5ITAA

Crystal structure of braf kinase domain bound to az-vem
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
271
structure length
250
Chain Sequence
b'DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGLSILWMAPEVIRMNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title An integrated model of RAF inhibitor action predicts inhibitor activity against oncogenic BRAF signaling
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 78
structure length 250
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5itaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5itaA01
2VTLA 4C38A 4BCGA 4DEGA 4AACA 4E6DA 1LUFA 2W1EA 3C51A 1PYEA 3OTUA 4O7LA 4YHFA 3DNDA 3QZGA 4NKSA 5IDPA 1RJBA 3QALE 2OBJA 3EIDA 3R7VA 2C5VA 3WOWA 4BKJA 2J9MA 1KWPA 4O96A 3Q52A 4MXXA 4L67A 3SGCA 2C6EA 3MFUA 4ID7A 3WYXA 4ENYA 4EOPA 3ID6C 3Q2JA 2RGPA 5KBRA 4X2NA 4XYFA 5BVKA 4F0IA 5M06A 3VBYA 4O84A 4YURA 1GZ8A 5DR2A 3PE2A 2WGJA 1H07A 3Q5ZA 4KBAA 4KB8A 3OCGA 4XBUA 5AR3A 4CFUA 5LJJA 3PJ8A 3HMIA 4G3FA 5GJGA 5H8BA 5EYCA 4EWQA 3MY0A 3ODYX 5IU2A 3DT1A 2GNHA 5E8YA 2B1PA 3PY0A 5GJDA 3TV6A 3H9RA 2GNJA 5CSWA 3RWPA 5JN2A 3HAMA 2C5NA 3EFWA 4IAAA 4BGQA 5E7RA 4RX7A 4A9UA 3DGKA 3LFSA 3NNUA 2VTOA 2WKMA 2E2BA 3DBCA 4FKGA 3I6WA 4NT4A 3EQBA 5HG9A 3S3IA 5IA3A 5DR9A 2J0MB 4IB3A 5EG3A 3RNIA 3Q60A 2YM8A 1H1WA 1H1QA 5I3OA 5LMAA 4XMOA 3NUUA 3HAVA 2R3RA 5DR6A 4FNZA 3BPRA 4IX4A 2E9NA 3SOCA 3MESA 3G90X 3FLZA 4EUTA 4FODA 3FMEA 4PPAA 4C37A 4RFYA 4ZOGA 4GH2A 3C0HA 3MS9A 2HW6A 3EQGA 4ANQA 2PHKA 3GU7A 3NLBA 4EC8A 4ERWA 4FSNA 2QG7A 2P2IA 5K5XA 4ZTHA 1JKSA 3CSVA 3SHEA 4EJ7A 4DEAA 3QQKA 4IAIA 3QWKA 3F5UA 4I93A 4A7CA 3OG7A 4WHZA 4IB5A 3GENA 4L3JA 3TNWA 4NWMA 4LM5A 3TUDA 1E1XA 5EHLA 3LVPA 4OT6A 2JLDA 4WT6A 3GNIB 3I5ZA 4UY9A 3FC2A 3QCXA 4IE9A 4R1VA 4TRLA 4FKVA 2PVRA 3HMMA 4FK3A 4QYHA 3RPVA 5DVRA 3H30A 4KKEA 2AC5A 4M13A 3CS9A 3LM5A 3R6XA 3ATSA 3KRXA 3ZDIA 5C8KA 5CU0A 4DFBA 4FT9A 2BRBA 2EB3A 2WMBA 2OGVA 3KXMA 5CX9A 4D5HA 3BWJA 3CJFA 1JSUA 1J3HA 3DFCB 5DRBA 3QCSA 4FV7A 4AT5A 4EHZA 2HY0A 4XG6A 2W9ZB 4HVSA 4JX7A 4NZWB 5DFPA 3M11A 2ESMA 5HG7A 4C57A 4HCUA 3ZU7A 2UVXA 1JSTA 3R02A 4E4XA 3NW5A 4MWHA 2OH4A 5I9YA 3CEKA 5M57A 2PVLA 4FIHA 4XOYA 4QP2A 3IDCA 2O5KA 2ZMDA 4FV4A 3LCKA 1R3CA 3SV0A 4F63A 3SRVB 4GIIA 4QMXA 4ZLOA 4I22A 2GQRA 2VRXA 3F5PA 1V0BA 4UYNA 3QYZA 4FR4A 2WPAA 3WARA 5A4TA 5F95A 3RGFA 1H8FA 3KMMA 3ULIA 2Z7LA 2YM6A 4DA5A 4O22A 4CRSA 5C1QB 4MQ2A 4OLIA 5GIOE 2HK5A 4D55A 3MIYA 3RJCA 4F09A 3CKXA 2VTIA 4D5KA 1GZNA 4DT9A 2UUEA 3Q6UA 3RAWA 2F49A 3FQSA 4KRCA 5ACKA 3FZOA 2BCJA 1O9UA 3FV8A 4DFUA 3ORIA 2OKRA 2H34A 4UMUA 3RPRA 1DAYA 4F9CA 3EWHA 3AT3A 4NM7A 3OOMA 5KMLA 4XV9A 4E5AX 3CPCA 5HTCA 3V5TA 3PA3A 3ULZA 3CE3A 2R3QA 4GEOA 1CDKA 2EXMA 3RTPA 4TW9A 3PJCA 4LOQA 4BY9E 4R1YA 5AA8A 2W1CA 1MP8A 4DLJA 4RWLA 1R39A 2XB7A 3E8CA 5IPJA 2Y4IC 4L01A 4G6LA 4F7LA 3PPZA 4D2WA 4FVRA 3F3WA 4YJTA 5CAOA 5CSPA 1Q5KA 3F3TA 5GNKA 5AADA 3R7GA 3MA3A 5A14A 5BQ0A 5CANA 5AFVA 2RF9A 3PXQA 2ONLC 1XQZA 4CT1A 4FEUA 2BMCA 4O7ZA 2WU7A 4ANLA 4QP4A 1JQHA 4K2RA 3TKHA 5IMEA 2WQOA 4H3BA 2CKOA 4R8QA 4J97A 2XK4A 3AQVA 3Q32A 4UZDA 5CAQA 3DAJA 2Z7QA 1BX6A 4G3DA 2PVHA 5ANOA 4FL3A 4J96A 2VTJA 4X21A 1A06A 3MWUA 3G0FA 4C59A 3DTWA 4EH8A 4LMNA 2YIYA 3VJNA 3BHUA 4O0SA 3NWWA 4BF2A 4GUBA 4BWKA 4MXYA 3GGFA 3RINA 5IQDA 2QLUA 3EN6A 3FZRA 3GQLA 4TY1A 4EOKA 3QZHA 1H27A 5CALA 3ZC5A 2JKMA 1MQ4A 3GC7A 3RAIA 1U54B 3KMWA 2Y0AA 4GJ3A 4L46A 5HOAA 3PZEA 3R7IA 4BTKA 2VO0A 3RZBA 5CU4A 5FBNC 4W8DA 4U44A 3K2LA 4ITHA 4PP7A 3NGAA 3P5KA 3PJ2A 4I92A 4FKPA 4M66A 4GG5A 3AMYA 2XVDA 5GINE 5BX0A 2X4ZA 3VUHA 3FPMA 2QHNA 5EM5A 2CSNA 4I21A 1G8SA 5IQGA 2HXLA 2PMLX 2ITUA 3BYOA 4PX6A 2PUIA 2WELA 4F9WA 4E73A 5BVFA 2OJ9A 1T45A 4BZOA 4OBQA 2OXXA 4GSBA 4MNFA 4I4EA 4RIXA 2XNOA 2QLQA 3F2NA 3BIZA 4FV2A 4BDBA 3MPMA 5BVDA 4YJNA 3P86A 4P5QA 2P55A 4XOZA 3KRWA 3T3UA 3HGKA 2JIIA 5D1JA 4AFJA 3LFFA 2XK9A 4B4LA 4DITA 4U42A 3S00A 3FZSA 3DB8A 4XG2A 4GFGA 4QD6A 4AT3A 5L6PA 3POOA 3BGPA 2PVNA 3GFWA 2QR8A 4YJVA 3FQHA 3OBJA 1Q99A 5E8XA 1ZMVA 2JDVA 3DPKA 4GFMA 2JKOA 4NEUA 5HX8A 4L42A 2R3MA 4D0XA 5T68A 4I24A 3KXZA 4C0TA 3TNIA 4EQUA 5L3AA 4E26A 4YSMA 5CF8A 1SVGA 2PMNX 5JFVA 4KD1A 3V01A 1UU3A 3A7GA 4BHNA 5FLFA 4YMJA 5L2WA 3TG1A 5DYJA 3BHVA 3HV6A 3KA0A 2X8IA 1Q3DA 2UVYA 4FKIA 3WBLA 4MTAA 4O0RA 4HGLA 4BC6A 5AJQA 2B7AA 4FKLA 4TKSA 4M67A 3FY2A 3I7CA 3DJ5A 5EI2A 3HUCA 4C4EA 5FM2A 4M0ZA 3D4QA 5CSVA 4PRJA 3LFCA 3W55A 4WA9A 1ZOEA 4G5PA 2R0UA 3NDMA 3ENMA 4RVKA 2EU9A 3UE4A 4LFIA 3R8MA 4J1RA 2A4LA 3UVQA 3V04A 4I5PA 3W16A 5IQCA 4LUDA 2JD5A 2PWLA 4BKYA 4U80A 3AD6A 5FDXA 4HVIA 4EOMA 4HVGA 5TT7A 3KU2A 1F0QA 4BDGA 4DFYA 3WF9A 3V5JA 3SLSA 4WG3A 3RVGA 4ITIA 3VIDA 4CTBA 2X7GA 3KC3A 3ZRLA 4EKLA 2HIWA 2B54A 4HYUA 2C6OA 4PL4A 1Q8UA 1ERKA 5D11A 2WTCA 5T3QA 1H1PA 4IZ5A 2LAVA 4IBMA 4AW2A 5B2MA 5EK7A 4EOJA 2JDOA 4ZZMA 2YDJA 5KBQA 2C1AA 2R7IA 3Q9XA 5LVOA 4NL0A 4RIWB 5FM3A 5AAGA 4FUXA 2J5EA 5JFWA 4FZDB 4IWOA 2OLCA 5DMZA 4P5ZA 2ETKA 3GFEA 2IVTA 4BTFA 1VEBA 4CNHA 3AT4A 4PDPA 3GCPA 4Y5QA 2A1AB 4IX6A 2VWVA 3ALNA 1SVHA 4TYGA 4O0WA 2CHLA 3DTCA 3E87A 3NW7A 5ETCA 2VX3A 3JS2A 5J9ZA 3KGAA 3GU6A 3VS5A 3VF8A 4CVAA 5HCXA 2CKQA 3I1AA 4AAAA 2VTPA 3E92A 4YJQA 3RI1A 4MK0A 2G2IA 4DE4A 4G17A 3QKMA 5H9BA 2WQBA 2IW6A 3PIXA 3KCKA 1ZAOA 3MVJA 3S1HA 4CTCA 1XKKA 3S0OA 3EKNA 5HX6A 4Y5HA 2SRCA 4Q5HA 2B4SB 2X7FA 3FDNA 1URCA 2YLFA 3RPYA 2GTMA 3VO3A 3OP5A 2XYUA 4FKWA 4WNMA 4DGGA 2R7BA 1IEPA 3BV3A 2UW0A 5IA1A 3C50A 4U81A 2W7XA 2PU8A 2W5HA 5F4NA 1OGUA 2HAKA 3DDPA 1YOJA 2ITYA 1XH4A 5DA3A 4DGLC 4JDHA 3A7IA 5C03A 3T9TA 4DEDA 2PY3A 2QO9A 3LQ3A 2C0OA 4N57A 3CKWA 4YLLA 4KAOA 4A9TA 3U6JA 2ZB0A 2DYLA 2OU7A 3ELJA 3VUMA 5HBJA 3TV4A 2VGPA 3PXKA 4X2JA 4IACA 4RA4A 4NH1A 2GFSA 4KIPA 5IQBA 1H0WA 2C6DA 2IG7A 2C6LA 4UBAA 2PYWA 3NYNA 1KV1A 3R01A 5FTOA 4QRCA 1IA9A 1P2AA 4Z55A 4ZLZA 4QNYA 3BBTB 3GP0A 4F6SA 3RHKA 4AZEA 4RFZA 1H26A 4TTHB 1GZOA 3C4EA 5E8VA 4F65A 3MJ2A 1RDQE 2GSFA 3E64A 3MYGA 4NK9A 2VO7A 3LCSA 3WE4A 3WF5A 2Q83A 3UOJA 5KCVA 4FSTA 3BYSA 2F2UA 4II5A 4LYNA 3VW8A 4I0TA 2IJMA 3R83A 3FMNA 5K9IA 3F3ZA 3I5NA 4RX8A 3ANRA 5IISA 3EQHA 3M42A 4MVFA 5D10A 4AU8A 4HVHA 3PJ1A 2OXDA 3OS3A 4H3QA 5I9UA 2W4JA 5E8TA 2JIVA 2JAMA 4NJDA 2UZLA 2VNWA 3UTOA 3NCZA 4IX5A 5ETAA 5TE0A 2C5OA 2G9XA 4MBJA 4C61A 5BUEA 2Y6OA 5M4CA 2YFXA 2OG8A 3OW3A 3VUDA 4ALWA 5KHXA 1YDTE 3ZCLA 5LVPA 3F2RA 2CPKE 1DI9A 2A27A 4WSQA 2X2KA 5JGAA 4G6OA 2W4OA 4DTKA 3A62A 5F94A 2A19B 3KFAA 2R3NA 2PVMA 4FKQA 4PMSA 5AR4A 5G1XA 3FHRA 3VUGA 3UNKA 1IG1A 4H1JA 4IWPA 4Q2AA 5DH3A 4BI0A 3R8VA 3BV2A 4A9RA 5FRIA 4AOTA 2YCFA 1PYXA 4XHKB 3SVVA 2OJIA 3QAME 4N6ZA 1XBAA 3VS3A 5D7VA 1G3NA 5JMSA 4GVAA 5GJFA 4GRBA 5HNIX 5KO1A 4PMTA 2CDZA 2QNJA 2UZOA 1QPCA 4EH6A 5AX3A 2C3IB 4I1ZA 2BVAA 2WMQA 3GOPA 4HZRA 3KXNA 3UOLA 4U5JA 3EQRA 3UC4A 5IA2A 3D94A 3LFBA 5I5ZA 4D28A 2PL0A 4EHEA 5ANJA 3W10A 3BI6A 4I5MA 2ERZE 4V0GB 4YO6A 4BICA 3SDJA 4C3PA 3OD6X 3MBLA 2R5TA 1NT2A 3UNZA 5DEYA 2EWAA 3GVUA 5C26A 4FTAA 4GW8A 1YVJA 3ZFYA 3DBQA 3E62A 5IA4A 1SNXA 3R71A 4AP7A 3QF9A 2ZB1A 1IRKA 2J0LA 1FVTA 4P4CA 3W18A 2JGZA 4OTWA 5LVLA 4ZSEA 5B2LA 2XRWA 5AUWA 4ACGA 3JY9A 3UQGA 4GFOA 4E4NA 1ATPE 2WMTA 3IECA 4HNIA 1OKYA 3R22A 1UNLA 1W98A 4FA2A 1DM2A 4AZWA 4KBCA 3TM0A 4IAYA 2WEVA 4RA5A 3CTHA 4ERKA 2C5XA 5HORA 1J91A 1YXXA 3R1NA 2UV2A 4QMPA 3QRIA 3H4JA 3VBXA 1W7HA 4O2ZA 3QX2A 2PK9A 3F7ZA 1YW2A 2CMWA 4TYEA 4I6QA 3ZSGA 4MF0A 2FVDA 3UDBA 2QODA 4GYGA 2R3FA 4I6HA 3R63A 3FUPA 4UWYA 5CEMA 4FTLA 3NNWA 4AA5A 4EH2A 4WNOA 4DBNA 3C7QA 5M56A 3B2WA 5BVOA 4FKUA 4EZ5A 4AOJA 2JDTA 3EL7A 3DJ6A 3E63A 4RWKA 4CMTA 2VTMA 1P4OA 4FYOA 2ACXA 3IONA 4YJPA 1NW1A 5K4JA 3TDWA 1CSNA 3PVUA 1SVEA 4RQVA 3L9PA 5ANDA 3F3VA 2ZM3A 3PVBA 4KWPA 4DFNA 5DE2A 2J0KA 4BCMA 3EHAA 3P1AA 4NCTC 4X3FA 1UKHA 2BKZA 4AGWA 1O6LA 3OEFX 2XIZA 4G34A 3TJDA 4CLIA 1IR3A 3IDBA 4OTQA 5ICPA 1F5QA 1YRPA 3KK8A 4HCTA 1WAKA 3EQCA 5I9VA 3RPOA 3R04A 3WZEA 4ALVA 3L8VA 5L8LA 4I0SA 3NEWA 1V0PA 4KSQA 2J90A 5IA0A 2BAKA 5IUIA 4E4MA 3A8XA 4AS0A 2ETMA 2W1HA 3OHTA 3PXZA 4IVDA 5HCYA 3ZRKA 4EL9A 1YHSA 2J2IB 3QA8A 3TL8A 3QLFA 5L8KA 5JGBA 3NYVA 2JFLA 4QQTA 4I6FA 3JUHA 3HVCA 4FZ7A 4YTCA 2V55A 4HJOA 2AUHA 4IX3A 2JEDA 3P0MA 4RC4A 1JKKA 3DXPA 2I6LA 2PZYA 3R1YA 4UALA 4UWCA 4AN2A 1JAMA 3R28A 3KRJA 4G3CA 5CVHA 2ZMCA 2XUUA 5ANEA 3R7YA 1X8BA 2J0JA 4XV2A 5A4EA 3G2FA 2H9VA 3ORLA 3WYYA 1R0PA 1DS5A 4CCUA 4D2RA 4U97A 4Z9LA 2OZAA 2GU8A 3JY0A 3UIBA 2O8YA 4WKQA 5ACBC 2DQ7X 4BDDA 3FAAA 1BUHA 3PVWA 4CFVA 1TQPA 3LFDA 3EQFA 3MH3A 4M15A 3UODA 5IEXA 5L6OA 4XP2A 5DIAA 5HE0A 2HZNA 3K54A 2X0GA 3OOGA 4FVPA 4MCVA 2C47A 3COMA 4FT3A 5ETIA 2V22A 1Q8YA 5CEOA 4BDIA 1YQJA 3GBZA 4OAUC 5E9EA 4EI4A 4IAFA 4P90A 2QU6A 3FKOA 2PZ5A 1NVRA 3PG1A 5KKRB 2CN8A 5FGKA 4GK4A 4I94A 1ZMWA 3Q4UA 3QD4A 4AUAA 3DA6A 4QP9A 1YI4A 4RWIA 3CJGA 4BVUA 4YTIA 2BAQA 5EOLA 2O0UA 4L43A 5E91A 2VTQA 3AMBA 4KSPA 3BLRA 5CF5A 2XS0A 2FYSA 2QD9A 4CXAA 1BYGA 2AC3A 4WD5A 5HE2A 5EHOA 4KS7A 4K9YA 3NNVA 3ODZX 3SQQA 4KIOA 4DF3A 4FTUA 3D15A 4B99A 2GHGA 5KMMA 4HGSA 1W82A 4TL0A 5GZ8A 4O7NA 3CPBA 3I60A 3BLQA 2ITXA 3FLNC 4LRJA 4QPSA 3ET7A 5AR2A 4BI1A 2QONA 1ZYLA 1OIYA 2CN5A 2JAVA 3LLTA 4Y85A 4TYHB 4A06A 3LXKA 3MIAA 5EKNA 3EN5A 4USEA 3FMDA 3A4OX 3QBNA 3F88A 3MFSA 5HG8A 4JR3A 3N4VA 2WMUA 3DOGA 4JG7A 4W4YA 3U9CA 5KE0A 1KOBA 1ZYDA 4BRXA 1KOAA 5IH4A 4G31A 1NVQA 5FQDC 3MV5A 5BYZA 2ZOQA 1PXOA 1WZYA 2O2UA 3THBA 5K4IA 2XK6A 3MY5A 4HYSA 4XG8A 4L68A 3PPKA 2BRNA 5CT7A 3WZJA 4CYJA 2O65A 3GXLA 5F1ZA 4BZNA 4E4LA 4BCNA 4FTIA 4EYMA 3R9HA 3DLSA 2CNUA 2UZDA 2FH9A 3IW5A 3ERKA 3DAKA 4YJSA 4O38A 2QOFA 3K3JA 3Q2MA 2C3KA 3ORPA 4H58A 4I4FA 4MX9A 4O7TA 4PTCA 3OFMA 4BN1A 3AGMA 3CIKA 3COHA 4QO9A 5FP5A 5M55A 2FO0A 4RIYA 4E7WA 4NM3A 3VJOA 2CKPA 4YBJA 5DEWA 5EKOA 4U8ZA 3C13A 4EOLA 4TYJA 3WF7A 4AF3A 4ZEGA 4O7VA 5EQPA 3OUNB 2XH5A 3O96A 5AP3A 3WIGA 3QX4A 3D5XA 2Z7RA 3NPCA 3PXRA 1WBWA 4O27B 4YU2A 1Y6BA 2ITNA 1LPUA 1XBBA 4JX3A 2FSTX 2ZDTA 3HMOA 3AGLA 4E3CA 4BDAA 5M4UA 3R8LA 4J8MA 5D41A 5AR7A 3BGQA 4ZY6A 2UZNA 1RE8A 3C4CA 3H0ZA 4CGAA 4B7TA 4RVTA 3QTQA 3AMAA 3VUTA 3NUNA 4QQ5A 4F70A 3BQCA 4I5CA 4W4WA 5CLPA 4ZP5A 2OK1A 1WBSA 4QNAA 3F82A 4YSJA 4GKHA 4YC3A 2XNEA 3PLAE 3VBWA 3OC1A 2JKQA 1QPEA 2BFYA 2UW4A 3H9FA 1Y8GA 5FXRA 5A6OA 4Z7GA 4E6AA 5CXHA 3O17A 5IA5A 4EBVA 2CNVA 4HPUE 1GIJA 2XIYA 2ZYBA 5E8UA 2X9FA 4A4OA 5CSXA 3JYAA 2XIKA 4A07A 2E9PA 4APPA 5CEIA 1UWHA 3ZZEA 3PP1A 3WE8A 3GC9A 1PY5A 4ASEA 3LMGA 2YM7A 2ITOA 3G6HA 4N6YA 1Q8WA 2WMVA 2OH0E 3MB7A 3OW4A 4J95A 2R3KA 3TI1A 2X9EA 4JBQA 3GU4A 4NIFA 5A9UA 1K9AA 2RFSA 2P33A 3ZS5A 4FV1A 5EHYA 4BGGA 3ZLSA 4EH5A 3V5QA 5CEKA 4FIIA 2WHBA 5HHWA 3MSSA 1Y8YA 3BHTA 4C35A 2EXCX 2WNTA 4MD7E 5K0KA 3OT8A 5HICA 1RQQA 2W17A 4KBKA 3W8LA 5KMOA 5M07A 3P78A 3C0IA 1OUYA 1HCKA 4OTDA 3FKNA 2GFCA 2A2AA 2VN9A 5J9LA 4L8MA 2X4FA 4MXOA 2PE1A 1FVRA 2REIA 1WVYA 1YXUA 3P9JA 5DT4A 4BI2A 3UJGA 4DYMA 3QTRA 2EUFB 3F66A 2O63A 1CTPE 4LI5A 3IW6A 5CEQA 4FEQA 5CVGA 4BTMA 3VBVA 3VS7A 3B8QA 4QYGA 3JXWA 3FI4A 4M7IA 4OUCA 5DG5A 4B8LA 1F3MC 5L8JA 2YAKA 3NR9A 1KUTA 3PSCA 3PSDA 3O0GA 2J51A 3BWFA 1BMKA 4H1MA 5D7AA 4F99A 2BTSA 2VV9A 2BILB 3FLWA 3ZEWA 1YHWA 2WAJA 5IQHA 2OICA 3WZDA 4BDFA 5J95A 4V04A 2X2MA 4TZRA 2HCKA 5L6WL 3UC3A 3MI9A 5EQYA 3PZHA 2G15A 2J5FA 4XLVA 2ONLA 5EFQA 3UIMA 4ANBA 4D58A 3RHXA 5JK3A 3FBVA 1OIUA 1OIRA 2FB8A 4DFXE 1PMUA 4OTFA 5J9YA 2KTYA 1Q62A 2C4GA 4Q5EA 2FSLX 3WF8A 1LEZA 2EVAA 3LPBA 1TQMA 2Q0BA 2Z2WA 3MPAA 5LXMA 3U9NA 1JOWB 4A9YA 2R4BA 4BTJA 3A7HA 3AT2A 3FMJA 4V05A 4ZIMA 5LWMA 4R78A 4IAZA 3UO4A 4AW5A 4E20A 4QMZA 1YXSA 3BLHA 3C5UA 5KMKA 3QCYA 4TNDA 2OI4X 4FV5A 4AOIA 5K5NA 3MFTA 3MN3A 3HRCA 4F0FA 2WMRA 4FKJA 5AMNA 4U45A 2FSOX 3OMVA 2JKKA 3F7WA 5AR5A 4QTEA 4IFCA 1PHKA 4XS2A 5LMBA 4O21A 3DKGA 3F9NA 3UOHA 4GS6A 4WBBB 3DBDA 3I0QA 4TPTA 4U41A 3SX9A 5AV0A 4K77A 5CNNA 4ANNA 5LQFA 4ZY4A 1UU8A 1OZ1A 5AX9A 4PP9A 4NKAA 4O0YA 5CZHA 2BZKB 4NIFB 5AIKA 3ZRMA 5G6VA 4MHAA 4YZMA 1KE8A 3R8UA 2HENA 3E88A 3HA8A 4DEIA 3R9NA 3MH0A 4RQKA 3R8PA 3ACKA 4PF4A 5LCKA 1REKA 5CY3A 5HU9A 3EQDA 3OWJA 2RL5A 1UV5A 3NW6A 4JAIA 5FXSA 3RKBA 5IQFA 4JJRA 4FIGA 1ZY4A 5J1WA 5J79A 2WTDA 4M69A 3R30A 2XM8A 4GV1A 2XNMA 3V8TA 4D2SA 1HOWA 2VTRA 3DZQA 2BR1A 1APME 4JR7A 3VHEA 4DAWA 2ERKA 3D2IA 3O8PA 5AAFA 3FZPA 2BZIB 2XIRA 2F7EE 4DINA 4NTSA 4F7SA 4EORA 3O8TA 4IZ7A 4C58A 2QC6A 4DTBA 2JDRA 3UG1A 4UX9A 4KKGA 2GTNA 3IDPA 1UKIA 4AWIA 4D4YA 4DH3A 4M12A 2VTSA 3VUKA 2XM9A 1MRYA 3RK5A 4IADA 1S9JA 3HP2A 3HV7A 4AN9A 5C4KA 3TZ9A 3KB7A 5CQUA 2Y4IB 3FMKA 3W1FA 1ZYSA 2VD5A 4D2PA 3LMHA 2OW3A 2YIXA 4J52A 3V5WA 4EONA 4EUUA 5CNOA 4IM3A 3HECA 3OBGA 3N9XA 3H0YA 2OF2A 3ZONA 3REPA 3OCTA 2JBPA 3PFQA 1O6KA 3QRTA 1HCLA 5C8NA 2R3OA 4WRGA 3WI6A 5J1VA 3P08A 3HRBA 2B52A 2VU3A 3QLGA 2QOHA 3ITZA 2H6DA 4FG7A 3FL4A 4JT3A 4C7TA 4RJ7A 2Y8OA 4EWHA 4NUSA 4WUNA 3VAPA 1AQ1A 2J50A 2NNWB 3U55A 5CENA 3W8QA 4K0YA 2BZJA 2GCDA 4J53A 5CU3A 4FV3A 1ZZ2A 4S32A 4CZYB 4NM5A 4J8NA 5IUGA 4QMQA 5CAVA 4C2VA 4Y95A 5AV1A 3QD2B 4CV8A 4QP3A 4GKIA 3ZO2A 5K3YA 3UVPA 1XWSA 3R1SA 4IMYA 3BX5A 2F7ZE 1VJYA 2ZM4A 3KY2A 1OPKA 3F6XA 2BALA 3H9OA 3MVMA 5T6KA 4B9DA 1JNKA 3TXOA 4FE2A 4FTNA 1TKIA 2GQGA 5I3RA 1U5RA 3R9OA 2RG5A 4U43A 1P5EA 5HO7A 1NVSA 2QOLA 3QTWA 1OMWA 2X7OA 2VUWA 2VTTA 2VWBA 4I3ZA 3ALOA 5JRSA 3CGFA 4FNXA 4RPVA 4TN6A 5IG1A 3U6IA 3KF4A 4LQMA 3OCSA 3ZTXA 4HZSA 3IS5A 4FTCA 2UW7A 4GT4A 2ZV9A 3OROA 4PDSA 4WUAA 4M97A 2ZV7A 3BHHA 3KRLA 3BCEA 3L1SA 3PA5A 4QMLA 3QGWA 1YOMA 5ITAA 2PE2A 3MY1A 4IDTA 3MTFA 2GS2A 4FIEA 4MXZA 4BCKA 3BBWA 3UBDA 4BYJA 3ZHPC 4FSMA 3FMMA 2R9SA 2JC6A 1M7QA 3I7BA 4FSWA 2PVJA 3AC5A 3B2TA 4K33A 3DXQA 4J7BA 4M69B 2HXQA 2YISA 4R7HA 2YABA 1YHVA 2UZUE 3AC1A 3ZO1A 3TN8A 4MWIA 4FSUA 4U79A 2VGOA 2W05A 3GCVA 5DRDA 3R7OA 3RPSA 3KVXA 4XV1A 1IAJA 3OEZA 3NAXA 5EW3A 3BU3A 3FLYA 3P7BA 4C3FA 4O2PA 4DG0E 3EOCA 3ZC6A 3V6RA 4FZ6A 5J5TA 1Y91A 3ATTA 2CGWA 4BWPA 1PXLA 4GCJA 2XEZA 1NY3A 1GZKA 2XBAA 3MW1A 4QPMA 5AV3A 4JI9A 4K11A 4F1TA 5DI1A 3EFKA 3NUPA 4QMYA 4OAVB 4O83A 4GT3A 3I81A 4O1PA 1YOLA 1M7NA 3VC4A 1UVRA 2XJ2A 2XNNA 3Q53A 2WMAA 4CYIA 1J1CA 2PE0A 3VBQA 4AGUA 4CKRA 4FGBA 2PZIA 4WG5A 2ETRA 5IKWA 2R3JA 4BKZA 3IK3A 4M68A 2X81A 4CFXA 1PXPA 5HESA 2QHMA 1PRYA 4A9SA 4OTRA 2UW6A 2VAGA 4PDOA 1I44A 4RIXB 2PUNA 5JZNA 4LMUA 4O0VA 1YWVA 3W2RA 1PMVA 4RJ8A 3Q4CA 5AP4A 3RNYA 4JRNA 4ZMFA 1H08A 4N0SA 2C5YA 5HE1A 5HU3A 2B9HA 3LXNA 3OTVA 3NUYA 4QTAA 2VTAA 5HBEA 2CLXA 4C2WA 3GI3A 3UPXA 1UA2A 3T3VA 4FGRA 5CXZA 2BTRA 4KIKA 4H36A 3ZLXA 3EN4A 3ZUTA 3WZKA 4FEWA 2YAAA 3A99A 4AX8A 4DC2A 3DQWA 3ETAA 3QQLA 5AUYA 3KVWA 4O0UA 2ZAZA 4HW7A 2RFDA 4Z3VA 1ZYJA 3LXPA 4YLKA 1W84A 4FG8A 3V6SA 4JAJA 4DH1A 2YITA 3TZ8A 5AUUA 5IH6A 5J5SA 1Y6AA 4DCAA 2WO6A 4YO4A 1OUKA 4FX3A 4GK3A 5A4CA 4RRVA 4MXAA 5HVYA 4F9BA 5IZFA 2X6EA 5KZ0A 3U4UA 4PNKA 5DLSA 2UW5A 3LJ0A 3OY1A 4BDKA 4BCQA 4FTRA 2YM4A 4PTEA 3UP7A 3FPQA 1P4FA 3RBWA 1OPLA 3G6GA 4DTAA 1KSWA 3EB0A 5EM8A 5H3QA 5EOBA 3SA0A 2B0QA 3POZA 3FMLA 3RWQA 4F08A 4LGHA 4ACDA 1GIHA 4RLLA 3A8WA 3IGGA 1FQ1B 4AZFA 4BIDA 2XBJA 1Q3WA 3F5XA 4Q9SA 4YZ9A 4BBMA 4D2VA 5C4LA 1JKLA 1BL6A 3KULA 4LOOA 4QQCA 4JBVA 4OTPA 2F9GA 4USFA 3QTUA 3NUSA 1QCFA 4G9RA 1UNHA 4YGAA 2BKKA 2ZVAA 3SW7A 4FL1A 4XUFA 5JH6A 3EL8A 3DCVA 4WNPA 3TACA 2HW7A 3R9DA 4XJ0A 4K1BA 3RCDA 4TT7A 3O50A 3OXIA 3QU0A 3QL8A 3TTJA 4PTGA 2WMXA 1SM2A 3R2YA 1XH9A 4Y83A 1JWHA 3U8WA 4AW1A 1SZMA 1R1WA 4FTOA 2QOCA 3ZBXA 1OKVA 1PXNA 5EW8A 2G2FA 2XKCA 3RAKA 3SOAA 3L8PA 2J6MA 4MKCA 3AXWA 3KREA 4EQMA 3GU5A 4BCHA 4LRMA 2W1DA 4U7ZA 3W2CA 4F1OA 4F4PA 2IVVA 3L9MA 2BAJA 3QUPA 4FSYA 1O6YA 4RIOA 2VTNA 4MYGA 2V7OA 4BFMA 5H8EA 4JQEA 5FEEA 2WIHA 5A6NA 2R3LA 3NRMA 4BIBA 3LLAA 5TF9A 3U6HA 5CI7A 3FXZA 4PQNA 4W9WA 3SG9A 3HV3A 2XK8A 3DZOA 4AN3A 2OXYA 2YIWA 4F64A 4PV0A 4P2KA 2G01A 3HUBA 2BDWA 3D5UA 3NSZA 2CLQA 5DGZA 3BE2A 1B39A 4WBOA 1H24A 5AR8A 4O91A 5H2UA 2X6DA 4R3PA 4YR8A 1CKPA 3M2WA 4FC0A 4IZYA 4UEUA 2WD1A 2F2CB 4OGRA 3TZ7A 4FF8A 2UW9A 5IH5A 3TZMA 4LGGA 3EYHA 1WBTA 2I0YA 4NCTA 2UW3A 3F69A 3SXFA 1FPUA 2WIPA 2GNGA 3OWPA 5J7HA 4NFNA 5KMJA 4EOOA 5EQEA 4QMVA 4UMQA 2JDSA 4FI1A 5ANIA 2Y6MA 3FXWA 4KA3A 4RT7A 5E8ZA 3ZLWA 4AZSA 5M4IA 5EW9A 2B55A 3ZSHA 1A48A 1Z5MA 4L9IA 2OFVA 4RJ6A 4AGDA 4CZTA 3VBTA 2WTWA 2ZM1A 2VTHA 4ZAUA 3AC4A 4CG9A 2NRYA 4RWJA 5HBHA 4NM0A 4TXCA 5E90A 5E4HA 2I0EA 3O71A 3LJ2A 4XP3A 5EH0A 4HYHA 2OFUA 4IHPA 3DB6A 4U0IA 3TIZA 1M52A 4S31A 4FL2A 4FOCA 1Q97A 5AUTA 3CTJA 4BDCA 3FE3A 4XBRA 2GNLA 4EOSA 3ZYAA 4YPDA 1KE6A 1M17A 4FTJA 4R5SA 4DGMA 2X8EA 3QXOA 2DWBA 3VS6A 1WFCA 5AP2A 3HNGA 3OY3A 3HKOA 2I40A 2JFMA 2R3IA 4X2KA 3RK9A 1E9HA 4FNYA 4FSRA 3V5LA 3NNXA 5F9EA 3NX8A 3CQUA 3EQIA 2R64A 3V8WA 1H0VA 3VQHA 4CRLA 4BDEA 2RIOA 4EYJA 3B8RA 4EHGA 5HVKA 1OBDA 1JLUE 4FIJA 5FP6A 2RFEA 4HYIA 1OKWA 1LR4A 1ZY5A 3LE6A 4JIKA 2C68A 2WOUA 1WMKA 5FTGA 1YDRE 4ZTNA 4Z7HA 4JQ8A 2P3GX 4IJ9A 4IB0A 3P79A 2W1ZA 4DHFA 2DUVA 3ZBFA 4BCOA 4D4VA 5M51A 3FHIA 2WTKB 1GIIA 4MXCA 3VN9A 4UXQA 4FEXA 5JFSA 3AC2A 3BE9A 1FOTA 3I79A 4GG7A 3MJ1A 1M2QA 4ARKA 3OXTA 4JNWA 2YZAA 3EN7A 2C3JA 1PXKA 3CD3A 1UNGA 3KMUA 4ZTRA 5A4QA 4FOBA 5LMKC 5J7BA 4Y73A 3SXRA 4S30A 4ALUA 4JQ7A 3DBEA 4BIEA 4C8BA 3MVLA 3LOKA 3C4XA 5HO6A 4ACCA 1VZOA 4C02A 3FZTA 4D1SA 1M14A 4ZZNA 5BYLA 3S4QA 4U3YA 3TNPC 2QO7A 2F57A 1TQIA 2GPHA 2ITTA 4I5HA 2IVSA 3DQXA 5CI6A 4W8EA 4YTHA 3KCFA 3F2AA 4JDJA 3FEGA 1PMEA 2CGVA 2BUJA 3ZH8A 4S2ZA 4FUYA 4QMMA 3R8ZA 1H28A 4ZTMA 3ZM4A 3G15A 1EH4A 2YM5A 4CQGA 3U51A 3TJCA 4M14A 5DNRA 4XG7A 3AG9A 1WVWA 2V0DA 4WSYA 5CASA 4CLJA 4LV5A 1FBNA 3QTZA 4ZLYA 1Q8TA 1Y57A 3HLLA 3VHKA 3V3VA 3G51A 5M09A 3RALA 3PUPA 3PRFA 4IEBA 5HE3A 4CT2A 3DK6A 3IO7A 2YHVA 4FKRA 1ZRZA 3I6UA 2CKEA 3QRJA 4GYIA 4RJ4A 4OTIA 2X1NA 3IPHA 2UW8A 2CJMA 4C62A 2QOOA 1ZXEA 3NYOA 3QHWA 4PL3A 4UXLA 5E8SA 4AXAA 4CKIA 2QKRA 3P23A 3MFRA 4K8AA 5LWNA 3ORMA 4BDHA 3LMIA 4DT8A 4FBXA 4FK6A 1MQBA 4IVAA 4ZS0A 4EZ3A 5FWKK 2XF0A 3VS4A 2C30A 3MDYA 4U40A 3E3BX 1JPAA 2G2HA 3QKKA 4I41A 4FTTA 2YZLA 3PY1A 4KIQA 2FGIA 3R73A 4EEVA 5AAEA 5JSMA 5A4LA 2WTIA 5BPYA 4X3FB 4FSZA 4IWDA 2QCSA 3E7VA 3E8EA 3P4KA 4X2GA 3TNHA 1RW8A 4DG2E 4F9YA 1U5QA 3E8NA 2DS1A 4WIHA 4JG6A 1QL6A 1H4LA 3FWQA 5DT0A 4ASDA 3EQPA 2XNPA 3EN9A 4UWBA 5AIRA 3QA0A 2Q0NA 5DWRA 1KV2A 4ZXTA 2QKWB 2IZUA 5E1SA 1LP4A 3F61A 3LHJA 5BMSA 4G3GA 4O82A 3LJ1A 3H10A 4L7FA 2OIDA 5EYDA 3ZLYA 4QMWA 3AC8A 3GEQA 3QTIA 3N4UA 2XCHA 2VWIA 4LL5A 3LFAA 3Q9ZA 4KABA 2W4KA 4BCPA 3IG7A 5FG8A 1I09A 4FV9A 2QU5A 5A54A 2RSVA 5IEYA 3QTSA 2BPMA 2XMYA 1LEWA 5HLNA 2QR7A 4QMOA 4X3JA 3IOPA 2QQ7A 3BQRA 2W1GA 3PVGA 4HNFA 5HD4A 4EK5A 1XH8A 5FEQA 4GIHA 1KE9A 1OIQA 2C3LA 4IW0A 4IFGA 4XNEA 3RM7A 3BYUA 2OZAB 4D0WA 4OR5A 2WQMA 1PJKA 3D7TA 5KHWA 1PW2A 4KS8A 4LL0A 3CQEA 5JKGA 1Q41A 4BCJA 3F5GA 4BWXA 2ITQA 2WB8A 3SRVA 2CGUA 3T8OA 4JDIA 2UZEA 2Y9QA 1J7IA 4FV6A 5CU2A 3N4TA 4H39A 3KL8A 5AP1A 2YIRA 4JBPA 4RJ5A 4YUQA 1G8AA 4IWQA 2NRUA 3QUEA 3NCGA 4WG4A 4UMPA 3K5UA 4F0GA 2WQNA 1KE7A 3PTGA 4RLKA 3V5PA 3UYSA 5JRQA 4ZS4A 1H00A 5CU6A 4ZMEA 4OBOA 5TO8A 4OTHA 1REJA 1U4DA 2ITZA 5EI6A 4XG3A 4BZDA 2FUMA 5HIDA 3UGCA 2VO6A 2YJRA 1KE5A 5FUTA 1OI9A 5B2KA 4L3PA 4BB4A 4AFEA 4EZ7A 4O7RA 1R78A 2HZ0A 2YJSA 3D14A 3DKFA 5B7VA 4I6BA 3RCJA 4X0MA 5DT3A 4FZFB 3I4BA 5EM6A 2HYYA 2IW8A 3UO6A 5TKDA 4RJ3A 3Q4ZA 3AC3A 4G5JA 4LV8A 5LVMA 1B38A 3KQ7A 4YHJA 5KUPA 1OVEA 1FGKA 2GDOA 3R0TA 4CG8A 2XYNA 5ETFA 2R3PA 4M84A 4WOVA 1YKRA 1BKXA 2O64A 2PZRA 2Z60A 3ORKA 4M3QA 5AM6A 4D9UA 2GMXA 4E5WA 1ZWSA 2WMSA 3EKKA 3QC4A 1OM1A 3BEAA 4GT5A 4RVLA 5EDPA 5A46A 1YI3A 3PPJA 4F6UA 2HOGA 4MBIA 1IAHA 3ORTA 2IW9A 4HOKA 3HV4A 3DXNA 4DFZE 2Z02A 2YDKA 4QTCA 5GZAA 4L44A 2BZHB 5IUHA 4O1OA 4BHZA 4OT5A 2YIQA 5BVEA 3VS1A 4YZCA 4CZUA 4QYEA 5LCJA 3NZ0A 4YNOA 3NVKI 3QZIA 4QP6A 4PUZA 2YEXA 4CD0A 3BYVA 3UIXA 3TT0A 3OT3A 3W2SA 4DH5A 4FV0A 1Q24A 2J4ZA 4AW0A 2XP2A 4RX5A 3G33A 1BI8A 2NO3A 3S2PA 3PJ3A 3G0EA 4RIYB 4F1MA 3DFAA 2ITVA 3PIYA 3UYTA 2FA2A 2VWUA 5CT0A 4O7YA 4XRJA 4E8AA 3D5VA 5A3XA 4CFFA 4DFLA 4CMOA 4ASXA 5C01A 2WMWA 5L2SA 4YP8A 3WZUA 3R00A 2JBOA 3GQIA 1QPDA 4DH7A 4L52A 3E5AA 3QQFA 1U54A 4FKSA 3QTXA 4QMSA 3VQUA 3SG8A 3DU8A 3HX4A 2H8HA 3L9NA 3QHRA 4IVCA 4A4LA 2WXVA 4FT0A 4U6RA 5AUXA 2YCRA 2GHMA 3CC6A 4F7NA 4L00A 1S9IA 2UZBA 3FLSA 4LRKA 4M8TA 5AWMA 3FL5A 1OITA 4ZK5A 3ZZWA 3D7TB 3ZOSA 1XHAA 3I0OA 5ANKA 5FD2A 5J87A 5E92A 4B8MA 3GCUA 1UU7A 1ZOHA 2OIBA 3ENHA 1BLXA 5HCZA 1WBNA 4AZVA 2HZ4A 4RFMA 4DEHA 5M44A 5AP5A 2I0HA 3MB6A 4GU9A 3L8SA 1T46A 4ACMA 4RZWA 3ORZA 3ACJA 4NSTA 3QRUA 3R7UA 4APCA 3CBLA 2OSCA 4EHVA 1U59A 1UWJA 1VR2A 2W1FA 1V1KA 5AP6A 2WU6A 3MA6A 5CTPA 3E93A 3AD5A 4NU1A 2HWPA 3OF0A 5AEPA 4YNEA 2B53A 4F7JA 3AOXA 4D4RA 3HRFA 1NA7A 1YI6A 3IW7A 5CAPA 4CKJA 2PSQA 1PKGA 4WNKA 4E6QA 2XNGA 2XRUA 2C0TA 3CQWA 3KXHA 1FMOE 2BIKB 5KMIA 1CKIA 3FSFA 5EYMA 1OB3A 2Y4PA 1YXVA 3GC0A 4RBLA 3VS0A 3SKCA 4QMUA 3LCDA 4DCEA 1ZOGA 2XNBA 5CWZA 5HLWA 3OZ6A 2F7XE 4HVDA 4OTGA 3P7AA 2WZJA 3PDTA 5JGDA 4D9TA 4IAKA 3NUXA 3BU6A 3UQCA 2BRGA 1XH5A 3LIJA 1PMNA 4X6RA 3COKA 3CXWA 4FNWA 5DN3A 3VW6A 3CTQA 3OXZA 4FT7A 4FIFA 3TV7A 4CV9A 4C34A 3CGOA 4D4SA 4M0YA 2I7QA 2H96A 4PNIA 5JEBA 1AGWA 3R2BA 3VS2A 1PXIA 4MEDA 4QP8A 5HNGA 1UU9A 4ZSJA 1CMKE 3TWJA 2A0CX 1Q61A 3BRBA 5AP0A 3TUBA 4EOIA 2IN6A 2XKFA 3Q3BA 4OW8A 4CFNA 3JVSA 2PULA 1QPJA 3C4FA 4CSVA 4FV8A 1K2PA 4QTDA 4AQCA 4EC9A 3FI8A 3QUDA 3SW4A 4X2FA 4U3ZA 5DPVA 4YLJA 5LOHA 4PMPA 4BL1A 5I0BA 2W1IA 2ITPA 3S95A 3R9RA 3OCBA 4N4SA 1XH7A 3FQEA 4FZAB 4RIWA 4BDJA 3KXGA 3IW4A 5IQEA 3VULA 3NIEA 4EK3A 2C1BA 1OPJA 2R0IA 2XJ0A 5BVWA 1MRVA 3C1XA 5L2QA 4YTFA 3D83A 2OZOA 4IDVA 3QCQA 1TVOA 2W5BA 3Q96A 2OJFE 4QYFA 2PZPA 3HEGA 2IVUA 3RAHA 3E7OA 2XA4A 4Z16A 4EBWA 3K3IA 2PUUA 1SMHA 5HD7A 3DY7A 2C6TA 3BHYA 3WIKA 2J0IA 4JDKA 1PXJA 5L2TA 4GU6A 4FSQA 5C9CA 4C4HA 3ZEPA 2VNYA 1ZYCA 3FXXA 3DK7A 4YJUA 4LUEA 4V01A 2I1MA 4ZTQA 2J7TA 2UZWE 4YJRA 4ACHA 3VRYA 2YCQA 3UIUA 3C9WA 4QPAA 2IZRA 3R7EA 2YDIA 3ZO4A 1H01A 3TDVA 3HDNA 3COIA 4HGTA 3ROYA 3PA4A 5CSHA 3BU5A 1VYZA 2C69A 3UQFA 5KZIA 3LAUA 3NYXA 3C0GA 3HMNA 4XH6A 5HZNA 4KUJA 4HGEA 1FGIA 3RM6A 2W06A 2CCIA 3W32A 3BYMA 4DGOA 1ND4A 1YDSE 1WCCA 2Z8CA 4XLIA 2X8DA 2XK7A 3EH9A 3W2OA 3P7CA 1NXKA 5F20A 5BUJA 4DEBA 1GAGA 5EDRA 3H3CA 2W0JA 1BI7A 1XO2B 3KXXA 3SC1A 3VVHA 2PMOX 4K18A 3ORXA 4KKHA 3UNJA 3FI3A 1Q8ZA 2YWVA 1SNUA 2QOKA 2RFNA 3MH1A 4ZJIA 4EH9A 4E6CA 5K0XA 5KX8A 3VUIA 4RG0A 2EB2A 3RP9A 3A4PA 1W0XC 4IM2A 1SYKA 2IZTA 4U9AA 4O6LA 1K3AA 3KK9A 5FBOA 2E9OA 4XEYA 4BR3A 2X2LA 3Q5IA 1M2PA 3PLSA 4BBEA 2BFXA 1J7UA 3QQGA 3OVVA 1P14A 5HLPA 5CF6A 1FVVA 2HY81 3ANQA 1JSVA 4FG9A 5GIPE 2HWOA 4D1ZA 3LFEA 4J71A 2V7AA 3D0EA 4X7QA 1GOLA 1WVXA 3EZRA 3NIZA 4NJ3A 5BYYA 1BL7A 3HP5A 3ORNA 4TNBA 3UZPA 4O0TA 3M1SA 3DK3A 1OL5A 1XR1A 3Q04A 3O7LD 4YPSA 4IZAA 4E5BA 4UN0C 4G6NA 5KNJA 4H05A 4I20A 4IB1A 3HYHA 4MBLA 3PG3A 4NW5A 3RMFA 4IC7A 3ZUUA 2OJGA 4RZVA 4AA4A 2R3GA 4MF1A 3NAYA 4ANMA 2XIXA 4R7IA 3KN5A 4WRSA 4BCIA 4B6LA 5IF1A 3O7LB 4AT4A 4DN5A 4XX9A 4R77A 3O51A 3WF6A 4FKOA 1GJOA 1H25A 3QWJA 5I9WA 3TIYA 4QOXA 3W2QA 1CM8A 2G1TA 3QKLA 4PY1A 5FDPA 3A2CA 5EI8A 3SD0A 4O7SA 5HGIA 3FC1X 5HQ0A 4EK4A 1MUOA 2VX0A 3JVRA 5JQ5A 1YWNA 1ZLTA 3VWAA 2GHLA 2QG5A 4EK6A 5CZIA 3ZSIA 1Z57A 1ZARA 3PXFA 3FZ1A 4FICA 4IQ6A 2V62A 3EYGA 4ZZOA 3U54A 4H3PA 5J8IA 4XG9A 3NUAA 2XKDA 3CP9A 5HO8A 4YJOA 5AV4A 3MGYA 3HDMA 4G3EA 2HZIA 3PE1A 4FT5A 5KMNA 3DJ7A 3UOKA 4IH8A 4O81A 1WBPA 2E9VA 4UV0A 2GS6A 3IOKA 4IJPA 3V8SA 4HPTE 3O2MA 5DOSA 5GZ9A 2QOBA 3LZBA 2QO2A 3PRIA 4GUEA 4V0GA 4QYYA 4RSSA 1QMZA 3FY0A 3A61A 3G9NA 3Q6WA 1L3RE 4JOAA 2VZ6A 2ZV8A 5HEZA 4D1XA 4JBOA 3NMUF 5JZJA 3G9LX 1WBOA 4R3CA 2EXEA 1MRUA 5IQIA 4QTBA 3RK7A 1PKDA 3ZMMA 4ANOA 4UMRA 3TNQB 3SXSA 1H1SA 4CMUA 4S33A 3UO5A 2OJJA 4RVMA 4DLIA 4L7SA 2RKUA 5CAUA 2ZDUA 4JXFA 2I0VA 3LW0A 4WO5A 1STCE 4XCUA 3ZFXA 4ZSAA 5ANGA 2AYPA 3HA6A 2OIQA 4JIAA 5BUIA 4G9CA 3LCOA 3BELA 3DAEA 3ZXZA 4F9AA 2PVFA 4E1ZA 4MD8E 3TTIA 4O7WA 3LKMA 2NPQA 4L6QA 2XEYA 4IANA 5HTBA 4FTQA 2UZTA 2BHEA 3TEIA 3ZM9A 4TWOA 3EMGA 2VWWA 4PL5A 4YZBA 4JRVA 5CF4A 5HG5A 3UMXA 3QD0A 3AD4A 2BIYA 4RC2A 3HV5A 2FSMX 1R0EA 2X39A 3OUKA 2QOIA 5AA9A 3TCPA 2UZVA 4EK8A 3F3UA 3L9LA 3PXYA 3DLZA 4ZSGA 2LGCA 4GJ2A 3QRKA 4KRDA 5LVNA 5IMXA 5CS6A 3UVRA 2OF4A 2V5QA 2O3PA 2XK3A 2YA9A 4HCVA 3QQJA 2WOTA 2PUPA 1L8TA 1OL6A 4JL9A 4O86A 4BGHA 3KF7A 4CCBA 5I9ZA 3DKOA 3D7ZA 3GU8A 3QQHA 4I0RA 5HTIA 3FLQA 5C8MA 4KIKB 4ZJVA 5HIEA 1ZZLA 3FYKX 3ZDUA 4ZSLA 5GHVA 4QT1A 3DS6A 4GL9A 2IZSA 4JLCA 4MNEA 3V51A 3EJ1A 3E3PA 3FYJX 3ROCA 4CFMA 4DBXA 2QOQA 3A7JA 3EZVA 4E93A 3ZXTA 3UZTA 3MTLA 5IEVA 4MD9E 4YC8A 5AUVA 3QZFA 4YBKA 3FJQE 2BDFA 1JKTA 5IQAA 2PTKA 2YACA 4L45A 3CY3A 5BMMA 5I4NA 4CEGA 3TKUA 3U4WA 2GNFA 2P2HA 3ZO3A 4KINA 2B9JA 3BZ3A 3DNEA 3FKLA 4MH7A 1GY3A 3NVMB 3R21A 2P4IA 4UZHA 2ITWA 2ZV2A 4RX9A 2QURA 4XG4A 2RG6A 4LOPA 4QMNA 3UPZA 2BDJA 4XRLA 2F4JA 4EJNA 1FINA 4J98A 2WEIA 1DAWA 4AE6A 5M53A 3GC8A 4ONAA 1GNGA 3KULB 1FMKA 4C36A 3DBFA 1YWRA 4ZJJA 1Q4LA 4EH3A 5EM7A 5LMKA 3OWLA 1WBVA 4FVQA 4UYAA 1V0OA 1A9UA 3VF9A 1XJDA 5L4QA 3KKVA 2VO3A 5HI2A 1AD5A 2BHHA 3C4ZA 4W9XA 2IPXA 4X6QC 4FYNA 4FEVA 3D2KA 3GT8A 1M2RA 4AZTA 3L8XA 5D12A 2CGXA 3LFQA 5BNJA 2PPQA 4W4XA 4JG8A 5I9XA 1CKJA 1Z9XA 4IXPA 5CVFA 3U87A 5M08A 3PSBA 1J1BA 2WTKC 3CD8A 4P7EA 5L2IA 2VX1A 4DGNA 4FTKA 1URWA 4RC3A 2JIUA 3IGOA 4D2TA 2YM3A 3QQUA 2P0CA 5B0XA 4LG4A 5EYKA 2C6KA 3GOKA 2R2PA 5AP7A 2OO8X 3PWYA 3UP2A 1E1VA 2WQEA 3CLYA 3D9VA 4ZTSA 3MVHA 5FXQA 2Z7SA 2GNIA 4C4IA 3FSKA 3DDQA 3D5WA 4AE9A 4TWNA 5BVNA 3TUCA 2XJ1A 3QYWA 2YLEA 2IO6A 1VYWA 2WTJA 3QC9A 4IM0A 5FEDA 4IIRA 5M4FA 4YZNA 3C4WA 4TYHA 2KULA 3QFVA 4C4GA 4EH7A 1U46A 3LCTA 3HMPA 3TKIA 2W9FB 3MPTA 4K6ZA 4YZDA 3BGZA 3JPVA 2BRHA 2IWIA 5CEPA 1G5SA 1W83A 2BROA 4ANSA 3T9IA 2ZJWA 2YCSA 1W8CA 1OL1A 5FTQA 4JVGA 3EFLA 3K5VA 4I23A 3UZRA 4G2FA 4JS8A 1XH6A 3E8DA 4AA0A 3LFNA 4ASZA 1OECA 3OWKA 4MNEB 2CNQA 3KRRA 4C4FA 3VRZA 3QXPA 5KKRC 3IW8A 4TWCA 3C5IA 3FI2A 1IASA 3GB2A 5EDQA 2GS7A 3LXLA 4XP0A 2PMIA 4ORKA 3Q4TA 4S34A 2BRMA 2OWBA 4GK2A 5E8WA 4A4XA 4UB7A 2YWPA 2VWZA 3DV3A 2WFYA 3W2PA 3UG2A 4C3RA 2PVKA 3PYYA 4Q9ZA 2HELA 4TYIA 2C6MA 3R1QA 4KNBA 5DBXA 4G1WA 3WILA 2WTVA 4NTTA 5CQWA 4CQEA 2UVZA 4W4VA 3N51A 4UMTA 3VNTA 4GVJA 3II5A 4B0GA 4GMYA 3FMHA 3LQ8A 3JR1A 4NYEA 4TWPA 1OL7A 4DH8A 4YC6A 4FTMA 4X3FC 4ITJA 4F6WA 4MAOA 4PPBA 1YXTA 4YHTA 1OL2A 4O6EA 2PVYA 1PF8A 3QD3A 2QVSE 4LGDA 1JBPE 4RGJA 4L3LA 5JT2A 2VWYA 5H8GA 3Q9WA 4BYIA 3PIZA 1PXMA 5DHJA 4FKTA 4ZTLA 1XBCA 3A7FA 3Q9YA 3PP0A 5CYIA 5HKMA 3GCSA 4PMMA 4C33A 4ZY5A 1OKZA 3CY2A 5E1EA 5AV2A 5TOZA 4AGCA 1H1RA 4Y8DA 4CFWA 4ENXA 5HVJA 3O8UA 2QI8A 4EKKA 4USDA 2W99B 3IQ7A 5IDNA 3KN6A 4QQJA 2XKEA 3DKCA 2VWXA 5HNBA 4BBFA 3GCQA 4Y72A 2Y7JA 4R5YA 2C6IA 4AG8A 3NS9A 4OBPA 4DEEA 4EOQA 2XCKA 4NW6A 2W5AA 2XZSA 5LARA 3LQ5A 3PWDA 5JFXA 5TR6A 5AUZA 4XV3A 1DI8A 4FMQA 1B6CB 1IA8A 2E9UA 2YN8A 3MH2A 4N70A 3BEGA 3EFJA 3SAYA 4R6VA 3ZUVA 3ZFMA 3GUBA 3IKAA 3PY3A 4QP7A 5HIBA 2CCHA 4QMTA 1OBGA 4J99A 4RMZA 4PWNA 4IC8A 2B9FA 3CR0A 3W33A 3G5DA 2JITA 1JVPP 2R3HA 3HL7A 3QGYA 2B9IA 4L53A 2GQSA 4MQ1A 5D9HA 4NFMA 4C4JA 1ZMUA 5AM7A 4R7BA 4PPCA 4QP1A 2W96B 4Y46A 2YERA 4EH4A 4BCFA 3BKBA 4G16A 4R3RA 3KEXA 3O23A 4PDYA 2C0IA 4IVBA 5C27A 3CCNA 4O0XA 2NP8A 3RZFA 4DG3E 5JQ8A 1J7LA 3LM0A 3HZTA 3A60A 4EQCA 3UMWA
chains in the Genus database with same CATH superfamily
2VTLA 4C38A 4BCGA 4DEGA 4AACA 4E6DA 1LUFA 2W1EA 3C51A 1PYEA 3OTUA 4O7LA 4YHFA 3DNDA 3QZGA 4NKSA 5IDPA 1RJBA 3QALE 2OBJA 3EIDA 3R7VA 2C5VA 3WOWA 4BKJA 2J9MA 1KWPA 4O96A 3Q52A 4MXXA 4L67A 3SGCA 4AXDA 2C6EA 3MFUA 4ID7A 3WYXA 4ENYA 4EOPA 3ID6C 3Q2JA 2RGPA 5KBRA 4X2NA 4XYFA 5BVKA 4F0IA 5M06A 3VBYA 4O84A 4YURA 1GZ8A 5DR2A 3PE2A 2WGJA 1H07A 3Q5ZA 4KBAA 4KB8A 3OCGA 4XBUA 5AR3A 4CFUA 5LJJA 3PJ8A 3HMIA 4G3FA 5GJGA 5H8BA 5EYCA 4EWQA 3MY0A 3ODYX 5IU2A 3DT1A 2GNHA 5E8YA 2B1PA 3PY0A 5GJDA 3TV6A 3H9RA 2GNJA 5CSWA 3RWPA 5JN2A 3HAMA 2C5NA 3EFWA 4IAAA 4BGQA 5BV3A 5E7RA 4RX7A 4A9UA 3DGKA 3LFSA 3NNUA 2VTOA 2WKMA 2E2BA 3DBCA 4FKGA 3I6WA 4NT4A 3EQBA 5HG9A 3S3IA 5IA3A 5DR9A 2J0MB 4IB3A 5EG3A 3RNIA 3Q60A 2YM8A 1H1WA 1H1QA 5I3OA 5LMAA 4XMOA 3NUUA 3HAVA 2R3RA 5DR6A 4FNZA 3BPRA 4IX4A 2E9NA 3SOCA 3MESA 3G90X 3FLZA 4EUTA 4FODA 3FMEA 4PPAA 4C37A 4RFYA 4ZOGA 4GH2A 3C0HA 3MS9A 2HW6A 3EQGA 4ANQA 2PHKA 3GU7A 3NLBA 4EC8A 4ERWA 4FSNA 2QG7A 2P2IA 5K5XA 4ZTHA 1JKSA 3CSVA 3SHEA 4EJ7A 4DEAA 3QQKA 4IAIA 3QWKA 3F5UA 4I93A 4A7CA 3OG7A 3W0QA 4WHZA 4IB5A 3GENA 4L3JA 3TNWA 4NWMA 4LM5A 3TUDA 1E1XA 5EHLA 3LVPA 4OT6A 2JLDA 4WT6A 3GNIB 3I5ZA 4UY9A 3FC2A 3QCXA 4IE9A 4R1VA 4TRLA 4FKVA 2PVRA 3HMMA 4FK3A 4QYHA 3RPVA 5DVRA 3H30A 4KKEA 2AC5A 4M13A 3CS9A 3LM5A 3R6XA 3ATSA 3KRXA 3ZDIA 5C8KA 5CU0A 4DFBA 4FT9A 2BRBA 2EB3A 2WMBA 2OGVA 3KXMA 5CX9A 4D5HA 3BWJA 3CJFA 1JSUA 1J3HA 3DFCB 5DRBA 3QCSA 4FV7A 4AT5A 4EHZA 2HY0A 4XG6A 4FRFA 2W9ZB 4HVSA 4JX7A 4NZWB 5DFPA 3M11A 2ESMA 5HG7A 4C57A 4HCUA 3ZU7A 2UVXA 1JSTA 3R02A 4E4XA 3NW5A 4MWHA 2OH4A 5I9YA 3CEKA 5M57A 2PVLA 4FIHA 4XOYA 4QP2A 3IDCA 2O5KA 2ZMDA 4FV4A 3LCKA 1R3CA 3SV0A 4FJVA 4F63A 3SRVB 4GIIA 4QMXA 4ZLOA 4I22A 2GQRA 2VRXA 3F5PA 1V0BA 4UYNA 2NYAA 3QYZA 4FR4A 2WPAA 3WARA 5A4TA 5F95A 3RGFA 1H8FA 3KMMA 3ULIA 2Z7LA 2YM6A 4DA5A 4O22A 4CRSA 5C1QB 4MQ2A 4OLIA 5GIOE 2HK5A 4D55A 3MIYA 3RJCA 4F09A 3NFFB 3CKXA 2VTIA 4D5KA 1GZNA 4DT9A 2UUEA 3Q6UA 3RAWA 2F49A 3FQSA 4KRCA 5ACKA 3FZOA 2BCJA 1O9UA 3FV8A 4QEBA 4DFUA 3ORIA 2OKRA 2H34A 4UMUA 3RPRA 1DAYA 4F9CA 3EWHA 3AT3A 4NM7A 3OOMA 5KMLA 4XV9A 4E5AX 3CPCA 5HTCA 3V5TA 3PA3A 3ULZA 3CE3A 2R3QA 4GEOA 1CDKA 2EXMA 3RTPA 4TW9A 4AQKA 3PJCA 4LOQA 4BY9E 4R1YA 5AA8A 2W1CA 1MP8A 4DLJA 4RWLA 1R39A 2XB7A 3E8CA 5IPJA 2Y4IC 4L01A 4G6LA 4F7LA 3PPZA 4D2WA 4FVRA 3F3WA 4YJTA 5CAOA 5CSPA 1Q5KA 3F3TA 5GNKA 5AADA 3R7GA 3MA3A 5A14A 5BQ0A 5CANA 5AFVA 2RF9A 3PXQA 2ONLC 1XQZA 4CT1A 4FEUA 2BMCA 4O7ZA 2WU7A 4ANLA 4QP4A 1JQHA 4K2RA 3TKHA 5IMEA 2WQOA 4H3BA 2CKOA 4R8QA 4J97A 2XK4A 3AQVA 3Q32A 4UZDA 5CAQA 3DAJA 2Z7QA 1BX6A 4G3DA 2PVHA 5ANOA 4FL3A 4J96A 2VTJA 4O4DA 1A06A 3MWUA 4X21A 3G0FA 4C59A 3DTWA 4EH8A 4LMNA 2YIYA 3VJNA 3BHUA 4O0SA 3NWWA 4BF2A 4GUBA 4BWKA 4MXYA 3GGFA 3RINA 5IQDA 2QLUA 3EN6A 3FZRA 3GQLA 4TY1A 4EOKA 3QZHA 1H27A 2X0OA 5CALA 3ZC5A 2JKMA 1MQ4A 3GC7A 3RAIA 1U54B 3KMWA 2Y0AA 4GJ3A 4L46A 5HOAA 3PZEA 3R7IA 4BTKA 2VO0A 3RZBA 5CU4A 5FBNC 4W8DA 4U44A 3K2LA 4ITHA 4PP7A 3NGAA 3P5KA 3PJ2A 4I92A 4FKPA 4M66A 4GG5A 3AMYA 2XVDA 5GINE 5BX0A 2X4ZA 3VUHA 3FPMA 2QHNA 5EM5A 2CSNA 4I21A 1G8SA 5IQGA 2HXLA 2PMLX 2ITUA 3BYOA 4PX6A 2PUIA 2WELA 4F9WA 4E73A 5BVFA 2OJ9A 1TZDA 1T45A 4BZOA 4OBQA 2OXXA 4GSBA 4MNFA 1XMMA 4I4EA 4RIXA 2XNOA 2QLQA 3F2NA 3BIZA 4FV2A 4BDBA 3MPMA 5BVDA 4YJNA 3P86A 4P5QA 2P55A 4XOZA 3KRWA 3T3UA 3HGKA 2JIIA 5D1JA 4AFJA 3LFFA 2XK9A 4B4LA 4DITA 4U42A 3S00A 3FZSA 4O4FA 3DB8A 4XG2A 4GFGA 4QD6A 4AT3A 5L6PA 3POOA 3BGPA 2PVNA 3GFWA 2QR8A 4YJVA 3FQHA 3OBJA 1Q99A 5E8XA 1ZMVA 2JDVA 3DPKA 4GFMA 2JKOA 4NEUA 5HX8A 4L42A 2R3MA 4D0XA 5T68A 4I24A 3KXZA 4C0TA 3TNIA 4EQUA 5L3AA 4E26A 4YSMA 5CF8A 1SVGA 2PMNX 5JFVA 4KD1A 3UDSA 3V01A 3ML1A 1UU3A 3A7GA 4BHNA 5FLFA 4YMJA 5L2WA 3TG1A 5DYJA 3BHVA 3HV6A 3KA0A 2X8IA 1Q3DA 2UVYA 4FKIA 3WBLA 4MTAA 4O0RA 4HGLA 4BC6A 5AJQA 2B7AA 4FKLA 4TKSA 4M67A 3FY2A 3I7CA 3DJ5A 5EI2A 3HUCA 4C4EA 5FM2A 4M0ZA 3D4QA 5CSVA 4PRJA 3LFCA 3W55A 4WA9A 1ZOEA 4G5PA 2R0UA 3NDMA 3ENMA 4RVKA 2EU9A 3UE4A 4LFIA 3R8MA 4J1RA 2A4LA 3UVQA 3V04A 4I5PA 3W16A 5IQCA 4LUDA 2JD5A 2PWLA 4BKYA 4U80A 3AD6A 5FDXA 4HVIA 4EOMA 4HVGA 5TT7A 3KU2A 1F0QA 4BDGA 4DFYA 3WF9A 3V5JA 3SLSA 4WG3A 3RVGA 4ITIA 3VIDA 4CTBA 3UDTA 2X7GA 3KC3A 3ZRLA 4EKLA 2HIWA 2B54A 4HYUA 2C6OA 4PL4A 1Q8UA 1ERKA 5D11A 2WTCA 5T3QA 1H1PA 4IZ5A 2LAVA 4IBMA 4AW2A 5B2MA 5EK7A 4EOJA 2JDOA 4ZZMA 2YDJA 5KBQA 2C1AA 2R7IA 3Q9XA 5LVOA 4NL0A 3W0PA 4RIWB 5FM3A 5AAGA 4FUXA 2J5EA 5JFWA 4FZDB 4IWOA 2OLCA 4QDEA 5DMZA 4P5ZA 2ETKA 3GFEA 2IVTA 3VONA 4BTFA 1VEBA 4CNHA 3AT4A 4PDPA 3GCPA 4Y5QA 2A1AB 4O4BB 2ZFYA 4IX6A 2VWVA 3ALNA 1SVHA 4TYGA 4O0WA 2CHLA 3DTCA 3E87A 3NW7A 5ETCA 2VX3A 3JS2A 5J9ZA 3KGAA 3GU6A 3VS5A 3VF8A 4CVAA 5HCXA 2CKQA 3I1AA 4AAAA 2VTPA 3E92A 4YJQA 3RI1A 4MK0A 2G2IA 4DE4A 4G17A 3QKMA 5H9BA 2WQBA 2IW6A 3PIXA 3KCKA 1ZAOA 3MVJA 3S1HA 4CTCA 1XKKA 3S0OA 3EKNA 5HX6A 4Y5HA 2SRCA 4Q5HA 2B4SB 2X7FA 3FDNA 1URCA 2YLFA 3RPYA 2GTMA 3VO3A 3OP5A 2XYUA 4FKWA 4WNMA 4DGGA 2R7BA 1IEPA 3BV3A 2UW0A 5IA1A 3C50A 4U81A 2W7XA 2PU8A 2W5HA 5F4NA 1OGUA 2HAKA 3DDPA 1YOJA 2ITYA 1XH4A 5DA3A 4DGLC 4JDHA 3A7IA 5C03A 3T9TA 4DEDA 2PY3A 2QO9A 3LQ3A 2C0OA 4N57A 3CKWA 4YLLA 4KAOA 4A9TA 3U6JA 2ZB0A 2DYLA 2IEWA 2OU7A 3ELJA 3VUMA 3TV4A 2VGPA 5HBJA 3PXKA 4X2JA 4IACA 4RA4A 4NH1A 2GFSA 4KIPA 5IQBA 1H0WA 2C6DA 2IG7A 2C6LA 4UBAA 2PYWA 3NYNA 1KV1A 3R01A 5FTOA 4QRCA 1IA9A 1P2AA 4Z55A 4ZLZA 4QNYA 3BBTB 3GP0A 4F6SA 3RHKA 4AZEA 4RFZA 1H26A 4TTHB 1GZOA 3C4EA 5E8VA 4F65A 3MJ2A 1RDQE 2GSFA 3E64A 3MYGA 4NK9A 2VO7A 3LCSA 3WE4A 3WF5A 2Q83A 4JMQA 3UOJA 5KCVA 4FSTA 3BYSA 2F2UA 4II5A 4LYNA 3VW8A 4I0TA 2IJMA 3R83A 3FMNA 5K9IA 3F3ZA 3I5NA 4RX8A 3ANRA 5IISA 3EQHA 3M42A 4MVFA 5D10A 4AU8A 4HVHA 3PJ1A 2OXDA 3OS3A 4H3QA 5I9UA 2W4JA 5E8TA 2JIVA 2JAMA 4NJDA 2UZLA 2VNWA 3UTOA 3NCZA 4IX5A 5ETAA 5TE0A 2C5OA 2G9XA 4MBJA 4C61A 5BUEA 2Y6OA 5M4CA 2YFXA 2OG8A 3OW3A 3VUDA 4ALWA 5KHXA 1YDTE 3ZCLA 5LVPA 3F2RA 2CPKE 1DI9A 2A27A 4WSQA 2X2KA 5JGAA 4G6OA 2W4OA 4DTKA 3A62A 5F94A 2A19B 3KFAA 2R3NA 2PVMA 4FKQA 4PMSA 5AR4A 5G1XA 3FHRA 3VUGA 3UNKA 1IG1A 4H1JA 4IWPA 4Q2AA 5DH3A 4BI0A 3R8VA 3BV2A 4A9RA 5FRIA 4AOTA 2YCFA 1PYXA 4XHKB 3SVVA 2OJIA 3QAME 4N6ZA 1XBAA 3VS3A 5D7VA 1G3NA 5JMSA 4GVAA 5GJFA 4GRBA 5HNIX 5KO1A 4PMTA 2CDZA 2QNJA 2UZOA 1QPCA 4EH6A 5AX3A 2C3IB 4I1ZA 2BVAA 2WMQA 3GOPA 4HZRA 3KXNA 3UOLA 4U5JA 3EQRA 3UC4A 5IA2A 3D94A 3LFBA 5I5ZA 4D28A 2PL0A 4EHEA 5ANJA 3W10A 3BI6A 4I5MA 2ERZE 4V0GB 4YO6A 4BICA 3SDJA 4C3PA 4MUQA 3OD6X 3MBLA 4AXFA 2R5TA 1NT2A 3UNZA 5DEYA 2EWAA 3GVUA 5C26A 4FTAA 4GW8A 1YVJA 3ZFYA 3DBQA 3E62A 5IA4A 1SNXA 3R71A 4AP7A 3QF9A 2ZB1A 1IRKA 2J0LA 1FVTA 4P4CA 3W18A 2JGZA 4OTWA 5LVLA 4ZSEA 5B2LA 2XRWA 5AUWA 4ACGA 3JY9A 1TFFA 3UQGA 4GFOA 4E4NA 1ATPE 2WMTA 3IECA 4HNIA 1OKYA 3R22A 1UNLA 1W98A 4FA2A 1DM2A 4AZWA 4KBCA 3TM0A 4IAYA 2WEVA 4RA5A 4BJJA 3CTHA 4ERKA 2C5XA 5HORA 1J91A 1YXXA 3R1NA 2UV2A 4QMPA 3QRIA 3H4JA 3VBXA 1W7HA 4O2ZA 3QX2A 2PK9A 3F7ZA 1YW2A 2CMWA 4TYEA 4I6QA 3ZSGA 4MF0A 2FVDA 3UDBA 2QODA 4GYGA 2R3FA 4I6HA 3R63A 3FUPA 4UWYA 5CEMA 3BLAA 4FTLA 3NNWA 4AA5A 4EH2A 4WNOA 4DBNA 3C7QA 5M56A 3B2WA 5BVOA 4FKUA 4EZ5A 4AOJA 2JDTA 3EL7A 3DJ6A 3E63A 4RWKA 4CMTA 2VTMA 1P4OA 4FYOA 2ACXA 3IONA 4YJPA 1NW1A 5K4JA 3TDWA 1CSNA 3PVUA 1SVEA 4RQVA 3L9PA 5ANDA 3PUFC 3F3VA 2ZM3A 3PVBA 4KWPA 4DFNA 5DE2A 2J0KA 4BCMA 3EHAA 3P1AA 4NCTC 4X3FA 1UKHA 2BKZA 4AGWA 1O6LA 3OEFX 2XIZA 4G34A 3TJDA 4CLIA 1IR3A 3IDBA 4OTQA 5ICPA 1F5QA 1YRPA 3KK8A 4HCTA 1WAKA 3EQCA 5I9VA 3RPOA 3R04A 3WZEA 4ALVA 3L8VA 5L8LA 4I0SA 3NEWA 1V0PA 4KSQA 2J90A 5IA0A 2BAKA 5IUIA 4E4MA 3A8XA 4AS0A 2ETMA 2W1HA 3OHTA 3PXZA 4IVDA 5HCYA 3ZRKA 4EL9A 1YHSA 2J2IB 3QA8A 3TL8A 3QLFA 5L8KA 5JGBA 3NYVA 2JFLA 4QQTA 4I6FA 3TYKA 3JUHA 3HVCA 4FZ7A 4YTCA 2V55A 4HJOA 2AUHA 4IX3A 2JEDA 3P0MA 4RC4A 1JKKA 2XAOA 3DXPA 2I6LA 2PZYA 3R1YA 4UALA 4UWCA 4AN2A 1JAMA 3R28A 3KRJA 4G3CA 5CVHA 2ZMCA 2IF8A 2XUUA 5ANEA 3R7YA 1X8BA 2J0JA 4XV2A 5A4EA 3G2FA 2H9VA 3ORLA 3WYYA 1R0PA 1DS5A 4CCUA 4D2RA 4U97A 4Z9LA 2OZAA 2GU8A 3JY0A 3UIBA 2O8YA 4WKQA 5ACBC 2DQ7X 4BDDA 3FAAA 1BUHA 3PVWA 4CFVA 1TQPA 3LFDA 3EQFA 3MH3A 4M15A 3UODA 5IEXA 5L6OA 4XP2A 5DIAA 5HE0A 2HZNA 3K54A 2X0GA 3OOGA 4FVPA 4MCVA 2C47A 3COMA 4FT3A 5ETIA 2V22A 1Q8YA 5CEOA 4BDIA 1YQJA 3GBZA 4OAUC 5E9EA 4EI4A 4IAFA 4P90A 2QU6A 3FKOA 2PZ5A 1NVRA 3PG1A 4BJJB 5KKRB 2CN8A 5FGKA 4GK4A 4I94A 1ZMWA 3Q4UA 3QD4A 4AUAA 3DA6A 4QP9A 1YI4A 4RWIA 3CJGA 4BVUA 4YTIA 2BAQA 5EOLA 2O0UA 4L43A 5E91A 2VTQA 3AMBA 4KSPA 3BLRA 5CF5A 2XS0A 2FYSA 2QD9A 4CXAA 1BYGA 2AC3A 4WD5A 5HE2A 5EHOA 4KS7A 4K9YA 3NNVA 3ODZX 3SQQA 4KIOA 4DHZA 4DF3A 4FTUA 3D15A 4B99A 2GHGA 5KMMA 4HGSA 1W82A 4TL0A 5GZ8A 4O7NA 3CPBA 3I60A 3BLQA 2ITXA 3FLNC 4LRJA 4QPSA 3ET7A 5AR2A 4BI1A 2QONA 1ZYLA 1OIYA 2CN5A 2JAVA 3LLTA 4Y85A 4TYHB 4A06A 3LXKA 3MIAA 5EKNA 3EN5A 4USEA 3FMDA 3A4OX 3QBNA 3F88A 3MFSA 5HG8A 4JR3A 3N4VA 2WMUA 3DOGA 4JG7A 4W4YA 3U9CA 5KE0A 1KOBA 1ZYDA 4BRXA 1KOAA 5IH4A 4G31A 1NVQA 5FQDC 3MV5A 5BYZA 2ZOQA 1PXOA 1WZYA 2O2UA 3THBA 5K4IA 2XK6A 3MY5A 4HYSA 4XG8A 4L68A 3PPKA 2BRNA 5CT7A 3WZJA 4CYJA 2O65A 3GXLA 5F1ZA 4BZNA 4E4LA 4BCNA 4FTIA 4EYMA 3NFGB 3R9HA 3DLSA 2CNUA 2UZDA 2FH9A 3IW5A 3ERKA 3DAKA 4YJSA 4O38A 2QOFA 3K3JA 3Q2MA 2C3KA 3ORPA 4H58A 4I4FA 4MX9A 4O7TA 4PTCA 3OFMA 4BN1A 3AGMA 3CIKA 3COHA 4QO9A 5FP5A 5M55A 2FO0A 4RIYA 4E7WA 4NM3A 3VJOA 1ST4A 4YBJA 5DEWA 5EKOA 4U8ZA 3C13A 4EOLA 4TYJA 3WF7A 4AF3A 4ZEGA 4O7VA 5EQPA 3OUNB 2XH5A 3O96A 5AP3A 3WIGA 3QX4A 3D5XA 2Z7RA 3NPCA 3PXRA 1WBWA 4O27B 4YU2A 1Y6BA 2ITNA 1LPUA 1XBBA 4JX3A 2FSTX 2ZDTA 3HMOA 3AGLA 4E3CA 4BDAA 5M4UA 3R8LA 4J8MA 5D41A 5AR7A 3BGQA 4ZY6A 2UZNA 1RE8A 3C4CA 3H0ZA 4CGAA 4B7TA 4LV7A 4RVTA 3QTQA 3AMAA 3VUTA 3NUNA 4QQ5A 4F70A 3BQCA 4I5CA 4W4WA 5CLPA 4ZP5A 2OK1A 1WBSA 4QNAA 3F82A 4YSJA 4GKHA 4YC3A 2XNEA 3PLAE 3VBWA 3OC1A 2JKQA 1QPEA 2BFYA 2UW4A 3H9FA 1Y8GA 5FXRA 5A6OA 4Z7GA 3W0NA 4E6AA 5CXHA 3O17A 5IA5A 4EBVA 2CNVA 4HPUE 1GIJA 2XIYA 2ZYBA 5E8UA 2X9FA 4A4OA 5CSXA 3JYAA 2XIKA 4A07A 2E9PA 4APPA 5CEIA 1UWHA 3ZZEA 3PP1A 3WE8A 3GC9A 1PY5A 4ASEA 3LMGA 2YM7A 2ITOA 3G6HA 4N6YA 1Q8WA 2WMVA 2OH0E 3MB7A 3OW4A 4J95A 2R3KA 3TI1A 2X9EA 4JBQA 3GU4A 4NIFA 5A9UA 1K9AA 2XAMA 2RFSA 2P33A 3ZS5A 4FV1A 5EHYA 4BGGA 3ZLSA 4EH5A 3V5QA 5CEKA 4FIIA 2WHBA 5HHWA 3MSSA 1Y8YA 3BHTA 4C35A 2EXCX 2WNTA 4MD7E 5K0KA 3OT8A 5HICA 1RQQA 2W17A 4KBKA 3W8LA 5KMOA 5M07A 3P78A 3C0IA 1OUYA 1HCKA 4OTDA 3FKNA 2GFCA 2A2AA 2VN9A 5J9LA 4L8MA 2X4FA 4MXOA 2PE1A 1FVRA 2REIA 1WVYA 1YXUA 3P9JA 5DT4A 4BI2A 3UJGA 4DYMA 3QTRA 2EUFB 3F66A 2O63A 1CTPE 4LI5A 3IW6A 5CEQA 4FEQA 5CVGA 4BTMA 3VBVA 3VS7A 3B8QA 4QYGA 3JXWA 3FI4A 4M7IA 4OUCA 5DG5A 4B8LA 1F3MC 5L8JA 2YAKA 3NR9A 1KUTA 3PSCA 3PSDA 3O0GA 2J51A 3BWFA 1BMKA 4H1MA 5D7AA 4F99A 2BTSA 2VV9A 2BILB 3FLWA 3ZEWA 1YHWA 2WAJA 5IQHA 2OICA 3WZDA 4BDFA 5J95A 4V04A 2X2MA 4TZRA 2HCKA 5L6WL 3UC3A 3MI9A 5EQYA 3PZHA 2G15A 2J5FA 4XLVA 2ONLA 5EFQA 3UIMA 4ANBA 4D58A 3RHXA 5JK3A 3FBVA 1OIUA 1OIRA 2FB8A 4DFXE 1PMUA 4OTFA 5J9YA 2KTYA 1Q62A 2C4GA 4Q5EA 4O4CA 2FSLX 3WF8A 1LEZA 2EVAA 3LPBA 1TQMA 2Q0BA 2Z2WA 3MPAA 5LXMA 3U9NA 1JOWB 4A9YA 2R4BA 4BTJA 2AQXA 3A7HA 3AT2A 3FMJA 4V05A 4ZIMA 5LWMA 4IAZA 3UO4A 4AW5A 4R78A 4E20A 4QMZA 1YXSA 3BLHA 3C5UA 5KMKA 3QCYA 3W0MA 4TNDA 2OI4X 4FV5A 4AOIA 5K5NA 3MFTA 3MN3A 3HRCA 4F0FA 2WMRA 4FKJA 2X0PA 5AMNA 4U45A 2FSOX 3OMVA 2JKKA 3F7WA 5AR5A 4QTEA 4IFCA 1PHKA 4XS2A 5LMBA 4O21A 3DKGA 3F9NA 3UOHA 4GS6A 4WBBB 3DBDA 3I0QA 4TPTA 4U41A 3SX9A 5AV0A 4K77A 5CNNA 4ANNA 5LQFA 4ZY4A 1UU8A 1OZ1A 5AX9A 3PFYA 3W0SA 4PP9A 4NKAA 4O0YA 5CZHA 4AXEA 2BZKB 4NIFB 5AIKA 3ZRMA 5G6VA 4MHAA 4YZMA 1KE8A 3R8UA 2HENA 3E88A 3HA8A 4DEIA 3R9NA 3MH0A 4RQKA 3R8PA 3ACKA 4PF4A 5LCKA 1REKA 5CY3A 5HU9A 3EQDA 3OWJA 2RL5A 1UV5A 3NW6A 4JAIA 5FXSA 3RKBA 5IQFA 4JJRA 4FIGA 1ZY4A 5J1WA 5J79A 2WTDA 4M69A 3R30A 2XM8A 4GV1A 2XNMA 3V8TA 4D2SA 1HOWA 2VTRA 3DZQA 2BR1A 1APME 4JR7A 3VHEA 1W2DA 2ERKA 4DAWA 3D2IA 3O8PA 5AAFA 3FZPA 2BZIB 2XIRA 2F7EE 4DINA 4NTSA 4F7SA 4EORA 3O8TA 4IZ7A 4C58A 2QC6A 4DTBA 2JDRA 3UG1A 4UX9A 4KKGA 2GTNA 3IDPA 1UKIA 4AWIA 4D4YA 4DH3A 4M12A 2VTSA 3VUKA 2XM9A 1MRYA 3RK5A 4IADA 1S9JA 3HP2A 3HV7A 4AN9A 5C4KA 3TZ9A 3KB7A 5CQUA 2Y4IB 3FMKA 3W1FA 1ZYSA 2VD5A 4D2PA 3LMHA 2OW3A 2YIXA 4J52A 3V5WA 4EONA 4EUUA 5CNOA 4IM3A 3HECA 3OBGA 3N9XA 3H0YA 2OF2A 3ZONA 3REPA 3OCTA 2JBPA 3PFQA 1O6KA 3QRTA 1HCLA 5C8NA 2R3OA 4WRGA 3WI6A 5J1VA 3P08A 3HRBA 2B52A 2VU3A 3QLGA 2QOHA 3ITZA 2H6DA 4FG7A 3FL4A 4JT3A 4C7TA 4RJ7A 2Y8OA 4EWHA 4NUSA 4WUNA 3VAPA 1AQ1A 2J50A 2NNWB 3U55A 5CENA 3W8QA 4K0YA 2BZJA 2GCDA 4J53A 5CU3A 4FV3A 1ZZ2A 4S32A 4CZYB 4NM5A 4J8NA 5IUGA 4QMQA 5CAVA 4C2VA 4Y95A 5AV1A 3QD2B 4CV8A 4QP3A 4GKIA 3ZO2A 5K3YA 3UVPA 1XWSA 3R1SA 4IMYA 3BX5A 2F7ZE 1VJYA 2ZM4A 3KY2A 1OPKA 3F6XA 2BALA 3H9OA 3MVMA 5T6KA 4B9DA 1JNKA 3TXOA 4FE2A 4FTNA 1TKIA 2GQGA 5I3RA 1U5RA 3R9OA 2RG5A 4U43A 1P5EA 5HO7A 1NVSA 2QOLA 3QTWA 1OMWA 2X7OA 2VUWA 2VTTA 2VWBA 4I3ZA 3ALOA 5JRSA 3CGFA 4FNXA 4RPVA 4TN6A 5IG1A 3U6IA 3KF4A 4LQMA 3OCSA 3ZTXA 4HZSA 3IS5A 4FTCA 2UW7A 4GT4A 2ZV9A 3OROA 4PDSA 4WUAA 4M97A 2ZV7A 3BHHA 3KRLA 3BCEA 3L1SA 3PA5A 4QMLA 3QGWA 1YOMA 5ITAA 2PE2A 3MY1A 4IDTA 3MTFA 2GS2A 4FIEA 4MXZA 4BCKA 3BBWA 3UBDA 4BYJA 3ZHPC 4FSMA 3FMMA 2R9SA 2JC6A 1M7QA 3I7BA 4FSWA 2PVJA 3AC5A 3B2TA 4K33A 3DXQA 3TMOA 4J7BA 4M69B 2HXQA 2YISA 4R7HA 2YABA 1YHVA 2UZUE 3AC1A 3ZO1A 3TN8A 4MWIA 4FSUA 4U79A 2VGOA 2W05A 3GCVA 5DRDA 3R7OA 3RPSA 3KVXA 4XV1A 1IAJA 3OEZA 3NAXA 5EW3A 3BU3A 3FLYA 3P7BA 4C3FA 4O2PA 4DG0E 3EOCA 3ZC6A 3UDZA 3V6RA 4FZ6A 5J5TA 1Y91A 3ATTA 2CGWA 4BWPA 1PXLA 4GCJA 2XEZA 1NY3A 1GZKA 2XBAA 3MW1A 4QPMA 5AV3A 4JI9A 4K11A 4F1TA 5DI1A 3EFKA 3NUPA 4QMYA 4OAVB 4O83A 4GT3A 3I81A 4O1PA 1YOLA 1M7NA 3VC4A 1UVRA 2XJ2A 2XNNA 3Q53A 2WMAA 4CYIA 1J1CA 2PE0A 3VBQA 4AGUA 4CKRA 4FGBA 2PZIA 4WG5A 2ETRA 5IKWA 2R3JA 4BKZA 3IK3A 4M68A 2X81A 4CFXA 1PXPA 5HESA 2QHMA 1PRYA