A 3C4FA 2V0DA 1ERKA 5HORA 3QGYA 1UV5A 4RZVA 4U0IA 4AN3A 2CN5A 3PIYA 4I92A 4S31A 4I1ZA 5CAVA 2P2IA 3LQ5A 5IF1A 3PXFA 4N6YA 3ENMA 2Z2WA 4BDKA 4XV3A 4O0UA 2OFUA 3LKMA 3QD4A 4USDA 4YMJA 4LRKA 1A9UA 2BHHA 4LUEA 1FGIA 2I0YA 3VC4A 3ELJA 4D9TA 3M2WA 5M44A 3WYXA 3DA6A 4E5WA 4FKVA 3NNVA 4EH6A 3EB0A 5CAPA 4ZZOA 3D4QA 4BGHA 2VD5A 2OXXA 3ITZA 4MK0A 3ACKA 3F82A 4BI1A 2WEIA 4O81A 1H00A 2OLCA 4PMPA 4J98A 4USEA 4A9TA 5I3RA 4QYYA 4AGDA 2VO3A 4HCVA 4XP3A 2R3FA 2IG7A 1V0OA 2OJ9A 3P7BA 5J87A 1H28A 2WZJA 5F94A 4B4LA 3HDMA 4ACGA 3EMGA 4KABA 4O6EA 3TZ9A 2XNMA 3BYMA 2O63A 3KKVA 3PSDA 4XLVA 3ULIA 4H05A 4R77A 2WMBA 3OS3A 4FL3A 2UVXA 4MHAA 4ZSGA 5IMEA 4ZS4A 5A3XA 1H26A
chains in the Genus database with same CATH superfamily
4DEHA 4TKSA 1XKKA 3Q5IA 2ZB0A 2XVDA 3QC4A 2UZBA 2W1GA 1Q8ZA 1MRVA 4DH5A 4M3QA 1JKSA 3R6XA 3PY3A 3G51A 3R00A 5H2UA 4QP4A 3KRWA 4X21A 5HLWA 4EBVA 3PP0A 1UU9A 1YI3A 4UYAA 2ZV2A 3WILA 2ITTA 4E6AA 2CGVA 3F5PA 4QNAA 4YZDA 3P08A 5FXRA 4FSYA 4GCJA 3PYYA 5L3AA 3L9LA 4XBUA 4ZY5A 2JITA 3AOXA 4R6VA 2PMNX 3U8WA 4CQEA 1QPEA 2HAKA 3R04A 4UWBA 4RLKA 4CFVA 5JN2A 4G5JA 4C33A 3KFAA 4QRCA 3AC2A 3C9WA 3F2RA 2UZDA 3I79A 3NRMA 4DLJA 4DLIA 4E20A 1Y91A 3CS9A 3ROYA 1UKIA 2GTNA 3VBWA 3FV8A 5LVPA 4DBXA 1KE5A 3BGQA 2P55A 4TYGA 4AZWA 3SW7A 4NM5A 4R3CA 4E26A 5I5ZA 2QG5A 3PTGA 1KV2A 4J71A 4N4SA 3AKJA 4EH8A 3DB8A 3TKIA 4WT6A 4IC7A 3RVGA 2C5NA 3PFYA 5BYLA 4IZYA 4MNEA 3WF8A 4FSWA 2PVKA 5AR7A 1H1RA 3ZTXA 3BEGA 1OKWA 2Y7JA 4HCUA 4ZEGA 1O6LA 4ZTLA 3V01A 2YCFA 3QWKA 4A07A 2YHVA 4GVAA 5DR2A 3QX2A 3VJNA 2WMWA 3RHKA 5DR6A 5HOAA 5DHJA 1XWSA 4X6RA 3OWLA 5IA5A 4ZTMA 4UY9A 3W33A 2WPAA 4CKRA 2YM3A 5DA3A 5AUVA 3ORMA 3A7JA 4FV3A 4RIXB 3VUHA 4BVUA 4E4MA 4EI4A 2IVVA 4O4EA 4ZZNA 5M4IA 2C0OA 1HCKA 2PE2A 3LCTA 3KF7A 4I6LA 2IVSA 2YFXA 4O7TA 4EYMA 4ANQA 5EKNA 1ST0A 3AT4A 4ANOA 4TN6A 3R0TA 4QMQA 2QOFA 5E8XA 2VNWA 3ORLA 3PE1A 4RVLA 3UMXA 4CTBA 1PKGA 2C6DA 4L3LA 4Q5EA 4EHGA 2OJIA 4J96A 4L42A 2FO0A 4MQ1A 4PNIA 2PMOX 3AXWA 4W8DA 4RC4A 1NT2A 4DFZE 2XKEA 3DKOA 2J51A 5HICA 2ZOQA 3DTWA 1GY3A 2QKRA 3BELA 4RIWB 3ZBXA 4N6ZA 3TM0A 2C6KA 4ASDA 1OL2A 2UZOA 3W2PA 4AW1A 4IE9A 3LCOA 3BI6A 4ZTSA 5HIBA 3NYXA 4KS8A 1H24A 3R7OA 3AT3A 4K2RA 4QMZA 3VWAA 2BROA 3OC1A 2P4IA 5AV1A 3I0OA 1PXNA 4L45A 4RA4A 4CT2A 1MRYA 1O9UA 3L8SA 3R9OA 3TKHA 5KUPA 4S32A 3LQ8A 4DFBA 4FKJA 4BTKA 4FKLA 1BUHA 3RK5A 2A19B 2ZB1A 3OFMA 5HU3A 2WTKB 4H3QA 3K2LA 4RJ7A 4QYEA 5CVGA 3A7HA 3NW7A 5CASA 3SLSA 3ZRKA 3MIYA 3ETAA 4PX6A 4ANLA 1BYGA 4O2PA 4WIHA 5AV3A 3U55A 3LZBA 3DU8A 3BE2A 3FBVA 3BWJA 3IOKA 3BYVA 2X81A 5TKDA 1KV1A 3D5WA 4FIHA 2BCJA 2GNJA 3MPMA 5IDPA 2NYAA 2VWBA 3SV0A 4CXAA 3TI1A 4FODA 1PYEA 1OECA 1UNHA 1CM8A 1DAWA 2YZAA 4M84A 2F49A 2O65A 5J79A 3AT2A 2UZUE 4Z7HA 4QMLA 4EK5A 4WKQA 2WQMA 4QTDA 2OH0E 4L7SA 1Q61A 4A9UA 2XAOA 2CJMA 2FVDA 4I93A 2EB3A 3VHKA 1V0BA 3QLGA 4P90A 5JH6A 2VTJA 3LIJA 5K3YA 4MF1A 2ZM3A 3AMAA 1OBDA 2GQGA 3P1AA 3GU8A 3F3UA 3RBWA 4DDGA 2OZOA 5C8NA 4XRJA 4E8AA 4IM3A 3TJDA 3EQRA 3RWQA 4KSQA 4K9YA 3RCJA 4UXLA 3BBTB 4MWHA 4AAYA 3LFNA 2CPKE 4FEXA 3LAUA 2QCSA 1YHVA 5ANKA 2ZV9A 4ANMA 2ERZE 5I0BA 1LPUA 4WUAA 4FEWA 4CZUA 3KIOC 3NUAA 4O7SA 3LFQA 1ST4A 1BLXA 3UTOA 5LVOA 3ATTA 2YCSA 4FZDB 5LMKA 4C8BA 2XBJA 3ANRA 5AP5A 2RFSA 3KL8A 1J7UA 4FTRA 4RPVA 2PUPA 4FV8A 4FKTA 3V8SA 2F4JA 1QCFA 5HLPA 2OK1A 2VTMA 3U51A 3CE3A 3DFCB 1U54A 4LOQA 2IW8A 2OSCA 3FHIA 1MQ4A 4LDTA 4KNBA 4O6LA 4AXDA 4AG8A 4FV4A 2CLXA 2GHLA 2AUHA 5M53A 3DQXA 5IEVA 4ZJIA 3Q4TA 5BVWA 4EZ5A 4BL1A 2O3PA 4KIKA 3QRKA 5HVYA 4CZTA 3NS9A 4BDJA 4JAJA 3OZ6A 4MWIA 4D5HA 3Q2MA 1DS5A 1K3AA 5LJJA 4PPAA 4FC0A 2XEYA 4DFXE 2CGUA 3V04A 3W0OA 2QOIA 5ETAA 3ANQA 3LJ0A 4LV8A 4PUZA 4NFNA 5KBQA 2SRCA 2QVSE 2YM8A 3HKOA 3TYKA 4OTWA 4XNEA 4I6BA 3HZTA 3RPYA 2C6EA 2W4JA 4CEGA 1CKIA 4F9CA 1XO2B 4R5SA 1LR4A 4D28A 2QQ7A 3MH3A 3D5UA 1XH7A 2YDKA 5H3QA 4BIEA 3FL4A 5FLFA 1OM1A 2W0JA 4ANSA 4QP7A 3BHYA 5IQIA 3VS6A 2ETRA 5AAGA 2WXVA 4Y5QA 5L8KA 4UMTA 5AP4A 2WMUA 3ZCLA 2AEGA 5CAUA 2XCHA 5GNKA 3BCEA 3R9RA 3QTIA 1JPAA 2HK5A 3LFAA 1QPDA 2F7ZE 3PSBA 4R3RA 3QTZA 3NAYA 3PVWA 3CC6A 5IZFA 5CLPA 4AP7A 2CDZA 3GT8A 3KK8A 1GJOA 2R5TA 3KMMA 4FKGA 4AXAA 1YOJA 4AUAA 3OW3A 2IZTA 3PPJA 5IEYA 2CCIA 1XHAA 5ANJA 4R1VA 4FIJA 3ZHPC 4EZ7A 2XP2A 4MNEB 2OIDA 1ZY4A 2UZNA 5CY3A 3RAKA 3F3ZA 3MJ2A 4EYJA 2PUIA 5CXZA 2C47A 2UW7A 4BR3A 3Q9YA 3ERKA 3A7IA 3QTRA 4RC3A 4RGJA 4W8EA 2YCQA 4RBLA 4EJNA 2P2HA 1OL5A 5E1SA 4IZ7A 4NIFA 3EQDA 3VS4A 4A4LA 1RQQA 3BU3A 4FT3A 2XZSA 4F7LA 3BQCA 4E5BA 4U42A 3KRRA 5EG3A 4R8QA 4UYNA 3D7ZA 3R73A 2RG6A 2WMVA 3VW6A 4C4GA 3V5WA 2ZM4A 1GOLA 5DPVA 1WVYA 1OPLA 1XBCA 3UZRA 3E88A 5TE0A 4K33A 4TNBA 2X0PA 2BDJA 3RNIA 1REKA 1PMUA 2UW5A 3HV3A 5DLSA 5C8KA 2Y9QA 4JX3A 4I0TA 5CNNA 3RINA 3MVHA 2CN8A 1IA8A 3QTQA 3OT3A 1AQ1A 2GS7A 3COMA 3FDNA 2PL0A 2VV9A 5AAFA 5C8MA 1O6YA 3NIZA 3R01A 2WU7A 4RWKA 4IAYA 2XM9A 5C27A 1M14A 4HVHA 3MA3A 3DY7A 5CSXA 4FMQA 4F0IA 4ACCA 4IJPA 3GU4A 4K6ZA 1URWA 4O82A 5J9YA 2E9VA 3Q52A 3ATSA 3QCYA 3ZRLA 4FT0A 3UP7A 4E4NA 1FVTA 3NNUA 3AC8A 4GEOA 5EYCA 5KMIA 3QYZA 3D9VA 3QALE 4FI1A 4BC6A 4M66A 5IUHA 3W16A 2C68A 3E87A 4X2NA 4BCIA 2E2BA 4LI5A 4F1OA 2J7TA 4LRJA 4OGRA 5J95A 4DFUA 2V7OA 2R0IA 2JGZA 3TWJA 5EDPA 5KHWA 5IH4A 3UOJA 3LJ2A 2BZJA 3Q4UA 5E90A 4MD9E 2Z7SA 1GAGA 2PZ5A 3HUBA 3Q3BA 3PFQA 3AGLA 2AYPA 3OUNB 4RQKA 3TUDA 2ETMA 4WBBB 4FKIA 2J9MA 1UKHA 3GUBA 4LM5A 5EYDA 2PUNA 2HW7A 3Q96A 3VUTA 1CKJA 4XG3A 3UZTA 4UZHA 2QC6A 5CS6A 4C37A 4BCJA 3MI9A 2VWWA 3LHJA 3SGCA 3FI4A 3TEIA 1BMKA 3WF5A 2X9EA 1WBSA 5E92A 1Y6BA 3P4KA 4JT3A 3HRCA 3Q5ZA 4FR4A 2VU3A 3SXSA 3R9NA 4D4VA 3PG1A 1H1PA 3E8CA 4E6DA 4YNEA 2HZNA 5C03A 4YHJA 2QLUA 3UG2A 3TKUA 3EZRA 2W1EA 4FTJA 4IB1A 2HY81 4F08A 1FMOE 3TUCA 5AP6A 3DLSA 3L8VA 4O0XA 5D7VA 5HU9A 5CEPA 1B6CB 4DEBA 4F1TA 2ETKA 4GFOA 4BBMA 2XJ0A 3PA4A 2WOTA 3HP5A 4NTSA 4G6LA 2UW3A 3ET7A 4EH4A 2XYNA 5AR3A 4F64A 3DXQA 5B2KA 5HNGA 2IZRA 2OI4X 4EHVA 2H34A 4XP2A 4AW2A 4QTBA 4CYJA 4EH7A 4DCAA 4K11A 3L9MA 3FMEA 3QZFA 5DBXA 2QLQA 4ANBA 2B4SB 5DT4A 3U4UA 4FT9A 4FT7A 4JDKA 1W2FA 4DG0E 4TT7A 1DM2A 1OMWA 3C13A 2QOLA 4GFMA 3UIXA 4AFJA 3TZ7A 4U81A 3DK3A 5F1ZA 3BV3A 4YLJA 3KCFA 5LMBA 3JXWA 4C58A 4K1BA 4J1RA 5AP7A 2H96A 2J6MA 4YTIA 1P4FA 3NYOA 4EORA 2ZMCA 2NP8A 4U8ZA 4YTHA 4BTJA 4DEAA 3GB2A 1YXVA 4ZZMA 1U54B 3PJ3A 4WD5A 3RPSA 4XOZA 5E9EA 1YW2A 3Q60A 4UWYA 4CLJA 3W8QA 3SAYA 3OUKA 3F7ZA 4C4HA 1RW8A 5LARA 2GFCA 4KIKB 4NWMA 5B7VA 4TYHA 4XS2A 5DFPA 3GCPA 3R22A 5BVDA 2WMXA 4W9WA 2J0KA 3O2MA 4OTHA 4QPSA 4EH5A 2BAQA 2OXDA 3IW4A 4O0TA 1ZOHA 2PVNA 2WTJA 4QQCA 5CYIA 3W0QA 2W99B 3Q6WA 4YBKA 3UDBA 4BZDA 1K2PA 4ERWA 3MJ1A 3C4CA 5JSMA 4FV7A 4JRNA 1YWNA 1OIYA 5A14A 2RSVA 3D2IA 3QGWA 2HWOA 4RFZA 4BGQA 4DEDA 4FZ7A 4U3YA 4IJ9A 3Q6UA 2ITPA 5IQAA 5H8BA 1MP8A 2PVFA 4Q2AA 4FEVA 1YHSA 4X2FA 2X6EA 2YIYA 5KCVA 2JIVA 2QOHA 5AX9A 3A99A 5EI8A 2JFMA 3BYOA 5E8ZA 3UVPA 4QMNA 5DNRA 2I1MA 5C26A 1XBBA 3EQCA 3MY0A 3R8PA 4O38A 2RL5A 2BILB 4FKPA 2ZV8A 4KKHA 4NJ3A 1OL6A 3H0YA 2QI8A 4FEUA 5AUXA 2R3JA 3WZJA 1CSNA 2FGIA 1IG1A 3H3CA 4BI2A 4X2GA 4BCGA 4D2VA 2GQRA 3PY1A 4QTCA 4E73A 5FXSA 3VBXA 2OGVA 2WTDA 4RVKA 3VS7A 4ALVA 1IR3A 5CAQA 4FE2A 3LCKA 1UU3A 5TT7A 1M2RA 1H1SA 3V5QA 2QR7A 4APPA 3QQUA 4IWPA 2JLDA 4GIIA 4C0TA 2XRUA 4MD8E 4CLIA 1KOAA 4S30A 1W83A 3G33A 4I0SA 5E7RA 3WI6A 5A6NA 1YWRA 4YJSA 4NIFB 4KS7A 4O0YA 5CENA 3VUGA 2BAKA 2IPXA 3EOCA 1S9IA 2HCKA 3R1YA 4G3EA 3FC2A 4GT4A 4V05A 2BIYA 3E63A 3VF8A 3FZOA 2XARA 4RT7A 2BZHB 5HE0A 4ZSAA 1RDQE 4CKIA 2CNQA 4QEBA 5HE3A 1TKIA 3CY2A 4I4FA 4FK6A 4L67A 2WAJA 3CLYA 3R8UA 4O4DA 2C3LA 2AC3A 2XYUA 4OBPA 2HZIA 3TTIA 4GYGA 3R71A 4BCNA 4V01A 5I9YA 4YJVA 3U4WA 2PVMA 3AKLA 1STCE 2BTSA 2W06A 1U5RA 5HI2A 2VWUA 3NNXA 4ZTHA 1WVXA 4FTIA 4YJPA 4AN9A 4AFEA 3DB6A 4BCOA 3PRIA 2VTPA 4WA9A 4BTFA 5K4IA 4L53A 2OJJA 1K9AA 2VTRA 4L44A 1SMHA 2XIYA 5K0XA 3JVSA 4M97A 2HENA 4HVSA 4ZMFA 2QO7A 3GFWA 3D7TA 3MH2A 3O0GA 3M42A 3OVVA 3ORXA 4GV1A 1RE8A 2WTCA 2IVUA 3R7VA 2CCHA 2XIRA 4IAZA 4YSJA 3L1SA 4BIDA 5EM7A 4CFFA 2RFNA 3P7CA 3AD5A 3CTHA 1FVVA 2XJ1A 4PMMA 4PRJA 3HECA 5EH0A 3SVVA 1G8AA 4LV5A 3VIDA 2C0IA 3HA6A 1R0PA 5BVKA 2W1FA 3ROCA 5I9XA 2YIXA 5FP5A 3ALNA 3H9RA 3QZHA 3WF9A 4FT5A 4QYHA 2BPMA 4GG7A 3QBNA 3F3WA 3O23A 2PVYA 4UB7A 3D5VA 2UVZA 1YOMA 3EQHA 5GZAA 1G8SA 4QQJA 5GIPE 3FMLA 4QP1A 5IA1A 4YC6A 1GIIA 3NUUA 3AD6A 4D55A 3TNWA 3COIA 1G8JA 4BCKA 3LMIA 3HAMA 3I81A 4BWXA 2C69A 3VRYA 4XX9A 4B8MA 4EKLA 2Y6MA 4CT1A 3VS2A 5M57A 2YIWA 3OD6X 4QPAA 4CVAA 3EJ1A 1OB3A 4OTIA 3I7BA 4W9XA 1FOTA 4AW0A 4BHZA 2YWPA 2B1PA 3AC4A 1JKTA 3ODZX 2OICA 2ITZA 3UIBA 1OZ1A 2JIUA 3IGGA 2IWIA 3QQKA 3EFWA 2WQNA 2VN9A 4J95A 2R3NA 3QTSA 2C4GA 4BDCA 2A4LA 3PE2A 4FNZA 4H1MA 2WHBA 3CJGA 4YBJA 3WYYA 5IUIA 4A7CA 4DH8A 5IMXA 3S95A 1I44A 2X7FA 5L6OA 2YZLA 4M13A 5JZNA 5LVLA 2NNWB 1Q3WA 3MPTA 2AC5A 4BJJA 2XNPA 2C6IA 4M14A 4FA2A 2C1AA 3QCXA 1URCA 3LXPA 1XMLA 3D14A 4EL9A 4BYIA 2OIQA 4FTTA 4PQNA 3ZFMA 4MX9A 3B8QA 2GHGA 3PPKA 5FM2A 3UIUA 5CU6A 4F6SA 2R3PA 3AC1A 4FV0A 1M17A 4BN1A 1H1QA 4JAIA 4BDFA 4EOKA 3FLYA 5BVOA 4DINA 4GSBA 4GW8A 3KRXA 5DOSA 3W10A 4CD0A 3VBTA 3Q4CA 5CQUA 1WBPA 2OIBA 5EFQA 2G2FA 4YZBA 3COHA 4EZ3A 4AZTA 5LMKC 3GCUA 4EH3A 4XYFA 5T3QA 1PXOA 4YZNA 4IAKA 1XH4A 5IQHA 3RK7A 5L2SA 3ZO1A 5E8TA 3GENA 3FXZA 1QL6A 1APME 5HVKA 4ZS0A 4YSMA 4QYFA 5J1WA 4M68A 4GU6A 4TYHB 2XIKA 4FV6A 3F7WA 4ITJA 1ZMWA 2EB2A 2PTKA 4CTCA 1AGWA 1G8KA 3PWDA 3UC3A 4PV0A 4I5PA 4WRSA 5EQPA 1YOLA 3KRJA 1PXIA 1SNXA 4EOIA 4MF0A 3OWKA 4L00A 1UA2A 4AGCA 3ZONA 3RAIA 1XH9A 4IIRA 2EVAA 4JX7A 3LE6A 4IX4A 3LW0A 3AKKA 1HCLA 3SOAA 3NFFB 3UVQA 5KMKA 3JY9A 5HX8A 2OWBA 1H0VA 4D0WA 3BX5A 3A2CA 3ZM9A 5CU0A 1U4DA 4M69A 4O7YA 1YI4A 3FMDA 2QOQA 5KMJA 1SVEA 2C3KA 4ALWA 2X39A 5AADA 5B2LA 3ML1A 4IVDA 3EKNA 1SM2A 2CSNA 5BMSA 4DG2E 3MGYA 4IHPA 1IRKA 4L6QA 1PJKA 3KULA 4ANNA 5HG7A 2DYLA 4TZRA 2R64A 3ZZWA 3OCSA 1WFCA 1XH8A 2YABA 4PF4A 2W5AA 2QR8A 4EQUA 2GPHA 5D1JA 2QKWB 4ZLOA 2JEDA 2XIXA 4C62A 3FYKX 4C3PA 5HESA 4ARKA 2VTNA 4CV8A 3ZU7A 3IPHA 1W2CA 4MAOA 4DHJA 4BCQA 4FOCA 2OJGA 1KOBA 2FB8A 3HX4A 4JBPA 3W2CA 4EK6A 2XNEA 1IAHA 1FQ1B 3OXIA 3M1SA 5M08A 3AD4A 4IACA 5J9LA 4YJQA 3T9IA 5FTGA 1R0EA 3DS6A 5FDXA 2NRUA 3NVKI 4F9BA 1P2AA 3QUEA 3QTUA 2PYWA 4FEQA 4DC2A 5I9WA 1HOWA 1KE6A 4GH2A 2E9UA 2BALA 2VWVA 3BV2A 2BUJA 3W32A 4J53A 5HTIA 3W0SA 4DH1A 5JQ8A 2OW3A 4IANA 3K54A 1UU8A 4HNIA 4RFYA 5EOBA 3QLFA 5BVEA 3UG1A 3I60A 3UBDA 4YO4A 3UO5A 2XNBA 1QPCA 5T6KA 5HO6A 4DTAA 3I4BA 1GNGA 3QHWA 4KUJA 3N4VA 2WIPA 4FKQA 1P4OA 3QRJA 2ITNA 2C0TA 2IW9A 3DK6A 2FSTX 3N51A 4F4PA 2G2IA 3BL7A 4ACHA 5HZNA 5CEMA 4G5PA 1NVSA 5AA9A 4Y5HA 1ND4A 3HV7A 4PDSA 4PL4A 5DT0A 3D83A 5EHLA 1J1BA 1XBAA 3BLHA 4G1WA 5M4UA 4J7BA 3D7TB 4U41A 2WNTA 3R8VA 3HEGA 5AV4A 1I09A 3JVRA 5JFVA 3EQBA 4WSQA 4GVJA 3RM6A 4LFIA 5JRSA 3MPAA 3QA8A 5I9ZA 2V62A 1W82A 3FI3A 5A4TA 5EI2A 1WZYA 3MS9A 3QC9A 5HD4A 5TF9A 3NX8A 2JBOA 4CG9A 4C3FA 1H07A 3KU2A 4O7VA 3VO3A 3C0GA 2IJMA 5EM6A 3T9TA 3NZ0A 4BCFA 4PL5A 4QD6A 3RHXA 1Q41A 3F5XA 4MUQA 4KKGA 2X7OA 1Q8WA 4GJ2A 4JBQA 2W5HA 3ENHA 3FZ1A 3I7CA 3ZRMA 3A4OX 5L8JA 3ZS5A 4B0GA 5K9IA 3QZGA 3EQFA 4I5CA 5DI1A 4R78A 4BDBA 3ZMMA 2IO6A 2GQSA 3I0QA 4FNWA 4JDHA 1TQMA 5FRIA 4CFUA 5CSPA 3G9LX 2YISA 4Y83A 5L8LA 2PE0A 3GCVA 4WNPA 4XEYA 4BDEA 1YDTE 5CANA 3PLSA 4BKZA 4FG9A 3Q9ZA 5EK7A 4NM3A 3VUMA 3CR0A 2O0UA 4IAFA 4USFA 2QO2A 5HGIA 4QP2A 2R3QA 2XK9A 3G90X 3UQFA 5C1QB 4I94A 1IA9A 3C50A 2PWLA 4GUBA 4NZWB 4PPCA 3ZLSA 2JDRA 3FEGA 2UZEA 2BKZA 3K3JA 3UE4A 3CD8A 4FTLA 1Q8TA 2ACXA 4P7EA 4H39A 5HD7A 4UXQA 4WUNA 2PMIA 3IONA 5FGKA 1L3RE 5HG9A 5C9CA 3TV4A 3WE4A 4C4EA 4DYMA 4BJJB 4IFCA 3G5DA 4BF2A 1MUOA 4CCBA 5HTCA 3W2SA 3NVMB 3RKBA 4MXXA 3WZDA 4XUFA 5FQDC 3IDBA 4II5A 3KN5A 2XKCA 1KE9A 1PW2A 3NW5A 5CXHA 2A1AB 3ZM4A 4O4BB 4AE9A 4AX8A 2PVHA 3MH1A 3JY0A 5IQGA 4BI0A 4U7ZA 4IB0A 3VONA 3R1SA 5H9BA 3ZO2A 2OU7A 4O27B 4FSMA 3AC5A 3EYGA 3WZUA 3KRLA 4I6HA 1H27A 2YJRA 4IDVA 3FPMA 5BVNA 2BRBA 3BLQA 3VQUA 5IH6A 4U79A 3ZXZA 4DHIB 4O7ZA 3EQIA 2VNYA 1EH4A 1QMZA 2F57A 2JKOA 4JG8A 4XBRA 3S4QA 3KA0A 4EBWA 3R9HA 3NSZA 3K5UA 4O22A 4AA0A 3GGFA 4DAWA 2DUVA 5KBRA 3VUIA 3CP9A 1WAKA 4EK3A 3NCZA 4M15A 1WVWA 3DFAA 2BDWA 2BRHA 3F5UA 3FKOA 4NM7A 5ANGA 3RM7A 4AQCA 4F0GA 5CU4A 4IVBA 3TZMA 1DAYA 3RAHA 4DEEA 1ZWSA 3DBDA 3LM0A 5IQBA 3POOA 4B8LA 5K0KA 4QO9A 3QXPA 5B0XA 3LFFA 1GIHA 5EKOA 3UYTA 4FZFB 4M0ZA 1UWJA 4BGGA 3FC1X 3LPBA 2B55A 3H9OA 4L9IA 2E9OA 3JPVA 4BDDA 2WQOA 4H36A 3IG7A 3ZOSA 5AR5A 4F7SA 2KULA 4I4EA 3OXZA 4D1XA 5LMAA 4RWIA 1U46A 2A2AA 2VGOA 4H3PA 2BRNA 4MBIA 2R7IA 4E93A 2UVYA 5DEYA 4PNKA 3QX4A 4NM0A 3OMVA 4XG9A 3SHEA 3O71A 3O7LD 4EUUA 4JQ7A 1JNKA 3L9NA 3P79A 3LFCA 4NEUA 5DT3A 5H8GA 3ZFXA 4EJ7A 4D1SA 4DGOA 4E6CA 4Z7GA 3B2TA 2NO3A 1QPJA 3CCNA 4FIGA 4XG6A 4Y73A 5HLNA 3GCSA 2WQBA 3BHUA 3KULB 1ZMVA 1FBNA 3COKA 4GT3A 2UW4A 1VYZA 4LQMA 5C4KA 4PTGA 3RAWA 2R3LA 4D2PA 4ZIMA 4O7WA 5LWNA 1BI7A 5JFXA 5IQCA 3GQIA 2WIHA 3D5XA 5EM5A 2IEWA 3UZPA 4QMVA 4FTUA 3C0HA 1LP4A 1Q8YA 2QOOA 3VS0A 3OWPA 5AR2A 4C36A 5CF8A 1YHWA 5CI7A 3SKCA 2F7XE 4NW5A 4YJOA 4WG3A 1GZ8A 3PXZA 3EFKA 5D11A 2Z7QA 3RZBA 3RGFA 3FZSA 4HYSA 4OTQA 2UW9A 4QMXA 2QG7A 4JVGA 2ONLA 2ITQA 4BYJA 2CKOA 3LCSA 5AUWA 2XBAA 3FZRA 4G6OA 4K18A 2HZ0A 3VBQA 1Y6AA 3FXWA 5LWMA 4RJ5A 3CPBA 5EW8A 1JKKA 5CZIA 3DDQA 4HYUA 3VUDA 5A9UA 3T3VA 3LCDA 3W18A 4FNYA 5IPJA 4QMOA 2WB8A 2XK8A 1VEBA 1FMKA 2WTVA 1ATPE 1Q4LA 1X8BA 1Q24A 3D0EA 2CGWA 3HMNA 3OROA 4KB8A 4QP9A 5FD2A 2KTYA 4BCPA 2PK9A 4CMTA 3ZC6A 2PVJA 5JZJA 2VUWA 2C1BA 3UPXA 3CKXA 4NCTC 4O83A 2OF2A 4NU1A 2QHNA 2WD1A 3ZO3A 2VTLA 2XKDA 3OW4A 2UZVA 3DJ7A 2XS0A 4FV9A 1JLUE 2XNOA 3FLZA 5JMSA 2YAKA 3SG9A 2AQXA 3JUHA 2ZDTA 4IAAA 5HTBA 4XG4A 3G0EA 4X2JA 2YAAA 4RIOA 1W2DA 5BPYA 3IW8A 2XF0A 4FVPA 3GC9A 3QUPA 3UO4A 2VTHA 3Q2JA 5HBHA 3R2BA 2W1CA 5F95A 3FY2A 4FTMA 4RJ4A 3MA6A 4AXCA 2XCKA 3OEZA 3QRUA 4RRVA 3O50A 3FKLA 4HGLA 3CJFA 4BDHA 2NPQA 4Y46A 5KKRC 2X6DA 3HYHA 1U59A 5TOZA 3ZXTA 2W7XA 3QCQA 1IEPA 5L2IA 4G3DA 4FIIA 3ZUTA 4OTFA 2JC6A 3E5AA 4X3JA 4FG7A 5M4FA 4KIOA 4F6UA 4RJ6A 3C0IA 1UWHA 1R3CA 2YLFA 1J91A 3Q53A 3RK9A 5EQEA 4WG4A 4P5ZA 2R3HA 3DQWA 3BKBA 3LMGA 3PXQA 4Y8DA 3BWFA 2I40A 3KEXA 2C5VA 2YERA 2YM5A 3OP5A 4YZCA 5ANDA 1YXSA 3RJCA 3DNDA 3AQVA 2XH5A 3Q04A 4HGEA 4BCHA 3HLLA 4X3FC 4HGTA 5G1XA 2JKQA 5DYJA 5FUTA 2JD5A 2YEXA 4IH8A 2WMSA 2O8YA 1PY5A 2QNJA 3LFEA 3MY1A 5IA0A 4N57A 1PXJA 3HP2A 1NY3A 3P23A 2VO0A 4XOYA 4AZFA 4J99A 3U9NA 3NNWA 5JQ5A 4OTRA 4U80A 5CT0A 3TV6A 3P5KA 4YHTA 3C4WA 3G15A 3G9NA 3UGCA 1E9HA 3SG8A 3Q9XA 2XK7A 2JIIA 3A7GA 1OVEA 4XCUA 5CTPA 3R7GA