5ITAA

Crystal structure of braf kinase domain bound to az-vem
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
271
structure length
250
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGLSILWMAPEVIRMNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title An integrated model of RAF inhibitor action predicts inhibitor activity against oncogenic BRAF signaling
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 78
structure length 250
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5itaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5itaA01
2BAKA 4DEDA 5ANOA 3H9RA 4QP2A 4I4EA 4YJOA 3FPQA 4O7SA 1RDQE 1U5QA 3VC4A 4RT7A 4DGNA 4PNKA 3UPXA 3QL8A 4BGGA 4F09A 5GHVA 5K4JA 5KMJA 4AAAA 1GZOA 3FBVA 5AJQA 3QGWA 3RTPA 3OTUA 4BF2A 4XHKB 3R8LA 1XH9A 3JYAA 3ODZX 3P7AA 4S33A 3ZLYA 4FVPA 4E4XA 2ITNA 5EKOA 3WOWA 3HV5A 5FP6A 5DHJA 2EB3A 5DI1A 3COMA 2GHMA 3I0QA 3Q4ZA 4IJPA 3SW4A 5IA0A 5HE0A 4JBPA 2ZOQA 3HKOA 3HMPA 4NM3A 4U5JA 4L7FA 5ANIA 3V8SA 5HVYA 5EYDA 4E93A 4Z3VA 4RRVA 4JDIA 5DR9A 4FOBA 3TZ9A 3NW5A 4GCJA 4IAKA 1MQBA 2IW6A 2OZAB 4PMPA 3RHXA 2C6DA 2PE0A 2YLEA 1OM1A 2VTTA 1XH5A 4LOPA 4ZTQA 3I79A 3NW7A 3RAKA 4AN9A 1CKJA 4NTSA 5L4QA 5M44A 3HRBA 5AR2A 5EQPA 3JS2A 1YOLA 5LMBA 3IW4A 4FK6A 2BKZA 4I5MA 1JWHA 2JITA 4UEUA 1UU3A 4AZSA 3E93A 5LMAA 5A9UA 2W5AA 5CLPA 3RPRA 3DKGA 4NCTC 3EQHA 4L3JA 4NZWB 4YSJA 2W5BA 3KVWA 2X7OA 3PPZA 5A14A 3QXOA 3QTIA 3ZLSA 4FSZA 2UZNA 4O86A 2BKKA 3QQHA 4LQMA 5CX9A 2BDJA 4ZTSA 4HVGA 2EXMA 3MFTA 4BI1A 3KREA 5EHYA 2A27A 4JBQA 5GNKA 3QTQA 4DFUA 3QBNA 4Q5EA 3H10A 2FUMA 2P33A 4HYHA 4GL9A 4K18A 2JKOA 4BWXA 2WMXA 3UNZA 4G17A 3R28A 3I5NA 4YR8A 4TYGA 1VZOA 4JRNA 3V5JA 1OKVA 3OXIA 1BI7A 4LMUA 3F2NA 4DT9A 5IQFA 2H96A 3Q4CA 4O27B 3IO7A 1XH4A 4EUTA 2X2KA 1UKHA 3MPMA 3EYGA 3GGFA 4I5HA 3UNJA 1ZOEA 3Q2JA 2PZ5A 3LVPA 2Y6MA 2GCDA 3RAIA 4C4EA 3QUPA 5HCYA 3LCOA 2SRCA 5EKNA 1YI4A 2QOHA 2RFDA 2UZEA 3FMJA 4WO5A 1Q8TA 4YNOA 3Q5ZA 1M7NA 2JGZA 3MIYA 1YI3A 1R39A 4QP7A 4KSPA 4TWPA 3VUKA 4QMNA 1OL6A 2Y4IC 4KNBA 2R3QA 3VN9A 2UZVA 4XBUA 5FG8A 3D5UA 2HZ4A 3ZRMA 2QI8A 2QHMA 3RAHA 1XBBA 3VWAA 2PVFA 2XYNA 4CYJA 5A54A 2JFLA 4IAZA 3UVQA 4B7TA 4X2NA 4X3FB 5AADA 3R1NA 4RSSA 3IW5A 5LMKA 4FSTA 1WCCA 4DTAA 4UBAA 2NNWB 2V62A 2OFVA 1QPJA 2QKWB 3FYKX 4YJNA 4GT4A 2BVAA 5J5SA 3E3PA 3FY0A 4FX3A 3BHYA 2JDSA 3SVVA 2BR1A 5ANGA 3UIMA 4W9XA 2HXLA 2GNGA 4CTBA 5FM2A 5HI2A 5C9CA 2BZKB 2E9NA 3AC1A 3FI4A 3MY5A 3NUPA 3VIDA 5J9YA 4MNEA 1RW8A 1JNKA 3KXNA 5CZIA 3CSVA 5FBNC 3KFAA 3A7HA 3GCSA 2WTCA 4D2SA 5GIPE 4GMYA 2JIIA 5CEPA 2UZLA 1HOWA 1OIRA 3EH9A 3FQSA 4GFOA 4K77A 4QMSA 3CY2A 1REJA 3OXTA 4I0SA 1BL7A 4L53A 1S9JA 4A4XA 4DA5A 1Y6BA 4FNWA 5AR4A 2JKKA 2VWWA 4ERWA 3QAME 2P2IA 1J7UA 1WVXA 3CGOA 3RM6A 2IPXA 2PUNA 1H01A 1UVRA 3PIYA 4FK3A 4F08A 3LM0A 3L8SA 4TYJA 5HQ0A 2VTQA 3DBEA 4G6OA 3AD5A 1SNXA 3PXYA 2HWPA 4QNAA 3VAPA 4GU6A 4RZWA 4U80A 3KU2A 1Q5KA 2YDJA 3PSCA 4O2ZA 2J5EA 4TYHB 2YM8A 2G9XA 4UXQA 4AGUA 3D5VA 3OVVA 4BDJA 3H9OA 4KUJA 3ZZWA 1H8FA 4RBLA 4EBWA 4U7ZA 3QQKA 1VYWA 5HTBA 4AW2A 2PUIA 1LEWA 3BHHA 3GNIB 4JJRA 4PPBA 3NVKI 2UW6A 5E1EA 3VRYA 2C6LA 3CJGA 3UZRA 3D15A 2R64A 4N6ZA 4O1PA 4RJ8A 3VUIA 3VW8A 3U6JA 4YBKA 4PDPA 3MA3A 1LEZA 2ZM1A 4P5ZA 4QMMA 3C0GA 5I9YA 1YXTA 3H30A 1O9UA 1M2QA 2YERA 4RFMA 3HGKA 4FNZA 4RIYB 4C61A 1R0EA 1ZWSA 2JFMA 4KIQA 2DUVA 5AR8A 3FQEA 3F2RA 1OVEA 2EVAA 4FNXA 3E8NA 5H8EA 5HICA 2X81A 3MJ1A 3UMWA 3DXNA 2OW3A 2YA9A 4AZWA 4CV8A 2PYWA 2YEXA 5HO6A 5I5ZA 5IUIA 1FINA 2JEDA 3DT1A 3LFBA 2ZDTA 5CVHA 3ATTA 5C4KA 2F2UA 2IN6A 4X0MA 2B9FA 3RWQA 3RPOA 4AF3A 5JFWA 2JDTA 3Q4UA 5CAOA 3EOCA 4UZDA 1OUKA 4DFYA 5HIDA 4DFLA 4U44A 4HVDA 3MPTA 3KKVA 4RX9A 4AZEA 2C68A 2UZTA 1TQPA 3MH2A 2C6EA 3G5DA 2Z8CA 3V8WA 3OCGA 5FEDA 3OY1A 2IZSA 3BZ3A 3KCKA 4QYEA 2W1IA 3NIEA 5J8IA 3VW6A 5DN3A 4L67A 3SOAA 4IAAA 3F9NA 2PVYA 4FSRA 5JZNA 5AP7A 3L8XA 1BI8A 2X8DA 3QCXA 2I0EA 2CN5A 3Q9ZA 2VO7A 5BUIA 4NYEA 5EOBA 4C4GA 4ZSEA 4W4YA 1P4FA 4OTRA 5IA5A 2CGUA 4I20A 4DGOA 4FC0A 1PMUA 4YLLA 3R8UA 2FA2A 3DKOA 4CLIA 3VS7A 5CT7A 3SXFA 4QPAA 5DOSA 3W18A 1UWJA 5FEEA 2PZPA 3EZRA 3RHKA 3NYXA 2PU8A 3OCSA 4O7WA 1K2PA 4BZOA 4IM0A 4EHZA 1G8SA 5EYMA 2UZBA 2XEYA 3IOPA 1OL2A 3QLFA 4BI0A 3DDPA 2XBAA 4ACCA 4DG0E 3OCTA 3VBQA 5HE1A 3TT0A 3C4WA 1ND4A 4DT8A 3WIKA 3NX8A 4FV8A 4IWPA 4F1OA 4BDKA 3B2WA 5GINE 3FWQA 3T3UA 3ORKA 4OLIA 4V0GA 4S2ZA 1XH8A 2VU3A 3R73A 5LARA 4Z7HA 4GV1A 5DEWA 4D5HA 3V3VA 4Y73A 1FBNA 1QPEA 1PMEA 3UZTA 4AACA 2XM8A 3OUNB 4XS2A 1IG1A 3PPJA 3HUCA 4O0SA 4FBXA 2C4GA 4C4IA 5G6VA 4ANBA 2VGOA 3EWHA 3LE6A 3PIXA 2YIWA 4FODA 4MHAA 4XG6A 5KCVA 4FTNA 3ITZA 4CTCA 4F70A 3F82A 1PYXA 4M8TA 3V5QA 5J5TA 3LCDA 4WRGA 1YHWA 5EW9A 1YXUA 4HVIA 3PA4A 2FSTX 3GOPA 4FKRA 4O38A 4N70A 2BRGA 2W96B 3QTXA 2WMVA 4KBAA 5E92A 5IQAA 5JZJA 4U6RA 5CI7A 4IXPA 4QO9A 5DGZA 4BDHA 3ZO3A 1XH6A 3A7FA 2XMYA 4XRLA 5LVMA 4H3QA 1WBOA 2R3PA 3HA6A 3DB8A 4FTQA 4XEYA 4XJ0A 3SXSA 3ANQA 3D9VA 4C33A 4F6WA 5JFXA 4YURA 2QG7A 5H9BA 4FKSA 3UBDA 4LV8A 3HV6A 4F99A 3OF0A 3NS9A 2PE2A 3SC1A 1UNHA 3LFCA 3AC5A 3TZMA 4BI2A 5IH6A 4XG8A 5JQ8A 4I1ZA 2BZIB 3VF9A 3DAEA 3HNGA 3ALNA 2IZTA 3DLSA 3PPKA 3FMEA 4NU1A 3QD2B 3PJ3A 5F1ZA 5J9LA 5CEIA 4A9UA 3DZOA 1H07A 3ORTA 5HHWA 4TYIA 4DEEA 4JQ8A 5F95A 2BALA 2VTOA 3W2QA 1PXMA 4JNWA 4FZ6A 1NW1A 3R7GA 2BIKB 4WBOA 1I09A 2C69A 3FKNA 3WF5A 2OIBA 4KABA 4IQ6A 5L6WL 4PWNA 4DCEA 5CAUA 2ZB1A 4CCUA 3VS2A 2B0QA 4YC3A 4RJ6A 2RIOA 3BYMA 3FZPA 4KS7A 4QYHA 3D14A 5FTGA 4FSYA 2B53A 3HP2A 3FMKA 1OIYA 4C0TA 3AD6A 2ITWA 4IX5A 4AA4A 3A7JA 3Q4TA 2VWBA 4XX9A 3ORMA 1T45A 3HDNA 4PP9A 1VEBA 2R3LA 3O8PA 2C3KA 3QUDA 5ANDA 4XYFA 1OZ1A 4ZSGA 4KKGA 3ZTXA 4M14A 4RIOA 4ORKA 3PA5A 3U6IA 4CQGA 2H8HA 3PYYA 3LQ5A 3SHEA 3HX4A 3AD4A 1M7QA 2CJMA 2GU8A 5AIKA 3RCJA 1YW2A 3ENMA 3FSKA 4YHJA 5AAEA 3C51A 5E1SA 1AQ1A 4RIXB 2YIYA 4FEQA 3FMNA 3L9NA 4JG8A 4FIIA 4USDA 5A4CA 4LRMA 2OXYA 3UC4A 5I9VA 3DTCA 5CF4A 4CFNA 3FI2A 3VUTA 3LJ1A 3OMVA 1A06A 4Q5HA 4ASZA 2HW6A 5EDRA 5IUGA 3KMMA 1FVTA 2QOFA 3M42A 1FPUA 5KHXA 3BELA 2OIQA 5AR5A 1MRYA 3LJ0A 3MFSA 3W2CA 2OK1A 1PY5A 2QHNA 3FZSA 4RVKA 4A4LA 3OXZA 4OUCA 2G2FA 3L8VA 4IDTA 4GVJA 4LOQA 3VS3A 1E1XA 2JC6A 3KN6A 4GW8A 4KSQA 1OI9A 4MQ1A 3RNIA 2P55A 4KD1A 3Q6WA 4TWCA 3ZUUA 1UNLA 2QC6A 2IZUA 5EW8A 1QPDA 5IA2A 1KUTA 3I5ZA 1TKIA 3D5XA 3N4VA 2CMWA 2GNJA 2AC3A 2XK9A 3DCVA 3IDBA 3NDMA 3W10A 4CQEA 4F0GA 4X21A 4LGGA 2O5KA 2QU5A 2ZDUA 4FOCA 4E4LA 3JR1A 4FL1A 2H34A 3R1SA 3TKHA 3W33A 5BX0A 2VTRA 3ZOSA 2PUUA 5TKDA 4J1RA 4QMPA 4PRJA 4RLKA 4CYIA 5BUJA 4DINA 2GHLA 4ZSLA 4HYIA 5HZNA 2WMAA 5FXQA 4V01A 2VWIA 4EONA 5CENA 3E5AA 1URWA 3FLWA 5J87A 3R2BA 5KMOA 1DAWA 5FRIA 4C3RA 4JLCA 4WSQA 5AIRA 3HP5A 1NA7A 1P2AA 4D4SA 3GUBA 3QRKA 4BHZA 4HVHA 3KRJA 3WYXA 5JGAA 3E87A 2W4JA 3MB6A 3BLQA 3BWFA 5M56A 1QL6A 3ZO4A 2X2MA 4C7TA 4F9BA 3PLSA 3GCUA 2PMNX 4UMQA 3EN6A 1TQMA 4BTKA 1ZOHA 1WVWA 2B54A 3KK8A 2I7QA 1Q3DA 5M55A 4ACGA 3WZDA 4ENYA 5JRQA 1OUYA 4D2WA 2FGIA 3OCBA 2XKFA 1M52A 3ETAA 3GFEA 1H28A 3Q96A 1U59A 4FICA 1UU8A 4QP3A 3AGMA 4ZLYA 5IUHA 5M4IA 2OF2A 3G6HA 5D1JA 4FTRA 2C3LA 3CPBA 4G3EA 4YO6A 5EM8A 4IEBA 3AC3A 5GZ9A 4QQCA 2UW3A 4UX9A 1PRYA 5DWRA 2UV2A 2YZLA 2I0VA 4JAIA 2NPQA 3QTWA 1MP8A 2X6DA 4MBIA 5IU2A 4ANLA 3NCZA 5FQDC 4APCA 2OZOA 2WO6A 1P5EA 2PVLA 1ZARA 2YIRA 4N6YA 5EFQA 4FV3A 4UY9A 3VUDA 3W1FA 5JFSA 5M06A 3ORIA 1PXKA 4ALWA 1NVRA 2R3HA 4MF1A 1XHAA 4ASDA 4LUEA 4EKLA 2WOTA 4NEUA 2VTMA 4U79A 3OD6X 2WQOA 5AA8A 4BCIA 2WFYA 4E7WA 4FV2A 4K8AA 3PXKA 5JSMA 2WU6A 4PDOA 1BKXA 4RZVA 3ZSHA 3ERKA 4ID7A 3DA6A 4MXAA 4JT3A 2XBJA 5EW3A 3RWPA 4N57A 4FTCA 2X7GA 2QLUA 2VD5A 3UMXA 1AGWA 2BDFA 2HYYA 1MRVA 4UB7A 4HYSA 2V55A 4NCTA 4OTGA 4AW1A 5GZ8A 2PMLX 5M4FA 2QLQA 2WEVA 3V5LA 1H27A 4LUDA 4G3DA 4D9UA 2VTAA 1Q8WA 1ZY4A 2FSOX 2QOKA 3D7TA 5ETAA 4UALA 2C0TA 4FSNA 4GUEA 3TNQB 3ZC5A 3ZDIA 3N9XA 4BB4A 5IQHA 1J91A 4J53A 4BCJA 4MD9E 4ZTNA 4J8MA 3QCSA 3GC9A 1QCFA 5KKRC 2YN8A 3WBLA 3ODYX 2GNHA 4W9WA 5ETCA 4ONAA 3VBYA 2BTRA 3C5IA 4M12A 3F3UA 4NFNA 4LV5A 3LIJA 4O0VA 4WNKA 3ZDUA 4DE4A 5A6OA 1Q8UA 3EQBA 3OWJA 4KWPA 3EQIA 2BAJA 4CFMA 5E91A 2Y4IB 3WILA 4QNYA 3UIXA 3A60A 3QQUA 4EI4A 4XUFA 3HEGA 1XH7A 5C26A 5EYKA 3PZEA 4AGCA 4CFXA 1REKA 3WI6A 3P86A 5M57A 5AUXA 3ZXZA 3R7YA 3VBXA 2FB8A 2QO7A 4OBOA 4YMJA 1EH4A 4GU9A 2OFUA 4R7IA 3GC8A 2W99B 4LFIA 1SVEA 4NIFA 5ANKA 3RMFA 2PSQA 3LCKA 2WPAA 3RM7A 4E4MA 1B39A 2XK3A 3MFUA 4YSMA 5DH3A 4EWQA 2GDOA 3C4FA 2XCKA 2PULA 4AOIA 3I60A 4KKHA 3WYYA 3FJQE 4WA9A 2GQGA 4ZY6A 4CMUA 2WQMA 2XKCA 4EOLA 4CG8A 5M51A 4AT5A 3NNWA 4TN6A 5LVLA 5CSWA 4D1ZA 1TQIA 5JT2A 5HE2A 4JRVA 3EL7A 2F9GA 2A2AA 4QRCA 2J6MA 2JBPA 4GYGA 4AZTA 4AWIA 5A4LA 2PPQA 4X6QC 2WMBA 2PVJA 4OAUC 2LGCA 2PVMA 4IMYA 4DAWA 4F9AA 2FVDA 3A7IA 2XNEA 4BDGA 2AC5A 2J9MA 4OTHA 2CGXA 1MRUA 2Y6OA 4R5SA 1JVPP 2Z60A 3NUYA 3ATSA 3EN7A 3C50A 1NT2A 5IA4A 4BVUA 5I3RA 4ANNA 2QOIA 2OO8X 2WQNA 4JBVA 1DI8A 4MBJA 1OMWA 2HK5A 3RPVA 1O6YA 5IG1A 2XIRA 4AN3A 2XNBA 3R9DA 3ZFMA 2GTNA 3FMMA 4RA5A 4WKQA 4XG9A 4X2GA 3OW3A 3Q32A 2GNLA 2R7BA 5DA3A 5LXMA 4J71A 1WZYA 4IVDA 4I6QA 3QKLA 1OIQA 2ETRA 4BHNA 4D2TA 4EC8A 4HVSA 2XK7A 5IQEA 4GKHA 4UYNA 3NYNA 3RAWA 3VNTA 5K5XA 2ITVA 1JSUA 2RFSA 4NT4A 3HA8A 4A06A 4QTEA 3E8EA 3PJCA 3OOMA 2W1EA 4B99A 2VWXA 4DH3A 1BMKA 5DT0A 1ZYLA 2CCHA 4BRXA 3RVGA 2R2PA 1P4OA 4JX3A 4H36A 5AUTA 5FXRA 3BHVA 4ZS0A 5CQWA 2XNMA 3SAYA 3HRFA 4Y5HA 3BGZA 5FD2A 3H0YA 5BVWA 2WMWA 3QRUA 4JG7A 1ZMWA 3H9FA 4R6VA 5FTQA 3CEKA 3L9MA 3QYZA 4XLVA 2WMTA 5CT0A 3LXPA 1W84A 4MXZA 4PMTA 3W2PA 3R71A 3SOCA 3ZRLA 2WTJA 4AQCA 4EOQA 4EOPA 3FLZA 5LVPA 3SRVA 3FY2A 4Y8DA 4MXYA 4A9YA 5KMKA 3ORZA 2UW7A 2XJ2A 2OXXA 3GC0A 3V8TA 3E3BX 1V1KA 3WF6A 3PJ2A 3F7WA 1H25A 2B52A 4RWLA 4BCMA 3COIA 2VX0A 4K33A 4O0TA 3GVUA 4BTJA 3EFWA 3FLNC 4MAOA 4IX6A 2YHVA 3LFEA 2PK9A 3GU4A 4U8ZA 4QMQA 3R8MA 3JY9A 5TO8A 3TV7A 4C57A 4DFXE 5CF8A 4EH5A 4B9DA 4P5QA 2CKOA 5CTPA 1W98A 1YDTE 4IAYA 4IVAA 4EOSA 3FC2A 4QMOA 2WIHA 5TF9A 3QHRA 2WELA 3ACJA 2C30A 3DBCA 3CY3A 2UVZA 1PMVA 4FTUA 4O96A 3V5TA 4IANA 3HECA 4ANMA 4YZCA 2PVHA 4IFCA 3E7VA 4QTBA 4F9YA 3IKAA 3Q52A 1F5QA 1Q3WA 2J51A 3KMWA 4PPAA 4S34A 3KN5A 5E8VA 5EI2A 2QOOA 4FR4A 5AUZA 3SXRA 5C4LA 3FV8A 3Q9YA 3UVPA 3G90X 3F5XA 5BVEA 3BKBA 3V04A 3GQLA 3A2CA 4KINA 4R5YA 3VF8A 2R3OA 4Z16A 1ZMVA 3S3IA 4E20A 4XP0A 3FLYA 2W1FA 3BEAA 4WG4A 1Y8YA 2PVNA 2BRMA 4A07A 4QP1A 3DLZA 1ZOGA 2OJJA 1YHVA 2YDKA 3DBDA 3EFKA 3NIZA 4LRJA 3MA6A 2JKMA 4RIWA 3ZBFA 3D94A 3DAKA 4GT3A 3DOGA 4DGLC 2X4FA 4G34A 4DHFA 5EH0A 3UGCA 5KBQA 3FI8A 1GZNA 2YACA 2HW7A 3CTQA 2VTLA 2R3FA 4XV9A 4R1YA 5H3QA 2ZV8A 2CLQA 3PXQA 4HCVA 2QURA 3QWJA 4I23A 3SDJA 3LQ3A 3CGFA 3AGLA 1OITA 2GHGA 4FV6A 4WD5A 4EK6A 4EK4A 1UA2A 2A0CX 3DFCB 5DFPA 3D5WA 4FKJA 5KZ0A 3IECA 4UXLA 4L00A 3N4TA 5IQIA 3DAJA 1ZYDA 2RKUA 3R9NA 5FDPA 2J2IB 2PZIA 4D58A 5DMZA 4D28A 3ZMMA 4FKLA 4YC6A 4DG3E 5E8WA 3S95A 1FVRA 2QU6A 2WQEA 2WTWA 3EQCA 3OHTA 4FT9A 1IR3A 2B1PA 4NH1A 5F20A 4GIHA 4GKIA 2C6KA 1JKLA 3DJ7A 3LFSA 4O0YA 4ALUA 1YKRA 5E7RA 3TN8A 4B4LA 3UOLA 3JVRA 4BCNA 5EYCA 1KE6A 2VTHA 3PXZA 5J95A 3L9PA 4QYYA 4C4FA 2HELA 3QFVA 2OH4A 2BILB 3VBTA 3FPMA 3WZJA 2R0UA 4MNEB 4OTDA 3GU8A 2YWVA 5HG8A 4FSUA 3RP9A 3QTSA 4ZMEA 4PV0A 2XNNA 4QMUA 4YTCA 4FIJA 4EHVA 1F3MC 3FUPA 3R7UA 4D2VA 2QG5A 4O7RA 3PG3A 5HORA 3BWJA 5KZIA 4BR3A 3VS6A 5EOLA 2V7AA 2WU7A 4S32A 3ZM4A 1FGIA 2QODA 4KIKA 1ATPE 4ASEA 2B7AA 3NAYA 3HAVA 3ORLA 2Y9QA 3WF7A 4EKKA 4HYUA 3G0EA 4DFBA 4C62A 1CKPA 5ANEA 4C36A 3A62A 3A4OX 3FE3A 4APPA 2VNWA 1A9UA 2JDRA 4G9RA 4X3JA 4JVGA 1KE5A 3EQRA 3C9WA 3DBQA 3OT3A 3BE2A 4EH2A 1BYGA 3G2FA 5CVGA 3R7EA 2IVSA 3BLRA 2HXQA 3B8QA 2XIYA 3DKFA 5AP5A 4U9AA 4QP4A 3KK9A 3NR9A 4YPDA 3FQHA 4CT2A 4D4VA 3LQ8A 3SQQA 2IVUA 3TKIA 5CSVA 1H24A 4ZXTA 2YCFA 2ZYBA 3GENA 4D2PA 1YWRA 3ANRA 3EQFA 4JS8A 4FKOA 5DR2A 1PXPA 4B8LA 2ACXA 4BDAA 2F7ZE 5KMLA 3FZ1A 3OY3A 4E5AX 4YJTA 2OF4A 3NGAA 1R3CA 2PMIA 2XIKA 4AA5A 2WB8A 3GFWA 3EYHA 4I3ZA 2BFYA 4DF3A 4R8QA 2VV9A 1VYZA 4IAFA 3BU5A 1AD5A 3A99A 5EQEA 4ACMA 1GIJA 4Y85A 3TM0A 2XB7A 4MWIA 3V6RA 3EN9A 4IW0A 5BVKA 3P0MA 4EWHA 4V04A 3HV3A 4PMSA 3VS5A 4ZEGA 2XRUA 2YM5A 2C5NA 1ZZ2A 3EN5A 2ZMDA 4Q2AA 2JKQA 2QOQA 2NRYA 2WGJA 4JG6A 4ZY4A 2X8EA 1UU9A 2GTMA 4KRDA 1W8CA 3KY2A 3TXOA 2NRUA 5K0KA 2CKPA 4PDYA 3T3VA 3O71A 5IA3A 4C02A 2PZYA 3HV7A 2F7EE 2VWUA 3WARA 5AP2A 2E9VA 1BLXA 3UE4A 3FDNA 1KV2A 3U54A 3EFLA 3P08A 2WTVA 5L6PA 1O6LA 2ONLC 4TKSA 3THBA 4C37A 5JN2A 3PE2A 2GFSA 4IWDA 4I0RA 5CNOA 5HCXA 3ZFXA 5GZAA 4GUBA 3PY1A 5HO8A 4C35A 2NO3A 4LL5A 3EL8A 1LR4A 2OXDA 3RNYA 3SLSA 4BCOA 4I94A 1JSTA 2A1AB 4P2KA 5I9UA 4X2FA 4AZFA 4E6CA 4EYMA 3EKKA 1TVOA 4L6QA 4YHFA 3E7OA 4F0IA 2UUEA 4OT5A 1YDRE 1IRKA 3K2LA 4YZNA 3TEIA 4EEVA 5CF6A 3VRZA 3ZBXA 4XMOA 2E9UA 4JR7A 2BHEA 4USEA 3UNKA 3GU7A 1J3HA 1URCA 2RGPA 4XOZA 3IW7A 3MH1A 3LLAA 3NUSA 4QTCA 4QTDA 3RKBA 5CAVA 5M4UA 3DFAA 1Q61A 4XG3A 3KRXA 3W8LA 3DPKA 2JAVA 5FUTA 3BGQA 4IB0A 1H1PA 1T46A 2J50A 4GS6A 4YJPA 2YZAA 3MTFA 4YNEA 3KB7A 2HZIA 2E9PA 2C6MA 2XVDA 4LM5A 3W2RA 2I6LA 3COKA 3MDYA 4V0GB 5DRBA 4ZJVA 5ACBC 5CANA 5C8MA 4ARKA 5E8TA 5CSPA 2C5YA 4NW6A 1E9HA 2YIQA 4IZAA 3CQEA 3N4UA 3BHTA 3FEGA 5E9EA 2R5TA 2NP8A 4O0XA 4TWOA 2I1MA 3K3IA 5C8KA 3O7LB 5AV1A 4DGGA 3RBWA 4G9CA 2WTIA 4O7LA 4DCAA 3IG7A 2PL0A 4QMYA 3KRRA 1GZ8A 4YZDA 4DEAA 4Z9LA 5AP6A 3VQHA 5GIOE 1F0QA 1XJDA 1UNGA 3BBTB 4UWBA 4FNYA 4YZMA 5CU0A 4P4CA 5CY3A 4KS8A 4Y83A 4G5PA 2WNTA 4RA4A 4FKIA 5D11A 3VULA 1NXKA 3TCPA 3UC3A 3BIZA 5L2SA 4PTEA 3PJ8A 4CKRA 4BDDA 3C4XA 3FKLA 3M11A 4FUYA 4WNMA 2XZSA 3P1AA 4I6FA 2R3JA 4EZ3A 3TV4A 4EOKA 1JLUE 4OTWA 1PXIA 3OG7A 3I6WA 5M53A 4MNFA 4I22A 1M17A 4RLLA 4L01A 1OBGA 3LOKA 4QP8A 3PVBA 5AV2A 3KMUA 3VUGA 4O84A 3DXPA 3LXKA 4HPUE 4CRLA 4P90A 2V22A 5TOZA 2O3PA 4AZVA 2Z02A 2QVSE 2XNOA 3F3VA 5E8SA 4W8EA 2VNYA 3KXXA 3ULZA 2CNQA 2EB2A 2WTKB 3DDQA 1WVYA 2OICA 3A8XA 3C1XA 4LOOA 4U3ZA 4BCFA 3N51A 5EDPA 4F9WA 4BCGA 4IE9A 3BV2A 2G2IA 2ITUA 4QQ5A 3ZS5A 4CV9A 4WT6A 3HMNA 4YP8A 4CG9A 4FTJA 2YJSA 4GVAA 5LCJA 2C3JA 3R7OA 4USFA 4PY1A 3PG1A 3M2WA 1B6CB 4W4XA 2JD5A 4MXOA 2R4BA 4R3PA 2BHHA 4D55A 5E4HA 4TZRA 3R9RA 1YOMA 2A4LA 5B2LA 3PXRA 5I9XA 4WHZA 4L45A 1OPKA 4OR5A 4ANSA 2HCKA 4JQEA 3BV3A 3T9TA 4ASXA 4X2KA 4I0TA 4GFMA 4M97A 3SG9A 3E92A 3EJ1A 3HVCA 4NM5A 3MVLA 2EWAA 2ZM4A 4LRKA 4MD7E 5CU2A 4CGAA 4BIBA 1Y6AA 1CSNA 2BCJA 2XKEA 2ITOA 4UV0A 5B2KA 4W8DA 5C03A 3W32A 3CJFA 4WIHA 2GPHA 4I6HA 4R3RA 3RK7A 3QWKA 4MXCA 2HAKA 4EL9A 3W55A 1M14A 5JGDA 4YJQA 3GT8A 4X3FC 3F3TA 2WMSA 3ZXTA 3KXMA 4D4RA 4R78A 4AN2A 1WBNA 2HY81 1JPAA 1KOBA 3OC1A 3QC9A 3JXWA 5G1XA 3S0OA 4I4FA 3BPRA 2XK6A 3O8TA 3A7GA 4UN0C 3HLLA 5GJFA 3MGYA 3R0TA 3G51A 4G3GA 3AXWA 4FEUA 1U54A 3FHRA 1JAMA 2XM9A 5EG3A 3VS1A 4G1WA 5D10A 3RI1A 4MTAA 3IS5A 2ITYA 4FT3A 5HLPA 1SM2A 4QQJA 3TJDA 3UP2A 3D7ZA 3NNUA 3MWUA 1J7IA 2Q83A 3CKWA 2P0CA 5HU9A 4GG7A 3NCGA 4A9RA 4FTLA 4ACDA 3E64A 3TKUA 3ET7A 3BGPA 3HMIA 4FTKA 2UZDA 4WNPA 4IC7A 4C4HA 5AR7A 4RX5A 4DC2A 3UJGA 4AU8A 3Q5IA 3UO4A 4H3PA 4CZYB 4CLJA 3FZOA 2HZNA 3R7VA 4WUAA 4E1ZA 2VAGA 2JBOA 4AFJA 4XG2A 3BYUA 3UG2A 3L1SA 2PUPA 3KQ7A 3LPBA 3PJ1A 1WAKA 4WNOA 4CEGA 4NWMA 1H1WA 3QUEA 2W06A 3COHA 3K3JA 4CCBA 3PWDA 2WHBA 4E3CA 2BROA 3LXNA 4FT0A 4M66A 4O6EA 1J1CA 2ETKA 2RFEA 4OTQA 4U97A 1IASA 4B8MA 2JIVA 2IWIA 3QX2A 2BTSA 1OPLA 4L43A 2C5OA 5CU4A 4EZ7A 1Q62A 5A3XA 1ZYCA 5A4TA 3JY0A 3DNDA 5LJJA 5E8UA 2W1DA 4GK3A 1V0PA 4CSVA 2CKQA 4FKTA 3Q3BA 5ITAA 2OKRA 2PHKA 4NW5A 2PZRA 3IW6A 4ZTLA 3VJNA 4BKZA 1G8AA 3A4PA 5EM6A 3D4QA 3WZEA 2O63A 5KO1A 3NW6A 4IZ7A 4JIAA 4WUNA 4F6UA 4TPTA 3DBFA 5L2WA 2RSVA 3RGFA 3UOJA 1JSVA 3I7BA 4K0YA 2YISA 3H0ZA 4M84A 4NM7A 4BBFA 4BCHA 4CZTA 2ZV2A 4RG0A 3G33A 5EHOA 4FIGA 3FC1X 4HPTE 4E6DA 4GK2A 4LG4A 3UYSA 4M69B 5I0BA 3UODA 1PF8A 4AOTA 3QZIA 4CD0A 4JL9A 4MD8E 4ZSAA 3EZVA 3F5GA 4JOAA 3S00A 1CTPE 4YC8A 3FMHA 1HCKA 1P14A 1L8TA 5TE0A 3OWLA 3GU5A 4PF4A 4UWYA 5AV3A 4E26A 3DKCA 3MY1A 4EOJA 4FSQA 4EH4A 4E4NA 5A4QA 1S9IA 4JR3A 1H4LA 2R3KA 4M69A 1SVHA 3DJ5A 4DFNA 4F7SA 3ULIA 1PKGA 4LI5A 3O17A 3QGYA 3QZHA 2BRHA 5CU3A 4H58A 5JGBA 1PXJA 4MBLA 5DIAA 4E5WA 5I3OA 2ZM3A 2BRBA 4IX4A 1OECA 4NTTA 4EH7A 4IM3A 1WBPA 1JQHA 1L3RE 2WKMA 2WMQA 4ITHA 4NL0A 3OUKA 3LCSA 5L3AA 1PXLA 5KBRA 5GJGA 5K5NA 5HGIA 3LMGA 1IA8A 5HBJA 5C27A 5A4EA 5L2IA 3R1YA 1UWHA 3PVUA 3FSFA 4YLKA 5DE2A 4PTGA 3D7TB 4Z55A 1YWVA 3KGAA 3UQCA 4EH8A 1U5RA 1ERKA 3CCNA 1Z5MA 3PE1A 2CSNA 4FSWA 4FV5A 4N4SA 2JDOA 4PNIA 5JEBA 4TYEA 4FIHA 4YJVA 2VTNA 4FI1A 4JAJA 1KE8A 4IX3A 3LMHA 5CYIA 5H2UA 5L2TA 4YTIA 2W05A 2OLCA 4AT4A 1BX6A 4DTKA 2HOGA 4JXFA 2I40A 4TL0A 3SW7A 4IZ5A 2QOBA 3UYTA 5AFVA 2C1AA 4YPSA 4CFVA 5CALA 4CFWA 3II5A 2W0JA 4RWIA 3VHKA 5DEYA 2J0IA 4U45A 3I0OA 4BC6A 3NLBA 5BPYA 4EHGA 2Z7RA 2O8YA 3QALE 4NUSA 3ZC6A 3SV0A 1FVVA 2FSMX 2ITPA 3KRWA 4K11A 4U0IA 5HNGA 3UZPA 3ZFYA 3LFQA 2R9SA 5AM6A 3F2AA 3KULA 1OL5A 4L46A 4NIFB 2OWBA 4L44A 3R22A 4I6BA 3NUUA 4TNBA 2UW9A 4ZJJA 3NUAA 3P7CA 5CF5A 4YJRA 5JH6A 3ZONA 2Y7JA 3QQJA 2BUJA 4IB1A 4QT1A 3O0GA 4FV1A 5IH4A 4GK4A 4I5CA 1DS5A 4FSMA 4GSBA 4OTIA 3UTOA 4A4OA 2R3NA 1GOLA 3KA0A 3C4CA 2R3MA 1KWPA 4MF0A 5T3QA 2ETMA 4PPCA 3BYOA 4EQUA 4WG5A 5BUEA 1IA9A 4G6NA 4F9CA 2VZ6A 4Y5QA 5E8ZA 4F1MA 4DEGA 4F64A 5K4IA 3QCYA 4KKEA 1PXNA 4R1VA 5IEYA 5HX6A 3NZ0A 3E63A 4JDKA 1E1VA 2F2CB 3OW4A 5EI6A 2W4OA 4DTBA 4YGAA 3H4JA 4S31A 5CS6A 3QTRA 3FXZA 3VO3A 5I4NA 4ENXA 4NM0A 3T9IA 5JRSA 2X7FA 3NPCA 4TRLA 3HMOA 4J97A 3PY0A 3REPA 3UPZA 5AX9A 4QP9A 4C3FA 5L8JA 4CRSA 1Q97A 5FLFA 4RVLA 4X6RA 4UMPA 3GQIA 3ZEPA 4ZTMA 4TNDA 4FG7A 5CEKA 5IKWA 4DBNA 3GB2A 4PP7A 2XIXA 4UMRA 3F5UA 2YWPA 3ALOA 5DNRA 4D0WA 2YAAA 3FZTA 3TNHA 4FIFA 4QD6A 3NUXA 5CZHA 4EOIA 5AP0A 4OTPA 4G2FA 4IACA 4EK3A 2Q0BA 2QONA 2IJMA 4NK9A 4ZIMA 2OIDA 2ITZA 4LL0A 3S1HA 1O6KA 5CAPA 3WF8A 3MESA 1R0PA 4BTMA 3TI1A 2IVVA 3R9OA 3UIBA 1M2RA 4FEWA 2IVTA 3EQGA 3ZO1A 2X0GA 1SMHA 1Q41A 3FMLA 2ZV9A 5A46A 4IB5A 4MXXA 3VBVA 4F6SA 3ZHPC 1ZLTA 2VX1A 4FL2A 2QO2A 2BPMA 5KE0A 2EU9A 2C1BA 1FQ1B 3SRVB 5JQ5A 2B4SB 4NJDA 5CWZA 5FTOA 3Q2MA 3TWJA 1Q4LA 5HVJA 2Q0NA 4C58A 3CXWA 4KIPA 2R3GA 3GI3A 2C3IB 4GJ2A 3JVSA 5T68A 3TL8A 2BIYA 5AP4A 2W17A 3DK3A 2GS2A 2JLDA 4FGRA 1ZMUA 3KC3A 3CKXA 1ZYJA 4GJ3A 2OI4X 5D7VA 3CQUA 2VO0A 3QD4A 3QXPA 2DS1A 1GJOA 3AC8A 4G3CA 5FM3A 4ZS4A 3O23A 3FI3A 2KULA 5IDNA 3OZ6A 4M0YA 5DT4A 3UP7A 4DGMA 4JI9A 4NKAA 4QOXA 4YBJA 3TTJA 1YOJA 2QOLA 3R1QA 4RWJA 5HBHA 2W1GA 2YCQA 3MTLA 5J7HA 2ONLA 5KHWA 3SA0A 1H1QA 3CTJA 2IO6A 1PXOA 2OBJA 3FKOA 2YCRA 4XG7A 3WE4A 2YM7A 3Q9XA 4MK0A 2HENA 3MH0A 5D12A 3C0IA 1LPUA 3LFDA 3R83A 2RG6A 1WBTA 3R21A 4KA3A 3EQPA 3AOXA 5D9HA 5DRDA 2VO3A 2IG7A 5FDXA 3U9NA 4EZ5A 2YM4A 3QF9A 3OROA 4OAVB 5AV4A 4FV9A 5AMNA 3FYJX 1DI9A 3CLYA 3GCQA 1YWNA 3R9HA 2B9JA 2O65A 4FVQA 3BCEA 4NSTA 4V05A 3PIZA 3DY7A 3OBGA 4HNIA 4QMVA 2YAKA 4FTOA 4RC2A 5M4CA 4DEBA 4JQ7A 3CQWA 3GCPA 2GFCA 2O0UA 4K6ZA 3U8WA 2C6IA 3C4EA 3E8CA 2C6TA 4R7HA 2PWLA 4D1SA 4FMQA 3ZZEA 3BU6A 4KAOA 3BX5A 3GP0A 2QD9A 1MQ4A 1PMNA 2ITXA 2XUUA 3K54A 4FKGA 4RIWB 5FGKA 3MS9A 2XS0A 3QTUA 4MVFA 4XP3A 5AUYA 2YFXA 3F3ZA 4EORA 3OEZA 5AV0A 3AC4A 5CAQA 2OJ9A 1IAHA 3E62A 4FTIA 3HUBA 3ACKA 3PXFA 3U9CA 3PDTA 4H05A 4C34A 2VWYA 3MW1A 5BVFA 2UW4A 1BL6A 3DJ6A 3OWKA 2VN9A 4BY9E 2WTDA 5LWMA 2UW8A 4R77A 2XF0A 2ZVAA 3D2IA 4O21A 3LKMA 2V5QA 4RJ7A 4BCPA 3U51A 1JKTA 4U40A 4FKQA 1IAJA 3TIZA 4F0FA 4D1XA 1ZY5A 5BVOA 2YLFA 2XNGA 5BQ0A 4IHPA 4XNEA 4HNFA 4J7BA 3EFJA 5DG5A 4NKSA 2X2LA 5GJDA 2VTJA 4Y72A 5HOAA 3UQFA 3W8QA 2Z7QA 2J4ZA 2OZAA 4ZZNA 3VBWA 4D4YA 2PVKA 3TNPC 2CN8A 4K9YA 3CE3A 2C5VA 3P78A 4G3FA 4H39A 4FE2A 3AG9A 1PW2A 1RJBA 4I41A 5IQDA 5HTCA 1ZAOA 2PTKA 3LAUA 5EQYA 1STCE 3EQDA 4G31A 5AP3A 3R8ZA 3ZM9A 4AE9A 1H1RA 4ZSJA 4ANOA 2Z7SA 4MEDA 2UW5A 3LCTA 4F4PA 3GBZA 2X9FA 3QD0A 5EI8A 4FA2A 3O96A 4HGEA 5IQCA 3QZFA 3RK9A 2CHLA 3M1SA 2IW8A 1BUHA 3IONA 1YI6A 3CD3A 3IGGA 3OT8A 4RQKA 2JDVA 4GT5A 4O1OA 5M08A 5KMIA 4BZNA 4PL5A 3ZRKA 4CXAA 3QD3A 4RFZA 4ZJIA 3Q6UA 2W1ZA 5DPVA 4XV1A 5E8YA 2WQBA 3R04A 4KIKB 5LCKA 2QKRA 4YTHA 2XKDA 5ANJA 5HX8A 4YJUA 4CMOA 4DFZE 5CASA 1V0BA 2WZJA 4AUAA 1KE9A 5HD7A 2WEIA 2Y0AA 3R02A 3DZQA 3Q53A 3ID6C 2XA4A 4PDSA 2GNIA 1U4DA 3FHIA 4S30A 2ZB0A 3V5PA 4KBCA 2P2HA 2YABA 5I9ZA 5J1WA 2I0YA 3KRLA 4YO4A 4YZ9A 2OG8A 3KXGA 1CDKA 2UVYA 3P23A 4ZTHA 4F7NA 2ITQA 2W9ZB 2WAJA 2QOCA 4ACHA 1PKDA 3F5PA 5HG9A 3VQUA 1PJKA 3LFFA 2G1TA 3C13A 4DLIA 5JK3A 3MY0A 2CKEA 1QMZA 1W82A 1Y91A 3LLTA 4M13A 4XH6A 5DR6A 3SD0A 1CM8A 2ZJWA 4EJNA 5HD4A 4QQTA 3NYOA 2R0IA 4QYFA 5C8NA 3D2KA 4HW7A 2CGWA 4BIDA 2VTSA 4QMZA 5K9IA 2Z2WA 3RZBA 3LZBA 3DTWA 3OS3A 3PP0A 4AW5A 4BDIA 3GXLA 4X3FA 4X2JA 4OGRA 3U87A 1R78A 4I93A 3HAMA 2F57A 1NY3A 5TR6A 2UZUE 3RALA 3O7LD 3UIUA 3ORNA 3ZUTA 4U41A 3MIAA 3QX4A 3TNIA 4BKYA 2XIZA 1K3AA 5ETIA 4CT1A 4EC9A 4EK8A 1OKZA 4A9SA 4CZUA 4U43A 3VS0A 5J79A 4I21A 4BYIA 3KXZA 4D5KA 3DV3A 4XRJA 2HY0A 5J7BA 4RMZA 1H0VA 3ENHA 1FGKA 2KTYA 2BFXA 1H00A 1JKKA 5CSHA 2XK4A 3BYSA 3QA0A 3G6GA 5F94A 3JPVA 3CIKA 4EH6A 2W1HA 5AM7A 4E6QA 5CNNA 3I1AA 4AE6A 5BVNA 5J1VA 2PMOX 4FT5A 2RG5A 4QPMA 3IW8A 1UKIA 2J0KA 3MFRA 4GYIA 4QPSA 4EOMA 4G5JA 4G6LA 5HCZA 3R8PA 1LP4A 2G2HA 3KVXA 4CFFA 5IMEA 4QTAA 5L2QA 3QQFA 3JUHA 4XV2A 5IH5A 2QR8A 2Y8OA 3DB6A 2YM6A 3S2PA 4BDCA 4Y46A 5LVOA 3GOKA 4R7BA 5M09A 4TYHA 1W83A 3ZSGA 5HEZA 2X9EA 4M3QA 4IDVA 3LJ2A 2OJGA 2GSFA 3V6SA 5FEQA 3BU3A 2R3IA 1A48A 4C4JA 1HCLA 5HLNA 3OWPA 5A6NA 1OIUA 2QQ7A 5KUPA 3GU6A 3HRCA 4E6AA 2XJ1A 3TJCA 4AT3A 2DYLA 4Q9SA 3AMYA 4O0WA 5HO7A 4FVRA 4BIEA 3IDPA 5E8XA 1YRPA 3FZRA 2A19B 3QZGA 4HGSA 4MH7A 4YJSA 3NNXA 4YLJA 4DH7A 3NSZA 4C2WA 4H1MA 2C47A 3C5UA 2BRNA 4FZ7A 4C59A 1ZXEA 4BYJA 4E73A 4JBOA 2JIUA 4RIYA 3OOGA 5KMMA 3SGCA 3P7BA 3QLGA 1FMOE 2YITA 4DITA 4NJ3A 5KNJA 4M0ZA 4TXCA 2G15A 3PY3A 2Z7LA 5K0XA 2YM3A 3E8DA 3ORXA 5EM7A 4WSYA 3DQWA 2HZ0A 4IWQA 4BKJA 3MVJA 2AUHA 4FKUA 3HZTA 3P5KA 1WBSA 5M07A 3PLAE 3EB0A 4L68A 4BWPA 3GC7A 5BNJA 3I4BA 3GEQA 3P79A 5CQUA 1KE7A 4CKJA 3QHWA 4EH9A 3C4ZA 4U3YA 2XNPA 4O7NA 4DH1A 3BI6A 3WZKA 1Y57A 4D0XA 3NMUF 3R30A 3UVRA 3ZU7A 4QMLA 2I0HA 4FV0A 1GY3A 3HDMA 3IK3A 4FKPA 4O7TA 1UV5A 2ITTA 2E9OA 5AX3A 3V5WA 5AUWA 4XLIA 2G01A 1XR1A 3CC6A 1I44A 3MB7A 2UZOA 3MVMA 5AAFA 2BMCA 3ZH8A 4ANQA 4YTFA 5BYYA 5HTIA 4B6LA 3UOKA 1YXVA 3PFQA 3PRFA 4RJ4A 2CLXA 4M7IA 2VX3A 2OGVA 2XRWA 4G16A 1W0XC 1APME 4W4VA 5DLSA 3NWWA 4GFGA 5AEPA 5KKRB 4F65A 3UOHA 3BE9A 2J0JA 3TACA 3ZUVA 4CNHA 3PVWA 4FYNA 3SKCA 4A7CA 4BWKA 3I81A 5L6OA 1GIIA 3EIDA 3TDWA 4BGHA 3R01A 2CPKE 3MV5A 4XG4A 4U81A 4BDFA 2FYSA 5AWMA 4D2RA 3ZLXA 2JAMA 3MBLA 4BFMA 2DQ7X 4ERKA 4DEHA 4RX8A 3TTIA 2H9VA 2J7TA 3KCFA 1WBWA 3BQCA 2VO6A 1JBPE 4GEOA 4U42A 1VJYA 4EQMA 3NVMB 3RK5A 4B0GA 2ERKA 1OBDA 4E5BA 1OB3A 3KL8A 3OTVA 4O81A 3BRBA 3RPSA 3CBLA 4BBMA 1YXSA 3VUHA 4CMTA 3OP5A 1XQZA 2J90A 4IADA 3VS4A 4YUQA 4AGDA 3EKNA 4L7SA 3BBWA 5HNBA 4RC4A 3IPHA 3W16A 2X1NA 2OJFE 3R00A 3RCDA 4HCTA 5LMKC 5IQBA 4OTFA 5B2MA 2CNVA 4EUUA 3QKKA 5H8BA 3R63A 5K3YA 3NNVA 4FTTA 3I7CA 4IAIA 4CKIA 2GS6A 1ZRZA 2YDIA 4MQ2A 2ZMCA 2C0IA 3SX9A 4DBXA 3POZA 1U54B 3RINA 4FV7A 4HGTA 4RGJA 4DH8A 4C2VA 4PMMA 4J96A 4XOYA 4FTMA 3UO5A 1YXXA 2ZAZA 1XWSA 2HIWA 3TUBA 2R7IA 3F3WA 2LAVA 2IZRA 2X39A 2F4JA 2HWOA 2V7OA 2WIPA 4FZDB 4BICA 4ZY5A 2CCIA 2W7XA 3V01A 3NRMA 5HG7A 4EJ7A 3LFAA 5EM5A 4E8AA 2BZJA 4O91A 3KF7A 1ZYSA 4Y95A 5BMMA 2XK8A 3PUPA 4CVAA 4F63A 4KBKA 4K1BA 2VTIA 3U4UA 4MYGA 5J9ZA 5HLWA 4ZZOA 4Q9ZA 5CEMA 5FP5A 4HZRA 2CNUA 2EXCX 2FSLX 2QR7A 1IEPA 4ZTRA 4AW0A 4I24A 2R3RA 4DYMA 3ZO2A 5IZFA 5CI6A 5HIEA 1OKYA 4F7JA 2CGVA 1X8BA 5BYLA 4XV3A 3E88A 3FMDA 5AUVA 3LMIA 4O2PA 4O7YA 2ESMA 5H8GA 3IOKA 3DNEA 4W4WA 1Q8ZA 3A8WA 3QA8A 3C0HA 4OBQA 4RC3A 2PY3A 4HOKA 5ICPA 4R3CA 2UZWE 1KV1A 1Z9XA 3F69A 1XBCA 1Q8YA 4EOOA 4L8MA 4J95A 4QYGA 2P4IA 4ZOGA 3NUNA 4RVMA 5I9WA 4BGQA 4JIKA 3P4KA 3HYHA 3ROYA 4PL3A 5KX8A 4O83A 2XEZA 4FGBA 4RJ5A 5EK7A 3WIGA 3L8PA 3DGKA 4WBBB 3F66A 4AXAA 4I92A 4O22A 1Q99A 3Q60A 3R2YA 4RIXA 4TTHB 3HMMA 3PRIA 4NFMA 3MVHA 2FO0A 5FXSA 3O50A 3QU0A 4PQNA 3QRJA 4ALVA 4M67A 4FEVA 4MCVA 2GQSA 5HKMA 3ELJA 5F9EA 3PZHA 4L3LA 1NVSA 3QRTA 3TZ7A 1VR2A 3EHAA 4ZMFA 4EH3A 4L9IA 4TY1A 3VJOA 4FUXA 5IF1A 4RX7A 1GIHA 4DN5A 3IGOA 2X8IA 2EUFB 3NAXA 4QP6A 1PHKA 2RL5A 3B8RA 3O8UA 5AP1A 3TUDA 2J5FA 2UVXA 5AAGA 1OL1A 1GNGA 5IISA 4FZAB 3AQVA 3KEXA 1JOWB 3OBJA 5HE3A 4MKCA 4X7QA 4PL4A 3BHUA 3R7IA 4LGDA 1RQQA 3TIYA 3V51A 4BBEA 3MSSA 1H1SA 2YCSA 4DEIA 1PYEA 4UWCA 2REIA 3NYVA 3BQRA 4FKVA 3K5VA 4FYOA 2QO9A 3D83A 1XKKA 4IB3A 2XCHA 2WOUA 2B9IA 3FXXA 4YU2A 4FTAA 4F1TA 1CMKE 5KMNA 2VRXA 2X4ZA 3VVHA 2VTPA 1SNUA 5DT3A 1QPCA 4EYJA 5HG5A 2B9HA 3F7ZA 1UU7A 2BZHB 4IVBA 5IQGA 2XH5A 1W7HA 3DK6A 4O7ZA 2W5HA 1GAGA 4O0UA 2O64A 5EDQA 5IEXA 1YDSE 2BDWA 2YIXA 2ZV7A 3B2TA 4FV4A 4BTFA 1K9AA 4H3BA 4OW8A 4GRBA 3WF9A 3TUCA 2RF9A 4AP7A 3TNWA 3VHEA 5C01A 2GNFA 4ITIA 4JDJA 4TT7A 2F49A 4HZSA 4C8BA 4ZZMA 4N0SA 1SYKA 3AT4A 4WOVA 3WZUA 1Z57A 5FBOA 2XYUA 2OU7A 4CFUA 2V0DA 3ROCA 3WE8A 4DLJA 4KB8A 1R1WA 3MYGA 1JKSA 3OEFX 4FL3A 2AYPA 3DK7A 3I6UA 5D7AA 3D0EA 2E2BA 4GIIA 4HGLA 3AMBA 2WXVA 1G5SA 4J99A 4UMUA 4O6LA 4M15A 1WFCA 4HJOA 5CVFA 4ZAUA 3KULB 1WMKA 3FAAA 3LM5A 4FEXA 1Y8GA 2J0MB 4ZLOA 2VGPA 3LXLA 5F4NA 5B0XA 2EXEA 3ZLWA 3W2OA 4AS0A 5CEOA 5IA1A 4C3PA 1CKIA 3AMAA 3F88A 3ZEWA 3U55A 4L3PA 4AFEA 2YJRA 1SZMA 4EBVA 2QCSA 1FOTA 2Y4PA 3UQGA 3ZSIA 3IQ7A 3BEGA 3UO6A 1U46A 3QQLA 4ITJA 3F61A 2UW0A 3P9JA 3MI9A 4RQVA 2XJ0A 3DU8A 1OGUA 2VWVA 4F7LA 3H3CA 2W4KA 4OT6A 2W1CA 4LGHA 3MH3A 2BAQA 5BVDA 4DH5A 3MJ2A 4PX6A 2ERZE 3EMGA 3G9NA 3S4QA 3GCVA 3POOA 5D41A 3NEWA 4QMTA 2GQRA 3UDBA 5FWKK 4XP2A 4AA0A 2W9FB 5DVRA 1XO2B 1ZZLA 3CR0A 5LOHA 3LW0A 1G3NA 4H1JA 4FZFB 1B38A 2OH0E 4RFYA 5CU6A 4L42A 4JX7A 4QMXA 4BDEA 2RFNA 4FKWA 5BMSA 2WTKC 4OBPA 4D9TA 3PSDA 4O82A 4TWNA 4BDBA 5B7VA 5AUUA 4IM2A 3FLSA 1GZKA 3RJCA 5C1QB 4UMTA 1NVQA 4P7EA 4RPVA 3QKMA 1KSWA 5E90A 3LFNA 3PSBA 4PUZA 4AX8A 5HVKA 2GMXA 5JMSA 2DWBA 2X6EA 3G0FA 5DBXA 5HBEA 2IW9A 1OL7A 3K5UA 3Q04A 3U4WA 4C38A 4RJ3A 5IMXA 4IJ9A 3ZYAA 1SVGA 1H08A 3CD8A 3FLQA 4EHEA 3AT3A 5ETFA 1J7LA 4TW9A 1MUOA 2PVRA 3PP1A 3U6HA 3RPYA 3Q9WA 5EHLA 4AG8A 2O2UA 2WD1A 4GH2A 4WG3A 4AGWA 3ZCLA 4ZP5A 3FXWA 4BN1A 3ORPA 4UZHA 5AR3A 5IEVA 3LHJA 3FL5A 4EQCA 4M68A 5IDPA 3CPCA 3F6XA 4II5A 3QRIA 5CSXA 3DQXA 3PA3A 3TG1A 1H0WA 3DS6A 4IBMA 4IH8A 3G15A 4IZYA 5JFVA 4BL1A 3O2MA 2XP2A 2FH9A 3QC4A 4IFGA 4RWKA 2F7XE 1Q24A 4FG8A 5L8LA 2J0LA 5CEQA 5HIBA 1YVJA 3BLHA 4LMNA 3CTHA 1OPJA 2C0OA 4J98A 3DXQA 4LYNA 3UG1A 2PE1A 3C7QA 3O51A 5HESA 3KF4A 1WBVA 3CP9A 5HU3A 3W2SA 2H6DA 3MPAA 4JDHA 1YQJA 1LUFA 3HV4A 2VWZA 4FF8A 1V0OA 4FT7A 4QMWA 3RZFA 3PVGA 5L8KA 4HCUA 4IVCA 4UYAA 4FG9A 4ZLZA 5LQFA 3CS9A 4PTCA 4RVTA 3QQGA 3AC2A 3IDCA 3HL7A 4K2RA 1YHSA 4I5PA 5DYJA 3OFMA 2OJIA 3QCQA 1J1BA 2QNJA 5HNIX 2GS7A 4J52A 4O7VA 5BYZA 3SG8A 1DM2A 4IC8A 4GG5A 3T8OA 1DAYA 4XCUA 4DG2E 2CDZA 5CXZA 3TDVA 3MN3A 4MX9A 1OKWA 3VUMA 5LVNA 3AT2A 3PTGA 2WMRA 4WRSA 4EK5A 5TT7A 4J8NA 4FIEA 4Z7GA 5LWNA 2OSCA 3KXHA 5AA9A 3QYWA 4BCQA 1KOAA 4XBRA 4BZDA 2P3GX 4IIRA 2VUWA 1H26A 2B55A 4KRCA 5T6KA 3PWYA 4YZBA 3BYVA 3QTZA 4O0RA 5CXHA 3R6XA 4IWOA 2C6OA 4YHTA 4BCKA 4A9TA 5JKGA 4AOJA 3R8VA 3TZ8A 1FMKA 4MWHA 1M2PA 3G9LX 1RE8A 3A61A 3EN4A 2C5XA 3TV6A 4KIOA 3L9LA 4ZK5A 4L52A 3FL4A 5ACKA 5IPJA 1XBAA 2WMUA
chains in the Genus database with same CATH superfamily
2BAKA 4DEDA 5ANOA 3H9RA 4QP2A 4I4EA 4YJOA 3FPQA 4O7SA 1RDQE 1U5QA 3VC4A 4RT7A 4DGNA 4PNKA 3UPXA 3QL8A 4BGGA 4F09A 5GHVA 5K4JA 5KMJA 4AAAA 1GZOA 3FBVA 5AJQA 3QGWA 3RTPA 3OTUA 4BF2A 4XHKB 3R8LA 1XH9A 3JYAA 3ODZX 3P7AA 4S33A 3ZLYA 4FVPA 4E4XA 2ITNA 4O4CA 5EKOA 3WOWA 3HV5A 5FP6A 5DHJA 2EB3A 5DI1A 3COMA 2GHMA 3I0QA 3Q4ZA 4IJPA 3SW4A 5IA0A 5HE0A 4JBPA 2ZOQA 3HKOA 3HMPA 4NM3A 4U5JA 4L7FA 5ANIA 3V8SA 5HVYA 5EYDA 4E93A 4Z3VA 4RRVA 4JDIA 5DR9A 4FOBA 4AXFA 3TZ9A 3NW5A 4GCJA 4IAKA 1MQBA 2IW6A 4DDGA 2OZAB 4PMPA 3RHXA 2C6DA 2PE0A 2YLEA 1OM1A 2VTTA 1XH5A 4LOPA 4ZTQA 3I79A 3NW7A 3RAKA 4AN9A 1CKJA 4F78A 4NTSA 5L4QA 5M44A 3HRBA 5AR2A 5EQPA 3JS2A 1YOLA 5LMBA 3IW4A 4FK6A 2BKZA 4I5MA 1JWHA 2JITA 4UEUA 1UU3A 4AZSA 3BL9A 3E93A 3W0QA 5LMAA 5A9UA 2W5AA 5CLPA 3RPRA 3DKGA 4NCTC 3EQHA 4L3JA 4NZWB 4YSJA 2W5BA 3KVWA 2X7OA 3PPZA 5A14A 3QXOA 3QTIA 3ZLSA 4FSZA 2UZNA 4O86A 2AQXA 2BKKA 3QQHA 4LQMA 5CX9A 2BDJA 4ZTSA 4HVGA 2EXMA 3MFTA 4BI1A 3KREA 5EHYA 2A27A 4JBQA 5GNKA 3QTQA 4DFUA 3QBNA 4Q5EA 3H10A 2FUMA 2P33A 4HYHA 4GL9A 4K18A 2JKOA 4BWXA 2WMXA 3UNZA 4G17A 3R28A 3I5NA 4YR8A 4TYGA 1VZOA 4JRNA 3V5JA 1OKVA 3OXIA 1BI7A 4LMUA 3F2NA 4DT9A 5IQFA 2H96A 3Q4CA 4O27B 3IO7A 1XH4A 2XANA 4EUTA 2X2KA 1UKHA 3MPMA 3EYGA 3GGFA 4I5HA 3UNJA 1ZOEA 3Q2JA 2PZ5A 3LVPA 2Y6MA 2GCDA 3RAIA 4C4EA 3QUPA 5HCYA 3LCOA 2SRCA 5EKNA 1YI4A 2QOHA 2RFDA 2UZEA 3FMJA 4WO5A 1Q8TA 4YNOA 3Q5ZA 1M7NA 2JGZA 3MIYA 1YI3A 1R39A 4QP7A 4KSPA 4TWPA 3VUKA 4QMNA 1OL6A 2Y4IC 4KNBA 2R3QA 3VN9A 2UZVA 3W0OA 4XBUA 5FG8A 3D5UA 2HZ4A 3ZRMA 2QI8A 2QHMA 3RAHA 1XBBA 3VWAA 2PVFA 2XYNA 4CYJA 5A54A 2JFLA 4IAZA 3UVQA 4B7TA 4X2NA 4X3FB 5AADA 3R1NA 4RSSA 3IW5A 5LMKA 4FSTA 1WCCA 4DTAA 4UBAA 2NNWB 2V62A 2OFVA 1QPJA 2QKWB 3FYKX 4YJNA 4GT4A 2BVAA 5J5SA 3E3PA 3FY0A 4FX3A 3BHYA 2JDSA 3SVVA 2BR1A 5ANGA 1TFFA 3UIMA 4W9XA 2HXLA 2GNGA 4CTBA 5FM2A 3NFGB 5HI2A 5C9CA 2BZKB 2E9NA 3AC1A 3FI4A 3MY5A 3NUPA 3VIDA 5J9YA 4MNEA 1RW8A 1JNKA 3KXNA 5CZIA 2XARA 5FBNC 3CSVA 3KFAA 3A7HA 3GCSA 2WTCA 4D2SA 5GIPE 4GMYA 2JIIA 5CEPA 2UZLA 1HOWA 1OIRA 3EH9A 3FQSA 4GFOA 4K77A 4QMSA 3CY2A 1REJA 3OXTA 4I0SA 1BL7A 4L53A 1S9JA 4A4XA 4DA5A 1Y6BA 4FNWA 5AR4A 2JKKA 2VWWA 4ERWA 3QAME 2P2IA 1J7UA 1WVXA 3CGOA 3RM6A 2IPXA 2PUNA 1H01A 1UVRA 3PIYA 4FK3A 4F08A 3LM0A 3L8SA 4TYJA 5HQ0A 2VTQA 3DBEA 4G6OA 3AD5A 1SNXA 3PXYA 2HWPA 4QNAA 3VAPA 4GU6A 4RZWA 4U80A 3KU2A 1Q5KA 2YDJA 3PSCA 4O2ZA 2J5EA 4TYHB 2YM8A 2G9XA 4UXQA 4AGUA 3D5VA 3OVVA 4BDJA 3H9OA 4KUJA 3ZZWA 1H8FA 4RBLA 4EBWA 4U7ZA 3QQKA 1VYWA 5HTBA 4AW2A 2PUIA 1LEWA 3BHHA 3GNIB 4JJRA 4PPBA 3NVKI 2UW6A 5E1EA 3VRYA 2C6LA 3CJGA 3UZRA 3D15A 2R64A 4N6ZA 4O1PA 4RJ8A 3VUIA 3VW8A 3U6JA 4YBKA 4PDPA 3MA3A 1LEZA 2ZM1A 4P5ZA 4QMMA 3C0GA 5I9YA 1YXTA 3H30A 1O9UA 1M2QA 2YERA 4RFMA 3HGKA 4FNZA 4RIYB 4C61A 1R0EA 1ZWSA 2JFMA 4KIQA 2DUVA 5AR8A 3FQEA 3F2RA 1OVEA 2EVAA 4FNXA 3E8NA 5H8EA 5HICA 2X81A 3MJ1A 3UMWA 3DXNA 2OW3A 2YA9A 4AZWA 4CV8A 2PYWA 2YEXA 5HO6A 5I5ZA 5IUIA 1FINA 2JEDA 3DT1A 3LFBA 2ZDTA 5CVHA 3ATTA 5C4KA 2F2UA 2IN6A 4X0MA 2B9FA 3RWQA 3RPOA 4AF3A 5JFWA 2JDTA 3Q4UA 5CAOA 3EOCA 4UZDA 1OUKA 4DFYA 5HIDA 4DFLA 4U44A 4HVDA 3MPTA 3KKVA 4RX9A 4AZEA 2C68A 2UZTA 1TQPA 3MH2A 2C6EA 3G5DA 2Z8CA 3V8WA 3OCGA 5FEDA 3OY1A 2IZSA 3BZ3A 3KCKA 4QYEA 2W1IA 3NIEA 5J8IA 3VW6A 5DN3A 4L67A 3SOAA 4IAAA 3F9NA 2PVYA 4FSRA 5JZNA 5AP7A 3L8XA 1BI8A 2X8DA 3QCXA 2I0EA 2CN5A 3Q9ZA 2VO7A 5BUIA 4NYEA 5EOBA 4C4GA 4ZSEA 4W4YA 1P4FA 4OTRA 5IA5A 2CGUA 4BJJB 4I20A 4DGOA 4FC0A 1PMUA 4YLLA 3R8UA 2FA2A 3DKOA 4CLIA 3VS7A 5CT7A 3SXFA 4QPAA 5DOSA 3W18A 1UWJA 5FEEA 2PZPA 3EZRA 3RHKA 3NYXA 2PU8A 3OCSA 4O7WA 1K2PA 4BZOA 4IM0A 4EHZA 1G8SA 5EYMA 2UZBA 2XEYA 3IOPA 1OL2A 3QLFA 4BI0A 3DDPA 4BJJA 2XBAA 4ACCA 4DG0E 3OCTA 3VBQA 5HE1A 3TT0A 3C4WA 1ND4A 4DT8A 3WIKA 3NX8A 4FV8A 4IWPA 4F1OA 4BDKA 3B2WA 5GINE 3FWQA 3T3UA 3ORKA 4OLIA 4V0GA 4S2ZA 1XH8A 2VU3A 3R73A 5LARA 4Z7HA 4GV1A 2IF8A 5DEWA 4D5HA 3V3VA 4Y73A 1FBNA 1QPEA 1PMEA 3UZTA 4AACA 2XM8A 3OUNB 4XS2A 1IG1A 3PPJA 3HUCA 4O0SA 4FBXA 2C4GA 4C4IA 5G6VA 4ANBA 2VGOA 3EWHA 3LE6A 3PIXA 2YIWA 4FODA 4MHAA 4XG6A 5KCVA 4FTNA 3ITZA 3W0NA 4CTCA 4F70A 3F82A 1PYXA 4M8TA 3V5QA 5J5TA 3LCDA 4WRGA 1YHWA 5EW9A 1YXUA 4HVIA 3PA4A 2FSTX 3GOPA 4FKRA 4O38A 4N70A 2BRGA 2W96B 3QTXA 2WMVA 4KBAA 5E92A 5IQAA 5JZJA 4U6RA 5CI7A 4IXPA 4QO9A 5DGZA 4BDHA 3ZO3A 1XH6A 3A7FA 2XMYA 4XRLA 5LVMA 4H3QA 1WBOA 2R3PA 3HA6A 3DB8A 4FTQA 4XEYA 4XJ0A 3SXSA 3ANQA 3D9VA 4C33A 4F6WA 5JFXA 4YURA 2QG7A 5H9BA 4FKSA 3UBDA 4LV8A 3HV6A 4F99A 3OF0A 3NS9A 2PE2A 3SC1A 1UNHA 3LFCA 3AC5A 3TZMA 4BI2A 5IH6A 4XG8A 5JQ8A 4I1ZA 2BZIB 3VF9A 3DAEA 3HNGA 3ALNA 2IZTA 3DLSA 3PPKA 3FMEA 4NU1A 3QD2B 3PJ3A 5F1ZA 5J9LA 5CEIA 4A9UA 3DZOA 1H07A 3ORTA 5HHWA 4TYIA 4DEEA 4JQ8A 5F95A 2BALA 2VTOA 3W2QA 1PXMA 4JNWA 4FZ6A 1NW1A 3R7GA 2BIKB 4WBOA 1I09A 2C69A 3FKNA 3WF5A 2OIBA 4KABA 4IQ6A 5L6WL 4PWNA 4DCEA 5CAUA 2ZB1A 4CCUA 3VS2A 2B0QA 4YC3A 4RJ6A 2RIOA 3BYMA 3FZPA 4KS7A 4QYHA 3D14A 5FTGA 4FSYA 2B53A 3HP2A 3FMKA 1OIYA 4C0TA 3AD6A 2ITWA 4IX5A 4AA4A 3A7JA 3Q4TA 2VWBA 4XX9A 3ORMA 1T45A 3HDNA 4PP9A 1VEBA 2R3LA 3O8PA 2C3KA 3QUDA 5ANDA 4XYFA 1OZ1A 4ZSGA 4KKGA 3ZTXA 4M14A 4RIOA 4ORKA 3PA5A 3U6IA 4CQGA 2H8HA 3PYYA 3LQ5A 3SHEA 3HX4A 3AD4A 1M7QA 2CJMA 2GU8A 5AIKA 3RCJA 1YW2A 3ENMA 3FSKA 4YHJA 5AAEA 3PUFC 3C51A 5E1SA 1AQ1A 4RIXB 2YIYA 4FEQA 3FMNA 3L9NA 4JG8A 4FIIA 4USDA 5A4CA 4LRMA 2OXYA 3UC4A 5I9VA 3DTCA 5CF4A 4CFNA 3FI2A 3VUTA 3LJ1A 3OMVA 1A06A 4Q5HA 4ASZA 2HW6A 5EDRA 5IUGA 3KMMA 1FVTA 2QOFA 3M42A 1FPUA 5KHXA 3BELA 2OIQA 5AR5A 1MRYA 3LJ0A 3MFSA 3W2CA 2OK1A 1PY5A 2QHNA 3FZSA 4DHJA 4RVKA 4A4LA 3OXZA 4OUCA 2G2FA 3L8VA 4IDTA 4GVJA 4LOQA 3VS3A 1E1XA 2JC6A 4QDVA 3KN6A 4GW8A 4KSQA 1OI9A 4MQ1A 3RNIA 2P55A 4KD1A 3Q6WA 4TWCA 3ZUUA 1UNLA 2QC6A 2IZUA 5EW8A 1QPDA 5IA2A 1KUTA 3I5ZA 1G8JA 1TKIA 3D5XA 3N4VA 2CMWA 2GNJA 2AC3A 2XK9A 3DCVA 3IDBA 3NDMA 3W10A 4CQEA 4F0GA 4X21A 4LGGA 2O5KA 2QU5A 2ZDUA 4FOCA 4E4LA 3JR1A 4FL1A 2H34A 3R1SA 3TKHA 3W33A 5BX0A 2VTRA 3ZOSA 2PUUA 5TKDA 4J1RA 4QMPA 4PRJA 4RLKA 4CYIA 5BUJA 4DINA 2GHLA 4ZSLA 4HYIA 5HZNA 2WMAA 5FXQA 4V01A 2VWIA 4EONA 5CENA 3E5AA 1URWA 3FLWA 5J87A 3R2BA 5KMOA 1DAWA 5FRIA 4C3RA 4JLCA 4WSQA 5AIRA 3HP5A 1NA7A 1P2AA 4D4SA 3GUBA 3QRKA 4BHZA 4HVHA 3KRJA 3WYXA 5JGAA 3E87A 2W4JA 3MB6A 3BLQA 3BWFA 5M56A 1QL6A 3ZO4A 2X2MA 4C7TA 4F9BA 3PLSA 3GCUA 2PMNX 4UMQA 3EN6A 1TQMA 4BTKA 1ZOHA 1WVWA 2B54A 3KK8A 2I7QA 1Q3DA 5M55A 4ACGA 3WZDA 4ENYA 5JRQA 1OUYA 4D2WA 2FGIA 3OCBA 2XKFA 1M52A 3ETAA 3GFEA 1H28A 3Q96A 1U59A 4FICA 1UU8A 4QP3A 3AGMA 4ZLYA 5IUHA 5M4IA 2OF2A 3G6HA 5D1JA 4FTRA 2C3LA 3CPBA 4G3EA 4YO6A 5EM8A 4IEBA 3AC3A 5GZ9A 4QQCA 2UW3A 4UX9A 1PRYA 5DWRA 2UV2A 2YZLA 2I0VA 4JAIA 2NPQA 3QTWA 1MP8A 2X6DA 4MBIA 5IU2A 4ANLA 3NCZA 5FQDC 4APCA 2OZOA 2WO6A 1P5EA 2PVLA 1ZARA 2YIRA 4N6YA 5EFQA 4FV3A 4UY9A 3VUDA 3W1FA 5JFSA 5M06A 3ORIA 1PXKA 4ALWA 1NVRA 2R3HA 4MF1A 1XHAA 4ASDA 4LUEA 4EKLA 2WOTA 4NEUA 2VTMA 4U79A 3OD6X 2WQOA 5AA8A 4BCIA 2WFYA 4E7WA 4I6LA 4FV2A 4K8AA 3PXKA 5JSMA 2WU6A 4PDOA 1BKXA 4RZVA 3ZSHA 3ERKA 4ID7A 3DA6A 4MXAA 4JT3A 2XBJA 5EW3A 3RWPA 4N57A 4FTCA 2X7GA 2QLUA 2VD5A 3UMXA 1AGWA 2BDFA 2HYYA 1MRVA 4UB7A 4HYSA 2V55A 4NCTA 4OTGA 4AW1A 5GZ8A 2PMLX 5M4FA 2QLQA 2WEVA 3V5LA 1H27A 4LUDA 4G3DA 4D9UA 2VTAA 1Q8WA 1ZY4A 2FSOX 2QOKA 3D7TA 5ETAA 4UALA 2C0TA 4FSNA 4GUEA 3TNQB 3ZC5A 3ZDIA 3N9XA 4BB4A 5IQHA 1J91A 4J53A 4BCJA 4MD9E 4ZTNA 4J8MA 3QCSA 4DHIB 3GC9A 1QCFA 5KKRC 2YN8A 3WBLA 3ODYX 2GNHA 4W9WA 5ETCA 4ONAA 3VBYA 2BTRA 3C5IA 4M12A 3F3UA 4NFNA 4LV5A 3LIJA 4O0VA 4WNKA 3ZDUA 4DE4A 5A6OA 1Q8UA 3EQBA 3OWJA 4KWPA 3EQIA 2BAJA 4CFMA 5E91A 2Y4IB 3WILA 4QNYA 3UIXA 3A60A 3QQUA 4EI4A 4XUFA 3HEGA 1XH7A 5C26A 5EYKA 3PZEA 4AGCA 4CFXA 1REKA 3WI6A 3P86A 5M57A 5AUXA 3ZXZA 3R7YA 3VBXA 2FB8A 2QO7A 4OBOA 4YMJA 1EH4A 4GU9A 2OFUA 4R7IA 3GC8A 3VONA 2W99B 4LFIA 1SVEA 4NIFA 5ANKA 3RMFA 2PSQA 3LCKA 2WPAA 3RM7A 4E4MA 1B39A 2XK3A 3MFUA 4YSMA 5DH3A 4EWQA 2GDOA 3C4FA 2XCKA 2PULA 4AOIA 3I60A 4KKHA 3WYYA 3FJQE 4WA9A 2GQGA 4ZY6A 4CMUA 2WQMA 2XKCA 4EOLA 4CG8A 5M51A 4AT5A 3NNWA 4TN6A 5LVLA 5CSWA 4D1ZA 1TQIA 5JT2A 5HE2A 4JRVA 3EL7A 2F9GA 2A2AA 4QRCA 2J6MA 2JBPA 4GYGA 4AZTA 4AWIA 5A4LA 2PPQA 4X6QC 2WMBA 2PVJA 4OAUC 2LGCA 2PVMA 4IMYA 4DAWA 4F9AA 2FVDA 3A7IA 2XNEA 4BDGA 2AC5A 2J9MA 4OTHA 2CGXA 1MRUA 2Y6OA 4R5SA 1JVPP 2Z60A 3NUYA 3ATSA 3EN7A 3C50A 1NT2A 5IA4A 4BVUA 5I3RA 4ANNA 2QOIA 2OO8X 2WQNA 4JBVA 1DI8A 4MBJA 1OMWA 2HK5A 3RPVA 1O6YA 5IG1A 2XIRA 4AN3A 2XNBA 3R9DA 3ZFMA 2GTNA 3FMMA 4RA5A 4WKQA 4XG9A 4X2GA 3OW3A 3Q32A 2GNLA 2R7BA 5DA3A 5LXMA 4J71A 1WZYA 4IVDA 4I6QA 3QKLA 1OIQA 2ETRA 4BHNA 4D2TA 4EC8A 4HVSA 2XK7A 4QEBA 5IQEA 4GKHA 4UYNA 3NYNA 3RAWA 3VNTA 5K5XA 2ITVA 1JSUA 2RFSA 4NT4A 3HA8A 4A06A 4QTEA 3E8EA 3PJCA 3OOMA 2W1EA 4B99A 2VWXA 4DH3A 1BMKA 5DT0A 1ZYLA 2CCHA 4BRXA 3RVGA 2R2PA 1P4OA 4JX3A 4H36A 5AUTA 5FXRA 3BHVA 4ZS0A 5CQWA 2XNMA 3SAYA 3HRFA 4Y5HA 3BGZA 5FD2A 3H0YA 5BVWA 2WMWA 3QRUA 4JG7A 1ZMWA 3H9FA 4R6VA 5FTQA 3CEKA 3L9MA 3QYZA 4XLVA 2WMTA 5CT0A 3LXPA 1W84A 4MXZA 4PMTA 3W2PA 3R71A 3SOCA 3ZRLA 2WTJA 4AQCA 4EOQA 4EOPA 3FLZA 5LVPA 3SRVA 3FY2A 4Y8DA 4MXYA 4A9YA 5KMKA 3ORZA 2UW7A 2XJ2A 2OXXA 3GC0A 3V8TA 3E3BX 1V1KA 3WF6A 3PJ2A 3F7WA 1H25A 2B52A 4RWLA 4BCMA 3COIA 2VX0A 4K33A 4O0TA 3GVUA 4BTJA 4AXDA 3EFWA 3FLNC 4MAOA 4IX6A 2YHVA 3LFEA 2PK9A 3GU4A 4U8ZA 4QMQA 3R8MA 3JY9A 5TO8A 3TV7A 4C57A 4DFXE 5CF8A 4EH5A 4B9DA 4P5QA 2CKOA 5CTPA 1W98A 1YDTE 4IAYA 4IVAA 4EOSA 3FC2A 4QMOA 2WIHA 5TF9A 3QHRA 2WELA 3ACJA 2C30A 3DBCA 3CY3A 2UVZA 1PMVA 4FTUA 4O96A 3V5TA 4IANA 3HECA 4ANMA 4YZCA 2PVHA 4IFCA 3E7VA 4QTBA 4F9YA 3IKAA 3Q52A 1F5QA 1Q3WA 2J51A 3KMWA 4PPAA 4S34A 3KN5A 5E8VA 5EI2A 2QOOA 4FR4A 5AUZA 3SXRA 5C4LA 3FV8A 3Q9YA 3UVPA 3G90X 3F5XA 5BVEA 3BKBA 3V04A 3GQLA 3A2CA 4KINA 4R5YA 3VF8A 2R3OA 4Z16A 1ZMVA 3S3IA 4E20A 4XP0A 3FLYA 2W1FA 3BEAA 4WG4A 1Y8YA 2PVNA 2BRMA 4A07A 4QP1A 3DLZA 1ZOGA 2OJJA 1YHVA 2YDKA 3DBDA 3EFKA 3NIZA 2AEGA 4LRJA 3MA6A 2JKMA 4RIWA 3ZBFA 3D94A 3DAKA 4GT3A 3DOGA 4DGLC 2X4FA 4G34A 4DHFA 5EH0A 3UGCA 5KBQA 3FI8A 1GZNA 2YACA 2HW7A 3CTQA 2VTLA 2R3FA 4XV9A 4R1YA 5H3QA 2ZV8A 2CLQA 3PXQA 4HCVA 2QURA 3QWJA 4I23A 3SDJA 4JMQA 3LQ3A 3CGFA 3AGLA 1OITA 2GHGA 4FV6A 4WD5A 4EK6A 4EK4A 1UA2A 2A0CX 3DFCB 5DFPA 3D5WA 4FKJA 5KZ0A 3IECA 4UXLA 4L00A 3N4TA 5IQIA 3DAJA 1ZYDA 2RKUA 3R9NA 5FDPA 2J2IB 2PZIA 4D58A 5DMZA 4D28A 3ZMMA 4FKLA 4YC6A 4DG3E 5E8WA 3S95A 1FVRA 2QU6A 2WQEA 2WTWA 3EQCA 3OHTA 4FT9A 5BV3A 1IR3A 2B1PA 4NH1A 5F20A 4GIHA 4GKIA 2C6KA 1JKLA 3DJ7A 3LFSA 4O0YA 4ALUA 1YKRA 5E7RA 3TN8A 4B4LA 3UOLA 3JVRA 4BCNA 5EYCA 1KE6A 2VTHA 3PXZA 5J95A 3L9PA 4QYYA 2XALA 4C4FA 2HELA 3QFVA 2OH4A 2BILB 3VBTA 3FPMA 3WZJA 2R0UA 4MNEB 4OTDA 3GU8A 3W2RA 5HG8A 2YWVA 4FSUA 3RP9A 3QTSA 4ZMEA 4PV0A 2XNNA 4QMUA 4YTCA 4FIJA 4EHVA 1F3MC 3FUPA 3R7UA 4D2VA 2QG5A 4O7RA 3PG3A 5HORA 3BWJA 5KZIA 4BR3A 3VS6A 5EOLA 2V7AA 2WU7A 4S32A 3ZM4A 1FGIA 2QODA 4KIKA 1ATPE 4ASEA 2B7AA 3NAYA 3HAVA 3ORLA 2Y9QA 3WF7A 4EKKA 4HYUA 3G0EA 4DFBA 4C62A 1CKPA 5ANEA 4C36A 3A62A 3A4OX 3FE3A 4APPA 2VNWA 1A9UA 2JDRA 4G9RA 4X3JA 4JVGA 1KE5A 3EQRA 3C9WA 3DBQA 3OT3A 3BE2A 4EH2A 1BYGA 3G2FA 5CVGA 3R7EA 2IVSA 3BLRA 2HXQA 3B8QA 2XIYA 3DKFA 5AP5A 4U9AA 4QP4A 1G8KA 3KK9A 3NR9A 4YPDA 3FQHA 4CT2A 4D4VA 3LQ8A 3SQQA 2IVUA 3TKIA 5CSVA 4AXCA 1H24A 4ZXTA 2YCFA 2ZYBA 3GENA 4D2PA 1YWRA 3ANRA 3EQFA 4JS8A 4FKOA 5DR2A 1PXPA 4B8LA 2ACXA 4BDAA 2F7ZE 5KMLA 3FZ1A 3OY3A 4E5AX 4YJTA 2OF4A 3NGAA 1R3CA 2PMIA 2XIKA 4AA5A 2WB8A 3GFWA 3EYHA 4I3ZA 2BFYA 4DF3A 4R8QA 2VV9A 1VYZA 4IAFA 3BU5A 1AD5A 3A99A 5EQEA 4ACMA 1GIJA 4Y85A 3TM0A 2XB7A 4MWIA 3V6RA 3EN9A 4IW0A 5BVKA 3P0MA 3AKKA 4EWHA 4V04A 3HV3A 4PMSA 3VS5A 4ZEGA 2XRUA 2YM5A 2C5NA 1ZZ2A 3BL7A 3EN5A 2ZMDA 4Q2AA 2JKQA 2QOQA 2NRYA 2WGJA 4JG6A 4ZY4A 2X8EA 1UU9A 2GTMA 4KRDA 1W8CA 3KY2A 3TXOA 2NRUA 5K0KA 2CKPA 4PDYA 3T3VA 3O71A 5IA3A 4C02A 2PZYA 3HV7A 2F7EE 2VWUA 3WARA 5AP2A 2E9VA 1BLXA 3UE4A 3FDNA 1KV2A 3U54A 3EFLA 3P08A 2WTVA 5L6PA 1O6LA 2ONLC 4TKSA 3THBA 4C37A 5JN2A 3PE2A 2GFSA 4IWDA 4I0RA 5CNOA 5HCXA 3ZFXA 5GZAA 4GUBA 3PY1A 5HO8A 4C35A 2NO3A 4LL5A 3EL8A 1LR4A 2OXDA 3RNYA 3SLSA 4BCOA 4I94A 1JSTA 2A1AB 4P2KA 5I9UA 1OGYA 4X2FA 4AZFA 4E6CA 4EYMA 3EKKA 1TVOA 4L6QA 4YHFA 3E7OA 4F0IA 2UUEA 4OT5A 1YDRE 1IRKA 3K2LA 4YZNA 3TEIA 4EEVA 5CF6A 3VRZA 3ZBXA 4XMOA 2E9UA 4JR7A 2BHEA 4USEA 3UNKA 3GU7A 2X0QA 1J3HA 1URCA 2RGPA 4XOZA 3IW7A 3MH1A 3LLAA 3NUSA 4QTCA 4QTDA 3RKBA 5CAVA 5M4UA 3DFAA 1Q61A 4XG3A 3KRXA 3W8LA 3DPKA 2JAVA 5FUTA 3BGQA 4IB0A 1H1PA 1T46A 2J50A 4GS6A 4YJPA 2YZAA 3MTFA 4YNEA 3KB7A 2HZIA 2E9PA 2C6MA 2X0OA 2XVDA 4LM5A 2I6LA 3COKA 3MDYA 4V0GB 5DRBA 4ZJVA 5ACBC 5CANA 5C8MA 4ARKA 5E8TA 5CSPA 2C5YA 4NW6A 1E9HA 2YIQA 4IZAA 3CQEA 3N4UA 3BHTA 3FEGA 5E9EA 2R5TA 2NP8A 4O0XA 4TWOA 2I1MA 3ML1A 3K3IA 5C8KA 3O7LB 5AV1A 4DGGA 3RBWA 4G9CA 2WTIA 4O7LA 4DCAA 3IG7A 2PL0A 4QMYA 3KRRA 1GZ8A 4YZDA 4DEAA 4Z9LA 5AP6A 3VQHA 5GIOE 1F0QA 1XJDA 1UNGA 3BBTB 4UWBA 4FNYA 4YZMA 5CU0A 4P4CA 5CY3A 1XMMA 4KS8A 4Y83A 4G5PA 2WNTA 4RA4A 4FKIA 5D11A 3VULA 1NXKA 3TCPA 3UC3A 3BIZA 5L2SA 4PTEA 3PJ8A 4CKRA 4BDDA 3C4XA 3FKLA 3M11A 4FUYA 4WNMA 2XZSA 3P1AA 4I6FA 2R3JA 4EZ3A 3TV4A 4EOKA 1JLUE 4OTWA 1PXIA 3OG7A 3I6WA 5M53A 4MNFA 4I22A 1M17A 4RLLA 4L01A 1OBGA 3LOKA 4QP8A 3PVBA 5AV2A 3KMUA 3VUGA 4O84A 3DXPA 3LXKA 4HPUE 4CRLA 4P90A 2V22A 5TOZA 2O3PA 4AZVA 2Z02A 2QVSE 2XNOA 3F3VA 5E8SA 4W8EA 2VNYA 3KXXA 3ULZA 2CNQA 2EB2A 2WTKB 3DDQA 1WVYA 2OICA 3A8XA 3C1XA 4LOOA 4U3ZA 4BCFA 3N51A 5EDPA 4F9WA 4BCGA 4IE9A 3BV2A 2G2IA 2ITUA 4QQ5A 3ZS5A 4CV9A 4WT6A 3HMNA 4YP8A 4CG9A 4FTJA 2YJSA 4GVAA 5LCJA 2C3JA 3R7OA 4USFA 4PY1A 3PG1A 3M2WA 1B6CB 4W4XA 2JD5A 4MXOA 2R4BA 4R3PA 2BHHA 4D55A 5E4HA 4TZRA 3R9RA 1YOMA 2A4LA 5B2LA 3PXRA 5I9XA 4WHZA 4L45A 1OPKA 4OR5A 4ANSA 2HCKA 4JQEA 3BV3A 3T9TA 4ASXA 4X2KA 4I0TA 4GFMA 4M97A 3SG9A 3E92A 3EJ1A 3HVCA 4NM5A 2XAMA 3MVLA 2EWAA 2ZM4A