5ITAA

Crystal structure of braf kinase domain bound to az-vem
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
271
structure length
250
Chain Sequence
DDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHASETKFEMKKLIDIARQTARGMDYLHAKSIIHRDLKSNNIFLHEDNTVKIGDFGLSILWMAPEVIRMNPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIEMVGRGSLSPDLSKVRSNCPKRMKRLMAECLKKKRDERPSFPRILAEIEELA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
publication title An integrated model of RAF inhibitor action predicts inhibitor activity against oncogenic BRAF signaling
rcsb
source organism Homo sapiens
total genus 78
structure length 250
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5itaA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5itaA01
2GNJA 2HWOA 4FTOA 2Z02A 1OL1A 3M1SA 3PXKA 1OL7A 3FMLA 3QXPA 2LAVA 3R8VA 3QUDA 4V0GB 5EOLA 3FC2A 3C4XA 4D4VA 1FGIA 4GKHA 3GQLA 1IG1A 3FI8A 3RWPA 2BIYA 4AX8A 2YZLA 3RM7A 5EW3A 2P3GX 4BWPA 5IA3A 4ANSA 3Q32A 2YDKA 3ZFXA 1BL6A 2UW3A 5HD7A 4WT6A 5IH6A 4QP6A 1ZZLA 4FV0A 4BICA 4O0TA 3FPMA 3QQKA 2W96B 2C6KA 4WSYA 2BRMA 3R9RA 4ITJA 4ZMEA 4KBKA 2J2IB 4Q2AA 5GZ8A 1KV1A 2XKDA 4JRVA 2GS7A 4MF1A 4KKGA 4IE9A 1XH6A 3R7GA 4NWMA 4BDFA 4O7SA 4RSSA 3MTFA 3D4QA 1YOMA 3OTVA 4L45A 5E8SA 3TKUA 4NM0A 4D2VA 1STCE 4C0TA 3O23A 2QOFA 1PMNA 4S32A 1IEPA 4YJRA 4D4SA 4OTGA 1M2RA 1FPUA 3UZRA 4CFXA 3Q9YA 2PVNA 2J9MA 2C6MA 4BZOA 4GJ2A 5D11A 4JG7A 1Z5MA 5HZNA 3P9JA 4GEOA 3PXYA 3KCFA 5BUIA 2G2IA 3GC7A 3DKCA 4HYIA 2C5NA 4BBFA 4BDIA 3NRMA 4NKSA 4FODA 5IPJA 2I6LA 3DU8A 3KMUA 4G6OA 1XO2B 3R9NA 3E63A 4KS8A 3V04A 4XG6A 4QYEA 4HVGA 2G2HA 3S95A 3UPXA 3R0TA 1SVGA 4ZXTA 1OIYA 5IA1A 3R2YA 3OWLA 4XBRA 3V01A 3TUBA 4Y5QA 3S0OA 1SZMA 5H8EA 2VTOA 3FZSA 2CLQA 2HELA 2ZDTA 2GS6A 5EI8A 4JT3A 3H30A 4WG3A 4BZDA 4NK9A 4WSQA 2QOHA 4G3CA 2SRCA 4ERWA 4QNYA 1P4FA 2DYLA 2QI8A 3ANRA 5DRDA 5TF9A 2XIXA 2BFYA 2QOOA 3LQ3A 4RJ4A 1UKIA 4HPUE 1L3RE 4MCVA 4MQ1A 4M67A 5LJJA 5HIBA 4AG8A 3O50A 3VBVA 3C50A 3UIXA 3W2OA 2GNIA 2VUWA 4CMTA 3R7OA 4N0SA 4BCGA 4A9SA 3FZ1A 2I0YA 2XH5A 5DHJA 4JAJA 5KMIA 2ONLC 2Y8OA 4IEBA 2Z2WA 3OBGA 4XX9A 3LFAA 1FMOE 2OJIA 3OTUA 4RPVA 5JFVA 2YWVA 3OXTA 5FM3A 3HMOA 2OSCA 4MNEA 2JKKA 3OEFX 5AAGA 2ITOA 3Q6WA 4QTDA 3QRUA 3DBFA 5L2TA 4RT7A 2W9FB 4CRLA 3V5JA 4P7EA 3A2CA 5EM5A 3NNUA 4NSTA 4EOPA 4NFNA 4RZVA 2WNTA 4RBLA 2BVAA 2OZOA 4YR8A 3V8SA 4AACA 5AP6A 3QD2B 4FBXA 1J1CA 4IMYA 1H4LA 2XNBA 3LCTA 3E8EA 5ANDA 2JDTA 3SKCA 5JGBA 1QMZA 3M42A 4E4NA 4DEGA 1Y8YA 1KV2A 4RA5A 4O7YA 4DGNA 5F4NA 3PIYA 4K11A 4U43A 5D12A 3ZMMA 5G1XA 3ZM9A 1PMUA 3HZTA 4RX5A 4OAUC 4U42A 3U6JA 5AR3A 3DJ5A 5HTCA 1KWPA 1UWJA 4IX5A 4OTHA 4CMUA 4F9WA 2QD9A 3AGLA 5JMSA 3OF0A 5CU3A 3F3VA 4CD0A 2IJMA 3N51A 3Q4CA 4J95A 3BHUA 1NA7A 1Q3WA 3FMEA 1HCKA 1UU3A 2R3PA 4G3GA 4X7QA 5CQWA 4JX7A 1YOLA 5HE2A 2J90A 2JKQA 3CY2A 3QCSA 4Q9SA 5ETAA 4AZSA 4G5JA 4J71A 4AN3A 4H3QA 3KMMA 2C6IA 5FRIA 5HESA 2GQGA 3SOCA 4L3LA 3ZDIA 3EN5A 5L4QA 1OPJA 5K5XA 3VS2A 1YHWA 3CGFA 4V04A 4RJ6A 3ID6C 2IZSA 4YZCA 1B38A 2B9IA 3CD3A 2GPHA 1Q97A 3AMAA 3UG1A 3VC4A 3OHTA 2CCHA 3C51A 3DLSA 3QTRA 4AE9A 2AUHA 1BLXA 2ZYBA 3P7CA 4GT5A 4QMLA 4D2SA 5IA0A 4DH3A 5CSPA 5AP4A 3CC6A 3GU5A 4CSVA 3C7QA 1J3HA 4XRLA 3DFAA 4ALVA 4KIKB 4BBMA 2QO7A 3K3IA 3SOAA 5E1SA 5GIOE 3GGFA 5CF6A 5HD4A 4MBIA 1DI8A 4NKAA 3FMJA 4EOOA 2ITPA 4LOQA 5CWZA 2UW6A 3NUAA 4F08A 2KTYA 2YITA 4YNEA 4HGSA 2R3IA 4XV1A 5KHXA 4ZS0A 4E4MA 3SV0A 3QYWA 3O8UA 3R73A 4S33A 4I0RA 4PMSA 2BROA 4TW9A 4F64A 4W4XA 2WMXA 4FKVA 4ACMA 3RALA 4CFUA 4FZ7A 1CMKE 3ZU7A 4USEA 2P55A 3OUNB 1DAWA 1KE9A 5EM7A 3ZSIA 3EQRA 4A7CA 1J7UA 2ZMDA 1ZXEA 5HNBA 5HOAA 1Z9XA 1YRPA 5E8XA 3WIGA 5IQCA 4GFGA 2XNOA 4LMNA 4QP7A 4D1ZA 3BYOA 4O2ZA 4XG2A 3TZ9A 3DBEA 4U79A 2PVYA 2IW9A 3ZEPA 2J5EA 2X6EA 3EFKA 3NNVA 4AGUA 3TNIA 4UY9A 4XG4A 2R3HA 4RVKA 3G6HA 3I6UA 4FK6A 3KULB 4FSQA 3H10A 4FIIA 2DUVA 4V0GA 3JY0A 3TZ8A 4R1YA 3KN5A 3OXZA 2XRWA 4IVCA 5HVKA 4PP7A 2FSTX 1NW1A 3BPRA 1YWVA 3OEZA 4E5WA 2HENA 4QQ5A 3IDBA 1P5EA 3A7HA 4YJSA 5CAQA 5IMEA 2YHVA 4FNZA 5DOSA 3UE4A 3CS9A 3PJ1A 5AAFA 2VTTA 5EKNA 3P79A 4IC8A 4FTUA 3KN6A 3BEGA 3R1NA 3S4QA 5E8WA 2IZUA 2Y6OA 3VS0A 4O7VA 3U55A 3PXQA 1O6YA 3E8CA 5HCZA 1W98A 4R3CA 5A6OA 3RPRA 4R5YA 3VF9A 2XJ1A 2XRUA 4LRKA 3UOLA 4BCMA 3NVMB 4WHZA 2R3NA 4TT7A 3LJ2A 4IVDA 3N4UA 2B4SB 2GNHA 4YZNA 4GIIA 4FTKA 4QMTA 2QVSE 4QMWA 4FTRA 5FLFA 3WYYA 2XA4A 2HK5A 3BHHA 1B39A 3V6RA 3DK6A 3QUPA 4Z9LA 4FSUA 4FTTA 3TV4A 3KFAA 4D4YA 2VO0A 3FQEA 4ID7A 2OJFE 4U45A 3VS6A 4BZNA 5L6WL 5FWKK 1F3MC 3R8ZA 5FP5A 2VWUA 1PRYA 5DNRA 5A4CA 4AA0A 3A61A 5CNNA 2IG7A 4FSZA 3A7GA 4H36A 2BZJA 3FI2A 4UMRA 3E3PA 3EN7A 5DIAA 4D2RA 5BUJA 3D0EA 4CFVA 1G3NA 4RJ8A 3LOKA 5EOBA 2A19B 2XKCA 4GKIA 1WBPA 5IQEA 4O84A 3UOKA 2CKQA 4KA3A 2QCSA 3VRYA 4ERKA 5J9LA 4MYGA 3LFNA 4RIXB 1E9HA 3CBLA 4FT5A 3W2RA 1JOWB 1VYZA 3QQUA 4U41A 3W8LA 5DLSA 4FT0A 4L8MA 3BLQA 1OM1A 2QODA 4FV8A 2O2UA 4Q9ZA 2BAJA 1Q8ZA 2ITXA 2XK8A 3MVMA 4IQ6A 4QP3A 2EU9A 2OBJA 4TPTA 4DH7A 2JBOA 3PIZA 3P78A 3R22A 5HGIA 3MW1A 2IWIA 3NCGA 3MPMA 3Q5ZA 4ENXA 1PXOA 3O7LB 4AW2A 4C58A 5IA4A 5IH4A 4DT8A 2ITVA 3Q2JA 4XHKB 4BN1A 3HUBA 2C5VA 4FL2A 3HMIA 2UV2A 4FV9A 4QOXA 4WNOA 1TQIA 5H8GA 2JAVA 3RAHA 3POOA 1OZ1A 5CT7A 2EVAA 2W1FA 3SDJA 5J5TA 1Y6BA 2JIVA 2QU5A 1Y91A 5EI6A 4FEQA 4AWIA 4AFJA 4TY1A 3DPKA 3E7VA 1M7NA 3WF8A 3MVHA 4ANNA 1J7LA 3FQHA 1PF8A 4MBJA 4IM3A 1RE8A 5CAOA 5C8NA 2PUNA 3CE3A 3COIA 4U44A 4BDGA 4DH5A 2XNEA 3P0MA 4RC2A 4IAYA 2PK9A 4IFCA 4BY9E 1Q61A 2JBPA 1OMWA 4NW5A 4ZY4A 4I21A 4YTCA 5E8YA 4QQCA 4C2VA 5EH0A 3BBTB 4FEUA 3OXIA 3DKOA 2B7AA 2PMNX 5JFSA 3PJ2A 2WGJA 1CDKA 3I5NA 3LQ5A 3CQWA 4JJRA 3BKBA 3V5WA 3IOKA 3HNGA 4LL5A 2JD5A 4WA9A 3NUUA 3TNHA 4AN9A 3FMHA 4HCTA 4X2GA 4QMNA 1JNKA 4FSMA 5AV2A 4RVLA 5I9XA 3SGCA 1LPUA 3JUHA 1VJYA 1SNUA 5J87A 4CGAA 1S9JA 4YTHA 2XNMA 5HORA 3VJNA 5E91A 3QKKA 4Q5EA 2X8IA 2I0HA 4IAKA 3EWHA 4RWLA 4ONAA 2EB2A 4DEHA 5KZ0A 4QO9A 4U40A 3P23A 3V8TA 3AC2A 5LVLA 2VAGA 2FGIA 3W2QA 3AMYA 4EH4A 2WMWA 3VUIA 1CKIA 3OP5A 3I7BA 3ZM4A 3SHEA 5EDPA 1O9UA 3BLRA 3QHWA 4IB0A 4HPTE 3G9LX 1PXLA 3QZHA 1GIJA 4I6FA 4MXAA 3MDYA 4PL4A 5BVWA 3LCOA 4OTWA 4C33A 2VWVA 1DI9A 3LCSA 4BDJA 2XYNA 2QC6A 4I20A 3RK9A 4TL0A 4DF3A 3WF5A 2W06A 2Z7QA 5G6VA 4IAZA 2W1IA 2ZMCA 4O96A 5LCJA 2J0IA 3TDWA 1KE7A 2QU6A 4CXAA 4F1MA 2OICA 4JOAA 2AYPA 4LL0A 3R9DA 4E26A 1LP4A 2C6OA 4E93A 4YTFA 2OO8X 3TIZA 3TN8A 3MTLA 2NP8A 4FKWA 4RC4A 3R28A 5H9BA 5HBJA 2WOTA 2F7EE 3LCKA 1Q8TA 3E87A 5BVNA 4PL5A 3BU6A 1FOTA 1PYXA 2R3OA 1KE8A 1KE6A 2BRNA 3NDMA 3RPYA 4BKZA 3G33A 5ANIA 4CZUA 3K54A 5JQ5A 3UNKA 3FWQA 4YZ9A 2JEDA 4GMYA 3ETAA 1P4OA 4G9RA 2WQBA 3NPCA 4IWPA 3SD0A 3F2RA 4PV0A 5HO6A 2CLXA 2ITUA 2OJJA 3EFJA 4XP3A 5HTIA 2RKUA 5BVFA 3FC1X 5A4TA 4MF0A 3COHA 3GT8A 4C3RA 3AGMA 4WRSA 3AT2A 3IQ7A 4FIHA 4MEDA 1GAGA 3KXMA 2GTMA 4CV9A 4ZTSA 1JKKA 3O8PA 3BGZA 2ITYA 2ZV9A 3KA0A 1FVVA 2XIRA 3LLTA 5JRSA 3R00A 3ORLA 1DM2A 4U9AA 3WE4A 3V5LA 2UUEA 2YAAA 3I0QA 5AV3A 2VX3A 1GZ8A 3PXFA 3TDVA 4DEAA 3OCSA 2J0JA 2FYSA 4D0WA 5JEBA 2XMYA 3KB7A 3ZFYA 3FL5A 1IA9A 1XJDA 3CXWA 4L53A 4AW5A 3PA4A 1ND4A 1NVSA 2GQRA 5IEYA 5CYIA 3N4VA 3KCKA 4ZY5A 5FTGA 5A6NA 1PMEA 2OH4A 3R04A 1OB3A 1WBSA 3DNEA 2WEVA 3DXPA 4C59A 4RVMA 5HG8A 2QURA 4BHZA 3CTQA 2JC6A 4M69A 4O86A 3KULA 1I44A 2X8EA 2QHNA 4XLVA 4RFMA 3FMKA 1PMVA 2W1GA 2BKKA 2BHHA 1JPAA 3TWJA 4O0VA 1YWNA 2PZRA 1F5QA 3CIKA 3DJ7A 3GXLA 4KINA 3TCPA 3GFEA 3RNIA 3U4WA 4A9UA 4D2PA 2UZOA 2E9NA 5CZHA 2BPMA 2IZTA 3ZO2A 3VUTA 4IZAA 3BEAA 3LFDA 4EWQA 5HU3A 2HYYA 5L3AA 4MNEB 2VWIA 3DAJA 3MH1A 3NUNA 3QKMA 4L7FA 4NTTA 4R8QA 3Q9WA 4V05A 2YEXA 1ZARA 4EZ3A 4M84A 4DGMA 3OW4A 2X2LA 3HEGA 5J1VA 1KOBA 2VTJA 2J0MB 4MD9E 3NIEA 4O0WA 3P08A 1Q3DA 4GK2A 2B53A 4ASEA 3BV2A 3BHVA 3WARA 4BGQA 2X9FA 3SLSA 3JVRA 4DEBA 4CYJA 3PY1A 1L8TA 4ZTNA 3DXQA 3QWJA 3LZBA 3QTQA 2PVRA 4ZLOA 3BWJA 3HV4A 2OXXA 3ACJA 4CFWA 4P4CA 4J98A 4L46A 4KNBA 3EHAA 5CU6A 4CZYB 3GI3A 4PTGA 4X2KA 4YLJA 2PULA 1IASA 4J1RA 4ZSEA 1FQ1B 4O0YA 4EWHA 1B6CB 2ETKA 5AP0A 5AR8A 4I5HA 4FTMA 4UMQA 2R3LA 2Y0AA 5E8TA 3I0OA 3QQHA 3VN9A 4IJPA 3IW6A 3KEXA 3PFQA 4X6RA 4S30A 1ERKA 1PKDA 2OI4X 2J4ZA 5LMAA 3ZLSA 2YM6A 3BRBA 4J8NA 4ZSLA 1BI7A 1ZAOA 2BAQA 2X8DA 2ZVAA 4IZ7A 3UIUA 4EZ7A 3BQCA 4K0YA 3FMMA 3HP5A 4RQVA 5I5ZA 4FKRA 4RIXA 1OKVA 1AQ1A 2WMUA 4FSWA 2O65A 4DH1A 4HVDA 5M44A 5L6OA 4E4LA 4D28A 1PHKA 3QD0A 5IA2A 5KKRB 4YP8A 4ZTMA 3MB6A 3RHKA 5KX8A 2WTIA 3R8LA 5AV0A 4Z16A 1WCCA 2XK7A 3LFQA 4WNMA 4EOJA 5KKRC 2PVHA 4YUQA 1HCLA 5EYMA 2YZAA 5C8KA 4FVRA 3G9NA 3NAYA 3HRFA 4CKIA 3PP0A 2XNPA 1WBWA 3IOPA 4EJNA 3LXPA 1WVXA 2V55A 3VHEA 3ZC5A 3DA6A 3QLFA 3PRFA 2R9SA 3DZQA 5IDNA 4M8TA 4O0XA 3O2MA 4F7JA 5AP2A 3D14A 2QOCA 3KXHA 5DEWA 5BQ0A 4EUTA 1P14A 2QONA 5J7HA 3FMDA 3CY3A 1YI4A 5CALA 5J1WA 1JWHA 2HY0A 3TKHA 3LHJA 5KMNA 3BE2A 4NIFB 3S00A 5IQGA 1QL6A 4FG7A 3KRRA 4E3CA 2GDOA 3U6IA 2A0CX 3DS6A 4QYFA 3R7UA 3TJCA 2VTIA 1YW2A 2ZV2A 1H07A 3KK9A 3EQHA 4WUAA 3TZ7A 3UOJA 2G2FA 5JZJA 5CXHA 2XM8A 1XQZA 3AXWA 3QD3A 4HYSA 4KSQA 4ZS4A 5IG1A 4OT6A 2WFYA 5AWMA 3HP2A 4JI9A 5EYCA 3F2AA 1YHVA 4QMYA 4IAAA 1BI8A 3CP9A 2A27A 2VX0A 5AUWA 3H9FA 2FSMX 1CM8A 4KRDA 3BGQA 4EOKA 4IM0A 4L7SA 5L2WA 3SG8A 4EKLA 3HGKA 4F70A 2F7XE 4AS0A 4EC8A 4OT5A 4IVAA 3AOXA 3TI1A 2WQEA 4BIEA 2H34A 4L42A 4F9CA 2CGVA 2XJ2A 2GTNA 4RC3A 5CAUA 1FVTA 1NVRA 2BRBA 3PPKA 4BKJA 2W1HA 3F7WA 4M97A 4DTKA 1TVOA 3T9IA 4C61A 5EW8A 4AT3A 2PMOX 2CKPA 4U0IA 1H0WA 4IJ9A 4EI4A 3TV6A 4QPAA 4DTBA 3LFSA 4GV1A 4FX3A 3FMNA 4YZMA 3LFBA 3KF4A 1RW8A 3BX5A 3BGPA 4BCIA 2IN6A 2VGPA 4I23A 1QPCA 3C13A 3EN6A 4M14A 1ZY4A 1VZOA 4G2FA 4H1JA 3ATTA 4Y46A 5BMMA 4UB7A 3D7TA 3ULIA 4FT9A 3ZC6A 2NO3A 1ZYLA 4XS2A 1BKXA 3DCVA 3L9MA 3W18A 3FPQA 4AZFA 4AXAA 1H1RA 3Q2MA 5EDRA 1UU9A 3Q6UA 4B9DA 3PXRA 4FKOA 5GZ9A 3DY7A 3Q9ZA 4C4GA 4WNKA 3EN4A 4YJNA 2EXCX 3ZH8A 5C27A 4I0SA 3HV7A 3FDNA 3QTXA 4QTAA 4IB3A 3H0ZA 3UQGA 2CNUA 3R6XA 3EQBA 4O22A 3QA8A 1TKIA 2B54A 1LUFA 4PRJA 2ACXA 2V5QA 3SXFA 5AAEA 3UC3A 3F5GA 4FOBA 4BCFA 3SVVA 4NH1A 4E7WA 4OLIA 4FTIA 1ZOHA 3DOGA 4OTFA 3PWYA 3JS2A 2QHMA 5ANKA 4FUYA 5FG8A 4UWYA 5E8ZA 2XCKA 3W1FA 3QTSA 4M15A 4GK4A 5T6KA 2R3RA 4YJVA 1OKWA 2GU8A 1PKGA 3NSZA 2XZSA 2YIWA 3NYXA 4WBBB 4XV2A 4B6LA 1Q5KA 2VTNA 4RFZA 4QMZA 4EJ7A 2PL0A 3VW8A 3I60A 4FKLA 5IEVA 4BB4A 1H1WA 3HVCA 4GUBA 4GW8A 5ETIA 2A1AB 5FUTA 4P90A 1KE5A 3DZOA 3RPVA 2YJRA 3SC1A 3E5AA 3R83A 4O7ZA 4FNYA 2VZ6A 5KNJA 5LCKA 5AUUA 3V5QA 5CEOA 4YJTA 3G0EA 3MGYA 3FXWA 4ZAUA 1GNGA 5ETCA 3GEQA 5LARA 3SQQA 3CSVA 1UNGA 4Q5HA 3GU7A 4AU8A 2ITQA 5CSVA 4EHZA 2BZIB 3PRIA 4TNDA 4CFMA 4BCQA 4F1OA 2UZLA 1FMKA 5M09A 1J1BA 2ZB1A 4M68A 5LOHA 2E9PA 5TR6A 1YHSA 2RFEA 2WTVA 4OTPA 3PPZA 5AV4A 3A99A 3MA3A 4RZWA 5HEZA 4BDKA 3KREA 2Y6MA 2ZB0A 2X7FA 2G9XA 3FV8A 4I94A 2C3JA 4ALUA 3GQIA 3R7IA 2CDZA 4ASXA 3LXNA 4A4OA 3E7OA 2OIBA 5IQIA 3MS9A 3AT4A 4L00A 4QMPA 4MXYA 3D2IA 5HG7A 4C4HA 4EEVA 2BMCA 3UBDA 4DYMA 4EK4A 1Q41A 2XK4A 1IRKA 2VWZA 3FL4A 5M56A 1VR2A 2BCJA 4IANA 2VD5A 3NVKI 2WIHA 5B2LA 5CU2A 4EORA 3RBWA 2F57A 2YERA 2CSNA 4YU2A 3KMWA 4F99A 4IWDA 5M4CA 4D58A 4NL0A 4RIOA 1OKYA 3EL7A 3QCQA 4MH7A 2HY81 1PY5A 4AZVA 2W1ZA 5FD2A 1MRYA 3K3JA 4EONA 4W4VA 2HZ0A 4TN6A 5I9ZA 3SAYA 4IZ5A 3F88A 4O6LA 3S1HA 2BUJA 3ATSA 3UQFA 4TYHB 4JDKA 3EJ1A 3TUCA 2V22A 5CZIA 3NWWA 1QPEA 2R3MA 2RFNA 4DGOA 3OUKA 5CEPA 4JQ8A 4LV8A 2E9VA 4R7HA 5DT0A 2WQOA 4O1OA 1YVJA 5DH3A 3O51A 1PYEA 5HLWA 4USDA 2QOBA 5LQFA 4L3PA 1GY3A 2FSOX 4BIBA 4FZ6A 4O7RA 1H1SA 4KAOA 4FZFB 3C5IA 2Z7SA 1APME 4C4EA 4LOOA 3UYSA 2ZJWA 4CEGA 5DN3A 4DE4A 1R1WA 3RNYA 2VN9A 2X4ZA 4FKTA 4FZDB 4S2ZA 4XEYA 4J96A 2WTKB 2R7IA 2JDVA 5AUVA 1SVHA 3WBLA 4LQMA 3ZUTA 3LW0A 4FE2A 1Q4LA 1YDSE 4BYJA 5FDXA 4ZJVA 5L8KA 2ZDUA 5JFXA 4IIRA 2F4JA 2E9OA 2Z7RA 4JBPA 1WMKA 2VGOA 4XG9A 4CZTA 1OUYA 5J79A 1WFCA 4TNBA 3C1XA 2WMBA 1MRVA 4QYHA 1MUOA 2IVVA 2X1NA 4DAWA 3C4CA 4ZSAA 2W5HA 2VTQA 5EI2A 2HZ4A 2OWBA 2DWBA 3P5KA 1V0PA 2C5XA 3ODYX 4QNAA 5AV1A 3V5TA 3ZRKA 1IAHA 4Y83A 2FSLX 4O1PA 4RG0A 4KBCA 5BYYA 5M51A 3QTZA 3WF9A 2O0UA 2JAMA 2W1CA 2YISA 3ITZA 2J7TA 4L67A 4BCKA 2C6DA 1Q8YA 3HMPA 3LJ0A 4MK0A 4LGGA 5TOZA 3MPTA 3HUCA 4NIFA 4C38A 4CKRA 2BDFA 1BYGA 2PZPA 3E8NA 3VBYA 4FTQA 3ALNA 4DG0E 4H58A 4XOZA 4BBEA 3VRZA 4FTLA 4I5MA 1FINA 1PW2A 4B8MA 5M55A 3EB0A 5C01A 4J52A 4LFIA 2QG5A 3ELJA 3R7VA 5C8MA 4FMQA 4IB5A 1ZOEA 3HKOA 2BZKB 3VULA 5HNIX 4MXCA 1SM2A 4DH8A 4GL9A 2IW8A 3JYAA 4GS6A 3W55A 5KMOA 4AW0A 3FEGA 2BDJA 4MQ2A 4ZZNA 3W33A 4EQCA 2IZRA 4U8ZA 2YFXA 1ZMUA 5LMKC 3N9XA 3FKNA 3TIYA 4M66A 4BIDA 5TE0A 3NEWA 4OBPA 2C4GA 2QO2A 3G5DA 4HNFA 4C8BA 2W05A 3TL8A 1YI6A 2YN8A 4M69B 1UV5A 4ACHA 3FY2A 3W2SA 2EUFB 4FKGA 3PWDA 3VUDA 4IB1A 3SRVB 1YXVA 4N6ZA 4DN5A 3FLWA 2B9FA 2Y4IB 4FKPA 4O0UA 5IA5A 1F0QA 4GK3A 5M06A 4EH7A 2WHBA 3G6GA 3VIDA 3QWKA 3IDCA 5CSXA 3VQUA 2QKRA 4PTCA 3G2FA 5A9UA 1ZZ2A 5AJQA 3EYHA 4ANLA 3W10A 4BDEA 2Y4IC 2AC3A 2JITA 3LM0A 3EMGA 5EG3A 3AC1A 1WBNA 4EYJA 1VYWA 3KXNA 4EH8A 1YXXA 5L8LA 3UMXA 5DYJA 4L43A 5CS6A 3UGCA 3VQHA 5E8VA 3FZOA 3NUPA 3FLZA 4B7TA 2BTSA 3ROCA 3ZRMA 4RA4A 5L2SA 5AUYA 5K5NA 5IH5A 1YQJA 3ORIA 4FR4A 1E1XA 2YM8A 4ALWA 3F7ZA 3EFWA 3FKOA 3NZ0A 4FIEA 3PG3A 3HDNA 3FQSA 3MFTA 5HCYA 4CT2A 2R3KA 2C5OA 2V7AA 2VNWA 2C6EA 2ZOQA 1V0BA 4DFZE 3ZSHA 4XCUA 4Z3VA 2YAKA 4IH8A 2ZM1A 5K0XA 4BCNA 1JLUE 2ZV8A 2XP2A 4JXFA 3POZA 1REJA 3ENMA 2GFSA 3PP1A 5JT2A 3BYVA 3C5UA 4LOPA 4F9BA 4DT9A 3WZDA 3JY9A 5FTOA 2R64A 2PE2A 4JQEA 2XIZA 4ASDA 4CG9A 2XB7A 4K6ZA 4BI0A 2O3PA 3DAKA 3GU8A 4FT7A 3RINA 5ITAA 3EKNA 1OL5A 2WB8A 2X7OA 2XK3A 3V6SA 5HIDA 4PY1A 2R3FA 3LFFA 4CMOA 4BDCA 4XH6A 3MVLA 4EUUA 4FL1A 3QRTA 5ETFA 3FZRA 3OS3A 3DJ6A 4ZK5A 4TWOA 1ZMWA 3DDQA 3HAVA 1W84A 3R2BA 3KRWA 1OPKA 4EQUA 5J5SA 2OH0E 3H3CA 4HGEA 4NU1A 1M14A 1EH4A 4YO4A 2DQ7X 4UWBA 3MY5A 3UPZA 4P2KA 3H0YA 2RFSA 3WIKA 5FEQA 2XNNA 4EBVA 3GOPA 3MV5A 4RMZA 1RQQA 4JL9A 5C9CA 3UDBA 1J91A 4HW7A 4J53A 2GS2A 3E3BX 4JR3A 5CXZA 2PMIA 2R4BA 3AMBA 3I5ZA 3KXZA 3EKKA 4YC3A 5M57A 2QOQA 2ETRA 1YKRA 5J7BA 4I3ZA 3VAPA 3KQ7A 3CQUA 4GVAA 5CT0A 2UW0A 2FB8A 5H8BA 1O6LA 1R3CA 3KXXA 4IFGA 2YACA 4ZTHA 2H6DA 3D94A 3RAKA 2Z8CA 4EOMA 4FSNA 2WELA 4QTEA 3WF7A 3NUSA 3D2KA 4AOJA 3EOCA 3BHTA 2C30A 3NW6A 2J0KA 3UZPA 4JIKA 4JS8A 4EH5A 3OCGA 2WTWA 3I79A 5GIPE 3IW8A 3MSSA 4F4PA 3FAAA 2FVDA 2W0JA 4EHGA 3AC5A 1ZYDA 4CCBA 5T3QA 2O64A 4YGAA 3TNWA 4FTAA 1R78A 4IACA 4PNKA 4F7NA 3COKA 5L6PA 3UQCA 3MWUA 3CJFA 4QT1A 5H2UA 4BI1A 2BTRA 5ANOA 2PUIA 4TYHA 4BI2A 1XBCA 3OBJA 3L1SA 1V0OA 3AD4A 3PSCA 3THBA 5A4LA 2H9VA 4QTBA 3FY0A 3HX4A 2ESMA 1KUTA 3BELA 3CQEA 2X6DA 1OI9A 2C47A 4E20A 3RMFA 2GFCA 2R7BA 4DTAA 4BWKA 3E62A 4MAOA 3PVUA 3JPVA 3LVPA 4FGBA 4ZSGA 4JLCA 4PDPA 2PE0A 4X3FB 4MXZA 1KSWA 4CFNA 4R78A 3FHIA 3K2LA 3KRJA 4HJOA 2QKWB 4IX6A 3BLHA 5FGKA 3PJ8A 3OWJA 4PNIA 5CI6A 4CT1A 1QPDA 3O17A 4M12A 5EHOA 4XG3A 4W4YA 1LR4A 5CY3A 5HHWA 3QXOA 3GENA 4AGCA 5I9YA 4F63A 3FXZA 3R7EA 3BYUA 5D10A 2XEZA 4EC9A 5KMKA 1OVEA 4PX6A 3VS4A 4EH3A 3MJ2A 2WTJA 5LWNA 3LKMA 4RFYA 2YDJA 5D9HA 4GFOA 4W4WA 4FV6A 3PY3A 4Y8DA 1Q8WA 4R7IA 1G5SA 4LRMA 3UO6A 4W9WA 2Y4PA 3UP7A 4DLJA 3D7TB 1Z57A 3L9NA 4YBKA 2R5TA 4GRBA 4A9TA 4HOKA 3BBWA 4TXCA 3S3IA 3BU5A 3FLYA 4EBWA 4GJ3A 4BL1A 2B9JA 4YMJA 1URCA 4YC8A 2WU7A 4QPMA 4QRCA 4O38A 5BVEA 1U46A 4CQGA 3DXNA 5E9EA 4KD1A 4PMTA 2C6LA 5AX3A 3U9CA 2UVYA 3A7IA 4G9CA 2WMQA 4GSBA 5AR7A 1G8AA 4AN2A 1P2AA 2G1TA 3VUHA 4C34A 3DDPA 4QQJA 4EOSA 3ORXA 3KK8A 1K9AA 4Y95A 5I4NA 5DI1A 4BCJA 4DINA 5LVNA 3QX4A 4QMUA 4ANBA 3ENHA 3M11A 3ZOSA 4CNHA 2VU3A 5J9YA 4RIYB 1S9IA 2C68A 3ZRLA 3BYSA 4PP9A 3KU2A 2XM9A 4DGLC 5JH6A 3R71A 4I24A 3OMVA 4IC7A 3VUMA 3RAIA 5EQYA 4LYNA 1FVRA 2F9GA 3ODZX 1OITA 4OBOA 5I3OA 5I9UA 3ANQA 3UVRA 4O91A 4BHNA 4CG8A 5LWMA 1M2PA 2WEIA 2WMSA 1XBAA 3MH0A 5LMKA 2XKFA 3ET7A 5M4FA 1ZRZA 4I22A 2GNFA 5EYDA 1XH4A 4AP7A 5JK3A 2HIWA 2UW5A 4R5SA 5DBXA 4NCTC 5DT4A 4WNPA 3PYYA 3D5WA 4DEIA 4EK5A 2HOGA 3AC3A 3WF6A 3W32A 4Z55A 3HA6A 4KUJA 1TQMA 3LMGA 3T3VA 3HA8A 1T46A 4NUSA 4AGDA 3P7AA 3KVXA 1UA2A 1A9UA 4K8AA 4RLKA 4UX9A 4FGRA 2KULA 3OCBA 4QMOA 4QP2A 5HQ0A 3GC9A 2OF2A 1BL7A 3UP2A 2VTPA 2WO6A 5KMLA 5A46A 2CNVA 5AX9A 3QTWA 2YA9A 4FYOA 1OIUA 2QOLA 4R77A 3F3UA 2W9ZB 3QA0A 4YZDA 5CX9A 3F82A 5AR5A 3SRVA 2ITTA 5BNJA 4BDDA 4HVSA 3W16A 3C9WA 5HTBA 3MVJA 5E4HA 3GB2A 4U97A 3QTIA 5TKDA 2BHEA 2XEYA 3OCTA 4DCEA 2O63A 1I09A 3NLBA 3QRIA 3UNZA 3F3TA 3AQVA 4YO6A 2J0LA 3QCXA 1WBVA 4DC2A 2HZIA 2Z60A 2YABA 3MFRA 5HBHA 1H8FA 4EHVA 3A4OX 2Q0BA 4KSPA 4BYIA 2VTSA 4C62A 4MTAA 4OTRA 1JKLA 4UMUA 5A14A 1YXUA 4NM7A 4DITA 3SXRA 2YCSA 3RM6A 4TZRA 4FKQA 4UMTA 4ZJIA 1ZY5A 5FEDA 3QQFA 4B8LA 4X2NA 4LGDA 4EOLA 3FE3A 1IA8A 4C37A 4XG7A 2VX1A 2WMAA 3ORPA 4DLIA 4F7LA 3IONA 3P86A 3E88A 4O2PA 5KCVA 2P33A 5J95A 2YM4A 5AP7A 4DGGA 4U7ZA 3F9NA 4BTMA 2BILB 1CTPE 2O8YA 1OPLA 1URWA 4FUXA 4XG8A 5CENA 3ZBFA 4DEEA 2PSQA 1Y57A 4UXQA 3V5PA 4DCAA 2JFMA 3IECA 5EFQA 4L68A 3UJGA 4II5A 4C02A 3PVBA 4IBMA 4N57A 3OROA 5B0XA 3U4UA 3RK7A 4H05A 2CCIA 4BCOA 4MXXA 5AR4A 4MD8E 4LMUA 2YIYA 3QU0A 3RVGA 4BTKA 4UV0A 2B52A 3ORKA 4KKHA 3B8QA 3IG7A 3PE1A 3ZUVA 2YCQA 4QMVA 4A9RA 4BKYA 3SG9A 1JSVA 3FYKX 2R2PA 2RFDA 5EHYA 4NTSA 4XP2A 3KRLA 5DMZA 3NR9A 2HW6A 3GVUA 3MB7A 3QZFA 3DBCA 3HV5A 4HYUA 2VTHA 3D7ZA 3V3VA 4C3PA 1XH7A 2WD1A 3UMWA 4YPDA 1DAYA 1QCFA 3VBTA 3DB6A 3MPAA 1JSTA 2DS1A 5I9VA 3HV6A 4PL3A 3GBZA 3VS7A 5B7VA 4YSMA 5ANEA 3F5XA 3TKIA 3VBWA 2BIKB 4IXPA 4PF4A 1RJBA 4J99A 4U3YA 4XOYA 1GZKA 3ZLYA 3GU4A 4LM5A 2GQSA 3UVQA 3PUPA 5DGZA 3P4KA 5LMBA 4ZLYA 3UC4A 3UNJA 4Z7HA 2OFUA 4FKIA 2WMVA 1K2PA 3ZHPC 3LFCA 4I5CA 4YJUA 5D41A 3PLSA 1SVEA 2E2BA 5DT3A 1O6KA 4FT3A 3QHRA 4JRNA 4IX4A 3WZEA 4EOQA 4PDYA 5KO1A 3F69A 3E92A 5L2IA 3OG7A 2YLEA 3HECA 4MXOA 5KE0A 4KRCA 2YDIA 4K18A 3RZBA 5HU9A 1XHAA 1OIQA 3TZMA 5AP1A 3CJGA 5A3XA 3GC0A 4YLLA 5IUGA 5TO8A 4WO5A 2RSVA 4I1ZA 2UZNA 2YJSA 3KC3A 4G34A 4EYMA 3Q04A 3Q3BA 5B2MA 5AFVA 4DFNA 2C0TA 3EH9A 3BIZA 3RCJA 3ZSGA 5CEMA 2RIOA 2I0VA 1SNXA 4IX3A 5AUXA 3IW5A 4M7IA 4TYGA 4EOIA 2W4JA 3D83A 3NAXA 3QYZA 3ZXZA 3IDPA 1GJOA 4IWQA 2QLQA 4XLIA 2PYWA 1XKKA 1OIRA 5C1QB 3DV3A 3QD4A 4K77A 5HG5A 5HI2A 4C2WA 4JG8A 4QP9A 4FV4A 4HVIA 4Y72A 3ZYAA 4EKKA 2B55A 3MBLA 1PXKA 2XCHA 2F2CB 4OUCA 4OAVB 2QQ7A 4KABA 4MNFA 1NXKA 3OT8A 2Y9QA 4YHJA 2BZHB 3FLQA 4X3FA 5HCXA 4G6NA 4QMSA 2W99B 4RVTA 3R1QA 4QD6A 4XRJA 4F1TA 4USFA 5HE0A 2C1BA 3EL8A 4GCJA 2QLUA 3BQRA 3HL7A 5CVFA 3MY1A 3CGOA 2OFVA 4O7WA 4XYFA 3CTHA 5A4QA 5JSMA 5CEIA 5I0BA 4WUNA 4W9XA 2ITNA 2VTRA 4OR5A 4KIQA 5AIRA 3PJCA 3PVGA 4QMXA 1U5RA 4S34A 1Q24A 4N4SA 2C3KA 2R3QA 1Q8UA 3ORTA 4FYNA 3UVPA 5KMJA 1ZYSA 4MVFA 3G15A 5KBRA 4MWIA 1ATPE 2P2HA 3Q4UA 2PTKA 2JGZA 3OW3A 4J97A 3KY2A 3DTWA 4A9YA 4KB8A 2F2UA 3ZO4A 2UZTA 2W4KA 4AAAA 5IQBA 2WQMA 1H1QA 2VWBA 3DT1A 2OIQA 3GCVA 4P5ZA 4DFUA 2QOIA 3IKAA 2IW6A 2XS0A 5HE3A 2C0OA 4LI5A 3VUGA 1GZOA 3ZLWA 3HMMA 2IVTA 4CRSA 4F7SA 4D1XA 4CLJA 4D4RA 3D9VA 4G3EA 3MYGA 4MD7E 5DE2A 5BX0A 2X39A 4B99A 1JKTA 3MI9A 4AZTA 5FBNC 3LQ8A 2R3GA 4UBAA 2X2MA 5CANA 4FA2A 5JKGA 3PSBA 4RIYA 1AD5A 2R0UA 1X8BA 2PUPA 3RPOA 4OGRA 5GJFA 1V1KA 4J8MA 1JBPE 1OECA 2ZAZA 2PE1A 2UZBA 3CPCA 1UVRA 2UW8A 3I81A 2WQNA 3RK5A 3QALE 3FI4A 2BKZA 2PZIA 2W1EA 2YWPA 3C4EA 1HOWA 2X2KA 3QQLA 5DG5A 4M13A 4NCTA 2RF9A 3O8TA 3L8SA 3KF7A 4JNWA 4LUEA 4TYEA 5DRBA 5JQ8A 4RX7A 4ZEGA 3S2PA 3IGGA 4K33A 5HE1A 4FV7A 4NM5A 3DFCB 3Q96A 4I4EA 4DG2E 4A06A 4I6BA 5DR9A 4GIHA 3A8WA 2OZAB 2XVDA 3I4BA 4CQEA 5HX8A 2C69A 4FIFA 2CMWA 3OZ6A 4KS7A 3WOWA 1M17A 3IPHA 3MESA 3U51A 3C4WA 4W8EA 5AADA 2B9HA 3TEIA 3ZBXA 2VTMA 4NJDA 2C3LA 1UNLA 4HNIA 4ZTQA 3V8WA 1CKJA 3HMNA 5EK7A 4DFYA 3QF9A 3DLZA 1BUHA 2GNLA 4O6EA 3TV7A 5BPYA 4C4JA 4TRLA 4CVAA 3PDTA 4PMMA 3JVSA 1E1VA 1LEWA 3P1AA 2YLFA 3JR1A 3Q5IA 2C6TA 3PY0A 1RDQE 4GG7A 4ZSJA 4HVHA 4BC6A 1OBGA 4BR3A 4NEUA 3CKXA 2V7OA 2WMRA 2X0GA 5BYZA 1GZNA 4WIHA 3RWQA 3L9PA 5F1ZA 4LRJA 3RJCA 1UU8A 3EQGA 3OY1A 5DPVA 3H9RA 4FV1A 3HRBA 4CCUA 4FV2A 4IADA 3KRXA 3F3WA 1WVWA 2WMTA 2CHLA 2AC5A 4MBLA 4HCVA 4AT5A 1YOJA 2BR1A 1JSUA 4NM3A 2CKEA 3BU3A 2A2AA 4R6VA 3DK3A 2PU8A 3BE9A 5HICA 3AT3A 1W0XC 3D15A 4FSYA 4U3ZA 4WG5A 5DA3A 3QX2A 3TJDA 2W7XA 3NYVA 2NRYA 2EXMA 2ZV7A 1ZYJA 3A7JA 3GP0A 2GHGA 4FG9A 1DS5A 5M4UA 1U4DA 3LJ1A 2ZM4A 1G8SA 4F6UA 1H00A 5IQDA 3CR0A 4ZZOA 3DBDA 2BRGA 2OIDA 2PZ5A 5CNOA 2G15A 2LGCA 2J6MA 4G5PA 4BGHA 4HZSA 5FXRA 4WG4A 3WZUA 1XH8A 5JZNA 4ACDA 3Q4TA 2OLCA 2J51A 4U80A 3PPJA 5CTPA 5KHWA 4F0IA 4ZLZA 3EQDA 4PDOA 2X7GA 4JQ7A 3FLSA 3LIJA 4Y5HA 5CI7A 4BCHA 1OUKA 5HLPA 4D1SA 5E90A 2QR8A 4FKJA 3EYGA 3F5UA 4OBQA 4QP4A 4ARKA 4UN0C 4PPAA 2CPKE 3MIYA 4TWNA 4E6AA 3NUXA 5CEQA 2PZYA 4G1WA 2ITZA 3EQIA 4JBOA 4RX9A 4I0TA 2WTKC 5ICPA 2G01A 4AOIA 1JQHA 4AUAA 4N70A 2HWPA 4I4FA 4EK3A 5K4JA 4YJOA 4YJPA 2UZUE 4FKSA 4APCA 4F09A 4PWNA 1H24A 2C5YA 4QPSA 3TACA 3C0GA 4R3PA 3QAME 4Y73A 5CAVA 3RZFA 3FI3A 3W2PA 5K9IA 5LVPA 3CCNA 1SYKA 2GHLA 3TTJA 4H3PA 5EDQA 4ACCA 3WZKA 1XH5A 3HYHA 3BCEA 3R8MA 3VF8A 3NX8A 2Q0NA 4F9AA 1YWRA 3Q53A 4D55A 3LAUA 3R9OA 3QLGA 2BFXA 4IHPA 1WZYA 3DKGA 4X21A 5IQAA 4KIOA 2X81A 1YXTA 3GFWA 3ORMA 4I5PA 4CFFA 1M7QA 5HNGA 1ZOGA 5BVOA 4GT4A 4S31A 3REPA 1H28A 4QQTA 5KUPA 2H8HA 1GIHA 3DKFA 4PDSA 2JIUA 4I92A 5E8UA 4E8AA 1FBNA 3I7CA 5FEEA 4X2JA 2WAJA 4X6QC 3NUYA 4PTEA 4GYGA 4ZOGA 4CV8A 2IO6A 3HRCA 4QP8A 3QGYA 1J7IA 1WVYA 4GH2A 5BVDA 4YHTA 1ZYCA 4AW1A 4ORKA 4F0GA 4MHAA 4NJ3A 3LXKA 4UZHA 2B0QA 3DNDA 3QFVA 2VWXA 5AIKA 3EZRA 3O96A 4WOVA 3F5PA 5F9EA 2JFLA 3AC8A 3IW4A 4FEXA 4X3JA 5HKMA 4BF2A 2PWLA 3BZ3A 3OOGA 3OVVA 3VW6A 4EL9A 1ZLTA 3AG9A 2P2IA 3ORNA 4GVJA 4YURA 5IISA 3L8XA 5L8JA 2VWYA 1NY3A 4JAIA 2XUUA 3MIAA 5AMNA 2UW4A 3E8DA 4JDHA 4O81A 3DGKA 2WXVA 3NYOA 3EIDA 1AGWA 1XBBA 3FHRA 4RGJA 4XP0A 3R9HA 2PUUA 4ANMA 1OKZA 1REKA 2ETMA 3OT3A 4G3DA 4JVGA 1OL2A 4GUEA 5A4EA 3QGWA 3GCQA 4FC0A 4OTIA 2WTDA 3ROYA 5CSHA 5LXMA 4IAIA 2IVSA 4ZY6A 1M52A 3R8PA 4FV5A 4BWXA 3A4PA 2CKOA 5DWRA 2VV9A 2JKMA 4IWOA 3F2NA 3COMA 3FKLA 4NFMA 3F6XA 4EH2A 4NT4A 5C03A 4E5BA 3AD5A 5TT7A 1IR3A 3G90X 3QC9A 4AT4A 4UYAA 3HAMA 2XK6A 3KXGA 1Y8GA 3KKVA 4ZZMA 1PXNA 2JDSA 4TYIA 3AD6A 3VUKA 4BDAA 4UXLA 1H01A 3KGAA 4NZWB 4U81A 4QYYA 4AZEA 2RGPA 2R3JA 4FNXA 5ACBC 5FTQA 3GCSA 3PIXA 4GG5A 3ERKA 1CKPA 3R7YA 3I1AA 4FK3A 4RLLA 5T68A 4IW0A 4EH6A 5AUZA 4X0MA 2XIYA 3DB8A 4YPSA 4FI1A 5HVJA 3D5UA 1H0VA 1Q99A 3EZVA 4YJQA 5EKOA 3F61A 3CTJA 3PXZA 3QC4A 3O7LD 4JR7A 5HLNA 2IVUA 3FJQE 5D7VA 4F65A 4B4LA 4YC6A 5GJGA 3TG1A 1H1PA 3OWPA 4XV3A 2F7ZE 3DAEA 2OXDA 4FL3A 4G17A 4L6QA 2CNQA 1XR1A 3RHXA 2XYUA 3Q52A 2XK9A 4DA5A 1OBDA 2Q83A 2QO9A 2BAKA 2WU6A 5FXQA 4CLIA 3MN3A 4TYJA 4MX9A 4FTJA 4XUFA 4C4FA 2OU7A 4ZMFA 4RJ3A 4RQKA 5HBEA 1UNHA 1M2QA 2VO7A 1U5QA 4GFMA 4D9TA 4OTDA 1Y6AA 3A62A 3O71A 3QQJA 3B2WA 3R1SA 3EQPA 4BTFA 4AFEA 4UALA 4QYGA 5KBQA 2BDWA 2WKMA 2JLDA 5C4LA 3NGAA 2GMXA 2V0DA 3NMUF 2EB3A 2OZAA 4FVQA 4MKCA 4HYHA 2CGUA 5CF4A 4BVUA 2PVFA 3UZTA 4APPA 4G16A 2CN8A 3GUBA 1MQ4A 4HZRA 1U54B 3DK7A 2HXLA 1ZMVA 2VO6A 3PE2A 3ZDUA 4XBUA 3M2WA 4RRVA 5DR2A 5E7RA 1WBOA 2YM3A 4AA5A 4FOCA 4NW6A 3R01A 2JKOA 4PUZA 3RKBA 4ANOA 4I6QA 2UW7A 3P7BA 4ENYA 5CSWA 4L9IA 5FP6A 2QG7A 4O82A 3EN9A 3SW7A 2BALA 3II5A 4O7TA 4RIWB 3TNQB 4OW8A 3QZIA 5IMXA 2GSFA 2YCFA 2XNGA 3CLYA 5D1JA 5EW9A 5KZIA 4ZTLA 2VO3A 4RJ5A 4ZIMA 3OFMA 5AEPA 4L44A 1Q62A 3BI6A 4YBJA 4G31A 1W82A 3ZXTA 2W4OA 3NNXA 4H3BA 2J5FA 3Q4ZA 3W8QA 2ONLA 2CN5A 1YDTE 2OW3A 3PSDA 4PPBA 1T45A 2GNGA 3Q60A 5DEYA 4KIPA 3ORZA 4E6QA 2C3IB 1UKHA 3PJ3A 3VWAA 4BFMA 3G51A 1WBTA 5GJDA 4XV9A 3RGFA 3ZS5A 5ACKA 4A07A 3WILA 2PVKA 4QMMA 2NRUA 4RWIA 5IKWA 5AP5A 5HX6A 3VJOA 4K1BA 3L8VA 2UZVA 4FKUA 3B8RA 4CKJA 4F6SA 4EH9A 4FSTA 1SMHA 4R7BA 4D2WA 2VRXA 3L9LA 3GCPA 3MH3A 2XBAA 4JDJA 3WI6A 3WE8A 4C4IA 3E93A 4K9YA 4TWCA 3TXOA 3QQGA 4KBAA 3VS3A 4FIGA 5JGAA 1A48A 4RX8A 1H26A 4D0XA 1R39A 4M3QA 5DFPA 3UIBA 5GINE 4AZWA 5AP3A 3NIZA 5FBOA 5FM2A 3KVWA 3F3ZA 4X3FC 4IDVA 5EM8A 3ULZA 3WZJA 5IUIA 4E6CA 1W7HA 3OC1A 2XKEA 3T9TA 3ZZWA 4ZP5A 2YM7A 1R0PA 4TTHB 5F95A 4C3FA 5BMSA 4AQCA 3QTUA 4IZYA 2YIXA 4ZJJA 2R0IA 3LFEA 2UZEA 3I6WA 4AA4A 4U5JA 5AA9A 5IEXA 3BWFA 2Z7LA 2X4FA 2CJMA 5M08A 3FXXA 4YLKA 3FSKA 2NNWB 2OJGA 4JIAA 4L01A 2WIPA 3C4FA 2OKRA 3FYJX 5F20A 2XBJA 5FQDC 4BDBA 4D5KA 4HGTA 1UWHA 4MWHA 3OY3A 3NCZA 5B2KA 4ZTRA 1A06A 4TKSA 5KMMA 2HXQA 4FVPA 1UU7A 5IQHA 3PG1A 4FTNA 2OG8A 4AE6A 4DFXE 1TQPA 3CPBA 5CEKA 3JXWA 5DVRA 2PVJA 5IZFA 1CSNA 3F66A 3K5UA 2ERKA 4YZBA 3QRKA 4DEDA 2IPXA 5EQEA 1PXIA 3FBVA 3R63A 3BYMA 4CTBA 4JBQA 1LEZA 1IAJA 3FLNC 3G0FA 4IDTA 3AC4A 4ASZA 4KWPA 3FZPA 5J8IA 4QP1A 3VBQA 4CYIA 5J9ZA 3NNWA 3RP9A 5HO8A 5AUTA 3GNIB 3LXLA 4CTCA 3QBNA 3SX9A 1VEBA 4KIKA 3SXSA 3MFSA 3R30A 4H39A 4FEVA 4UEUA 5ANJA 1BMKA 3HLLA 4G3FA 3EQFA 3ACKA 3C0HA 4X2FA 3PVWA 5EYKA 5AM6A 3C0IA 3UTOA 2VTAA 4EK6A 4YSJA 5BUEA 3TTIA 2OJ9A 4E6DA 4HGLA 4PPCA 2J50A 1NT2A 2FO0A 4QMQA 2YIRA 3TM0A 2ERZE 1PXPA 3A7FA 3QL8A 5AA8A 3PZEA 3A8XA 4G6LA 5CLPA 5GNKA 3KL8A 4L52A 3EQCA 1NVQA 4C35A 4C7TA 2VNYA 2FH9A 2E9UA 4FSRA 5LVMA 3R8UA 5K4IA 1GIIA 4M0ZA 3IW7A 3O0GA 2UVXA 4LGHA 1ZWSA 1WAKA 2WTCA 5AR2A 2I1MA 3E64A 3ZLXA 4FNWA 1K3AA 2OF4A 5CU4A 3PTGA 3TNPC 3U54A 3OD6X 4O7NA 4UZDA 3H9OA 3LMHA 1H27A 1U59A 4O7LA 4WRGA 3U6HA 3ZFMA 5DR6A 5JN2A 3LMIA 3UO5A 3H4JA 1H25A 3LM5A 3HV3A 4GU9A 4H1MA 4L3JA 3GC8A 4RJ7A 5D7AA 5FXSA 5K0KA 4NYEA 4HCUA 2WOUA 2JDOA 2WPAA 2ZM3A 5BYLA 4J7BA 2UVZA 2I40A 2YM5A 1QPJA 3UYTA 2NPQA 3ZZEA 2CGWA 1R0EA 4RWJA 4AGWA 1W83A 3CKWA 5ANGA 2VTLA 3MH2A 3QRJA 4GYIA 4D9UA 3RPSA 2FA2A 3B2TA 4DFBA 4DHFA 2W17A 4JDIA 2JDRA 4XNEA 5JGDA 2RG5A 3OOMA 5HO7A 5E92A 4D2TA 1MRUA 3VBXA 3Q9XA 4RWKA 4ANQA 4I41A 4AOTA 3MY0A 2UZDA 3LE6A 4YNOA 3ZO1A 4YTIA 3MA6A 3IGOA 4WD5A 4BRXA 3BV3A 2W5AA 3PLAE 3V51A 2RL5A 3RTPA 4BGGA 2PY3A 2VWWA 3DQWA 4UWCA 5CQUA 3UIMA 4AF3A 4OTQA 4O83A 3T8OA 1MQBA 3ZEWA 2XIKA 2C0IA 2X9EA 4Y85A 2W1DA 3R21A 4FTCA 4A4LA 4JX3A 2FUMA 3QCYA 4EK8A 4FV3A 5HVYA 5M53A 2O5KA 3RI1A 2OK1A 3D5VA 3VHKA 3U87A 3U9NA 4F9YA 4FEWA 3LLAA 4BDHA 5K3YA 3CEKA 1MP8A 2EXEA 2XF0A 4FF8A 5A54A 3D5XA 4LV5A 3DBQA 5JRQA 5IUHA 2H96A 3DTCA 3R1YA 3NW7A 1KOAA 2HAKA 4QTCA 1XWSA 4FICA 3UOHA 2A4LA 2ITWA 3IS5A 4M0YA 3FUPA 5IU2A 2HZNA 3RAWA 3ZTXA 2QNJA 4ITHA 5CF8A 2C1AA 1PXJA 2UZWE 2WZJA 3C4ZA 1JVPP 4YHFA 3UODA 3GU6A 4O0SA 4PQNA 4DG3E 4XJ0A 2OGVA 2HCKA 4JBVA 1FGKA 4I6HA 1U54A 1XH9A 5BVKA 4E73A 3NW5A 4ITIA 5I3RA 3SA0A 4A4XA 5EM6A 2PVMA 4O0RA 3DQXA 2F49A 3ZCLA 3RCDA 3ZONA 3BHYA 5CVGA 4TWPA 3WYXA 4JG6A 3MFUA 3TT0A 3UG2A 2EWAA 2GCDA 1JKSA 5IDPA 3U8WA 5CF5A 3SW4A 3R02A 3LCDA 3T3UA 5CASA 5EQPA 4R3RA 2I0EA 3ZO3A 4RIWA 5AM7A 1H08A 1W8CA 2BRHA 2PMLX 4IVBA 4IM2A 4R1VA 3ZUUA 4DBNA 4D5HA 4O27B 4WBOA 3NYNA 4FZAB 3VNTA 2JIIA 5LVOA 3IK3A 5EHLA 3EFLA 5HG9A 2OXYA 4K2RA 2P0CA 1JAMA 5CAPA 4N6YA 2XJ0A 1OL6A 3FSFA 2QOKA 2V62A 2REIA 4LG4A 5CVHA 4P5QA 5F94A 2Y7JA 4U6RA 5H3QA 4DBXA 4O21A 5C4KA 1YI3A 4BCPA 1PXMA 1BX6A 4FIJA 3QUEA 3OWKA 5IF1A 2W5BA 3LPBA 3QKLA 2RG6A 2B1PA 3VS1A 1PJKA 5CU0A 2QR7A 4KKEA 4LUDA 2I7QA 3GCUA 5L2QA 2UW9A 4IAFA 4EHEA 1OGUA 4Z7GA 4WKQA 4DFLA 5C26A 5IQFA 2GHMA 2P4IA 2YIQA 3GOKA 4GT3A 4ACGA 4F0FA 5M4IA 2PPQA 3A60A 4F6WA 4E4XA 4XMOA 3IO7A 4FG8A 4W8DA 3NS9A 4BTJA 3TUDA 5M07A 1YXSA 4EZ5A 2PHKA 3CD8A 4I93A 4B0GA 5JFWA 4C36A 4UYNA 4UMPA 3FZTA 2CGXA 4GU6A 3L8PA 3VVHA 4EQMA 3N4TA 5I9WA 3VO3A 4PMPA 4E5AX 3PA5A 3PA3A 1YDRE 3W2CA 2PVLA 3K5VA 2YCRA 3PZHA 3ALOA 5FDPA 5GZAA 3QZGA 5E1EA 2HW7A 3MJ1A 4E1ZA 5HIEA 3HDMA 1GOLA 4C57A 5GHVA 3VS5A 4V01A 3UO4A
chains in the Genus database with same CATH superfamily
2GNJA 2HWOA 4FTOA 2Z02A 1OL1A 3M1SA 3PXKA 1OL7A 3FMLA 3QXPA 2LAVA 3R8VA 3QUDA 4V0GB 5EOLA 3FC2A 3C4XA 4D4VA 1FGIA 4GKHA 3GQLA 1IG1A 3FI8A 3RWPA 2BIYA 4AX8A 2YZLA 3W0NA 3RM7A 5EW3A 2P3GX 4BWPA 5IA3A 4ANSA 3Q32A 2YDKA 3ZFXA 1BL6A 4O4CA 2UW3A 5HD7A 4WT6A 5IH6A 4QP6A 1ZZLA 4FV0A 4BICA 4O0TA 3FPMA 3QQKA 2W96B 2C6KA 4WSYA 2BRMA 3R9RA 4ITJA 4ZMEA 4KBKA 2J2IB 4Q2AA 5GZ8A 1KV1A 2XKDA 4JRVA 2GS7A 4MF1A 4KKGA 4IE9A 1XH6A 3R7GA 4NWMA 3AKLA 4BDFA 4O7SA 4RSSA 3MTFA 3D4QA 1YOMA 3OTVA 4L45A 5E8SA 3TKUA 4NM0A 4D2VA 1STCE 4C0TA 3O23A 2QOFA 1PMNA 4S32A 1IEPA 4YJRA 4D4SA 4OTGA 1M2RA 1FPUA 2NYAA 3UZRA 4CFXA 3Q9YA 2PVNA 2J9MA 2C6MA 4BZOA 4GJ2A 5D11A 4JG7A 1Z5MA 5HZNA 3P9JA 4GEOA 3PXYA 3KCFA 5BUIA 2G2IA 3GC7A 3DKCA 4HYIA 2C5NA 4BBFA 4BDIA 3NRMA 4NKSA 4FODA 5IPJA 2I6LA 3DU8A 3KMUA 3P5JC 4G6OA 1XO2B 3R9NA 3E63A 4KS8A 3V04A 4XG6A 4QYEA 4HVGA 2G2HA 3S95A 3UPXA 3R0TA 1SVGA 4ZXTA 1OIYA 5IA1A 3R2YA 3OWLA 4XBRA 3V01A 3TUBA 4Y5QA 3S0OA 1SZMA 5H8EA 2VTOA 3FZSA 2CLQA 2HELA 2ZDTA 2GS6A 5EI8A 4JT3A 3H30A 4WG3A 4BZDA 4NK9A 4WSQA 2QOHA 4G3CA 2SRCA 4ERWA 4QNYA 1P4FA 2DYLA 2QI8A 3ANRA 5DRDA 5TF9A 2XIXA 2BFYA 2QOOA 3LQ3A 4RJ4A 1UKIA 4HPUE 1L3RE 4MCVA 4MQ1A 4M67A 5LJJA 5HIBA 4AG8A 3O50A 3VBVA 3C50A 3UIXA 3W2OA 2GNIA 2VUWA 4CMTA 3R7OA 4N0SA 4BCGA 4A9SA 3FZ1A 2I0YA 2XH5A 5DHJA 4JAJA 5KMIA 2ONLC 2Y8OA 4IEBA 2Z2WA 3OBGA 4XX9A 3LFAA 1FMOE 2OJIA 3OTUA 4RPVA 5JFVA 2YWVA 3UDSA 3OXTA 5FM3A 3HMOA 2OSCA 4MNEA 2JKKA 3OEFX 5AAGA 2ITOA 3Q6WA 4QTDA 3QRUA 3DBFA 5L2TA 4RT7A 2W9FB 4CRLA 3V5JA 4P7EA 3A2CA 5EM5A 3NNUA 4NSTA 4EOPA 4NFNA 4RZVA 2WNTA 4RBLA 2BVAA 2OZOA 4YR8A 3V8SA 4AACA 5AP6A 3QD2B 4FBXA 1J1CA 4IMYA 1H4LA 2XNBA 3LCTA 3E8EA 5ANDA 2JDTA 3SKCA 5JGBA 1QMZA 3M42A 4E4NA 4DEGA 1Y8YA 1KV2A 4RA5A 4O7YA 4DGNA 5F4NA 3PIYA 4K11A 4U43A 5D12A 3ZMMA 5G1XA 3ZM9A 1PMUA 3HZTA 4RX5A 4OAUC 4U42A 3U6JA 5AR3A 3DJ5A 5HTCA 1KWPA 1UWJA 4IX5A 4OTHA 4CMUA 4F9WA 2QD9A 3AGLA 5JMSA 3OF0A 5CU3A 3F3VA 4CD0A 2IJMA 3N51A 3Q4CA 4J95A 3BHUA 1NA7A 1Q3WA 3FMEA 1HCKA 1UU3A 2R3PA 4G3GA 4X7QA 5CQWA 4JX7A 1YOLA 4FRFA 5HE2A 2J90A 2JKQA 3CY2A 3QCSA 4Q9SA 5ETAA 4AZSA 4G5JA 4J71A 4AN3A 4H3QA 3KMMA 2C6IA 1OGYA 5FRIA 5HESA 2GQGA 3SOCA 4L3LA 3ZDIA 3EN5A 5L4QA 1OPJA 5K5XA 3VS2A 1YHWA 3CGFA 1W2FA 1TZDA 4V04A 4RJ6A 3ID6C 2IZSA 4YZCA 1B38A 2B9IA 3CD3A 2GPHA 1Q97A 3AMAA 3UG1A 3VC4A 3OHTA 2CCHA 3C51A 3DLSA 3QTRA 4AE9A 2AUHA 1BLXA 2ZYBA 3P7CA 4GT5A 4QMLA 4D2SA 5IA0A 4DH3A 5CSPA 5AP4A 3CC6A 3GU5A 4CSVA 3C7QA 1J3HA 4XRLA 3DFAA 4ALVA 4KIKB 4BBMA 2QO7A 3K3IA 3SOAA 5E1SA 5GIOE 3GGFA 5CF6A 5HD4A 4MBIA 1DI8A 4NKAA 3FMJA 4EOOA 2ITPA 4LOQA 5CWZA 2UW6A 3NUAA 4F08A 2KTYA 4AXCA 2YITA 4YNEA 4HGSA 2R3IA 4XV1A 5KHXA 4ZS0A 4E4MA 3SV0A 3QYWA 3O8UA 3R73A 4S33A 4I0RA 4PMSA 2BROA 4TW9A 4F64A 4W4XA 2WMXA 4FKVA 4ACMA 3RALA 4CFUA 4FZ7A 1CMKE 3ZU7A 4USEA 2P55A 3OUNB 1DAWA 1KE9A 5EM7A 3ZSIA 3EQRA 4A7CA 1J7UA 2ZMDA 1ZXEA 5HNBA 5HOAA 1Z9XA 1YRPA 5E8XA 3WIGA 5IQCA 4GFGA 2XNOA 4LMNA 4QP7A 4D1ZA 3BYOA 4O2ZA 4XG2A 3TZ9A 3DBEA 4U79A 2PVYA 2IW9A 3ZEPA 2J5EA 2X6EA 3EFKA 3NNVA 4AGUA 3TNIA 4UY9A 4XG4A 2R3HA 4RVKA 3G6HA 3I6UA 4FK6A 3KULB 4FSQA 3H10A 4FIIA 2DUVA 4V0GA 3JY0A 3TZ8A 4R1YA 3KN5A 3OXZA 2XRWA 4IVCA 5HVKA 4PP7A 2FSTX 1NW1A 3BPRA 1YWVA 3OEZA 4E5WA 2HENA 4QQ5A 3IDBA 1P5EA 3A7HA 4YJSA 5CAQA 5IMEA 4JMQA 3W0SA 2YHVA 4FNZA 5DOSA 3UE4A 3CS9A 3PJ1A 5AAFA 2VTTA 4QEBA 5EKNA 3P79A 4IC8A 4FTUA 3KN6A 3BEGA 3R1NA 3S4QA 5E8WA 2IZUA 2Y6OA 3VS0A 4O7VA 3U55A 3PXQA 1O6YA 3E8CA 5HCZA 1W98A 4R3CA 5A6OA 3RPRA 4R5YA 3VF9A 2XJ1A 2XRUA 4LRKA 3UOLA 4BCMA 3NVMB 4WHZA 2R3NA 4TT7A 3LJ2A 4IVDA 3N4UA 2B4SB 3VONA 2GNHA 4YZNA 4GIIA 4FTKA 4QMTA 2QVSE 4QMWA 4FTRA 5FLFA 3WYYA 2XA4A 2HK5A 3BHHA 1B39A 3V6RA 3DK6A 3QUPA 4Z9LA 4FSUA 4FTTA 3TV4A 3KFAA 4D4YA 3TYKA 2VO0A 3FQEA 4ID7A 2OJFE 4U45A 3VS6A 4BZNA 5L6WL 5FWKK 1F3MC 3R8ZA 5FP5A 2VWUA 1PRYA 5DNRA 5A4CA 4AA0A 3A61A 5CNNA 1G8KA 2IG7A 4FSZA 3A7GA 4H36A 2BZJA 3FI2A 4UMRA 3E3PA 3EN7A 5DIAA 4D2RA 5BUJA 3D0EA 3ML1A 4CFVA 1G3NA 4RJ8A 3LOKA 5EOBA 2A19B 2XKCA 4GKIA 1WBPA 5IQEA 4O84A 3UOKA 2CKQA 4KA3A 2QCSA 3VRYA 4ERKA 5J9LA 4MYGA 3LFNA 4RIXB 1E9HA 3CBLA 4FT5A 3W2RA 1JOWB 1VYZA 3QQUA 4U41A 3W8LA 5DLSA 4DHZA 4FT0A 4L8MA 3BLQA 1OM1A 2QODA 4FV8A 2O2UA 4Q9ZA 2BAJA 1Q8ZA 2ITXA 2XK8A 3MVMA 4IQ6A 4QP3A 2EU9A 2OBJA 4TPTA 4DH7A 2JBOA 3PIZA 3P78A 3R22A 5HGIA 3MW1A 2IWIA 3NCGA 3MPMA 3Q5ZA 4ENXA 1PXOA 3O7LB 4AW2A 4C58A 5IA4A 5IH4A 4DT8A 3BL7A 2ITVA 3Q2JA 4XHKB 4BN1A 3HUBA 2C5VA 4FL2A 3HMIA 2UV2A 4FV9A 4QOXA 4WNOA 1TQIA 5H8GA 2JAVA 3RAHA 3POOA 1OZ1A 5CT7A 2EVAA 2W1FA 3SDJA 5J5TA 1Y6BA 2JIVA 2QU5A 1Y91A 5EI6A 4FEQA 4AWIA 4AFJA 4TY1A 3DPKA 3E7VA 1M7NA 3WF8A 3MVHA 4AXFA 4ANNA 1J7LA 3FQHA 1PF8A 4MBJA 4IM3A 1RE8A 5CAOA 5C8NA 2PUNA 3CE3A 3COIA 4U44A 4BDGA 4DH5A 2XNEA 3P0MA 4RC2A 4IAYA 2PK9A 4IFCA 4BY9E 1Q61A 2JBPA 1OMWA 4NW5A 4ZY4A 4I21A 4YTCA 5E8YA 4QQCA 4C2VA 5EH0A 3BBTB 4FEUA 3OXIA 3DKOA 2B7AA 2PMNX 5JFSA 3PJ2A 2WGJA 1CDKA 3I5NA 3LQ5A 3CQWA 4JJRA 3BKBA 3V5WA 3IOKA 3HNGA 4LL5A 2JD5A 4WA9A 3NUUA 3TNHA 4AN9A 3FMHA 4HCTA 4X2GA 4QMNA 1JNKA 4FSMA 5AV2A 4RVLA 5I9XA 3SGCA 1LPUA 3JUHA 1VJYA 1SNUA 5J87A 4CGAA 1S9JA 4YTHA 2XNMA 5HORA 3VJNA 5E91A 3QKKA 4Q5EA 2X8IA 3AKJA 2I0HA 4IAKA 3EWHA 4RWLA 4ONAA 2EB2A 4DEHA 5KZ0A 4QO9A 4U40A 3P23A 3V8TA 3AC2A 5LVLA 2VAGA 2FGIA 3W2QA 3AMYA 4EH4A 2WMWA 3VUIA 1CKIA 3OP5A 3I7BA 3ZM4A 3SHEA 5EDPA 1O9UA 3BLRA 3QHWA 4IB0A 4HPTE 3G9LX 1PXLA 3QZHA 1GIJA 4I6FA 4MXAA 3MDYA 4PL4A 5BVWA 3LCOA 4OTWA 4C33A 2VWVA 1DI9A 3LCSA 4BDJA 2XYNA 2QC6A 4I20A 3RK9A 4TL0A 4DF3A 3WF5A 2W06A 2Z7QA 5G6VA 4IAZA 2W1IA 2ZMCA 4O96A 5LCJA 2J0IA 3TDWA 1KE7A 2QU6A 4CXAA 4F1MA 2OICA 4JOAA 2AYPA 4LL0A 3R9DA 4E26A 1LP4A 2C6OA 4E93A 4YTFA 2OO8X 3TIZA 3TN8A 4AXEA 3MTLA 2NP8A 4FKWA 4RC4A 3R28A 5H9BA 5HBJA 2WOTA 2F7EE 3LCKA 1Q8TA 3E87A 5BVNA 4PL5A 3BU6A 1FOTA 1PYXA 2R3OA 1KE8A 1KE6A 2BRNA 3NDMA 3RPYA 4BKZA 3G33A 5ANIA 4CZUA 3K54A 5JQ5A 3UNKA 3FWQA 4O4FA 4YZ9A 2JEDA 4GMYA 3ETAA 1P4OA 4G9RA 2WQBA 3NPCA 4IWPA 3SD0A 3F2RA 4PV0A 5HO6A 2CLXA 2ITUA 2OJJA 3EFJA 4XP3A 5HTIA 2RKUA 5BVFA 3FC1X 5A4TA 4MF0A 3COHA 3GT8A 4C3RA 3AGMA 4WRSA 3AT2A 3IQ7A 4FIHA 4MEDA 1GAGA 3KXMA 2GTMA 4CV9A 4ZTSA 1JKKA 3O8PA 3BGZA 2ITYA 2ZV9A 3KA0A 1FVVA 2XIRA 3LLTA 5JRSA 3R00A 3ORLA 1DM2A 4U9AA 3WE4A 3V5LA 2UUEA 2YAAA 3I0QA 5AV3A 2VX3A 1GZ8A 3PXFA 3TDVA 4DEAA 3OCSA 2J0JA 2FYSA 4D0WA 5JEBA 2XMYA 3KB7A 4LV7A 3ZFYA 3FL5A 1IA9A 1XJDA 3CXWA 4L53A 4AW5A 3PA4A 1ND4A 1NVSA 2GQRA 5IEYA 5CYIA 3N4VA 3KCKA 1W2DA 4ZY5A 5A6NA 5FTGA 1PMEA 2OH4A 3R04A 1OB3A 1WBSA 3DNEA 2WEVA 3DXPA 4C59A 4RVMA 5HG8A 2QURA 4BHZA 3CTQA 2JC6A 4M69A 4O86A 3KULA 1I44A 2X8EA 2QHNA 4XLVA 4RFMA 3FMKA 1PMVA 1W2CA 2W1GA 2BHHA 2BKKA 1JPAA 3TWJA 4O0VA 1YWNA 2PZRA 1F5QA 3CIKA 3DJ7A 3GXLA 4KINA 3TCPA 3GFEA 3RNIA 3U4WA 4A9UA 4D2PA 2UZOA 2E9NA 5CZHA 2BPMA 2IZTA 3ZO2A 3VUTA 4IZAA 3BEAA 3LFDA 4EWQA 5HU3A 2HYYA 5L3AA 4MNEB 2VWIA 3DAJA 3MH1A 3NUNA 3QKMA 4L7FA 4NTTA 4R8QA 3Q9WA 4V05A 2YEXA 1ZARA 4EZ3A 4M84A 4DGMA 3OW4A 2X2LA 3HEGA 5J1VA 1KOBA 2VTJA 2J0MB 4MD9E 3NIEA 4O0WA 3P08A 1Q3DA 4GK2A 2B53A 4ASEA 3BV2A 3BHVA 3WARA 4BGQA 2X9FA 3SLSA 3JVRA 4DEBA 4CYJA 3PY1A 1L8TA 4ZTNA 3DXQA 2X0OA 3QWJA 3LZBA 3QTQA 2PVRA 4ZLOA 3BWJA 3HV4A 2OXXA 3ACJA 4CFWA 4P4CA 4J98A 4L46A 4KNBA 3EHAA 5CU6A 4CZYB 3GI3A 4PTGA 4X2KA 4YLJA 2PULA 1IASA 4J1RA 4ZSEA 1FQ1B 4O0YA 4EWHA 1B6CB 2ETKA 5AP0A 5AR8A 4I5HA 4FTMA 4UMQA 2R3LA 2Y0AA 5E8TA 3I0OA 3QQHA 3VN9A 4IJPA 3IW6A 3KEXA 3PFQA 4X6RA 4S30A 1ERKA 1PKDA 2OI4X 2J4ZA 5LMAA 3ZLSA 2YM6A 3BRBA 4J8NA 4ZSLA 1BI7A 1ZAOA 2BAQA 2X8DA 2ZVAA 4IZ7A 3UIUA 4EZ7A 3BQCA 4K0YA 3FMMA 3HP5A 4RQVA 5I5ZA 4FKRA 4RIXA 1OKVA 1AQ1A 2WMUA 4FSWA 2O65A 4DH1A 4HVDA 5M44A 5L6OA 4E4LA 4D28A 1PHKA 3QD0A 5IA2A 5KKRB 4YP8A 4ZTMA 3MB6A 3RHKA 5KX8A 3O5AA 2WTIA 3R8LA 5AV0A 4Z16A 1WCCA 2XK7A 3LFQA 4WNMA 4EOJA 5KKRC 2PVHA 4YUQA 1HCLA 5EYMA 2YZAA 5C8KA 4FVRA 3G9NA 3NAYA 3HRFA 4CKIA 3PP0A 2XNPA 1WBWA 3IOPA 4EJNA 3LXPA 1WVXA 2V55A 3VHEA 3ZC5A 3DA6A 3QLFA 3PRFA 2R9SA 3DZQA 5IDNA 4M8TA 4O0XA 3O2MA 4F7JA 5AP2A 3D14A 2QOCA 3KXHA 5DEWA 5BQ0A 4EUTA 1P14A 2QONA 5J7HA 3FMDA 3CY3A 1YI4A 5CALA 5J1WA 1JWHA 2HY0A 3TKHA 3LHJA 5KMNA 3BE2A 4NIFB 3S00A 5IQGA 1QL6A 4FG7A 3KRRA 4E3CA 2GDOA 3U6IA 2A0CX 3DS6A 4QYFA 3R7UA 3TJCA 2VTIA 3W0OA 1YW2A 2ZV2A 1H07A 3KK9A 3EQHA 4WUAA 3TZ7A 3UOJA 2G2FA 5JZJA 5CXHA 2XM8A 1XQZA 3AXWA 3QD3A 4HYSA 4KSQA 4ZS4A 5IG1A 4OT6A 2WFYA 5AWMA 3HP2A 4JI9A 5EYCA 3F2AA 1YHVA 4QMYA 4IAAA 1BI8A 3CP9A 2A27A 2VX0A 5AUWA 3BLAA 3H9FA 2FSMX 1CM8A 4KRDA 3BGQA 4EOKA 4IM0A 4L7SA 5L2WA 3SG8A 4EKLA 3HGKA 4F70A 2F7XE 4AS0A 4EC8A 4OT5A 4IVAA 3AOXA 3TI1A 2WQEA 4BIEA 2H34A 4L42A 4F9CA 2CGVA 2XJ2A 2GTNA 4RC3A 5CAUA 1FVTA 1NVRA 2BRBA 3PPKA 4BKJA 2W1HA 3F7WA 4M97A 4DTKA 1TVOA 3T9IA 4C61A 5EW8A 4AT3A 2PMOX 2CKPA 4U0IA 1H0WA 4IJ9A 4EI4A 3TV6A 4QPAA 4DTBA 3LFSA 4GV1A 4FX3A 3FMNA 4YZMA 3LFBA 4LDTA 3KF4A 1RW8A 3BX5A 3BGPA 4BCIA 2IN6A 2VGPA 4I23A 1QPCA 3C13A 3EN6A 4M14A 1ZY4A 1VZOA 4G2FA 4H1JA 3ATTA 4Y46A 5BMMA 4UB7A 3D7TA 3ULIA 4FT9A 3ZC6A 2NO3A 1ZYLA 4XS2A 1BKXA 3DCVA 3L9MA 3W18A 3FPQA 4AZFA 4AXAA 1H1RA 3Q2MA 5EDRA 1UU9A 3Q6UA 4B9DA 3PXRA 4FKOA 5GZ9A 3DY7A 3Q9ZA 4C4GA 4WNKA 3EN4A 4YJNA 2EXCX 3ZH8A 5C27A 4I0SA 3HV7A 3FDNA 3QTXA 4QTAA 4IB3A 3H0ZA 3UQGA 2CNUA 3R6XA 3EQBA 4O22A 3QA8A 1TKIA 2B54A 1LUFA 4PRJA 2ACXA 2V5QA 3SXFA 5AAEA 2XANA 3UC3A 3F5GA 4FOBA 4BCFA 3SVVA 4NH1A 4E7WA 4OLIA 4FTIA 1ZOHA 3DOGA 4OTFA 3PWYA 3JS2A 2QHMA 5ANKA 4FUYA 5FG8A 4UWYA 5E8ZA 2XCKA 3W1FA 3QTSA 4M15A 4GK4A 5T6KA 2R3RA 4YJVA 1OKWA 2GU8A 1PKGA 3NSZA 2XZSA 2YIWA 3NYXA 4WBBB 4XV2A 4B6LA 1Q5KA 2VTNA 4RFZA 3UDTA 4QMZA 4EJ7A 2PL0A 3VW8A 3I60A 4FKLA 5IEVA 4BB4A 1H1WA 3HVCA 4GUBA 4GW8A 5ETIA 2A1AB 5FUTA 4P90A 1KE5A 3DZOA 3RPVA 2YJRA 3SC1A 3E5AA 3R83A 4O7ZA 4FNYA 2VZ6A 5KNJA 5LCKA 5AUUA 3V5QA 5CEOA 4YJTA 3G0EA 3MGYA 3FXWA 4ZAUA 1GNGA 5ETCA 3GEQA 5LARA 3SQQA 3CSVA 1UNGA 4Q5HA 3GU7A 4AU8A 2ITQA 5CSVA 4EHZA 2BZIB 3PRIA 4TNDA 4CFMA 4BCQA 4F1OA 2UZLA 1FMKA 5M09A 1J1BA 2ZB1A 4M68A 5LOHA 2E9PA 5TR6A 1YHSA 2RFEA 2WTVA 4OTPA 3PPZA 3PFYA 5AV4A 3A99A 3MA3A 4RZWA 5HEZA 4BDKA 3KREA 2Y6MA 2ZB0A 2X7FA 2G9XA 3FV8A 4I94A 2C3JA 4ALUA 3GQIA 3R7IA 2CDZA 4ASXA 3LXNA 4A4OA 3E7OA 2OIBA 5IQIA 3MS9A 3AT4A 4L00A 4QMPA 4MXYA 3D2IA 5HG7A 4C4HA 4EEVA 2BMCA 3UBDA 4DYMA 4EK4A 1Q41A 2XK4A 1IRKA 2VWZA 3FL4A 5M56A 1VR2A 2BCJA 4IANA 2VD5A 3NVKI 2WIHA 5B2LA 5CU2A 4EORA 3RBWA 2F57A 2YERA 2CSNA 4YU2A 3KMWA 4F99A 4IWDA 5M4CA 4D58A 4NL0A 4RIOA 1OKYA 3EL7A 3QCQA 4MH7A 2HY81 1PY5A 4AZVA 2W1ZA 5FD2A 1MRYA 3K3JA 4EONA 4W4VA 2HZ0A 4TN6A 5I9ZA 3SAYA 4IZ5A 3F88A 4O6LA 3S1HA 2BUJA 3ATSA 3UQFA 4TYHB 4JDKA 3EJ1A 3TUCA 2V22A 5CZIA 3NWWA 4BJJA 1QPEA 2R3MA 2RFNA 4DGOA 3OUKA 5CEPA 4JQ8A 4LV8A 2E9VA 4R7HA 5DT0A 2WQOA 4O1OA 1YVJA 5DH3A 3O51A 1PYEA 5HLWA 4USDA 2QOBA 5LQFA 4L3PA 1GY3A 2FSOX 4BIBA 4FZ6A 4O7RA 1H1SA 4KAOA 4FZFB 3C5IA 2Z7SA 1APME 4C4EA 4LOOA 3UYSA 2ZJWA 4CEGA 5DN3A 4DE4A 1R1WA 3RNYA 2VN9A 2X4ZA 4FKTA 4FZDB 4S2ZA 4XEYA 4J96A 2WTKB 2R7IA 2JDVA 5AUVA 1SVHA 3WBLA 4LQMA 3ZUTA 3LW0A 4FE2A 1Q4LA 1YDSE 4BYJA 5FDXA 4ZJVA 5L8KA 2ZDUA 5JFXA 4IIRA 2F4JA 2E9OA 2Z7RA 4JBPA 1WMKA 2VGOA 4XG9A 4CZTA 1OUYA 5J79A 3AKKA 1WFCA 4TNBA 3C1XA 2WMBA 1MRVA 4O4EA 4QYHA 1MUOA 2IVVA 2X1NA 4DAWA 3C4CA 4ZSAA 2W5HA 2VTQA 5EI2A 2HZ4A 2OWBA 2DWBA 3P5KA 1V0PA 2C5XA 3ODYX 4QNAA 5AV1A 3V5TA 3ZRKA 1IAHA 4Y83A 2FSLX 4O1PA 4RG0A 4KBCA 5BYYA 5M51A 3QTZA 3WF9A 2O0UA 2JAMA 2W1CA 2YISA 3ITZA 2J7TA 4L67A 4BCKA 2C6DA 1Q8YA 3HMPA 3LJ0A 4MK0A 4LGGA 5TOZA 3MPTA 3HUCA 4NIFA 4C38A 4CKRA 2BDFA 4DDGA 1BYGA 2PZPA 3E8NA 3VBYA 4FTQA 3ALNA 4DG0E 4H58A 4XOZA 4BBEA 3VRZA 4FTLA 4I5MA 1FINA 1PW2A 4B8MA 5M55A 3EB0A 5C01A 4J52A 4LFIA 2QG5A 3ELJA 3R7VA 5C8MA 4FMQA 4IB5A 1ZOEA 3HKOA 2BZKB 3VULA 5HNIX 4DDIA 4MXCA 1SM2A 4DH8A 4GL9A 2IW8A 3JYAA 4GS6A 3W55A 5KMOA 4AW0A 3FEGA 2BDJA 4MQ2A 4ZZNA 3W33A 4EQCA 2IZRA 4U8ZA 2YFXA 1ZMUA 5LMKC 3N9XA 3FKNA 3TIYA 4M66A 4BIDA 5TE0A 3NEWA 4OBPA 2C4GA 2QO2A 3G5DA 4HNFA 4C8BA 2W05A 3TL8A 1YI6A 2YN8A 4M69B 1UV5A 4ACHA 3FY2A 3W2SA 3W0MA 2EUFB 4FKGA 3PWDA 3VUDA 4IB1A 3SRVB 1YXVA 4N6ZA 4DN5A 3FLWA 2B9FA 2Y4IB 4FKPA 4O0UA 5IA5A 1F0QA 4GK3A 5M06A 4EH7A 2WHBA 3G6GA 3VIDA 3QWKA 3IDCA 5CSXA 3VQUA 2QKRA 4PTCA 3G2FA 5A9UA 1ZZ2A 5AJQA 3EYHA 4ANLA 3W10A 4BDEA 5BV3A 2Y4IC 2AC3A 2JITA 3LM0A 3EMGA 5EG3A 3AC1A 1WBNA 4EYJA 1VYWA 3KXNA 4EH8A 1YXXA 5L8LA 3UMXA 5DYJA 4L43A 5CS6A 3UGCA 3VQHA 5E8VA 3FZOA 3NUPA 3FLZA 4B7TA 2BTSA 3ROCA 3ZRMA 4RA4A 5L2SA 5AUYA 5K5NA 5IH5A 1YQJA 3ORIA 4FR4A 1E1XA 2YM8A 4ALWA 3F7ZA 3EFWA 3FKOA 3NZ0A 4FIEA 3PG3A 3HDNA 3FQSA 3MFTA 5HCYA 4CT2A 2R3KA 2C5OA 2V7AA 2VNWA 2C6EA 2ZOQA 1V0BA 4DFZE 3ZSHA 4XCUA 4Z3VA 2YAKA 4IH8A 2ZM1A 5K0XA 4BCNA 1JLUE 2ZV8A 2XP2A 4JXFA 3POZA 1REJA 3ENMA 2GFSA 3PP1A 5JT2A 3BYVA 3C5UA 4LOPA 4F9BA 4DT9A 3WZDA 3JY9A 5FTOA 2R64A 2PE2A 4JQEA 2XIZA 4ASDA 4CG9A 2XB7A 4K6ZA 4BI0A 2O3PA 3DAKA 3GU8A 4FT7A 3RINA 5ITAA 3EKNA 1OL5A 2WB8A 2X7OA 2XK3A 3V6SA 5HIDA 4PY1A 2R3FA 3LFFA 4CMOA 4BDCA 4XH6A 3MVLA 4EUUA 4FL1A 3QRTA 5ETFA 3FZRA 3OS3A 3DJ6A 4ZK5A 4TWOA 1ZMWA 3DDQA 3HAVA 1W84A 3R2BA 3KRWA 1OPKA 4EQUA 5J5SA 2OH0E 3H3CA 4HGEA 4NU1A 1M14A 1EH4A 4YO4A 2DQ7X 4UWBA 3MY5A 3UPZA 4P2KA 3H0YA 2RFSA 3WIKA 5FEQA 4F78A 2XNNA 4EBVA 3GOPA 3MV5A 4RMZA 1RQQA 4JL9A 5C9CA 3UDBA 1J91A 2IF8A 4HW7A 4J53A 2GS2A 3E3BX 4JR3A 5CXZA 2PMIA 2R4BA 3AMBA 3I5ZA 3KXZA 3EKKA 4YC3A 5M57A 2QOQA 2ETRA 1YKRA 5J7BA 4I3ZA 3VAPA 3KQ7A 3CQUA 4GVAA 5CT0A 2UW0A 2FB8A 5H8BA 3W0PA 1O6LA 1R3CA 3KXXA 4IFGA 2YACA 4ZTHA 2H6DA 3D94A 3RAKA 2Z8CA 4EOMA 4FSNA 2WELA 4QTEA 3WF7A 3NUSA 3D2KA 4AOJA 3EOCA 3BHTA 2C30A 3NW6A 2J0KA 3UZPA 4JIKA 4JS8A 4EH5A 3OCGA 2WTWA 3I79A 5GIPE 3IW8A 3MSSA 4F4PA 3FAAA 2FVDA 2W0JA 4EHGA 3AC5A 1ZYDA 4CCBA 5T3QA 2O64A 4YGAA 3TNWA 4FTAA 1R78A 4IACA 4PNKA 4F7NA 3COKA 5L6PA 3UQCA 1ST4A 3MWUA 3CJFA 4QT1A 5H2UA