5FWKK

Atomic cryoem structure of hsp90-cdc37-cdk4 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
209
structure length
209
Chain Sequence
IKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT SHOCK PROTEIN HSP 90 BETA
publication title Atomic Structure of Hsp90-Cdc37-Cdk4 Reveals that Hsp90 Traps and Stabilizes an Unfolded Kinase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 52
structure length 209
sequence length 209
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2016-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5fwkK00
4EOKA 3QQUA 5CEOA 4WUAA 4FKGA 3I81A 5IH5A 4LOQA 2B54A 4O0RA 2UVXA 2WHBA 4U97A 1OPKA 5TOZA 5JGAA 4I6HA 1ZWSA 3KXXA 4CFUA 2HY0A 2OH4A 3QALE 3OBJA 4K11A 4W8EA 3VQHA 3EN9A 1SNUA 5EKNA 4EOOA 2W5BA 3KY2A 3BWJA 3QX2A 2VTHA 3PG1A 2V5QA 4LV5A 4U42A 5D12A 1ZOGA 5KMJA 1JSVA 2JAMA 3TJCA 3LCOA 2BFXA 4FOBA 2ITQA 4DH3A 2R2PA 1TVOA 2RFSA 4MF1A 5LVPA 4V0GB 4GIIA 3KEXA 1OIUA 1BI7A 4XRJA 4WO5A 3LFEA 3DKGA 5AP2A 5HLWA 1GZ8A 3BEAA 2JKOA 3IOPA 5EW8A 3AG9A 2QD9A 3OWJA 4ZSAA 5L3AA 5M56A 2BIYA 3SVVA 4G6LA 2R5TA 2VTSA 2QOFA 5CT7A 3GVUA 4TYIA 3PWYA 3MY0A 4I24A 3ZFYA 5M53A 4F4PA 4FTOA 2ERZE 5AJQA 4DG3E 3RK9A 5C8KA 3PFQA 4FKWA 3I5ZA 3CQEA 2C5XA 4C35A 1PXIA 5G6VA 4BWXA 3HLLA 4QOXA 4R1YA 2CN8A 5FDXA 3VUKA 4PMTA 4YLLA 4F7NA 2UZUE 4M8TA 4EK6A 4C57A 4XS2A 2JBOA 1SMHA 3CQUA 1WVYA 4L6QA 4R7IA 1U46A 1WBTA 3IW7A 3PVBA 4QP6A 3ZZEA 2GNIA 5BVFA 2YABA 1Q8WA 3H3CA 3NYOA 3FXWA 3C4ZA 4XYFA 3UIUA 1HOWA 4GSBA 3F3VA 3IGOA 2W17A 4ZZOA 3EQPA 1YOJA 5BNJA 4MBLA 2E9OA 3W18A 4A07A 2HOGA 2WEIA 3D83A 4FIGA 4LOOA 5E8VA 5HE1A 3P1AA 2EXCX 2EXMA 1M2RA 2B9FA 4WBOA 5GJFA 4HZSA 5K9IA 4GG7A 4HCVA 1H1RA 5FXSA 5I5ZA 3R71A 5EDPA 3WZJA 4DFNA 3IW8A 4JDKA 4C58A 4RJ7A 2XP2A 4OBOA 3QTWA 2C6MA 3QC4A 4V04A 1ZOHA 5EI2A 3O7LB 3UNZA 3VS5A 5EOBA 2HXLA 1BI8A 4FVRA 4QYFA 4Y95A 2A27A 4G3GA 5EHOA 2UZTA 3DTWA 4ZJIA 5JRQA 3RKBA 2WMTA 4PWNA 4CKRA 4X3FB 2WMXA 4FUXA 4RWJA 3UC3A 2RL5A 3ACKA 3OF0A 5TT7A 3T8OA 2XKEA 3RINA 3FZ1A 3DBQA 1L3RE 2Z7SA 2PE1A 4KKHA 4PUZA 1ATPE 4JIAA 4ZZMA 4AGUA 3R28A 1JQHA 2H6DA 4C3PA 3UIXA 5CSPA 4RA4A 3NW7A 4I0SA 1YXVA 5HIDA 4BIDA 4XNEA 3LCSA 2XJ0A 3PE2A 4V0GA 3WF9A 5CF8A 2WTKC 3LM0A 3Q4UA 5CT0A 3TIZA 5HTBA 2P55A 2QHNA 3D5UA 4QYHA 4DFYA 3QHWA 5HORA 3E8EA 3OG7A 3QA0A 5J1WA 3SLSA 2XIYA 1JKSA 4F99A 4HVHA 2C6IA 2WQMA 4DN5A 5AP7A 1MRVA 5CNNA 3R8PA 3R7UA 4RRVA 4KRDA 3RK5A 5KBRA 1LR4A 2VTNA 3D2IA 3GU4A 3CGOA 1RJBA 1P5EA 4QMQA 2VZ6A 4FNXA 4AZWA 5EYDA 3I5NA 3O8PA 4JJRA 4FSNA 2B4SB 3Q5ZA 3Q60A 4CKIA 1OL5A 4DCEA 5DMZA 1FMOE 2DQ7X 3CP9A 3ZRMA 3UOHA 1U54B 2B52A 3P86A 5AIKA 2BMCA 3VC4A 4QTEA 3F7ZA 3WARA 2HAKA 1DAWA 3DAJA 3A7IA 3R01A 4FK3A 2QOIA 2XCKA 4WBBB 4B8LA 3L8VA 1JSTA 2Y6OA 2VN9A 2WTIA 5JRSA 4M3QA 5M4CA 3NIEA 1H25A 1Q3DA 2HENA 1NXKA 3BGQA 2QOHA 5FEEA 2WU6A 4CCBA 4I94A 4BBMA 5HVJA 5CEKA 5BQ0A 2YERA 4ZY5A 3QYZA 3WIGA 3CXWA 4FGBA 5IH6A 3H10A 4QP3A 3D9VA 3C7QA 5FBOA 3GB2A 2ERKA 2BR1A 2YIXA 3FMJA 3IDCA 3QFVA 5E8XA 2IVVA 5AUWA 2VD5A 4GUEA 3HDMA 4IWDA 2Z7RA 3UQFA 4CT2A 3V01A 4RVMA 4YU2A 2C5NA 2H96A 2I0VA 2UW8A 1SNXA 3QF9A 1LPUA 2R7IA 3LZBA 3REPA 4BHZA 1NVSA 4EH8A 3UGCA 4KKEA 4GMYA 5ANOA 4FV7A 4I4FA 3P9JA 4L3JA 4GT3A 4PF4A 5CU2A 4ZY6A 3CKWA 4I0TA 5JGDA 3TUDA 1ZAOA 4XCUA 3DV3A 3LOKA 4W8DA 2W5HA 2PZRA 4YZBA 4NWMA 3DCVA 1VJYA 3EL8A 5CANA 1PYEA 3FMNA 3ENHA 1PF8A 2UW5A 3ZXTA 4FKVA 4J8MA 4W4WA 1Q62A 3EQHA 4QMNA 3TKHA 3A8XA 5EI8A 5C26A 5HBJA 4TY1A 1Y6BA 4F9YA 4FTLA 3GC9A 4CT1A 2Z7LA 2WKMA 1Q97A 4FMQA 2ITTA 1IR3A 4JS8A 3DBCA 3E87A 5D11A 4BYJA 4YR8A 3MY5A 3L9PA 3Q32A 4PMSA 2PUUA 3F66A 5DG5A 3R8ZA 3DNEA 4RA5A 3QCQA 4GRBA 2R3GA 2UZEA 2WMBA 3C13A 3TNIA 1H24A 4C4GA 3W2PA 1H26A 1SVGA 3FKOA 4G5JA 4K8AA 1BL7A 5HNIX 2YWPA 3G0FA 4XG8A 4AT4A 3EFJA 3PJ3A 3DZQA 4M84A 5CU0A 4JNWA 2JIIA 4FT9A 4CMTA 4FODA 3TXOA 1KOBA 4OTFA 4UWBA 4EOLA 2GS2A 4OTDA 3G6HA 3V8WA 4GFOA 2A19B 5HLNA 4XHKB 5CI7A 4F64A 1PY5A 3PRIA 5CU4A 4QQTA 2BKZA 4EHEA 4W9WA 5J79A 2C0IA 2R9SA 5KO1A 4MBIA 3Q3BA 3BU5A 4X0MA 4TZRA 3R9OA 3UC4A 3QBNA 4OAUC 2VNYA 4OTPA 3TKIA 2ETMA 4C38A 5DRDA 4IJPA 4G16A 3RTPA 3G0EA 4N4SA 3U9CA 1YVJA 4FIFA 4NK9A 2CN5A 2YM3A 4CFNA 3BPRA 3OUNB 1Y8YA 3WZEA 1Z9XA 3QKKA 4AZEA 4D1XA 3NYNA 3KVXA 4G3EA 2QI8A 4PDSA 3VHKA 3E8NA 4YUQA 4CD0A 3A99A 3POZA 2IW9A 3TZMA 3ZO3A 2XIXA 5AUYA 3PTGA 5F95A 4R7HA 5L2QA 4L00A 1GIIA 3PA3A 4CYJA 4XG4A 4W4YA 4UEUA 4YTFA 3ZC6A 2W96B 3BGZA 4IEBA 3PIXA 5E7RA 2PVMA 4E5WA 3NUYA 4BDGA 4XJ0A 4DC2A 1GIJA 1R1WA 4RX9A 1H27A 5A6OA 2UW7A 3JPVA 2WFYA 3I6UA 3UO4A 4RLKA 4C59A 3FMEA 4RJ5A 4UWCA 4YC6A 2XS0A 3ORZA 1VZOA 4HPTE 5ICPA 2OICA 3LQ8A 3RM7A 3S3IA 1KSWA 1CTPE 3EN6A 4N6YA 5CU3A 3VQUA 4ZLOA 2BRNA 1PXPA 2XK4A 4UYNA 3VUHA 1CDKA 5ACKA 3HNGA 5ETCA 5AR7A 3VS0A 1YXUA 4PP7A 1NVRA 4QP7A 4AW2A 1SM2A 3PVWA 4D2PA 3GU8A 3W2QA 5AX3A 3UG1A 3VF8A 5H8GA 4L3PA 1FGIA 4TYJA 4FL2A 2GS6A 2H9VA 5CS6A 5KE0A 2X4FA 4Q9ZA 4BCOA 4OTHA 4RIYB 2VAGA 4K0YA 3KMUA 3OROA 3V04A 3DA6A 4ANMA 3BBTB 5CF4A 4R5YA 1W0XC 5KBQA 3EYGA 5ITAA 4D0XA 4U0IA 1PXJA 2ZV7A 1BYGA 2JIUA 3C4CA 3KMMA 2W1IA 4FV4A 4FG8A 4G3DA 1ZARA 2V55A 3THBA 5L8KA 4P5ZA 2QU5A 2XNPA 4ZTQA 1ZZLA 3RGFA 1Q3WA 2UW4A 3NAYA 4AAAA 4FSRA 5CTPA 3PSBA 2UVZA 4IDTA 2QOQA 3MJ2A 2XF0A 4J52A 5HE2A 3BHYA 4ONAA 1M17A 4FSTA 1K9AA 4YJQA 3UODA 3WBLA 3OC1A 1STCE 4BVUA 4ARKA 4AZVA 2XEZA 4QYYA 3EQDA 3QUDA 3RVGA 3F6XA 5CWZA 4GUBA 4PNIA 5CF5A 4JBPA 5ETAA 3PA5A 3ORPA 3QC9A 4ZLZA 4YJNA 5I9YA 3HV7A 4L67A 5GZAA 3FQEA 2C5OA 2WU7A 3TZ7A 4WT6A 3E8CA 3RAWA 3OWPA 3MH1A 1H1QA 2JFMA 5CU6A 3EB0A 2FUMA 2YDJA 4IWQA 3I0OA 3R8LA 1ZRZA 5DNRA 4YSJA 3FMLA 3VWAA 4H39A 3C4WA 1HCLA 3CLYA 3RNYA 3ZLSA 4QYEA 3ZRKA 3L8PA 4FTIA 3TG1A 2CGUA 3MVJA 4YLKA 3KRJA 3FHIA 4M7IA 3II5A 1T45A 3F3WA 5ANEA 3RHXA 2J90A 4K2RA 4RG0A 4Y73A 2W1GA 4OUCA 1AQ1A 1MRUA 2C68A 4M69A 3ZSIA 2LGCA 4P7EA 4RPVA 4EBWA 4Z16A 3BBWA 1Q99A 3ET7A 3HMNA 3GFWA 4UB7A 5IA5A 3ODYX 3ZFXA 4X3JA 4A9SA 4FKIA 4ID7A 3WILA 4DEGA 4OLIA 4K77A 4F1OA 4JG8A 4NT4A 4A4LA 4HCTA 3VBYA 4EOIA 3CKXA 3BRBA 5C1QB 3R8VA 3WF5A 3MGYA 4USEA 4BTMA 3NR9A 3FPMA 4ZTLA 4PQNA 2ITYA 4ZZNA 2WOTA 5AP0A 2PVHA 4CFXA 4TW9A 4G3CA 3PJCA 3VO3A 2YIWA 4XMOA 2WTKB 4TWCA 4XV9A 4YJTA 5I9XA 4NUSA 3JUHA 1B6CB 3FXZA 4JLCA 3CR0A 5HIBA 3R8MA 5AP3A 4EH3A 4YMJA 2VWVA 3NRMA 3BWFA 2WXVA 1MUOA 3QD4A 4PL3A 4PL5A 5J87A 3RJCA 4XP0A 4AW0A 5EYKA 2WD1A 4CV8A 5BVDA 4BDCA 3OCTA 4R3PA 2BTSA 2Q0NA 1YHVA 1OI9A 3DLSA 3IONA 4FOCA 5L8JA 4QYGA 4AFEA 3GUBA 4CRLA 3SW4A 4DHFA 5IUGA 4B8MA 4HVGA 3GNIB 4KSPA 1TKIA 4N0SA 5J7BA 5CSVA 4IX5A 1REKA 2X7FA 5CQWA 3C1XA 4AA4A 4AU8A 2BRBA 4O0SA 2Q0BA 2W1ZA 4YHFA 4C37A 4ACCA 4ENYA 5E8UA 5ETFA 4YZCA 4AT5A 3CPBA 4U40A 3EFLA 5KHWA 2I0HA 3UQCA 3CTHA 4KABA 5AWMA 1WVXA 4FTJA 1OKVA 2XYNA 3F5XA 3MH3A 1IEPA 3PA4A 5TF9A 4QMMA 5J95A 5HCZA 2OBJA 1RQQA 2R3QA 4R3CA 3OMVA 3OWLA 3ROYA 2XRWA 4XUFA 5LVLA 3A61A 3A62A 3D5WA 5T3QA 4BC6A 3HMMA 4APCA 2VRXA 4CMOA 4RX8A 5ANDA 4J98A 2BROA 1DI8A 4FTQA 4QMZA 4EONA 3LJ2A 2CLXA 4E20A 2PVNA 5L6PA 2QCSA 2V62A 3PP1A 3ZLYA 3HVCA 5BVEA 3DLZA 2ZYBA 5M4UA 4ITHA 3WE4A 4TT7A 1OGUA 2ITZA 4ASEA 4BDHA 3ALOA 4D2TA 1JKLA 1PXLA 2VO7A 2VO3A 1YDSE 1G5SA 2YZAA 3C0IA 3NAXA 5HVYA 4BWKA 1M7QA 4QMOA 5FGKA 4KSQA 1Z5MA 4I93A 4RGJA 4CZTA 4E7WA 2CDZA 5ANGA 4RIXA 4RZVA 1YHWA 4IZ5A 3ZSHA 4FKPA 4KIOA 5HTCA 1Q24A 3BZ3A 4YHTA 4M14A 4QMLA 3UDBA 3Q9XA 2RFEA 4ASZA 2WAJA 4RVTA 2YHVA 3FUPA 3HRBA 3V5JA 4IC7A 2B53A 4AW1A 5EW9A 4FKQA 5CQUA 4HJOA 3DGKA 3LHJA 4IADA 3KULB 4OT6A 2WOUA 3D15A 3ZSGA 2HK5A 3EN5A 4M97A 2NRYA 4O38A 1JSUA 3SRVA 4KAOA 2XIZA 2XB7A 4DGGA 4F6UA 5M51A 2A1AB 3R02A 1UVRA 2RFNA 2YDIA 1OKZA 2GMXA 5DN3A 4BCKA 2BILB 2X9FA 1UU9A 2JAVA 4FX3A 4IE9A 1YI6A 4DH1A 3HGKA 4NKAA 5H3QA 1DAYA 4KBCA 2HELA 4EK8A 5A4TA 2JDTA 5AADA 1XWSA 2H34A 1T46A 4Z9LA 3TZ9A 4U41A 1R0EA 4BBEA 2J5FA 3VF9A 2R3NA 2HIWA 1IA8A 2CGXA 1AGWA 3RNIA 3F3ZA 4D2SA 3L8XA 2PE0A 1XBAA 2X2KA 2GNLA 3QUPA 3SAYA 2YDKA 5I4NA 1FQ1B 3KF4A 2UZWE 3BYVA 5LJJA 3UOLA 3RPRA 2ITUA 2VTQA 2XMYA 4EH7A 2YACA 5LVNA 5L4QA 3MTFA 3ROCA 5GZ9A 4EOJA 3UO5A 5IEYA 2PZ5A 5HI2A 2IW6A 4FV3A 5AP6A 4H1MA 4UYAA 5BX0A 2XBJA 3LCDA 3IW6A 2JITA 3AD5A 5ANKA 4MWHA 2VV9A 4FSZA 3UOJA 4LQMA 1LEZA 4IAFA 5JFVA 3I79A 5C8MA 2C5VA 1H08A 2O3PA 4IZYA 5L2TA 5AA8A 4YBJA 3HA6A 3DBEA 4EYJA 5D1JA 4ANSA 3NUNA 5HD4A 4QMYA 4WOVA 2QHMA 3QTRA 4G9RA 3F3TA 5TO8A 3VS6A 5FBNC 3KN5A 2BZHB 4DEAA 3D14A 4BI2A 2BZJA 5F4NA 4AWIA 2WZJA 5HO7A 2RKUA 4U6RA 3ZUTA 4FTTA 4FTRA 3IS5A 4NCTA 3UP7A 3GU5A 3LJ0A 2W5AA 4FR4A 3GQLA 3FZPA 2OF4A 2ZOQA 4L68A 3LFSA 4OBPA 2XKDA 1PHKA 4ZIMA 2UW6A 4WNPA 5HBEA 4UZDA 5IA4A 5IG1A 4OR5A 2C0TA 4MNFA 1H01A 3F3UA 3MA6A 1P14A 4PL4A 2FO0A 4CFFA 2YEXA 2XJ1A 4CQEA 2E2BA 3TZ8A 1VYZA 5HBHA 2CSNA 2OJ9A 4OGRA 2YM7A 3G33A 5CAPA 4HZRA 4QPAA 3V5QA 4AN3A 2YLFA 4G2FA 3D7TA 3FV8A 5ACBC 5LXMA 1SZMA 3EKNA 4ANQA 2Y7JA 4GT4A 4M15A 5FDPA 4WA9A 4WNKA 4BDDA 4WIHA 3FI3A 4TL0A 4YTHA 2CKEA 5LMBA 2OIQA 2XNMA 5LQFA 2J9MA 3MB6A 3ZMMA 3E93A 2BFYA 4M66A 2JFLA 4O0UA 2OW3A 3ZUVA 3BLHA 4FV0A 4JR3A 2O8YA 3FL5A 1OUYA 1UKHA 4LOPA 4S32A 1WBVA 2X8EA 5JZNA 3UOKA 4OTWA 3BHHA 3CE3A 4D4VA 5B0XA 3FI4A 3TJDA 4F0FA 3DXNA 1H1PA 1U59A 3K3JA 4NTSA 1MQBA 2VTAA 3FWQA 3BYOA 2J4ZA 1A06A 3E88A 4QPSA 5FQDC 3Q5IA 4BL1A 1QPCA 2CGWA 3FXXA 4FIEA 4YLJA 2X1NA 4NFMA 2OGVA 3RAKA 2YCRA 3E7OA 3LFBA 1B38A 5DEWA 3DNDA 5AR2A 1DS5A 2ZMDA 4JOAA 2R3IA 2QR8A 4S31A 3TNQB 2C5YA 4V01A 4WHZA 4RZWA 3ZDUA 4FI1A 5HGIA 3NSZA 3UYSA 2GNGA 2QOLA 3VVHA 4WRGA 2F2UA 5FP6A 3Q4CA 4O2PA 4QNYA 2UZVA 3PXYA 3ZONA 5ANIA 2OI4X 4BTFA 4D1ZA 2XNEA 3POOA 5B2LA 3KXHA 4BCJA 2W99B 3SQQA 1BL6A 2X7GA 4RVLA 4UBAA 2OZOA 3K5UA 4NH1A 2JDRA 3V5LA 4HVIA 1M52A 3TACA 3AOXA 5KCVA 3I1AA 3A60A 2C3IB 5DEYA 3CEKA 5AUUA 4FK6A 5HU3A 4L3LA 1QPJA 3FYKX 4AW5A 4NTTA 4HVDA 5DE2A 3HEGA 4X2NA 3PG3A 4MVFA 4YSMA 5BPYA 1Y6AA 4GK2A 2PVLA 5M55A 3P08A 4FNWA 1WBPA 2OJIA 5L2WA 3NW6A 3F7WA 4P2KA 1XBBA 3AMAA 4ACGA 4YURA 4U45A 1F3MC 2RFDA 3FLZA 5AMNA 5EG3A 3FZOA 3W55A 3FC2A 5IMXA 3MVHA 2PK9A 1R3CA 3Q6UA 1BLXA 3W10A 4BWPA 1PMNA 4FVPA 1IASA 5HO8A 3ZH8A 4AQCA 4BICA 4JX7A 5JKGA 4NKSA 1BKXA 2OIDA 4TWPA 2ITWA 4XP2A 4IAKA 4L42A 4A06A 3AT4A 2O63A 4F9WA 1UNGA 3VIDA 5IA3A 1WBWA 3DS6A 3ORNA 3UMXA 3BU6A 5LMKC 3GC8A 4BDJA 1OL1A 4Y46A 3W8LA 2WELA 3D2KA 3IOKA 3ZFMA 4FZ7A 1MQ4A 3KGAA 2XRUA 4O6LA 3R9DA 4A4OA 2YFXA 3QWKA 3UMWA 4QMPA 3HMOA 5LCJA 4HNFA 1BX6A 4EWHA 5KUPA 4F6SA 2JD5A 4CLIA 3KQ7A 3SOAA 1PKGA 4DEEA 4O96A 4ALUA 4FSYA 4K33A 4NZWB 4RLLA 1XQZA 1M14A 4GEOA 2RGPA 4QMWA 5HHWA 3UVRA 1V0PA 3BELA 4IQ6A 2PL0A 2R3RA 3SX9A 4EZ5A 3K3IA 4CMUA 5L6WL 1J3HA 4F09A 2GNFA 2JEDA 4G5PA 4GCJA 3FKNA 3HYHA 3EH9A 4PPBA 4E6CA 3KU2A 3MH2A 3VRZA 4N70A 2W4OA 4LMUA 2B9IA 3G2FA 3A7JA 4FV1A 4YO4A 4CFWA 3MW1A 4ERKA 3ORTA 4IIRA 3VBVA 4ZTHA 4ASDA 3S1HA 3G6GA 2VUWA 3FY2A 4FL1A 5CNOA 2C6DA 1H28A 3QTXA 2YCFA 5F9EA 4ZP5A 1Q5KA 3IW4A 4LGGA 3QZIA 1XH9A 3OCGA 4MXYA 3K2LA 4Y83A 2XEYA 2WTDA 3HZTA 2JLDA 3ANQA 1TQPA 3IPHA 5E8SA 2C30A 3IDPA 4LGHA 2WQNA 2VTOA 3QQKA 1FOTA 1OMWA 1YWVA 3P4KA 2OZAB 3G9LX 5E91A 4E4LA 4S33A 3H0ZA 3G90X 3ETAA 3KMWA 3T3UA 3NNWA 4P90A 2UZBA 4WD5A 5JN2A 3KN6A 3B2WA 4ZTNA 3EFKA 1PXOA 5AAGA 5HX8A 4GU6A 2QNJA 2JDVA 2XIKA 3ZHPC 4XBRA 1F0QA 2X0GA 5M57A 3ZO4A 4J1RA 5EI6A 4AE6A 1OECA 3HV6A 1FVRA 2QOCA 3ZDIA 3O8TA 4L01A 4GH2A 3R1SA 3R9HA 5K4IA 2YAKA 3BKBA 3CCNA 3ZS5A 3TEIA 2XH5A 3PY0A 4ZSLA 4YO6A 2P2HA 3FMMA 3ZCLA 2I1MA 2X7OA 3R1QA 4IVAA 4PTGA 2X6EA 3HL7A 3DK6A 3NYXA 4F70A 2WMQA 3EFWA 2J0LA 3E3PA 4E26A 1WCCA 5D7VA 4TKSA 1NA7A 3COKA 4RFZA 4QRCA 3L9NA 4PTCA 3R7VA 2FH9A 3ZOSA 4X3FA 5CAUA 4RWLA 5IEVA 2J0MB 2J6MA 4F7LA 3EOCA 3H4JA 2UZNA 3GCSA 2W4KA 4IAIA 4IDVA 4MEDA 4TPTA 5LARA 4Q2AA 5HE0A 4IVCA 2QLUA 2ZM4A 1W7HA 2EXEA 4PPCA 3V6SA 1F5QA 1UV5A 2W9FB 5E92A 4FA2A 4UMPA 3BEGA 4YNOA 3PPKA 2IVUA 2ONLC 1Q4LA 2DYLA 2WQEA 3RHKA 1FVTA 2QOBA 3MFUA 4ZSEA 1FGKA 1ZMUA 3FLWA 4B6LA 1OIRA 1UNHA 4JBVA 3D94A 3DFAA 4RBLA 5EHLA 5AV2A 2EU9A 3FDNA 3ORKA 3RP9A 1VYWA 1PKDA 4G17A 3AGMA 3FZSA 1KV1A 1UWJA 3UPZA 4BZNA 3ENMA 4UMQA 3RM6A 3LMGA 3VS4A 3WF7A 4X7QA 3HMPA 4E73A 3PXRA 1SVHA 2AUHA 4IZ7A 3SC1A 4YZMA 4QT1A 4KIKB 3LCTA 2JBPA 2DS1A 2UVYA 3S4QA 3U4WA 4EH6A 2BALA 3TI1A 5KMMA 3QCXA 5A3XA 5CX9A 4Y72A 5KMIA 4XG9A 4BDFA 3O7LD 1U5RA 4ITIA 5BUEA 5C8NA 5IISA 2CLQA 3QRJA 5HQ0A 3MYGA 1U54A 2YAAA 1XH4A 3P5KA 3OHTA 4YZNA 3ITZA 4G6NA 5J5SA 2HZ4A 1KOAA 4Q5HA 5AV3A 1GZKA 1W82A 3AC5A 2OZAA 3R30A 4XLVA 5DWRA 5EOLA 5CENA 3BHUA 4TNDA 4FZDB 3H0YA 3RPVA 3EN4A 4EQCA 4MNEB 3EIDA 2XCHA 4FT5A 3BQCA 3HA8A 5KZ0A 1YQJA 3R7GA 2PY3A 3JY9A 2C0OA 4TTHB 2ESMA 4IM0A 3ZEWA 4IVDA 3PJ1A 4J7BA 2GCDA 2RIOA 2HZIA 3AC8A 2IW8A 4ZS0A 4BCMA 4D1SA 4Q5EA 3GXLA 5AUXA 4FVQA 4X2JA 2YM8A 3MY1A 4YPDA 4L45A 4UALA 4AN9A 2P33A 1XKKA 2RG5A 4FSUA 4X21A 3RPSA 4F65A 2XJ2A 4DGMA 4II5A 1VEBA 5AP5A 2ITNA 2IZUA 3DJ5A 4DBNA 5I9VA 3H9FA 4QP9A 4E4XA 4F7JA 3UYTA 3KF7A 1J1BA 2HY81 3CTQA 3LFDA 5CEMA 5JSMA 2R3KA 2C3LA 4NM3A 3GCUA 3F61A 1OUKA 4BCNA 2XNNA 4CLJA 1DM2A 4ACDA 4MYGA 4ANOA 3O8UA 2O0UA 4FL3A 3ULIA 5AIRA 3FQSA 4C4HA 2CCHA 3ORMA 1E1VA 4MCVA 4RFYA 4C61A 4DEBA 2VWUA 3NNVA 4YC8A 4FZ6A 3DQXA 5F94A 3OP5A 4AOTA 2GHGA 3KCKA 2BAJA 4JDJA 1H1WA 2P2IA 5D9HA 3TV4A 2J50A 5G1XA 1YW2A 3G9NA 1UKIA 3K5VA 3BLQA 3EWHA 5JEBA 3MBLA 3TWJA 1PXNA 5B2MA 4F1TA 3IO7A 4JRVA 2ZB1A 3QTUA 3QLFA 1M2QA 3CTJA 5FM2A 5JMSA 4NIFB 5E90A 2OXDA 4J53A 2PVRA 4H3BA 2RSVA 5FTOA 4NEUA 4LL0A 3EMGA 4FKRA 4E4NA 2NP8A 4QMVA 4NM7A 1ZZ2A 3U4UA 4BFMA 2WIHA 3AT2A 4TYHB 1XBCA 1YI3A 3QCSA 2OJFE 4WG5A 3SDJA 4AZTA 3EQFA 4MXCA 5LWMA 4QTBA 4TYEA 5FRIA 3U9NA 4I41A 4BYIA 1Y8GA 3PXQA 4C4EA 4RSSA 4ANLA 5A4EA 1UNLA 3FLSA 5L2SA 1PJKA 3QA8A 4MTAA 5EHYA 2ZB0A 1WZYA 4EC8A 3B8RA 1WMKA 3GU6A 4CNHA 3MTLA 3DB8A 4CEGA 3R1YA 2VTIA 4BI0A 1WBNA 3P23A 5KHXA 3ALNA 3A7FA 2F9GA 4D9TA 2NPQA 2GPHA 4KNBA 3A7GA 4O0VA 1MP8A 5ETIA 3P7CA 4LRKA 3TCPA 3HECA 3VJNA 5EKOA 3BIZA 4L44A 5CAVA 5IU2A 2PWLA 4Z3VA 3KRXA 4HOKA 4MNEA 5LCKA 3PJ2A 1ZYLA 3NUXA 5EM8A 2C1AA 2C1BA 4RC4A 4YJPA 3VUIA 4AZSA 2JKKA 3F9NA 2PVJA 5LOHA 2G2HA 4Y5QA 3COMA 4IWOA 1UWHA 4WNOA 4RIOA 3WYYA 1U4DA 2JGZA 2X6DA 4YTIA 4RC3A 5GJGA 1OZ1A 4NSTA 3DY7A 4HYUA 4QD6A 4FV5A 2XK3A 2R3MA 1CKJA 5AV1A 3QHRA 4C3FA 2FSLX 1V1KA 3G5DA 3AXWA 3SKCA 3R0TA 3R2YA 4F63A 4FKJA 1S9JA 2UUEA 3FE3A 3P7AA 5HTIA 4C02A 3GENA 1GZOA 1OKWA 1BMKA 3LQ5A 3Q6WA 3W1FA 5LMAA 2KULA 2OFVA 4MD8E 4DH7A 4X2FA 4YP8A 3DB6A 4M0YA 5CLPA 4ZTMA 3LVPA 3KCFA 5K0XA 3I6WA 3NUSA 3NYVA 4E3CA 2QODA 3NUPA 3MB7A 3S00A 2J51A 5T68A 4MXOA 3QGYA 4JX3A 1PXMA 3WE8A 2OF2A 3QRUA 3UNJA 3S2PA 3TTIA 4W4XA 5K5XA 2IVTA 3PLSA 4BCQA 4AF3A 3OXIA 3RCDA 3LJ1A 1XHAA 3V6RA 5C27A 1OL7A 4ZTSA 2VWWA 2DWBA 3NX8A 2YM5A 4ALWA 3CPCA 3PY3A 4LUDA 1GZNA 2ZMCA 1GAGA 2B7AA 5D41A 3FY0A 2AC5A 2EB2A 2W9ZB 4L7FA 4KIQA 2VTMA 4IWPA 4C2VA 3PE1A 5HG8A 3OXTA 4G31A 1H07A 2FSOX 3W2SA 3UE4A 4UWYA 3JS2A 4S2ZA 3PPZA 4HGSA 3EQBA 3GBZA 1PYXA 2PMOX 4TYHA 2A2AA 3R6XA 4QMSA 4DINA 2VX1A 4I20A 4RIYA 3QL8A 4ACMA 3GOKA 3W2OA 2GU8A 2XK7A 3RPOA 4F7SA 3VHEA 3KVWA 4AA0A 3FZTA 5L6OA 1OVEA 3ZU7A 5HICA 2Y4IC 4KS7A 4M0ZA 2V0DA 5LVOA 1CKPA 3KKVA 2R3OA 3NNUA 4C4FA 4C7TA 4J95A 5GNKA 2GTNA 4BCGA 5E8WA 2VNWA 1QMZA 4EOPA 2NO3A 3M2WA 5H8EA 1LUFA 1YDRE 2PVFA 3BHTA 5B7VA 5CEPA 4TXCA 3QQLA 3UBDA 4BRXA 2QG5A 5BVNA 3QRTA 3DTCA 3MIYA 1CMKE 2XM9A 3VULA 1PMEA 5CZIA 2REIA 4O0TA 4YJRA 4FIJA 4O22A 3QTQA 4QTDA 4CTCA 4UX9A 3HRCA 3P78A 4L9IA 3CD3A 3OT3A 3KA0A 2PVYA 2PZYA 2PHKA 3Q9ZA 4ANBA 4FT0A 2BTRA 3LW0A 3DFCB 4FYNA 2GFCA 4U7ZA 4DAWA 2IJMA 3GCVA 3QTIA 4S30A 2VWIA 1E1XA 4FKTA 5DPVA 3S0OA 4O0XA 1JLUE 2UZLA 4FG9A 4KRCA 3DK7A 4PV0A 5HE3A 4DGLC 1URWA 3OS3A 4H3PA 4F0GA 4IX3A 2VX3A 3A4OX 4JQ7A 3VBTA 4HGTA 4RX5A 1H8FA 5J7HA 4FSQA 4DH8A 2VU3A 5JQ8A 5IZFA 4M13A 3WF6A 2W0JA 2CPKE 3DDPA 5CVGA 3FSKA 4PTEA 3ZYAA 2VTTA 5K3YA 3BYSA 4PDPA 2YITA 2J0KA 2F4JA 4WG4A 5HNBA 1QCFA 3FHRA 2XK9A 3COHA 4XG7A 4YJVA 5JFWA 3D7ZA 3TIYA 2Z8CA 3F2AA 3PUPA 3QCYA 5AAEA 1V0OA 1YDTE 2CGVA 3KXNA 3PPJA 4QQ5A 3ZO1A 3FQHA 4CVAA 4YHJA 4QMTA 2W1EA 3QQGA 4MH7A 5HZNA 2WGJA 3V51A 5HCYA 1X8BA 3KK9A 3LFFA 3HRFA 2W4JA 1JOWB 4FNZA 5IUIA 3BLRA 3UZPA 4EZ7A 3CS9A 3SXRA 4A4XA 2WMVA 5LWNA 5HU9A 4XG3A 3HV5A 3TNHA 4Z7HA 3I60A 3UTOA 4AP7A 4ZXTA 5CY3A 4O2ZA 1GY3A 2C3JA 3QGWA 4OT5A 4XBUA 2GFSA 4EHZA 4Z55A 5KKRC 2R3LA 5CSXA 4EJNA 3I4BA 4MAOA 3EQCA 4OTQA 3AD6A 2HZ0A 3IK3A 3COIA 2XUUA 3JVRA 1S9IA 3QKLA 4KBAA 1KE5A 5DR9A 3EKKA 2VTLA 3HKOA 4FTCA 2UZOA 3O2MA 4BIEA 5J9ZA 3AQVA 5K4JA 3NDMA 4QP1A 2B1PA 2DUVA 2FGIA 3GQIA 4TWOA 4A9TA 3O51A 3QD3A 3CY2A 3QZHA 2GNJA 1RDQE 4I23A 5CXZA 5BUJA 2BAKA 1FVVA 2J5EA 5AUTA 2YIRA 5J8IA 4PPAA 5C01A 4U3ZA 5AM6A 1W98A 3FLQA 3MSSA 5E8TA 3TKUA 5DHJA 4IMYA 3C0HA 3W2RA 3F5UA 4QQCA 3VBXA 1W83A 3O0GA 4G1WA 4KB8A 5DIAA 5H8BA 3MVLA 2P3GX 2A0CX 2IZSA 5HO6A 5BMSA 4UZHA 2ETKA 4AFJA 1APME 4AZFA 3U8WA 4I0RA 3PIYA 2BAQA 3GFEA 4I5CA 4TWNA 5EH0A 1ZYCA 3NCGA 3OEFX 4D0WA 4B7TA 2V7OA 5CALA 4MWIA 3DOGA 4A9RA 2X8IA 3CD8A 4O21A 3ZLWA 2PE2A 4NJDA 2C6TA 3PY1A 5DA3A 1H0VA 2GSFA 2J0JA 3MPTA 5CXHA 2ZV8A 3FBVA 3ZEPA 2QURA 4C36A 4R8QA 4V05A 5K5NA 1KE8A 2HCKA 4MQ2A 3ZZWA 2FSMX 4DFZE 3KULA 5A4LA 2UW9A 4D4RA 4KWPA 1OPJA 4L43A 5DH3A 5AUVA 4JIKA 4X2KA 3ZUUA 4BTKA 4UXLA 3DKOA 4E4MA 4BCFA 4ANNA 4QQJA 2VO0A 4GJ2A 1O6LA 1ZLTA 4ZOGA 3H9OA 4LMNA 1Q8TA 4BKJA 3AC3A 3VW6A 4NW5A 2OIBA 5M44A 4R1VA 3KRRA 1QPEA 2J7TA 3SA0A 2Y9QA 4ZSJA 3IDBA 3T3VA 5A46A 4ENXA 3MPMA 3RMFA 4HYIA 4EH4A 3Q96A 4EWQA 1XH6A 1HCKA 3MVMA 4BI1A 4KBKA 5IA0A 4EUUA 2XNBA 4AOJA 2OJGA 2FA2A 5FD2A 2HXQA 3VBWA 5K0KA 2G2IA 4JXFA 2FVDA 4MBJA 2WB8A 4U9AA 2BZIB 3WYXA 3LCKA 2X8DA 3IKAA 4E6AA 4HGEA 1I44A 2JDSA 2OO8X 4EK4A 1TQIA 5BUIA 2GTMA 4ZJJA 5IKWA 3FPQA 2E9UA 1YWRA 3FL4A 3NWWA 1OKYA 4GFGA 3BE9A 4HNIA 3IW5A 3R7YA 1LEWA 4CXAA 5E8ZA 4J96A 3KXZA 2W1FA 4EL9A 5IEXA 1M2PA 2F57A 2B9JA 3ERKA 4YNEA 2ZDUA 4IAZA 3D4QA 3EQRA 4H58A 2Y0AA 4JR7A 3QAME 4EC9A 2XK6A 4I21A 4MD9E 2R3FA 3ZTXA 4CTBA 4LG4A 4AA5A 5CF6A 3EQGA 3Q04A 3FI2A 3QTSA 3VS2A 5JK3A 3V5WA 2XKCA 5ANJA 4U43A 3TN8A 3W33A 4FBXA 2HW6A 5TKDA 4UXQA 4FZAB 3R21A 2H8HA 4IM2A 1Y91A 3DT1A 4BZOA 3ORXA 2VTPA 4WG3A 3KB7A 1OIQA 3NNXA 2IO6A 2QOOA 4UV0A 3RI1A 4TYGA 5FEDA 5C9CA 1FINA 3RCJA 4BGGA 2WIPA 4U80A 3MJ1A 3E64A 1A9UA 3EQIA 4ZJVA 5DR6A 1B39A 2YM4A 1R78A 1E9HA 3NUUA 4NW6A 4GYIA 4PY1A 5AUZA 3FKLA 3O96A 4D4SA 4Z7GA 2C47A 3BX5A 3ZLXA 5AR8A 3RAIA 4GG5A 3Q9YA 2ZM3A 4GW8A 5CYIA 3L9LA 3U51A 3JVSA 3WZUA 2BRMA 3DAEA 4GS6A 4Q9SA 4BCHA 3O71A 4BKZA 4HVSA 3VS7A 5IA1A 4RQKA 4DEHA 2QC6A 1I09A 3OY1A 4BCPA 2VGOA 3UVPA 4IZAA 4HPUE 4K6ZA 3IECA 4MKCA 4DLJA 1ZMWA 1O6KA 5EFQA 4M67A 3TL8A 4JBOA 5DT0A 5BVKA 3QYWA 3DQWA 2BHHA 2HZNA 2BUJA 1NVQA 4K9YA 3S95A 4U81A 4EOQA 5AA9A 1DI9A 3C5UA 3CC6A 4UY9A 2WQBA 2XK8A 3QQJA 4MF0A 5J9YA 3GC7A 2F2CB 4YJOA 3OCSA 3N51A 4BDBA 4DGOA 4KA3A 4XV3A 2WO6A 3RPYA 4JAJA 4HCUA 3U6JA 2QO7A 5M4FA 2VWYA 4F6WA 5HIEA 2IZRA 2IWIA 5HKMA 2G1TA 5JZJA 2UV2A 3OY3A 2CCIA 4LUEA 3ZM4A 5JGBA 4ITJA 3NLBA 2Z60A 1H4LA 1ZOEA 2B9HA 3R04A 4FYOA 5IUHA 2IVSA 5CEIA 2XNOA 4NM0A 3QZFA 3F2NA 2Y4IB 2OXYA 1XH5A 4NM5A 5J1VA 4IB5A 2XZSA 3QD0A 1OL2A 3LIJA 3UIBA 2XVDA 3R00A 3QQFA 4G6OA 4GV1A 3F69A 4O1OA 4RJ3A 5D7AA 5FM3A 3ZO2A 4OTRA 3OBGA 2RF9A 2YA9A 4PMMA 3UZTA 2HW7A 1R0PA 3FMHA 4UMTA 1KE9A 4JL9A 5E1SA 3UJGA 3LXPA 4HGLA 4I1ZA 3WI6A 3KL8A 5IA2A 1PXKA 5AAFA 3HMIA 2Y8OA 2PMIA 2B55A 2X2MA 3PZEA 3FC1X 1G3NA 2OSCA 3C50A 4KKGA 5CAQA 4CFMA 4PX6A 4D2WA 3ORLA 3GCQA 3SV0A 1OIYA 3OOMA 3SD0A 4AN2A 4EKLA 2ITXA 3QXOA 4QP8A 4D5HA 5H2UA 4Y85A 4JQ8A 1K2PA 5GHVA 3CJFA 2FB8A 4EBVA 4RVKA 2R3JA 3LFQA 4YPSA 3VRYA 3W16A 4BHNA 4O91A 4BIBA 5HVKA 1YWNA 4M68A 3GI3A 5DOSA 2W06A 5HEZA 4BDAA 4FEQA 5FLFA 3OD6X 3UP2A 2XBAA 3CQWA 3DKCA 2W1DA 5FXRA 2BRGA 5HLPA 3V8TA 5KMKA 2YJRA 1BUHA 4FIHA 5BYZA 4ZEGA 3VUTA 2WMAA 3OFMA 4ZTRA 5HG9A 3CBLA 1P2AA 3NW5A 4NU1A 1OITA 3EHAA 4RIWB 3ZC5A 5EM5A 4O0WA 3ULZA 4ZLYA 4FKLA 4C62A 4EYMA 3Q52A 3MFSA 3DKFA 4AS0A 5AEPA 2F49A 4XEYA 5HOAA 1WFCA 4AT3A 1ZYDA 4CYIA 3QQHA 3E3BX 4IB3A 2BHEA 5HG7A 2BPMA 1WVWA 4PP9A 5JH6A 1MRYA 4IXPA 3ACJA 2J2IB 5L2IA 4CZUA 4EK5A 3PXKA 5CVHA 1UU8A 3BV2A 1Y57A 4MXXA 3SOCA 2WEVA 4FC0A 4RJ6A 5A6NA 3P0MA 5CSHA 1Q8YA 3BGPA 4ZK5A 1UA2A 4FSWA 5T6KA 5BVWA 4LGDA 4ASXA 2R0IA 3GC0A 3FMDA 3HUCA 4FKUA 4I5HA 2LAVA 5L8LA 4FTUA 5DGZA 3Q4TA 5IDNA 4QP4A 1UU7A 2I0YA 2C6OA 2O2UA 4O27B 4JDIA 4JRNA 4NCTC 3QXPA 4QP2A 2XYUA 5AV0A 1YXTA 4IVBA 5JQ5A 3HUBA 2F7EE 4FV6A 3QD2B 1JAMA 3FSFA 5HESA 5JT2A 5KKRB 4YZ9A 4N6ZA 3IQ7A 4IB0A 4R5SA 2E9VA 5CEQA 4EH5A 5BVOA 5I9WA 3L1SA 4AACA 2J0IA 3TT0A 3C4FA 3I7BA 2XM8A 4R3RA 2SRCA 3PYYA 4I5PA 1CKIA 4NJ3A 4Y8DA 2YCSA 2C4GA 3SXFA 2GQGA 4CQGA 3F5GA 4HW7A 3HV4A 3EZRA 1GOLA 4IBMA 4ALVA 3IGGA 3QWJA 5AX9A 5I0BA 4I6QA 2W05A 3AC4A 4S34A 1JKTA 2R7BA 3GEQA 4FT3A 2VTJA 4F9CA 1FPUA 4PRJA 4OTIA 5EK7A 4C33A 3TUCA 3NZ0A 3WF8A 3PRFA 4FZFB 5F20A 4MXAA 2BDWA 1ZXEA 2UZDA 4KD1A 2KTYA 3EYHA 4EORA 4NFNA 5FTQA 5KMOA 5I9ZA 2BIKB 1M7NA 4KIPA 3WZKA 1KWPA 2VX0A 5J9LA 1U5QA 4JG7A 2WMSA 3DAKA 4C8BA 2I40A 5DVRA 3AMBA 3G51A 5KMNA 4U5JA 3MWUA 2OK1A 2ZV9A 3AC2A 4I4EA 1XH7A 2IZTA 3W32A 5GZ8A 2QQ7A 4U8ZA 3ZBFA 4PNKA 2O64A 4RIWA 5KZIA 3VS3A 4UMUA 3R7OA 4QPMA 3PSCA 2WTVA 1H0WA 2HYYA 3UPXA 5HX6A 1LP4A 3NCZA 3QU0A 2EUFB 3ZBXA 4ERWA 4F9BA 5KNJA 4RQVA 4U79A 1YKRA 4X2GA 4AGCA 5AV4A 3HX4A 3P79A 4I92A 2YISA 1YXSA 2EB3A 2YCQA 4IHPA 4YBKA 2HWPA 5CASA 4PMPA 4USFA 3M11A 3DK3A 2WQOA 3PWDA 1YOMA 4GYGA 4WRSA 5FG8A 4IAYA 4I6FA 4RX7A 5AM7A 5I3RA 2RG6A 2C6KA 4TRLA 5FEQA 4L53A 3PP0A 1KE7A 1O9UA 3EZVA 4RC2A 4LV8A 3RAHA 4AOIA 3MIAA 4A9YA 4FNYA 4EI4A 3D5XA 1URCA 4FKSA 4J97A 4UN0C 2V22A 4OBQA 2VO6A 5D10A 3AC1A 4FF8A 3W2CA 4BCIA 4EK3A 4U44A 3LXNA 2C6LA 3VBQA 4KS8A 3ANRA 4BBFA 3Q4ZA 4FV2A 2XIRA 4EOSA 2E9PA 4DG0E 2VGPA 2PMNX 4RWIA 4TNBA 4CCUA 2QKWB 4CV9A 4BDEA 3LFAA 3VN9A 3PVUA 3R2BA 4CKJA 2WPAA 1TQMA 3PIZA 4RWKA 3WIKA 2R0UA 4M69B 1H00A 3TV7A 5J5TA 4TN6A 5KX8A 3MI9A 3F5PA 5F1ZA 2W1HA 3A2CA 3TV6A 1IG1A 4JAIA 5HG5A 3RZBA 1J1CA 4KIKA 2Y4PA 2CJMA 1Q8UA 2VTRA 5FWKK 4E6DA 3AD4A 4FTKA 3MDYA 4AE9A 4GL9A 3P7BA 5EYMA 3DZOA 4LYNA 4IACA 2PSQA 3B2TA 3PZHA 5HNGA 4QO9A 4FKOA 3DPKA 3AMYA 3EJ1A 4E5BA 4OAVB 4X6QC 3DDQA 3LFNA 3V5TA 4D4YA 5FXQA 3C0GA 4DFXE 4FSMA 3MA3A 4XG2A 4W4VA 1RW8A 3VW8A 4APPA 4E1ZA 4IW0A 2QO2A 2ITVA 2GHMA 2P0CA 1FMKA 3E92A 3VUGA 1KV2A 5GJDA 2WMRA 4JDHA 3ORIA 2WMWA 5M4IA 2OJJA 5FP5A 3QRKA 3KK8A 1YHSA 4FTAA 1RE8A 1XH8A 3GCPA 3BU3A 2G2FA 2BDFA 3FJQE 4JT3A 4EHGA 4EZ3A 2ZVAA 3C51A 5IDPA 4D2VA 2R3HA 2PVKA 4LFIA 3T9IA 4A7CA 5DT3A 2BZKB 1VR2A 3VUDA 3UVQA 3SHEA 1XO2B 3QZGA 3OUKA 1EH4A 4B99A 4J71A 4CSVA 4MHAA 2ZV2A 3H30A 1ZYSA 4XG6A 4C3RA 4G3FA 3OXZA 4BZDA 3TTJA 3OW4A 3MPAA 2C6EA 3BQRA 4QMUA 2O65A 4WSQA 4FTNA 5TR6A 4AXAA 4AGDA 3L8SA 3MV5A 2R64A 5AR3A 4RMZA 2OU7A 5DI1A 2G01A 3A4PA 3V3VA 5I9UA 1PMVA 4JQEA 2GNHA 4YTCA 3A8WA 4WNMA 2W7XA 3GT8A 4BGHA 5AR5A 3LPBA 5AP4A 3BCEA 3TUBA 3FZRA 4A9UA 4DTKA 5JFSA 3ELJA 4B9DA 3NIZA 3UNKA 4H36A 3IG7A 3R73A 5CVFA 1Q61A 4MK0A 3ZXZA 3HP5A 4BB4A 4IAAA 5CAOA 2F7ZE 2HWOA 4ZSGA 2Z7QA 2XA4A 4G34A 3UG2A 4M12A 2ZAZA 4J8NA 4WKQA 2A4LA 2YN8A 3OOGA 4EH9A 1P4FA 3E8DA 5EDRA 2UW0A 2WTJA 5AR4A 5EYCA 4B4LA 5EM7A 2CHLA 4D28A 4FG7A 4F1MA 2ITOA 1ZMVA 1QL6A 3LM5A 4NIFA 4X6RA 2XNGA 4BKYA 4RIXB 1K3AA 5HD7A 3BE2A 2AYPA 3R83A 3W8QA 2FYSA 4E5AX 3NPCA 2FSTX 4H3QA 4BN1A 3HP2A 3I0QA 4FV9A 4RJ4A 3T9TA 2WNTA 4GIHA 3OTVA 4E93A 2QO9A 2R3PA 4QNAA 3H9RA 4XLIA 3HV3A 5IH4A 1PW2A 4AG8A 5EM6A 4GK3A 3SRVB 1WBOA 4LM5A 4MQ1A 2ACXA 4WSYA 4BTJA 2QU6A 4X3FC 4H1JA 4L8MA 4XH6A 3Q2MA 5C03A 2IN6A 3JYAA 4XV2A 1JWHA 2JIVA 3U6HA 2CMWA 2UW3A 3KRWA 3B8QA 4MX9A 5DFPA 4LRMA 3AT3A 4RFMA 4U3YA 3QRIA 4JBQA 3UIMA 4ZY4A 2V7AA 1YOLA 4BDIA 2ETRA 2QOKA 4IX6A 4LL5A 5A14A 1ERKA 2JDOA 3C4XA 2OKRA 3GU7A 4B0GA 4EQUA 3JY0A 5CZHA 5IF1A 4E8AA 1NY3A 5LVMA 4XX9A 3MN3A 1IRKA 4C2WA 3R1NA 4RT7A 5H9BA 3LLTA 4XOZA 5A54A 3RWQA 4WUNA 1H1SA 1JNKA 2ZM1A 4I6BA 1JVPP 5BYYA 2QVSE 3KFAA 2F7XE 5A4QA 4CRSA 4GVJA 2OXXA 2OWBA 2EWAA 2BRHA 5TE0A 3RK7A 5CSWA 3DBDA 3PXFA 3OVVA 4LI5A 3TNWA 4ZAUA 1GNGA 4D55A 3D0EA 2EVAA 4DH5A 4BGQA 2YLEA 3KXGA 5KMLA 3FYJX 4C4IA 4FTMA 2JKQA 3FLNC 4XOYA 3PJ8A 3U87A 3VUMA 1YXXA 3AGLA 3QTZA 2OH0E 3OZ6A 5BMMA 2GS7A 1Q41A 4GJ3A 3R9NA 4ACHA 4DITA 2X2LA 4DG2E 3K54A 3LXKA 1UU3A 5HCXA 2NRUA 5A4CA 4G9CA 2GDOA 3R7EA 5LMKA 2E9NA 2VWXA 4K18A 3BYUA 4IFCA 1XJDA 1WBSA 2VWBA 4JI9A 1OPLA 3OCBA 4MD7E 4RJ8A 3OTUA 1ZY5A 3DBFA 4YJSA 4C34A 4DGNA 4QMXA 3V8SA 1OL6A 3N9XA 2JC6A 3O50A 2QKRA 4FICA 4LRJA 5DRBA 5E8YA 4O6EA 3NGAA 3OT8A 1JBPE 5DLSA 3NS9A 3TNPC 1SYKA 3BV3A 1J91A 3BI6A 5B2KA 4XRLA 2QLQA 4P5QA 4EHVA 3LE6A 4KINA 3CJGA 1ZYJA 5EW3A 1XR1A 4I22A 4BDKA 4IANA 3MH0A 3RWPA 2Y6MA 2YJSA 2BVAA 4GVAA 4EUTA 4F08A 3PVGA 3OEZA 2JKMA 1V0BA 3O17A 3U6IA 2ZJWA 1KE6A 2G9XA 3EN7A 4C0TA 2AC3A 3M42A 4P4CA 2X39A 1ZY4A 3PXZA 4USDA 4XP3A 5DT4A 2C69A 3EL7A 1CSNA 4EEVA 1JKKA 3CY3A 4IB1A 3HDNA 4HYHA 2ITPA 5CI6A 3Q53A 4EQMA 3KC3A 5IMEA 1GJOA 3CGFA 2BDJA 2X81A 3FMKA 3D7TB 4YZDA 1SVEA 4IC8A 3DJ7A 3JXWA 3KXMA 4L52A 3VJOA 4GT5A 3E7VA 3OWKA 3OW3A 4IM3A 4HYSA 3F88A 1GIHA 2OG8A 3QX4A 5JFXA 4DYMA 2YIYA 2YM6A 4D5KA 4AGWA 3R7IA 3WZDA 2G15A 3Q9WA 1REJA 2PZIA 3L9MA 3R63A 4I3ZA 4GU9A 3RBWA 4AX8A 4E6QA 2I0EA 2VWZA 4DEDA 1QPDA 3MS9A 4DFLA 4L46A 3SXSA 2YIQA 3LFCA 1YI4A 3F82A 4YC3A 3UO6A 4CZYB 4O0YA 2O5KA 4YJUA 3GP0A 3E5AA 3UQGA 4IH8A 2I6LA 3BHVA 4PDOA 4UMRA 4GK4A 2PZPA 2C3KA 3QLGA 1OM1A 4D58A 1WAKA 4Y5HA 4GFMA 4MXZA 3LXLA 4F0IA 4FV8A 3BYMA 3FLYA 4OW8A 2Z2WA 4O1PA 3SW7A 3C4EA 4I5MA 3NEWA 3VS1A 3O23A 4AUAA 4OTGA 5A9UA 4R6VA 2W1CA 4CFVA 4EH2A 2BCJA 3I7CA 3ODZX 3VAPA 1O6YA 2WTCA 3A7HA 5DR2A 5E1EA 4C4JA 2QONA 2R4BA 4JVGA 1JPAA 3FAAA 2PTKA 4BF2A 4YGAA 1OB3A 4D9UA 1Z57A 3GGFA 4FIIA 4IJ9A 4J99A 4QTAA 2X4ZA 2X9EA 2ONLA 1AD5A 3R22A 1Q8ZA 3D5VA 5AP1A 1PMUA 2PMLX 3E62A 3PSDA 4EOMA 1P4OA 1YRPA 4JG6A 2OFUA 4F9AA 1CM8A 4K1BA 3M1SA 4D2RA 1W8CA 4DEIA 4FUYA 3R8UA 3MFTA 3KRLA 4DLIA 3GOPA 4IX4A 2WMUA 3C9WA 3RZFA 3QUEA 3E63A 4L7SA 1R39A 3VNTA 4W9XA 3MFRA 3LAUA 2P4IA 2QR7A 4XV1A 1W84A 4QTCA 2ZDTA 3ZRLA 3QKMA 4EKKA 2GHLA 5IPJA 2XKFA 5I3OA 5DBXA 3DU8A 3WOWA 5EDQA 3CIKA 2WTWA 3RALA 4FT7A 3DJ6A 4IFGA 3V5PA
chains in the Genus database with same CATH superfamily
4EOKA 3QQUA 5CEOA 4WUAA 4FKGA 3I81A 5IH5A 4LOQA 2B54A 4O0RA 2UVXA 2WHBA 4U97A 1OPKA 5TOZA 5JGAA 4I6HA 1ZWSA 3KXXA 4CFUA 2HY0A 2OH4A 3QALE 3OBJA 4K11A 4W8EA 3VQHA 3EN9A 1SNUA 5EKNA 4EOOA 2W5BA 3KY2A 3BWJA 3QX2A 2VTHA 3PG1A 2V5QA 4LV5A 4U42A 5D12A 1W2FA 1ZOGA 5KMJA 1JSVA 2JAMA 3TJCA 3LCOA 2BFXA 4FOBA 2ITQA 4DH3A 2R2PA 1TVOA 2RFSA 4MF1A 5LVPA 4V0GB 4GIIA 3KEXA 1OIUA 1BI7A 4XRJA 4WO5A 3LFEA 3DKGA 5AP2A 5HLWA 1GZ8A 3BEAA 2JKOA 3IOPA 5EW8A 3AG9A 2QD9A 3OWJA 4ZSAA 5L3AA 5M56A 2BIYA 3SVVA 4G6LA 2R5TA 2VTSA 2QOFA 5CT7A 3GVUA 4TYIA 3PWYA 3MY0A 4I24A 3ZFYA 5M53A 4F4PA 4FTOA 2ERZE 5AJQA 4DG3E 3RK9A 5C8KA 3PFQA 4FKWA 3I5ZA 3CQEA 2C5XA 4C35A 1PXIA 5G6VA 4BWXA 3HLLA 4QOXA 4R1YA 2CN8A 5FDXA 3VUKA 4PMTA 4YLLA 4F7NA 2UZUE 4M8TA 4EK6A 4C57A 4XS2A 2JBOA 1SMHA 3CQUA 1WVYA 4L6QA 4R7IA 1U46A 1WBTA 3IW7A 3PVBA 4QP6A 3ZZEA 2GNIA 5BVFA 2YABA 1Q8WA 3H3CA 3NYOA 3FXWA 3C4ZA 4XYFA 3UIUA 1HOWA 4GSBA 3F3VA 3IGOA 2W17A 4ZZOA 3EQPA 1YOJA 5BNJA 4MBLA 2E9OA 3W18A 4A07A 2HOGA 2WEIA 3D83A 4FIGA 4LOOA 5E8VA 5HE1A 3P1AA 2EXCX 2EXMA 1M2RA 2B9FA 4WBOA 5GJFA 4HZSA 5K9IA 4GG7A 4HCVA 1H1RA 5FXSA 5I5ZA 3R71A 5EDPA 3WZJA 4DFNA 3IW8A 4JDKA 4C58A 4RJ7A 2XP2A 4OBOA 3QTWA 2C6MA 3QC4A 4V04A 1ZOHA 5EI2A 3O7LB 3UNZA 3VS5A 5EOBA 2HXLA 1BI8A 4FVRA 4QYFA 4Y95A 2A27A 4G3GA 5EHOA 2UZTA 3DTWA 4ZJIA 5JRQA 3RKBA 2WMTA 4PWNA 4CKRA 4X3FB 2WMXA 4FUXA 4RWJA 3UC3A 2RL5A 3ACKA 3OF0A 5TT7A 3T8OA 2XKEA 3RINA 3FZ1A 3DBQA 1L3RE 2Z7SA 2PE1A 4KKHA 4PUZA 1ATPE 4JIAA 4ZZMA 4AGUA 3R28A 1JQHA 2H6DA 4C3PA 3UIXA 5CSPA 4RA4A 3NW7A 4I0SA 1YXVA 5HIDA 4BIDA 4XNEA 3LCSA 2XJ0A 3PE2A 4V0GA 3WF9A 5CF8A 2WTKC 3LM0A 3Q4UA 5CT0A 3TIZA 5HTBA 2P55A 2QHNA 3D5UA 4QYHA 4DFYA 3QHWA 5HORA 3E8EA 3OG7A 3QA0A 5J1WA 3SLSA 2XIYA 1JKSA 4F99A 4HVHA 2C6IA 2WQMA 4DN5A 5AP7A 1MRVA 5CNNA 3R8PA 3R7UA 4RRVA 4KRDA 3RK5A 5KBRA 1LR4A 2VTNA 3D2IA 3GU4A 3CGOA 1RJBA 1P5EA 4QMQA 2VZ6A 4FNXA 4AZWA 5EYDA 3I5NA 3O8PA 4JJRA 4FSNA 2B4SB 3Q5ZA 3Q60A 4CKIA 1OL5A 4DCEA 5DMZA 1FMOE 2DQ7X 3CP9A 3ZRMA 3UOHA 1U54B 2B52A 3P86A 5AIKA 2BMCA 3VC4A 4QTEA 3F7ZA 3WARA 2HAKA 1DAWA 3DAJA 3A7IA 3R01A 4FK3A 2QOIA 2XCKA 4WBBB 4B8LA 3L8VA 1JSTA 2Y6OA 2VN9A 2WTIA 5JRSA 4M3QA 5M4CA 3NIEA 1H25A 1Q3DA 2HENA 1NXKA 3BGQA 2QOHA 5FEEA 2WU6A 1W2CA 4CCBA 4I94A 4BBMA 5HVJA 5CEKA 5BQ0A 2YERA 4ZY5A 3QYZA 3WIGA 3CXWA 4FGBA 5IH6A 3H10A 4QP3A 3D9VA 3C7QA 5FBOA 3GB2A 2ERKA 2BR1A 2YIXA 3FMJA 3IDCA 3QFVA 5E8XA 2IVVA 5AUWA 2VD5A 4GUEA 3HDMA 4IWDA 2Z7RA 3UQFA 4CT2A 3V01A 4RVMA 4YU2A 2C5NA 2H96A 2I0VA 2UW8A 1SNXA 3QF9A 1LPUA 2R7IA 3LZBA 3REPA 4BHZA 1NVSA 4EH8A 3UGCA 4KKEA 4GMYA 5ANOA 4FV7A 4I4FA 3P9JA 4L3JA 4GT3A 4PF4A 5CU2A 4ZY6A 3CKWA 4I0TA 5JGDA 3TUDA 1ZAOA 4XCUA 3DV3A 3LOKA 4W8DA 2W5HA 2PZRA 4YZBA 4NWMA 3DCVA 1VJYA 3EL8A 5CANA 1PYEA 3FMNA 3ENHA 1PF8A 2UW5A 3ZXTA 4FKVA 4J8MA 4W4WA 1Q62A 3EQHA 4QMNA 3TKHA 3A8XA 5EI8A 5C26A 5HBJA 4TY1A 1Y6BA 4F9YA 4FTLA 3GC9A 4CT1A 2Z7LA 2WKMA 1Q97A 4FMQA 2ITTA 1IR3A 4JS8A 3DBCA 3E87A 5D11A 4BYJA 4YR8A 3MY5A 3L9PA 3Q32A 4PMSA 2PUUA 3F66A 5DG5A 3R8ZA 3DNEA 4RA5A 3QCQA 4GRBA 2R3GA 2UZEA 2WMBA 3C13A 3TNIA 1H24A 4C4GA 3W2PA 1H26A 1SVGA 3FKOA 4G5JA 4K8AA 1BL7A 5HNIX 2YWPA 3G0FA 4XG8A 4AT4A 3EFJA 3PJ3A 3DZQA 4M84A 5CU0A 4JNWA 2JIIA 4FT9A 4CMTA 4FODA 3TXOA 1KOBA 4OTFA 4UWBA 4EOLA 2GS2A 4OTDA 3G6HA 3V8WA 4GFOA 2A19B 5HLNA 4XHKB 5CI7A 4F64A 1PY5A 3PRIA 5CU4A 4QQTA 2BKZA 4EHEA 4W9WA 5J79A 2C0IA 2R9SA 5KO1A 4MBIA 3Q3BA 3BU5A 4X0MA 4TZRA 3R9OA 3UC4A 3QBNA 4OAUC 2VNYA 4OTPA 3TKIA 2ETMA 4C38A 5DRDA 4IJPA 4G16A 3RTPA 3G0EA 4N4SA 3U9CA 1YVJA 4FIFA 4NK9A 2CN5A 2YM3A 4CFNA 3BPRA 3OUNB 1Y8YA 3WZEA 1Z9XA 3QKKA 4AZEA 4D1XA 3NYNA 3KVXA 4G3EA 2QI8A 4PDSA 3VHKA 3E8NA 4YUQA 4CD0A 3A99A 3POZA 2IW9A 3TZMA 3ZO3A 2XIXA 5AUYA 3PTGA 5F95A 4R7HA 5L2QA 4L00A 1GIIA 3PA3A 4CYJA 4XG4A 4W4YA 4UEUA 4YTFA 3ZC6A 2W96B 3BGZA 4IEBA 3PIXA 5E7RA 2PVMA 4E5WA 3NUYA 4BDGA 4XJ0A 4DC2A 1GIJA 1R1WA 4RX9A 1H27A 5A6OA 2UW7A 3JPVA 2WFYA 3I6UA 3UO4A 4RLKA 4C59A 3FMEA 4RJ5A 4UWCA 4YC6A 2XS0A 3ORZA 1VZOA 4HPTE 5ICPA 2OICA 3LQ8A 3RM7A 3S3IA 1KSWA 1CTPE 3EN6A 4N6YA 5CU3A 3VQUA 4ZLOA 2BRNA 1PXPA 2XK4A 4UYNA 3VUHA 1CDKA 5ACKA 3HNGA 5ETCA 5AR7A 3VS0A 1YXUA 4PP7A 1NVRA 4QP7A 4AW2A 1SM2A 3PVWA 4D2PA 3GU8A 3W2QA 5AX3A 3UG1A 3VF8A 5H8GA 4L3PA 1FGIA 4TYJA 4FL2A 2GS6A 2H9VA 5CS6A 5KE0A 2X4FA 4Q9ZA 4BCOA 4OTHA 4RIYB 2VAGA 4K0YA 3KMUA 3OROA 3V04A 3DA6A 4ANMA 3BBTB 5CF4A 4R5YA 1W0XC 5KBQA 3EYGA 5ITAA 4D0XA 4U0IA 1PXJA 2ZV7A 1BYGA 2JIUA 3C4CA 3KMMA 2W1IA 4FV4A 4FG8A 4G3DA 1ZARA 2V55A 3THBA 5L8KA 4P5ZA 2QU5A 2XNPA 4ZTQA 1ZZLA 3RGFA 1Q3WA 2UW4A 3NAYA 4AAAA 4FSRA 5CTPA 3PSBA 2UVZA 4IDTA 2QOQA 3MJ2A 2XF0A 4J52A 5HE2A 3BHYA 4ONAA 1M17A 4FSTA 1K9AA 4YJQA 3UODA 3WBLA 3OC1A 1STCE 4BVUA 4ARKA 4AZVA 2XEZA 4QYYA 3EQDA 3QUDA 3RVGA 3F6XA 5CWZA 4GUBA 4PNIA 5CF5A 4JBPA 5ETAA 3PA5A 3ORPA 3QC9A 4ZLZA 4YJNA 5I9YA 3HV7A 4L67A 5GZAA 3FQEA 2C5OA 2WU7A 3TZ7A 4WT6A 3E8CA 3RAWA 3OWPA 3MH1A 1H1QA 2JFMA 5CU6A 3EB0A 2FUMA 2YDJA 4IWQA 3I0OA 3R8LA 1ZRZA 5DNRA 4YSJA 3FMLA 3VWAA 4H39A 3C4WA 1HCLA 3CLYA 3RNYA 3ZLSA 4QYEA 3ZRKA 3L8PA 4FTIA 3TG1A 2CGUA 3MVJA 4YLKA 3KRJA 3FHIA 4M7IA 3II5A 1T45A 3F3WA 5ANEA 3RHXA 2J90A 4K2RA 4RG0A 4Y73A 2W1GA 4OUCA 1AQ1A 1MRUA 2C68A 4M69A 3ZSIA 2LGCA 4P7EA 4RPVA 4EBWA 4Z16A 3BBWA 1Q99A 3ET7A 3HMNA 3GFWA 4UB7A 5IA5A 3ODYX 3ZFXA 4X3JA 4A9SA 4FKIA 4ID7A 3WILA 4DEGA 4OLIA 4K77A 4F1OA 4JG8A 4NT4A 4A4LA 4HCTA 3VBYA 4EOIA 3CKXA 3BRBA 5C1QB 3R8VA 3WF5A 3MGYA 4USEA 4BTMA 3NR9A 3FPMA 4ZTLA 4PQNA 2ITYA 4ZZNA 2WOTA 5AP0A 2PVHA 4CFXA 4TW9A 4G3CA 3PJCA 3VO3A 2YIWA 4XMOA 2WTKB 4TWCA 4XV9A 4YJTA 5I9XA 4NUSA 3JUHA 1B6CB 3FXZA 4JLCA 3CR0A 5HIBA 3R8MA 5AP3A 4EH3A 4YMJA 2VWVA 3NRMA 3BWFA 2WXVA 1MUOA 3QD4A 4PL3A 4PL5A 5J87A 3RJCA 4XP0A 4AW0A 5EYKA 2WD1A 4CV8A 5BVDA 4BDCA 3OCTA 4R3PA 2BTSA 2Q0NA 1YHVA 1OI9A 3DLSA 3IONA 4FOCA 5L8JA 4QYGA 4AFEA 3GUBA 4CRLA 3SW4A 4DHFA 5IUGA 4B8MA 4HVGA 3GNIB 4KSPA 1TKIA 4N0SA 5J7BA 5CSVA 4IX5A 1REKA 4O4CA 2X7FA 5CQWA 3C1XA 2IEWA 4AA4A 4AU8A 2BRBA 4O0SA 2Q0BA 2W1ZA 4YHFA 4C37A 4ACCA 4ENYA 5E8UA 5ETFA 4YZCA 4AT5A 3CPBA 4U40A 3EFLA 5KHWA 2I0HA 3UQCA 3CTHA 4KABA 5AWMA 1WVXA 4FTJA 1OKVA 2XYNA 3F5XA 3MH3A 1IEPA 3PA4A 5TF9A 4QMMA 5J95A 5HCZA 2OBJA 1RQQA 2R3QA 4R3CA 3OMVA 3OWLA 3ROYA 2XRWA 4XUFA 5LVLA 3A61A 3A62A 3D5WA 5T3QA 4BC6A 3HMMA 4APCA 2VRXA 4CMOA 4RX8A 5ANDA 4J98A 2BROA 1DI8A 4FTQA 4QMZA 4EONA 3LJ2A 2CLXA 4E20A 2PVNA 5L6PA 2QCSA 2V62A 3PP1A 3ZLYA 3HVCA 5BVEA 3DLZA 2ZYBA 5M4UA 4ITHA 3WE4A 4TT7A 1OGUA 2ITZA 4ASEA 4BDHA 3ALOA 4D2TA 1JKLA 1PXLA 2VO7A 2VO3A 1YDSE 1G5SA 2YZAA 3C0IA 3NAXA 5HVYA 4BWKA 1M7QA 4QMOA 5FGKA 4KSQA 1Z5MA 4I93A 4RGJA 4CZTA 4E7WA 2CDZA 5ANGA 4RIXA 4RZVA 1YHWA 4IZ5A 3ZSHA 4FKPA 4KIOA 5HTCA 1Q24A 3BZ3A 4YHTA 4M14A 4QMLA 3UDBA 3Q9XA 2RFEA 4ASZA 2WAJA 4RVTA 2YHVA 3FUPA 3HRBA 3V5JA 4IC7A 2B53A 4AW1A 5EW9A 4FKQA 5CQUA 4HJOA 3DGKA 3LHJA 4IADA 3KULB 4OT6A 2WOUA 3D15A 3ZSGA 2HK5A 3EN5A 4M97A 2NRYA 4O38A 1JSUA 3SRVA 4KAOA 2XIZA 2XB7A 4DGGA 4F6UA 5M51A 2A1AB 3R02A 1UVRA 2RFNA 2YDIA 1OKZA 2GMXA 5DN3A 4BCKA 2BILB 2X9FA 1UU9A 2JAVA 4FX3A 4IE9A 1YI6A 4DH1A 3HGKA 4NKAA 5H3QA 1DAYA 4KBCA 2HELA 4EK8A 5A4TA 2JDTA 5AADA 1XWSA 2H34A 1T46A 4Z9LA 3TZ9A 4U41A 1R0EA 4BBEA 2J5FA 3VF9A 2R3NA 2HIWA 1IA8A 2CGXA 1AGWA 3RNIA 3F3ZA 4D2SA 3L8XA 2PE0A 1XBAA 2X2KA 2GNLA 3QUPA 3SAYA 2YDKA 5I4NA 1FQ1B 3KF4A 2UZWE 3BYVA 5LJJA 3UOLA 3RPRA 2ITUA 2VTQA 2XMYA 4EH7A 2YACA 5LVNA 5L4QA 3MTFA 3ROCA 5GZ9A 4EOJA 3UO5A 5IEYA 2PZ5A 5HI2A 2IW6A 4FV3A 5AP6A 4H1MA 4UYAA 5BX0A 2XBJA 3LCDA 3IW6A 2JITA 3AD5A 5ANKA 4MWHA 2VV9A 4FSZA 3UOJA 4LQMA 1LEZA 4IAFA 5JFVA 3I79A 5C8MA 2C5VA 1H08A 2O3PA 4IZYA 5L2TA 5AA8A 4YBJA 3HA6A 3DBEA 4EYJA 5D1JA 4ANSA 3NUNA 5HD4A 4QMYA 4WOVA 2QHMA 3QTRA 4G9RA 3F3TA 5TO8A 3VS6A 5FBNC 3KN5A 2BZHB 4DEAA 3D14A 4BI2A 2BZJA 5F4NA 4AWIA 2WZJA 5HO7A 2RKUA 4U6RA 3ZUTA 4FTTA 4FTRA 3IS5A 4NCTA 3UP7A 3GU5A 3LJ0A 2W5AA 4FR4A 3GQLA 3FZPA 2OF4A 2ZOQA 4L68A 3LFSA 4OBPA 2XKDA 1PHKA 4ZIMA 2UW6A 4WNPA 5HBEA 4UZDA 5IA4A 5IG1A 4OR5A 2C0TA 4MNFA 1H01A 3F3UA 3MA6A 1P14A 4PL4A 2FO0A 4CFFA 2YEXA 2XJ1A 4CQEA 2E2BA 3TZ8A 1VYZA 5HBHA 2CSNA 2OJ9A 4OGRA 2YM7A 3G33A 5CAPA 4HZRA 4QPAA 3V5QA 4AN3A 2YLFA 4G2FA 3D7TA 3FV8A 5ACBC 5LXMA 1SZMA 3EKNA 4ANQA 2Y7JA 4GT4A 4M15A 5FDPA 4WA9A 4WNKA 4BDDA 4WIHA 3FI3A 4TL0A 4YTHA 2CKEA 5LMBA 2OIQA 2XNMA 5LQFA 2J9MA 3MB6A 3ZMMA 3E93A 2BFYA 4M66A 2JFLA 4O0UA 2OW3A 3ZUVA 3BLHA 4FV0A 4JR3A 2O8YA 3FL5A 1OUYA 1UKHA 4LOPA 4S32A 1WBVA 2X8EA 5JZNA 3UOKA 4OTWA 3BHHA 3CE3A 4D4VA 5B0XA 3FI4A 3TJDA 4F0FA 3DXNA 1H1PA 1U59A 3K3JA 4NTSA 1MQBA 2VTAA 3FWQA 3BYOA 2J4ZA 1A06A 3E88A 4QPSA 5FQDC 3Q5IA 4BL1A 1QPCA 2CGWA 3FXXA 4FIEA 4YLJA 2X1NA 4NFMA 2OGVA 3RAKA 2YCRA 3E7OA 3LFBA 1B38A 5DEWA 3DNDA 5AR2A 1DS5A 2ZMDA 4JOAA 2R3IA 2QR8A 4S31A 3TNQB 2C5YA 4V01A 4WHZA 4RZWA 3ZDUA 4FI1A 5HGIA 3NSZA 3UYSA 2GNGA 2QOLA 3VVHA 4WRGA 2F2UA 5FP6A 3Q4CA 4O2PA 4QNYA 2UZVA 3PXYA 3ZONA 5ANIA 2OI4X 4BTFA 4D1ZA 2XNEA 3POOA 5B2LA 3KXHA 4BCJA 2W99B 3SQQA 1BL6A 2X7GA 4RVLA 4UBAA 2OZOA 3K5UA 4NH1A 2JDRA 3V5LA 4HVIA 1M52A 3TACA 3AOXA 5KCVA 3I1AA 3A60A 2C3IB 5DEYA 3CEKA 5AUUA 4FK6A 5HU3A 4L3LA 1QPJA 3FYKX 4AW5A 4NTTA 4HVDA 5DE2A 3HEGA 4X2NA 3PG3A 4MVFA 4YSMA 5BPYA 1Y6AA 4GK2A 2PVLA 5M55A 3P08A 4FNWA 1WBPA 2OJIA 5L2WA 3NW6A 3F7WA 4P2KA 1XBBA 3AMAA 4ACGA 4YURA 4U45A 1F3MC 2RFDA 3FLZA 5AMNA 5EG3A 3FZOA 3W55A 3FC2A 5IMXA 3MVHA 2PK9A 1R3CA 3Q6UA 1BLXA 3W10A 4BWPA 1PMNA 4FVPA 1IASA 5HO8A 3ZH8A 4AQCA 4BICA 4JX7A 5JKGA 4NKSA 1BKXA 2OIDA 4TWPA 2ITWA 4XP2A 4IAKA 4L42A 4A06A 3AT4A 2O63A 4F9WA 1UNGA 3VIDA 5IA3A 1WBWA 3DS6A 3ORNA 3UMXA 3BU6A 5LMKC 3GC8A 4BDJA 1OL1A 4Y46A 3W8LA 2WELA 3D2KA 3IOKA 3ZFMA 4FZ7A 1MQ4A 3KGAA 2XRUA 4O6LA 3R9DA 4A4OA 2YFXA 3QWKA 3UMWA 4QMPA 3HMOA 5LCJA 4HNFA 1BX6A 4EWHA 5KUPA 4F6SA 2JD5A 4CLIA 3KQ7A 3SOAA 1PKGA 4DEEA 4O96A 4ALUA 4FSYA 4K33A 4NZWB 4RLLA 1XQZA 1M14A 4GEOA 2RGPA 4QMWA 5HHWA 3UVRA 1V0PA 3BELA 4IQ6A 2PL0A 2R3RA 3SX9A 4EZ5A 3K3IA 4CMUA 5L6WL 1J3HA 4F09A 2GNFA 2JEDA 4G5PA 4GCJA 3FKNA 3HYHA 3EH9A 4PPBA 4E6CA 3KU2A 3MH2A 3VRZA 4N70A 2W4OA 4LMUA 2B9IA 3G2FA 3A7JA 4FV1A 4YO4A 4CFWA 3MW1A 4ERKA 3ORTA 4IIRA 3VBVA 4ZTHA 4ASDA 3S1HA 3G6GA 2VUWA 3FY2A 4FL1A 5CNOA 2C6DA 1H28A 3QTXA 2YCFA 5F9EA 4ZP5A 1Q5KA 3IW4A 4LGGA 3QZIA 1XH9A 3OCGA 4MXYA 3K2LA 4Y83A 2XEYA 2WTDA 3HZTA 2JLDA 3ANQA 1TQPA 3IPHA 5E8SA 2C30A 3IDPA 4LGHA 2WQNA 2VTOA 3QQKA 1FOTA 1OMWA 1YWVA 3P4KA 2OZAB 3G9LX 5E91A 4E4LA 4S33A 3H0ZA 3G90X 3ETAA 3KMWA 3T3UA 3NNWA 4P90A 2UZBA 4WD5A 5JN2A 3KN6A 3B2WA 4ZTNA 3EFKA 1PXOA 5AAGA 5HX8A 4GU6A 2QNJA 2JDVA 2XIKA 3ZHPC 4XBRA 1F0QA 2X0GA 5M57A 3ZO4A 4J1RA 5EI6A 4AE6A 1OECA 3HV6A 1FVRA 2QOCA 3ZDIA 3O8TA 4L01A 4GH2A 3R1SA 3R9HA 5K4IA 2YAKA 3BKBA 3CCNA 3ZS5A 3TEIA 2XH5A 3PY0A 4ZSLA 4YO6A 2P2HA 3FMMA 3ZCLA 2I1MA 2X7OA 3R1QA 4IVAA 4PTGA 2X6EA 3HL7A 3DK6A 3NYXA 4F70A 2WMQA 3EFWA 2J0LA 3E3PA 4E26A 1WCCA 5D7VA 4TKSA 1NA7A 3COKA 4RFZA 4QRCA 3L9NA 4PTCA 3R7VA 2FH9A 3ZOSA 4X3FA 5CAUA 4RWLA 5IEVA 2J0MB 2J6MA 4F7LA 3EOCA 3H4JA 2UZNA 3GCSA 2W4KA 4IAIA 4IDVA 4MEDA 4TPTA 5LARA 4Q2AA 5HE0A 4IVCA 2QLUA 2ZM4A 1W7HA 2EXEA 4PPCA 3V6SA 1F5QA 1UV5A 2W9FB 5E92A 4FA2A 4UMPA 3BEGA 4YNOA 3PPKA 2IVUA 2ONLC 1Q4LA 2DYLA 2WQEA 3RHKA 1FVTA 2QOBA 3MFUA 4ZSEA 1FGKA 1ZMUA 3FLWA 4B6LA 1OIRA 1UNHA 4JBVA 3D94A 3DFAA 4RBLA 5EHLA 5AV2A 2EU9A 3FDNA 3ORKA 3RP9A 1VYWA 1PKDA 4G17A 3AGMA 3FZSA 1KV1A 1UWJA 3UPZA 4BZNA 3ENMA 4UMQA 3RM6A 3LMGA 3VS4A 3WF7A 4X7QA 3HMPA 4E73A 3PXRA 1SVHA 2AUHA 4IZ7A 3SC1A 4YZMA 4QT1A 4KIKB 3LCTA 2JBPA 2DS1A 2UVYA 3S4QA 3U4WA 4EH6A 2BALA 3TI1A 5KMMA 3QCXA 5A3XA 5CX9A 4Y72A 5KMIA 4XG9A 4BDFA 3O7LD 1U5RA 4ITIA 5BUEA 5C8NA 5IISA 2CLQA 3QRJA 5HQ0A 3MYGA 1U54A 2YAAA 1XH4A 3P5KA 3OHTA 4YZNA 3ITZA 4G6NA 5J5SA 2HZ4A 1KOAA 4Q5HA 5AV3A 1GZKA 1W82A 3AC5A 2OZAA 3R30A 4XLVA 5DWRA 5EOLA 5CENA 3BHUA 4TNDA 4FZDB 3H0YA 3RPVA 3EN4A 4EQCA 4MNEB 3EIDA 2XCHA 4FT5A 4O4FA 3BQCA 3HA8A 5KZ0A 1YQJA 3R7GA 2PY3A 3JY9A 2C0OA 4TTHB 2ESMA 4IM0A 3ZEWA 4IVDA 3PJ1A 4J7BA 2GCDA 2RIOA 2HZIA 3AC8A 2IW8A 4ZS0A 4BCMA 4D1SA 4Q5EA 3GXLA 5AUXA 4FVQA 4X2JA 2YM8A 3MY1A 4YPDA 4L45A 4UALA 4AN9A 2P33A 1XKKA 2RG5A 4FSUA 4X21A 3RPSA 4F65A 2XJ2A 4DGMA 4II5A 1VEBA 5AP5A 2ITNA 2IZUA 3DJ5A 4DBNA 5I9VA 3H9FA 4QP9A 4E4XA 4F7JA 3UYTA 3KF7A 1J1BA 2HY81 3CTQA 3LFDA 5CEMA 5JSMA 2R3KA 2C3LA 4NM3A 3GCUA 3F61A 1OUKA 4BCNA 2XNNA 4CLJA 1DM2A 4ACDA 4MYGA 4ANOA 3O8UA 2O0UA 4FL3A 3ULIA 5AIRA 3FQSA 4C4HA 2CCHA 3ORMA 1E1VA 4MCVA 4RFYA 4C61A 4DEBA 2VWUA 3NNVA 4YC8A 4FZ6A 3DQXA 5F94A 3OP5A 4AOTA 2GHGA 3KCKA 2BAJA 4JDJA 1H1WA 2P2IA 5D9HA 3TV4A 2J50A 5G1XA 1YW2A 3G9NA 1UKIA 3K5VA 3BLQA 3EWHA 5JEBA 3MBLA 2X0OA 3TWJA 1PXNA 5B2MA 4F1TA 3IO7A 4JRVA 2ZB1A 3QTUA 3QLFA 1M2QA 3CTJA 5FM2A 5JMSA 4NIFB 5E90A 2OXDA 4J53A 2PVRA 4H3BA 2RSVA 5FTOA 4NEUA 4LL0A 3EMGA 4FKRA 4E4NA 2NP8A 4QMVA 4NM7A 1ZZ2A 3U4UA 4BFMA 2WIHA 3AT2A 4TYHB 1XBCA 1YI3A 3QCSA 2OJFE 4WG5A 3SDJA 4AZTA 3EQFA 4MXCA 5LWMA 4QTBA 4TYEA 5FRIA 3U9NA 4I41A 4BYIA 1Y8GA 3PXQA 4C4EA 4RSSA 4ANLA 5A4EA 1UNLA 3FLSA 5L2SA 1PJKA 3QA8A 4MTAA 5EHYA 2ZB0A 1WZYA 4EC8A 3B8RA 1WMKA 3GU6A 4CNHA 3MTLA 3DB8A 4CEGA 3R1YA 2VTIA 4BI0A 1WBNA 3P23A 5KHXA 3ALNA 3A7FA 2F9GA 4D9TA 2NPQA 2GPHA 4KNBA 3A7GA 4O0VA 1MP8A 5ETIA 3P7CA 4LRKA 3TCPA 3HECA 3VJNA 5EKOA 3BIZA 4L44A 5CAVA 5IU2A 2PWLA 4Z3VA 3KRXA 4HOKA 4MNEA 5LCKA 3PJ2A 1ZYLA 3NUXA 5EM8A 2C1AA 2C1BA 4RC4A 4YJPA 3VUIA 4AZSA 2JKKA 3F9NA 2PVJA 5LOHA 2G2HA 4Y5QA 3COMA 4IWOA 1UWHA 4WNOA 4RIOA 3WYYA 1U4DA 2JGZA 2X6DA 4YTIA 4RC3A 5GJGA 1OZ1A 4NSTA 3DY7A 4HYUA 4QD6A 4FV5A 2XK3A 2R3MA 1CKJA 5AV1A 3QHRA 4C3FA 2FSLX 1V1KA 3G5DA 3AXWA 3SKCA 3R0TA 3R2YA 4F63A 4FKJA 1S9JA 2UUEA 3FE3A 3P7AA 5HTIA 4C02A 3GENA 1GZOA 1OKWA 1BMKA 3LQ5A 3Q6WA 3W1FA 5LMAA 2KULA 2OFVA 4MD8E 4DH7A 4X2FA 4YP8A 3DB6A 4M0YA 5CLPA 4ZTMA 3LVPA 3KCFA 5K0XA 3I6WA 3NUSA 3NYVA 4E3CA 2QODA 3NUPA 3MB7A 3S00A 2J51A 5T68A 4MXOA 3QGYA 4JX3A 1PXMA 3WE8A 2OF2A 3QRUA 3UNJA 3S2PA 3TTIA 4W4XA 5K5XA 2IVTA 3PLSA 4BCQA 4AF3A 3OXIA 3RCDA 3LJ1A 1XHAA 3V6RA 5C27A 1OL7A 4ZTSA 2VWWA 2DWBA 3NX8A 2YM5A 4ALWA 3CPCA 3PY3A 4LUDA 1GZNA 2ZMCA 1GAGA 2B7AA 5D41A 3FY0A 2AC5A 2EB2A 2W9ZB 4L7FA 4KIQA 2VTMA 4IWPA 4C2VA 3PE1A 5HG8A 3OXTA 4G31A 1H07A 2FSOX 3W2SA 3UE4A 4UWYA 3JS2A 4S2ZA 3PPZA 4HGSA 3EQBA 3GBZA 1PYXA 2PMOX 4TYHA 2A2AA 3R6XA 4QMSA 4DINA 2VX1A 4I20A 4RIYA 3QL8A 4ACMA 3GOKA 3W2OA 2GU8A 2XK7A 3RPOA 4F7SA 3VHEA 3KVWA 4AA0A 3FZTA 5L6OA 1OVEA 3ZU7A 5HICA 2Y4IC 4KS7A 4M0ZA 2V0DA 5LVOA 1CKPA 3KKVA 2R3OA 3NNUA 4C4FA 4C7TA 4J95A 5GNKA 2GTNA 4BCGA 5E8WA 2VNWA 1QMZA 4EOPA 2NO3A 3M2WA 5H8EA 1LUFA 1YDRE 2PVFA 3BHTA 5B7VA 5CEPA 4TXCA 3QQLA 3UBDA 4BRXA 2QG5A 5BVNA 3QRTA 3DTCA 3MIYA 1CMKE 2XM9A 3VULA 1PMEA 5CZIA 2REIA 4O0TA 4YJRA 4FIJA 4O22A 3QTQA 4QTDA 4CTCA 4UX9A 3HRCA 3P78A 4L9IA 3CD3A 2X0QA 3OT3A 3KA0A 2PVYA 2PZYA 2PHKA 3Q9ZA 4ANBA 4FT0A 2BTRA 3LW0A