5FWKK

Atomic cryoem structure of hsp90-cdc37-cdk4 complex
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
209
structure length
209
Chain Sequence
IKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords HEAT SHOCK PROTEIN HSP 90 BETA
publication title Atomic Structure of Hsp90-Cdc37-Cdk4 Reveals that Hsp90 Traps and Stabilizes an Unfolded Kinase.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 209
sequence length 209
ec nomenclature ec 2.7.11.22: Cyclin-dependent kinase.
pdb deposition date 2016-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5fwkK00
3LXLA 5FEEA 4UZDA 2VTMA 2JIIA 3ALNA 4JAJA 4NK9A 4ZSAA 2OW3A 1XH7A 2C69A 4ITJA 3PYYA 4OTQA 4LRMA 4YTIA 2HZNA 3FLZA 3PXKA 4FT3A 4S34A 4PDPA 4HPTE 3QD4A 2C0OA 3Q5ZA 4X3FC 1SMHA 1UNHA 2OBJA 5EHOA 4IZYA 3UVQA 3CTQA 3IKAA 2WMVA 4RIWA 3D5WA 5HVJA 4IB3A 4ZZNA 4QMXA 2RSVA 3COIA 2EB3A 4L3JA 2W5HA 4Q9SA 5HORA 4QTAA 3R7VA 1PYEA 3NUXA 4E3CA 3LFAA 1OZ1A 4AOTA 2A27A 4QO9A 3LIJA 3E5AA 4K77A 4F0GA 2UZVA 3FC2A 3V6SA 3L8SA 3SVVA 2UVYA 1LP4A 3FMNA 3NGAA 3QCSA 1CM8A 3DGKA 4L43A 4I0TA 5AR8A 3RAIA 3TIZA 5J5SA 4ASZA 5D7VA 3C4ZA 4L00A 4A07A 1Q99A 1DM2A 2PVNA 2B7AA 2PVMA 5DBXA 3KKVA 4IJPA 2JAMA 3R8MA 3B2TA 1M7QA 2C0TA 2KTYA 4TYGA 1SYKA 4UYAA 4YHJA 3OT3A 3Q60A 4AA0A 2RIOA 3FXXA 3RZFA 3V8TA 3G33A 4CQEA 2Y9QA 5EHYA 3VHEA 4BGQA 3DNDA 3A8WA 3E63A 4YC6A 4FTOA 2Y0AA 2YJSA 4XH6A 2WD1A 4AX8A 1MUOA 1J91A 5B2KA 1RQQA 2O0UA 2X8IA 3FZSA 1P14A 4I24A 1PKGA 3DZQA 4A9SA 2W9FB 2CCHA 4ZJJA 3MTFA 1Q8WA 3VS1A 5ANKA 1XHAA 4HNIA 1R1WA 4KKHA 2XNMA 3V5TA 4C2VA 3GU7A 1X8BA 3G9NA 4LRJA 2WO6A 4PMPA 3ZO3A 4ITIA 4M0ZA 5AAEA 2RG5A 2VWZA 4IDTA 3ZMMA 5HBHA 5IA4A 5HG9A 4FT0A 4MK0A 2B52A 4DLIA 3E88A 2QOCA 3NYVA 3EFLA 3LLTA 4BIEA 4F6SA 2XK6A 3EZRA 3QLGA 4XG2A 2X1NA 3DZOA 4IANA 5KMIA 2X2MA 3Q04A 4S30A 5BYZA 3FMJA 3KXXA 2X8EA 3PSBA 2PMLX 2P2IA 5AUXA 3WARA 4KS7A 4PNKA 5KO1A 4QYFA 3MN3A 3UQGA 4EH3A 4FVPA 3R83A 2P4IA 3ZH8A 2W4OA 4PF4A 4GUEA 1H28A 5HQ0A 4R3RA 4X21A 4FTAA 5HX6A 3BYMA 2P0CA 5E8VA 5K0KA 4C4GA 4IADA 2AC3A 3HUCA 4DG0E 2UZUE 2YEXA 3NCGA 5L8KA 2C6EA 2YCQA 1Y57A 3WYXA 1PHKA 3QQUA 3LQ5A 1GIIA 4JRNA 4DFZE 3FL4A 1ZLTA 2WB8A 2XIXA 3R8PA 1JQHA 5I0BA 3O96A 2QOOA 1H8FA 1WAKA 4BL1A 5CQWA 5FM2A 4BHZA 4ITHA 5K4IA 1NA7A 4QMZA 4WNKA 3D83A 4M3QA 3TNWA 5IEXA 3UG1A 3TNPC 4RVKA 2QCSA 5ANIA 3BIZA 5EOLA 4GJ2A 1W8CA 4G3CA 4CRSA 4Q2AA 4C57A 5ITAA 4G6OA 2BIYA 2RG6A 4MBIA 3RK7A 4MBLA 5A3XA 4AGCA 5AP2A 3LJ1A 4D2RA 1I09A 4BYIA 3D7TA 2ACXA 2YM8A 4MWHA 5HIEA 4FODA 2R3KA 4F4PA 1OL5A 4KS8A 5FRIA 4QQCA 5AUWA 3UZTA 4JG7A 3BE9A 4QT1A 4UB7A 4BKZA 2CGWA 4CRLA 3DAEA 2VU3A 3EYHA 3IECA 4F1TA 3TZMA 4EOSA 4QTEA 2XRUA 2WQEA 2X8DA 5LQFA 4GK2A 5HICA 4QP8A 3PIZA 4M14A 3UIBA 2RGPA 2C30A 4CKJA 3VUTA 4HYSA 3W8LA 1JBPE 1Q8YA 4KIKA 4LV8A 4O27B 3D2KA 3OCBA 3UTOA 4F0FA 2ZM4A 3PPKA 1IA8A 4MQ1A 3KC3A 4YJPA 5FEQA 4EC8A 1CSNA 4PPAA 1YHVA 4PTGA 5IISA 2Y4IB 2WEVA 4TYIA 3L8VA 4O0UA 1YDTE 3ET7A 1P2AA 3C9WA 5EDQA 3QZGA 1W0XC 5C03A 2OIDA 3PY3A 4IB1A 4JG8A 3D2IA 2GQGA 4I23A 1KE6A 3IQ7A 3EIDA 3MY1A 2KULA 3NSZA 2Y4IC 4ANSA 3PVUA 5DWRA 3ZDIA 3RK9A 3LFSA 1BYGA 3R2BA 4KA3A 4YLKA 2C5NA 3MWUA 1OUYA 3CKXA 4XG4A 3MFRA 2PSQA 3PSDA 2R3RA 3WF6A 4EBWA 3EFJA 3AC4A 2ITWA 3HRFA 4FTLA 4D4RA 5AR3A 4EHZA 2HWPA 4RJ8A 3ZCLA 2YLFA 4JQEA 1H01A 4F63A 4GVJA 1PXNA 2UZEA 2VTLA 4FKLA 1SZMA 4XBUA 3S3IA 3UNZA 4K2RA 4DBNA 1Q3DA 4GV1A 3E3PA 4JR7A 4LI5A 5CAPA 4EYJA 4UXLA 4M69A 1YHSA 3TI1A 3CLYA 1CKIA 3EN4A 4YC3A 3W10A 3QU0A 1JNKA 4FSMA 1M52A 2C6DA 3ZLXA 5IA2A 4GJ3A 4FYOA 4K11A 2ZV8A 4GT5A 5KBQA 5HE0A 2C68A 2HENA 1OI9A 5HTIA 3DJ7A 3MPTA 3SRVA 3LJ0A 3HMPA 3LW0A 3FDNA 4P90A 4C35A 2UVXA 4DFNA 5ANGA 2XEZA 1H27A 4LM5A 3TNQB 4DGGA 5LMAA 2B54A 4RX7A 2HW6A 5CT7A 5KZIA 3O51A 3WZUA 2GHLA 3ELJA 5J1VA 3FLNC 1PJKA 1CKJA 3II5A 3QA8A 3WBLA 3WF7A 4CXAA 3TACA 2BDWA 4FV6A 3OCGA 4C61A 1OIYA 3EQPA 5HVYA 2VTRA 5M51A 1H1QA 2XEYA 5DR9A 4LOOA 2SRCA 3F82A 4JG6A 3LFNA 4QMPA 5AV3A 5LVLA 4TT7A 3UC4A 5E8XA 4CVAA 3RZBA 5DNRA 4FA2A 4OTPA 2VO7A 2YM5A 3V01A 4EUTA 5E8UA 3F88A 4JIAA 5FEDA 3RM7A 4A06A 2PE2A 3OUNB 1PXPA 5LVNA 2OJ9A 2OIQA 4GL9A 4YHTA 5E1EA 4EHEA 3T9TA 5K0XA 2QURA 3THBA 4YTFA 3QBNA 3VF9A 3UMWA 3ORPA 2YM7A 3PRIA 4XNEA 4Y95A 2BZIB 3EL7A 5HNBA 2WU6A 3BQRA 3C4EA 4MXYA 3A7HA 2YM4A 3MPAA 2WHBA 4J98A 4S33A 2CN8A 2DYLA 3F3TA 5CSVA 5J79A 1FQ1B 4NFMA 4PTEA 3PE1A 1K3AA 5KMNA 3UPZA 3JPVA 4AN2A 3KRWA 3POZA 4RVMA 4P4CA 2PMNX 3IG7A 4I6HA 3TJCA 5L2WA 4O38A 1OMWA 3DKFA 4AE9A 3HMOA 3FY0A 4F7NA 5KHWA 2E2BA 4C02A 4JX7A 3RHXA 4I20A 4BDFA 3RNYA 4FL1A 4BDCA 3I0QA 3QCQA 4L3LA 2B9JA 4U6RA 4EWQA 4CCUA 4RX9A 4H3BA 3BQCA 3KULA 2GFSA 4X0MA 4RA4A 3UMXA 4A4LA 4DEHA 2FSMX 3QGWA 4Z55A 3IOKA 3PXZA 5BNJA 2W7XA 4BBFA 5HG5A 2JDTA 2QI8A 2FO0A 2WKMA 3DLZA 4X2KA 2C6LA 4BCFA 3VC4A 4ACHA 2FH9A 4ANNA 3PG1A 5A46A 4I41A 3ACKA 4NSTA 3HVCA 2J51A 2HZ4A 4J52A 4AOJA 1O9UA 3MIYA 2QD9A 4UMPA 2J7TA 3TT0A 1H1SA 3HA6A 1KV2A 3L1SA 2YCSA 3NX8A 5T6KA 3E8DA 4H36A 3WZJA 5J5TA 4CFUA 1A06A 3MY0A 3WZDA 4W8EA 3MA6A 5BMSA 2PVJA 2UZOA 2R3LA 4OTWA 3OWJA 4B0GA 5CEOA 4KD1A 4IB5A 3ORMA 4L68A 4AGWA 3AGMA 3OCSA 4EUUA 1YDSE 3R9DA 2OXDA 2I0HA 4M15A 3P7CA 3QAME 3ZM4A 3UO4A 4RIWB 3AD5A 3EQGA 4DCEA 3MGYA 3RNIA 4PQNA 3TZ7A 4I6FA 4NIFB 5LXMA 2WMAA 1CMKE 2FVDA 3O8PA 3KN5A 4WSQA 3EWHA 4YPDA 1PXKA 4RLKA 3G90X 5HLWA 3UO6A 4QNAA 3UDBA 1XR1A 3KXNA 3VBVA 4E93A 4QTBA 4UMUA 2CDZA 2C4GA 1JAMA 4A9UA 4EHVA 4HZRA 5FXSA 4E8AA 1LEWA 2WTKB 2PY3A 2PVHA 1PMNA 4YZ9A 3SHEA 1OKVA 2CGXA 2OWBA 4C4HA 4B8MA 2DQ7X 3LCKA 3CQWA 5CF8A 4HCUA 4FI1A 3B8RA 1RDQE 4LQMA 4U5JA 2IW6A 2BZHB 3QTUA 4M12A 5CF5A 4L6QA 4GS6A 4E7WA 4X2NA 2ESMA 2WTKC 4WG4A 3HX4A 2YJRA 3VWAA 4EOQA 5JGBA 2W05A 4O21A 4HYUA 2XNOA 3KK9A 4TYHA 3GI3A 4TXCA 4IWQA 3Q32A 4U40A 4ZTLA 5ICPA 3V6RA 3OW3A 4X2JA 4AZEA 1XH6A 4L46A 4B99A 2PHKA 2EXCX 4WOVA 3CPBA 2HZIA 2OKRA 3KMMA 4YP8A 3DS6A 4L42A 4LL0A 2G2HA 4PL4A 4M67A 1URCA 4I0RA 3GENA 2BZJA 3OD6X 3D14A 4EK4A 5CEKA 5AR5A 2YWPA 4YLLA 3D5XA 2PK9A 1FMKA 2OSCA 2QLUA 3L9PA 4RFZA 3ROYA 1XJDA 2VO0A 3RPSA 4B7TA 2CSNA 4G2FA 4RQKA 2RKUA 3CD8A 3BYSA 4QMUA 3QTSA 4U97A 2O65A 3COHA 2JBOA 3M42A 2W17A 2W06A 1OECA 2R7BA 3HA8A 3OBJA 3PE2A 3CR0A 3PUPA 3PXYA 3EQFA 3LJ2A 3QZFA 4H3PA 4LG4A 4W9WA 5H3QA 3NLBA 3UP2A 3QTZA 3KRLA 3AT2A 2PE0A 3C4WA 3DCVA 5DN3A 4BCIA 3FXZA 3QRJA 4AW1A 2BCJA 1YI6A 4AT3A 2JFMA 3MFUA 2YCRA 4TN6A 1UV5A 3ZRLA 4IIRA 5AEPA 4CSVA 5AUVA 4APPA 5L6OA 5BUJA 2OJFE 4QP6A 1Q3WA 4FTKA 3GCSA 3S1HA 4YR8A 4D4YA 4A7CA 5F94A 2F2UA 4BCMA 2BPMA 1SM2A 5CEMA 2YABA 2GFCA 3DB8A 4EK8A 2Q0BA 2C6OA 4ZOGA 3ZOSA 4UY9A 3W1FA 3E8EA 2QO2A 3EN9A 4G34A 2R9SA 4O1PA 1OKZA 4PMSA 4QQTA 2I0YA 3CP9A 4YJVA 4W4WA 2WNTA 4FNWA 4I6QA 4QYHA 2OH4A 3OUKA 2ZV7A 5AJQA 5EI6A 5HE1A 4A9YA 5DMZA 3I6WA 3D7TB 4E4LA 5D1JA 1FPUA 3ZO4A 1UU3A 4IWOA 5AUUA 3F5PA 1T45A 3LZBA 4L3PA 5E8TA 2JDRA 2WMSA 1OL1A 4FTNA 2YDKA 2YITA 4WRGA 1EH4A 2RF9A 5JEBA 3NYNA 1BLXA 1U5QA 3UOHA 2ZDTA 1JKSA 2PL0A 5AP5A 4FTCA 4KIKB 3VAPA 3ZDUA 3SD0A 4BDGA 4ZZOA 3QXOA 5EYMA 4KIPA 2P2HA 3Q6WA 4JT3A 4X6RA 4ZLZA 5HCYA 3UC3A 5FXRA 3G2FA 4J95A 4O22A 4W8DA 3VS6A 3VHKA 3FMDA 2R3MA 3LXNA 3PFQA 1XQZA 4R8QA 2CN5A 2CJMA 4ANMA 4F1OA 4FK3A 4XV9A 4BVUA 1O6KA 4I6BA 4TNBA 4WBOA 2ITYA 3BE2A 4ZK5A 5TKDA 4DH7A 4JIKA 4MVFA 4FEQA 1DS5A 4BWKA 2CPKE 4ALUA 4IACA 3OCTA 2A0CX 2JITA 3FI4A 3I5ZA 4HNFA 3P1AA 4CNHA 1W7HA 4BYJA 4XV2A 5FXQA 5JK3A 4R3PA 5I9XA 4OUCA 3QYWA 2CLQA 5ACKA 3HV3A 1KWPA 3KK8A 3LFBA 2ETMA 3W32A 2B9IA 4F70A 2R3JA 1AD5A 4BZDA 3I6UA 4EOPA 3NAYA 3R21A 4BF2A 4FG9A 4K0YA 3DBFA 3TV4A 3NYXA 3CTHA 5CQUA 3EH9A 4ANLA 3DDPA 3BCEA 4L9IA 3FYKX 1MQ4A 3ZBXA 2LGCA 4J8NA 1WVWA 2EWAA 3JUHA 4O0VA 3A62A 5AAGA 2J90A 3QD0A 4QP7A 3ULIA 4GU9A 4F7SA 5F4NA 3KEXA 2YACA 5BX0A 2XIYA 2OU7A 2G15A 4RZVA 3RM6A 4WA9A 3ZUUA 3NEWA 5CU3A 1FINA 2JFLA 4QMLA 3FLWA 2HZ0A 3ZXTA 3GCVA 4X6QC 2ZYBA 2W1IA 3R9NA 1MRYA 3L8PA 3PA5A 5HOAA 2WQBA 2XS0A 3F7ZA 3O8TA 4C2WA 5CT0A 2REIA 2QONA 4IB0A 5HCZA 4QQJA 2ZV9A 3DBQA 3HDMA 3ZZEA 3F6XA 4OTFA 2WTJA 3DK7A 4OTDA 2LAVA 4D0XA 2J4ZA 3FHIA 4BDDA 2X2KA 2GPHA 3RPOA 2JKOA 3HRCA 3MVHA 1OKWA 2R7IA 3VNTA 2X7OA 3DQXA 3RVGA 4GYIA 1ZOGA 2PVYA 4QYEA 1ZZLA 5JFXA 3P7AA 3PG3A 2QR8A 1J3HA 4O1OA 5CEQA 5CU4A 3M1SA 4XG7A 3FMKA 4CMTA 3OWLA 1KE7A 3O2MA 3Q9WA 3QX4A 2QO9A 3ZU7A 3RKBA 4NFNA 2VTIA 2OGVA 5DR6A 3A7JA 4U45A 2C5YA 4NKSA 3GOKA 5TF9A 4FT9A 2W96B 3JY9A 4EK6A 3OROA 3U9CA 2OF4A 4FOCA 4JLCA 4RIXA 2EU9A 2XKEA 3GVUA 5BMMA 3PVGA 4YGAA 5HU9A 4X2FA 2XZSA 5CYIA 1LR4A 4EBVA 1YVJA 3UJGA 5M55A 2O3PA 5I3RA 5KKRB 4BDHA 5H2UA 5H8EA 4MD7E 1Z5MA 4BDKA 2C5VA 3G5DA 4RSSA 3ZLYA 5JH6A 2YERA 3FQEA 5HVKA 3LCSA 4A9RA 2P33A 2WMBA 2JDOA 3NAXA 4R5YA 3OFMA 3ZXZA 5IPJA 4WRSA 4C59A 3A61A 4BBMA 3OT8A 5EW8A 1JKLA 3LE6A 4M66A 4MH7A 5F95A 3CPCA 3JXWA 4RQVA 3R7OA 1ATPE 5HESA 5JMSA 4AQCA 5JSMA 2W9ZB 3WE8A 3ZBFA 4AZTA 5IA0A 2BTRA 1DI8A 1V1KA 4AF3A 1OL7A 3DA6A 1U46A 1AQ1A 1Y8GA 2QODA 2V22A 3KULB 4U8ZA 5HG8A 3ZUTA 3COKA 4C3FA 5CU2A 4E6DA 2C0IA 4G6LA 4LL5A 3VS5A 3CS9A 3KF4A 4QMYA 1M2QA 3MBLA 2VWUA 5A6OA 4FV9A 5CF4A 4M84A 3UOJA 5CAQA 4C4JA 1DI9A 2G01A 3EZVA 4IVDA 1F5QA 5HIBA 3W16A 4YJUA 4OBOA 3A99A 3HV4A 3D15A 3QZIA 2BZKB 4K9YA 2ITZA 3DTWA 3F9NA 4YBJA 3MH2A 3WE4A 5I9WA 3MVLA 2OZOA 4BDJA 2JAVA 4BN1A 5FDPA 4KINA 4LRKA 4YZNA 4NIFA 4DH8A 3U6HA 4AXAA 4EH9A 3LM0A 2HY0A 3FKLA 3NDMA 4G5PA 4U3YA 3E7VA 1JPAA 1TQPA 5BUIA 2XYNA 3ULZA 5JGAA 2IN6A 4ZY6A 4IHPA 3BLRA 2YM3A 2UZDA 4ASXA 4C7TA 4L67A 1YRPA 2CKEA 4JDJA 5KE0A 3U4UA 2R3HA 3Q4UA 3T9IA 4PUZA 4R5SA 1U54A 3FC1X 4IX6A 4CLIA 1UKHA 2BFYA 3C5UA 4L01A 3I5NA 5BVFA 3HL7A 3ZC6A 1YI4A 4MX9A 5GJFA 2YAAA 4FSRA 4IAFA 4AP7A 4XMOA 5D9HA 2W1ZA 5BQ0A 1O6LA 2GNFA 3D0EA 3FZOA 1VJYA 3EKNA 4XLVA 4BTFA 4PRJA 4FTQA 5EYCA 4O0RA 4F9CA 1REJA 3DV3A 4FIGA 4UWYA 4ENYA 5AUTA 4M0YA 2JC6A 2BRNA 3CE3A 4ZS0A 4GT3A 4ZXTA 4HYIA 2FSLX 2DS1A 1ZY4A 2R3NA 4ZLOA 5FG8A 4OAVB 4C4EA 4FL2A 4LGGA 3DPKA 3P78A 1ZMUA 3R1NA 4G17A 4GCJA 3QF9A 4I5PA 3CGFA 4ZZMA 3TKUA 5LCKA 4TYHB 3ZFXA 4IM2A 5BVDA 3KN6A 3GFEA 2WPAA 4G3EA 4U0IA 3OBGA 1YOMA 4FSYA 4I21A 4DHFA 2ETRA 5DLSA 4ERKA 3I7BA 4O0XA 4TW9A 3U51A 3ZRMA 3F69A 3H9OA 3ZLWA 4FMQA 4H3QA 3AC3A 4RFMA 3OS3A 4QMWA 2W1FA 4IM3A 5D12A 2JKQA 5CZIA 1JKTA 1KE5A 5KHXA 4A4OA 5ANJA 5FD2A 3LFEA 4JDIA 5E8YA 4YURA 4DLJA 3W33A 3VJOA 2WOTA 2V7AA 4UMRA 3DBDA 2VTNA 2BROA 2V5QA 3KVXA 5M4FA 4ZIMA 2XBJA 1H1RA 1Y91A 3EQHA 4IC8A 4MXOA 3G0FA 3LOKA 3DLSA 4E73A 3AGLA 1XH5A 4A9TA 3QUPA 2QO7A 3K3JA 1ZYCA 2JBPA 4U7ZA 3F3UA 2JDVA 5H8BA 1G3NA 4HGEA 3QRTA 3V3VA 5C1QB 3C0HA 1LPUA 1MRVA 3ZO1A 4LGHA 3QTRA 4O6EA 5EI2A 5BVWA 1YW2A 3OG7A 1PXMA 4ASEA 5LWMA 3VQUA 5G1XA 4WSYA 3E3BX 1I44A 3E62A 2IVTA 4FK6A 4LOPA 4RWIA 2B9HA 4D2TA 4RIYA 4C33A 1URWA 4L53A 5KUPA 3W8QA 4LV5A 5AA9A 3FQSA 4FICA 3QWKA 3KCFA 3QGYA 5E90A 5K4JA 4BTJA 5FDXA 3DDQA 3QKMA 4CEGA 4MNEB 4F0IA 3VS3A 1FVVA 3CQUA 1BI7A 2QHMA 4WUNA 4J97A 4EEVA 3HYHA 2YIYA 4DGMA 5H8GA 4FIEA 5J9LA 3E8NA 3LM5A 3KRJA 5L8LA 1ZAOA 3PWDA 3R63A 3S00A 1TKIA 5E8WA 3GCPA 2IZRA 3AD4A 2A4LA 2IZSA 3Q3BA 4XG8A 3R71A 1XBAA 2QQ7A 4F64A 3P86A 4IX5A 3EQBA 3GU4A 2IJMA 2BHHA 3EYGA 5IA5A 4DH1A 4XG6A 2WQMA 3GCQA 2XK4A 3MB6A 4WNOA 3MSSA 3VUDA 3Q4CA 5IZFA 4WHZA 3QWJA 3W18A 5EM6A 5KBRA 4XV1A 3DJ6A 3D9VA 2UVZA 3BZ3A 2C6MA 4E4XA 4HCTA 5I9ZA 2QHNA 4Y85A 4CFFA 4R7IA 4EL9A 1BL6A 4N6ZA 5EM8A 3KCKA 3CD3A 4MEDA 2XKFA 3MJ1A 3BEAA 4YJQA 5FP6A 5HG7A 3QALE 3QKKA 1ZMVA 5FWKK 3WOWA 4D0WA 1PW2A 2WTWA 2YZAA 2AUHA 2BMCA 4EK5A 4DTKA 4W9XA 4YMJA 4BGGA 5AV0A 4N70A 3FPMA 2ZM1A 3LHJA 2WFYA 2Z7RA 5CNNA 3BLHA 1M7NA 5LARA 1GOLA 2DUVA 3I0OA 3R22A 2H8HA 5EYDA 4AN9A 5M4CA 3NYOA 3CQEA 4IZAA 4AW5A 5AAFA 1GAGA 2YISA 3NW7A 2Q0NA 4FIFA 3LXPA 4JVGA 4JL9A 4C3PA 2ITNA 1IEPA 4RWLA 3VBYA 2AYPA 1H4LA 4Z7HA 5EK7A 4RX5A 3OZ6A 2E9VA 4QYYA 4IQ6A 4EH8A 5TR6A 3ALOA 2WMUA 3PWYA 2VGOA 4P7EA 4YPSA 4PDOA 3EKKA 3VW8A 3HNGA 3WZEA 1UKIA 4I94A 3LFFA 3NR9A 2IVVA 4LYNA 3QQLA 1Q8ZA 1CDKA 2QOBA 2PZIA 4S2ZA 3H10A 4YNEA 4AU8A 4I4EA 4PP7A 5M56A 4LGDA 3TKIA 5JN2A 3AXWA 2OH0E 4HVIA 4QPSA 4I5CA 4RC4A 2XNNA 3TN8A 1UA2A 2BVAA 4DINA 5DPVA 5AP0A 1Y6BA 2B1PA 2QU5A 4CFWA 4ZTMA 4J1RA 3DY7A 3E64A 4RJ6A 5LCJA 5D41A 5CY3A 2O63A 1APME 4NCTA 3ZYAA 3KVWA 3P5KA 3EN7A 1B6CB 1JKKA 1RJBA 3P79A 4B9DA 5IH4A 4UXQA 5A6NA 4TTHB 4LUDA 4Y5HA 5CEPA 3IO7A 5KMMA 2CLXA 2XK7A 4GMYA 2JLDA 2UZNA 5B2MA 3D7ZA 3BV2A 3A7IA 5CAOA 2XJ2A 4BDAA 4JAIA 4KWPA 4DFLA 4XS2A 4ANQA 5E8SA 1YWVA 3MFTA 3QTIA 4U43A 5FLFA 4Y8DA 3COMA 1J1CA 3U9NA 1FMOE 3C4FA 4MYGA 5CLPA 2VAGA 3S95A 4C8BA 5DH3A 3FV8A 5CENA 2VWWA 4EH4A 2FYSA 4BDBA 4ZY5A 3NUPA 4IZ5A 4E1ZA 3L8XA 2Z7LA 3IS5A 2R3IA 3MI9A 3O8UA 5HNIX 3RWPA 3GC0A 4D4VA 4ALWA 2YIXA 4FZAB 5A4EA 2BALA 4D1XA 2R3GA 4UMTA 5IUHA 3OVVA 3ORXA 3EQDA 3FLQA 1ZWSA 3CIKA 2C1BA 4YHFA 3GGFA 1XBCA 4KBCA 3TEIA 2BAQA 4CD0A 5IA1A 5DI1A 3DK3A 4RIXB 5A9UA 3OMVA 4BZNA 1SVEA 4RX8A 2Y8OA 3HV6A 4AACA 4CCBA 4RZWA 4FTJA 2VV9A 4Y73A 3MTLA 4WNPA 3V5QA 4UWCA 4F08A 4YUQA 4ACMA 4BHNA 3G0EA 3PLSA 2YCFA 2BKZA 5EW9A 4BTKA 5LMKA 5EW3A 3RP9A 3KF7A 3UG2A 3FE3A 2QNJA 3HMNA 4ZSGA 5A4QA 3R7GA 3KB7A 3E8CA 3JY0A 4XJ0A 4F6UA 2XCKA 1W84A 1W82A 2AC5A 2YIRA 3NIEA 4PY1A 3BV3A 4GU6A 5DFPA 3H9FA 4CYIA 4IFCA 4RC2A 4L7FA 2OIBA 2C3KA 4KABA 3SKCA 2XIKA 4D4SA 3ORTA 4QTDA 3VN9A 2ITUA 4L7SA 5IKWA 2GSFA 2VX3A 1U4DA 3AC2A 1VZOA 4RG0A 3I79A 4YSJA 3UNKA 5AA8A 3CC6A 2UW3A 4IAZA 3VBQA 4UX9A 4JBVA 4QMTA 4R6VA 4BGHA 5ETCA 3V51A 5M57A 2GMXA 4UMQA 1V0BA 4Z9LA 4O0YA 5B0XA 3I81A 2R64A 3AT4A 3QQJA 5GJDA 4ZJVA 3UO5A 4CZTA 2WGJA 3UNJA 1WFCA 2B55A 3PSCA 2UZTA 5G6VA 3IDBA 3EQCA 3Q4TA 4MXCA 2W1GA 2GHMA 4RIOA 4FBXA 1GIHA 5HLNA 4QPMA 3R8ZA 4EQCA 2ZMDA 3RAHA 2E9NA 4G1WA 4C4IA 4E26A 4QMNA 3ORNA 4G3GA 3QC4A 5HI2A 3R7YA 2QR7A 3PVWA 3UP7A 1W98A 2OO8X 2J0KA 2XNBA 1WBTA 1YXUA 3FKOA 5A4TA 2XNEA 3A4PA 2YFXA 3IDPA 3GC7A 1FGKA 3MW1A 2BDJA 4XG9A 3NNWA 4FNYA 5ANOA 3UBDA 1H07A 4FC0A 5I9UA 3KQ7A 3ZLSA 4FKIA 1BUHA 4G16A 4EC9A 1U54B 4YBKA 1IASA 5C8KA 2W1EA 2R3PA 4DEDA 4ID7A 4UZHA 4EK3A 3Q9ZA 5B2LA 3KXHA 3UIUA 1ZMWA 4AFEA 3KY2A 4RWJA 3NUNA 4NKAA 4EOIA 1WVXA 5K5NA 3ENHA 1WZYA 2F9GA 2CGVA 2WMRA 1WBNA 3UZPA 4FZ6A 1H08A 3OWKA 3A8XA 2I40A 2O64A 3O71A 4FKJA 4IWPA 5HD7A 4LUEA 4JS8A 5HBEA 3GBZA 4AG8A 4F9WA 1T46A 4EQMA 4IJ9A 2I0VA 5AP3A 3QC9A 3A4OX 4EH6A 3DBCA 3ZZWA 3BKBA 4FTUA 4ZEGA 4MHAA 2NO3A 1XH4A 2F57A 4DG3E 3F5UA 3V5PA 3G6HA 3Q6UA 4G3FA 5BUEA 2GU8A 5AR2A 3RPRA 2GDOA 2YDJA 3L9NA 4U79A 1KSWA 4FUYA 3KXMA 3TV7A 4NJ3A 4FZ7A 5LJJA 2ZJWA 3K5VA 3NIZA 3O50A 4EQUA 4FIIA 3CJGA 3NRMA 2C47A 3GXLA 3GC9A 3KFAA 1UNGA 1ZY5A 3OOGA 3ZONA 4B8LA 4FV8A 4LMNA 3RAKA 2BR1A 2ITPA 4XG3A 1DAYA 3PZHA 4FSZA 4AT5A 4WKQA 1SVHA 4RFYA 3POOA 3SDJA 1WCCA 4PWNA 2V62A 1PMVA 3WIGA 5AP6A 4CMUA 4GFGA 3SOAA 3FWQA 4NM5A 4O0TA 3TIYA 3FMLA 4I1ZA 2W5BA 4BDIA 4U41A 4CFNA 1S9IA 4FX3A 4WUAA 1OIQA 1BL7A 2BHEA 2HELA 1XKKA 2XMYA 4HGLA 2XUUA 3QQHA 2P3GX 4MXZA 4GRBA 4AUAA 2ZM3A 4PX6A 4BCNA 3F66A 4GK3A 3RK5A 4MWIA 5DT0A 3VULA 3DKGA 4F9BA 2WTVA 2F7EE 3ORKA 1UWJA 3T8OA 2NP8A 5DGZA 4RJ3A 3K3IA 1B38A 3P0MA 2GNJA 3S4QA 1GNGA 4C62A 3GUBA 4IWDA 5K5XA 1OPLA 2VZ6A 3FI2A 4ACGA 4MNEA 4QMSA 2EUFB 3MDYA 1JOWB 3BU5A 3IK3A 5B7VA 4W4YA 4FSUA 4RC3A 4YO4A 4IX4A 4M13A 3MPMA 3AMBA 4FKUA 4CMOA 2W4JA 5L3AA 2W1HA 1NVSA 3S2PA 3UOLA 3LQ8A 1ZYLA 3GNIB 4RIYB 4UBAA 4DEIA 2WMTA 3R00A 2JGZA 4FKGA 4ANOA 2IWIA 5JQ8A 5L2SA 3IW4A 1R0PA 3ACJA 4D2PA 2VO3A 1QPCA 4AGDA 3BHUA 3PVBA 1OUKA 4JJRA 1HCLA 1VR2A 3EJ1A 4AOIA 4CYJA 5JFWA 4EI4A 4CLJA 4AW0A 1IR3A 1G5SA 3F5XA 3FSFA 2VWYA 4GG7A 3F7WA 3VBXA 2XNGA 4YTHA 3T3UA 3QXPA 4KNBA 5M44A 4L45A 2VRXA 5FTOA 3ZEPA 3GEQA 3KA0A 4EKLA 4BB4A 5JZJA 4FT5A 3D5VA 3DBEA 4DITA 3K2LA 5L6PA 3V8SA 5AP4A 5H9BA 2V55A 4RJ4A 5IMEA 1F0QA 3CCNA 3GOPA 4DG2E 2JDSA 3RGFA 5BVKA 1QCFA 5EDPA 3MA3A 5KCVA 5GHVA 3NNUA 3JVRA 4FKOA 5JQ5A 2WQNA 1L3RE 1BMKA 3DFCB 4IM0A 4O0WA 1H0WA 2V0DA 5DIAA 2UZWE 3EHAA 4FTIA 4DFXE 4R7HA 3R1QA 2UUEA 3R8UA 3ZO2A 3BGPA 5I4NA 4D2SA 2R0UA 2IW9A 5GZ8A 2X7FA 5GNKA 1XWSA 2VWIA 3FKNA 3NUUA 3MH1A 3HUBA 3DXNA 3C51A 4NU1A 4RVTA 2QOLA 2J5FA 4FNZA 2XJ1A 3CXWA 4I93A 5JFSA 2YHVA 5HKMA 5C26A 5IMXA 4FV1A 1Q8UA 2XRWA 3EQIA 4TKSA 3HMMA 3RPYA 3GFWA 1Z9XA 4PL3A 1UU8A 3O7LB 3OXTA 2DWBA 3SX9A 3SXRA 3AT3A 4F6WA 1ZARA 3GB2A 1BX6A 1WBSA 3OC1A 4GH2A 4PPCA 5CEIA 3DB6A 3FYJX 3PJ2A 2PVFA 4I5MA 2XH5A 3PY1A 2WIHA 3BEGA 4E4MA 3IW7A 5IA3A 4CTCA 5A4LA 2RFSA 5E7RA 4ARKA 5I5ZA 3FMHA 3QQGA 4II5A 3QTQA 4EONA 3UPXA 3NNXA 4YZBA 4FV7A 5F1ZA 4KRCA 4BDEA 1ZXEA 3BELA 3RMFA 1XO2B 2E9PA 4IBMA 4ZY4A 1WBWA 5EOBA 5DEYA 4USEA 2NRUA 3CY2A 3ZS5A 4OTHA 4ZTHA 3F3WA 2X7GA 3I7CA 3OXIA 4KIQA 1ZRZA 2C6IA 5JRSA 4FV5A 5BVNA 4ACCA 4NH1A 2VTPA 3A7GA 2YIQA 4PV0A 4TY1A 5EG3A 5J8IA 3I1AA 4C3RA 5IF1A 3ORIA 2CCIA 5EM5A 2ZMCA 3AOXA 3M2WA 4YNOA 3HRBA 4EZ5A 3EMGA 3FL5A 5E8ZA 5K9IA 4GT4A 4QTCA 2ITQA 3UOKA 4FVRA 4NCTC 3F2AA 3RBWA 1SVGA 4IVAA 2VTQA 4OR5A 4F65A 4IDVA 5JGDA 4CZUA 3PJ1A 4F9AA 2JEDA 4EH7A 3LMGA 4O6LA 4ASDA 3RALA 4BI1A 5CVHA 3LCOA 3QFVA 1OPJA 4D1SA 4U3ZA 4QMQA 2PE1A 4U9AA 1SNXA 3CEKA 4J7BA 4YO6A 5CSPA 1Z57A 2C6KA 4XP2A 4OGRA 2UW6A 3OWPA 4CT2A 5FGKA 4H1MA 3V5JA 3ZFMA 5JFVA 3PRFA 2QU6A 2GS7A 5I3OA 4RGJA 4JDHA 5J9YA 4RA5A 4DEGA 1OL6A 4CKIA 5HD4A 5AR7A 3Q5IA 1Q24A 3HZTA 4CV9A 4NTSA 1GZKA 4O2ZA 5AIRA 5DR2A 2VTHA 2F49A 4D2WA 5EHLA 3O17A 2UZLA 5KKRC 5LOHA 3DKCA 3HGKA 3PPJA 4X7QA 5CVGA 5DEWA 1TVOA 4I4FA 3WI6A 2OJIA 5DE2A 1OVEA 1XH8A 5C01A 4JQ7A 5CX9A 2P55A 4RRVA 4WG5A 5HTBA 4UYNA 4ZSEA 3DU8A 4G6NA 4BCPA 4J99A 1R39A 3FZ1A 4UWBA 4AZSA 5IDNA 3DJ5A 1UNLA 3IGGA 3F5GA 2GTNA 1H26A 2ZVAA 2IVSA 4JBPA 3R9OA 3ERKA 4E5WA 4E6QA 4F09A 5AM7A 5FBNC 2O5KA 4YLJA 3BI6A 2CMWA 2C3JA 5DOSA 4NUSA 5HHWA 2UW4A 3QZHA 5LMKC 2PUUA 4V05A 3FLSA 5FBOA 5KMKA 3HV5A 3O0GA 2Z2WA 4IVCA 4D5HA 2ITTA 3PZEA 4TYEA 3E93A 4FZFB 3ODZX 5M4IA 3SXSA 5FP5A 3QRUA 5J87A 1FGIA 2R0IA 2C6TA 2ONLC 3BU3A 1GJOA 4PMTA 5EDRA 1M2PA 4BI0A 4MD9E 5CF6A 2J0LA 2XKDA 3BLQA 4ERWA 4FSWA 4BI2A 4HYHA 4EZ7A 4XP3A 5F20A 3VW6A 4O0SA 2UW8A 4D28A 3MH0A 3VBWA 2OJJA 4JXFA 4V0GA 3UODA 4AFJA 2ZOQA 3MIAA 5TT7A 4FIJA 4QNYA 5HLPA 1FVRA 2HOGA 2PVLA 5AUYA 1OPKA 4E4NA 1K2PA 3BYOA 2X9EA 3CGOA 2YM6A 4F9YA 5CI7A 3KMUA 4BCHA 4EORA 4NTTA 5LVPA 5AM6A 3OOMA 3RI1A 2XA4A 1HOWA 3PP0A 4JQ8A 1H0VA 3W2RA 4FV0A 3SXFA 4IE9A 2Y6OA 2EVAA 3EQRA 3PA3A 5ETIA 3C50A 2WXVA 2F7XE 2XJ0A 3MV5A 3DK6A 4GEOA 3W2CA 2ZB1A 4U42A 4BFMA 4IW0A 4KKGA 4FR4A 5KMOA 3HDNA 2BIKB 4C34A 2IW8A 1Q97A 1E1VA 3W2SA 2OZAB 4J8MA 5LMBA 2X6EA 3VUIA 4KBAA 1PMUA 3DOGA 3WYYA 4Q5EA 2HXLA 4Z3VA 5CZHA 5EM7A 1Q61A 4E5BA 4FV2A 2OI4X 4IX3A 4N4SA 2RFEA 2XIRA 2XYUA 5CSXA 5BVOA 3DNEA 2Z8CA 3IOPA 4JDKA 5GZ9A 5KX8A 3R02A 4MXXA 4PDSA 1KOAA 3EB0A 4G9RA 4D9TA 3BPRA 4IXPA 1QL6A 3LXKA 5DA3A 5EYKA 2WQOA 4HCVA 3RTPA 4FL3A 1RE8A 4LMUA 4YU2A 3IDCA 2CHLA 3TXOA 3MS9A 2JIUA 3A60A 4YJSA 3TZ9A 5CU0A 3NS9A 4FG8A 3TL8A 4JR3A 3BYVA 2WIPA 3IW5A 4V04A 1IG1A 4EYMA 3PJCA 4USDA 2QC6A 3TJDA 3C0GA 3DTCA 4FF8A 1ZOEA 2EXEA 2X2LA 3QKLA 4JI9A 5LWNA 5IDPA 4OAUC 3FSKA 4C4FA 1R3CA 1PXLA 4J53A 4CV8A 3GQLA 2QLQA 3QQFA 3ORZA 2XK3A 1Y6AA 4FSNA 3FPQA 5CVFA 2B9FA 2H34A 3RPVA 4EJNA 5TOZA 3ZEWA 2X4ZA 4BKJA 2JIVA 4ZTSA 4AN3A 5T3QA 1SNUA 4JBOA 2VUWA 2XF0A 4F7LA 4NW5A 1ZYDA 4WD5A 4JRVA 3P7BA 1PXIA 3VF8A 1GIJA 2Y6MA 1BI8A 5ACBC 3VBTA 2C5OA 4TPTA 4ENXA 4ONAA 4ACDA 2VWVA 3GQIA 3SC1A 2F7ZE 2VWXA 4ZTRA 2W99B 3OTUA 3ZHPC 1H1PA 4C0TA 3UYTA 1FVTA 4DEAA 4GIHA 4S31A 4V01A 4YSMA 2C3IB 4GYGA 1QPDA 2R2PA 3FJQE 3PXFA 5CXHA 3BHYA 3SLSA 4EH2A 3EFKA 4AA4A 5EKNA 1B39A 4LFIA 3ZFYA 3HECA 3CTJA 3OEZA 1MQBA 5GJGA 3MYGA 3FZPA 3NW5A 3QRKA 4MKCA 5BYYA 3TUDA 3ETAA 3UIXA 3IW8A 4IH8A 1UWHA 2WTDA 3NPCA 2X81A 4M97A 3GC8A 5DRBA 4AWIA 1QPJA 2QG5A 5C8MA 3TCPA 2FGIA 4YC8A 3DKOA 3EFWA 3NUYA 1YDRE 2YLEA 4ANBA 3QTWA 4UV0A 2WEIA 3R1SA 4AA5A 2BUJA 5IEYA 2UW9A 2OICA 4I0SA 4AZWA 4CFMA 1VYZA 4NM3A 3SA0A 3IW6A 3N9XA 2ZB0A 3FY2A 2O8YA 4ZTQA 4BTMA 2RFNA 4QYGA 3BU6A 5HE3A 4BCGA 4QP9A 5CI6A 3EN5A 4K1BA 4G3DA 5M53A 4FSQA 1K9AA 2ERKA 4KBKA 3FQHA 3VO3A 2BRBA 4I3ZA 2QOFA 1GZOA 3BWFA 4IAAA 4O91A 3PXQA 4I5HA 3R01A 1YQJA 4NZWB 3U4WA 1H24A 2VTAA 2X6DA 4PPBA 4KB8A 1S9JA 4PTCA 3E87A 2XP2A 4H1JA 2VWBA 4KRDA 1YI3A 5AP1A 5HO8A 4HGTA 3KXGA 4WG3A 3LPBA 2G2IA 3V5LA 4APCA 4TYJA 4H58A 3GU6A 5J9ZA 1PXOA 2A2AA 3TG1A 4L52A 3GT8A 2ETKA 4IAIA 4RBLA 1WVYA 5J1WA 2W5AA 4XYFA 5KMLA 3TUBA 3QD2B 4I22A 5AX3A 5HE2A 3VS0A 1P4FA 4XOYA 5EFQA 3VUHA 2I1MA 2HCKA 3DT1A 5HO6A 3ZUVA 4F7JA 2BILB 3KU2A 5HO7A 5J7HA 2WU7A 1WBVA 5L2IA 4GK4A 3W2QA 2PMIA 4Z7GA 1MRUA 3IONA 3KL8A 5J7BA 4TZRA 4HJOA 3V04A 3HP2A 1P5EA 3UE4A 4J71A 3WF9A 3WIKA 4DC2A 3AC1A 3RCJA 4U81A 4EKKA 1JVPP 3V8WA 5J95A 3T3VA 2YN8A 3W2PA 3PIYA 4C36A 3BBWA 3GU5A 4FIHA 3QCXA 4CQGA 1OIRA 3NUSA 5L2QA 2VTJA 4Z16A 3KRXA 3QHRA 2OJGA 3KRRA 2QOIA 4ZAUA 3JS2A 5HNGA 5L6WL 1YXTA 3R7EA 3UYSA 1VYWA 4F1MA 4FTTA 5C27A 3QLFA 3LFDA 1IRKA 4RWKA 4P5QA 3R9HA 4EZ3A 2B4SB 4FVQA 2BAKA 2OFUA 4X2GA 3I4BA 5GZAA 4MTAA 3TKHA 1OL2A 3ODYX 3IPHA 3VJNA 2ITVA 5TE0A 1F3MC 1YWRA 3B2WA 3R0TA 4LOQA 3V5WA 4FOBA 4P2KA 2HWOA 5IEVA 2ITOA 3F61A 5DT4A 4XOZA 5HTCA 4FKTA 4QPAA 3DQWA 2VNYA 4OTGA 2C3LA 4MXAA 3OY1A 4E6CA 2UW7A 1PXJA 3U87A 5DG5A 5FTQA 2PZYA 1P4OA 4NW6A 2BFXA 3P4KA 3QD3A 3ANQA 4RJ5A 2HW7A 4IC7A 2HY81 3ROCA 3SQQA 3ZRKA 1ERKA 4DH5A 3AG9A 2PTKA 4FT7A 3K5UA 4CKRA 3BGZA 5ETAA 2PMOX 3C13A 5CAVA 3QCYA 4FTMA 4FKQA 3TTJA 4TRLA 4BIDA 3VUMA 2NRYA 3HMIA 4GFOA 5AV2A 2WMXA 3EOCA 1CKPA 2QOKA 4U44A 5AWMA 5I9VA 3ITZA 3UQCA 1NVRA 3HEGA 3I60A 5EI8A 1YWNA 3KGAA 4C58A 2X9FA 4BKYA 1PMEA 4FG7A 4BZOA 4OBPA 1XH9A 3QL8A 2VD5A 4JNWA 4OT5A 4BCKA 2XVDA 3FZTA 2XKCA 4K8AA 5CU6A 1QPEA 3FBVA 1OITA 3Q4ZA 4IZ7A 5KMJA 2OK1A 3TTIA 4R1YA 4OLIA 5T68A 3BWJA 4QMMA 4QP2A 2UZBA 1UU9A 2I0EA 2QKWB 4MD8E 5IU2A 5JRQA 4A4XA 5D11A 4FSTA 4HPUE 1ZZ2A 1OM1A 2GNLA 2ONLA 3GCUA 4B4LA 3UQFA 3WF8A 4YJNA 3PPZA 1FOTA 2WELA 5AUZA 2EB2A 1M2RA 3H4JA 4X3FA 4Y72A 1WBOA 3OTVA 2PZPA 4FKSA 4BRXA 3CY3A 4RMZA 5I9YA 3O23A 2B53A 5HEZA 5LVOA 4XHKB 4BCQA 2XB7A 4MF1A 2BRHA 1AGWA 3A7FA 2C1AA 4NM7A 2GNHA 2RL5A 3Q9XA 4ALVA 2GTMA 4AS0A 4DEEA 2F2CB 3FUPA 3LCTA 1A9UA 3QYZA 4FTRA 5DT3A 5F9EA 3AMYA 3R7IA 1YOLA 2Z7QA 2GS2A 3CBLA 1JSVA 2PZ5A 4GSBA 2WMQA 2J50A 5E91A 4DGNA 2H6DA 3C7QA 5AV1A 4FNXA 3FAAA 3P9JA 4G9CA 2VX1A 1Q41A 5CASA 4FKVA 4L8MA 3BHVA 3RWQA 2F4JA 4BBEA 4ZSJA 2VO6A 1OIUA 2HK5A 2J2IB 4H39A 4XEYA 5DRDA 4HZSA 4QP1A 1KOBA 1V0PA 2VTSA 3L9MA 2JKKA 3LAUA 2QVSE 4DAWA 4NM0A 3F2NA 1ZYSA 1UU7A 4DH3A 3W2OA 4OW8A 1ZOHA 2YIWA 3BX5A 4GW8A 2XCHA 5AX9A 5HX8A 3BHHA 3U8WA 2XK9A 2FB8A 2FSOX 3JVSA 4V0GB 4WNMA 5D7AA 5A4CA 2JKMA 1H1WA 2X39A 2OZAA 4EOLA 5JT2A 4WT6A 1YOJA 2X4FA 1QMZA 3QTXA 3RINA 4RLLA 3EL8A 2XM8A 5DHJA 4FUXA 1YXSA 4IAYA 3R8LA 1GY3A 2QOQA 4UEUA 2XNPA 1WBPA 4WO5A 3UVRA 4QP4A 2ZDUA 4HW7A 5L4QA 3MB7A 3REPA 4GIIA 4DYMA 5FM3A 2J6MA 1JSUA 3F3ZA 4KIOA 4MNFA 3H3CA 1Q5KA 1TQIA 4QMVA 1STCE 1NXKA 2J0MB 3ORLA 1PYXA 4BWXA 1JSTA 3VQHA 4E5AX 3LCDA 2FUMA 2OF2A 3OF0A 4C38A 2UW5A 2VTOA 4N0SA 4W4VA 1NVQA 3LFCA 5AIKA 3W55A 3MVJA 3ZSIA 5AADA 4DGOA 5D10A 2Z60A 5BVEA 4ZLYA 1M14A 4OTRA 1U5RA 4UN0C 2VX0A 3E7OA 2WZJA 2UV2A 4PMMA 3OW4A 4QQ5A 3NW6A 3BYUA 3KMWA 2GNGA 4PL5A 4XLIA 4AAAA 4ZSLA 3QUDA 3TUCA 4BIBA 4K6ZA 4JX3A 4QD6A 2VN9A 3VS4A 3SW4A 1JWHA 4CFXA 4D2VA 3N51A 2WTCA 5CAUA 3IGOA 4XBRA 3U6JA 1OGUA 3H0ZA 3VRZA 2IZUA 2IVUA 3ENMA 4Y5QA 5M4UA 4OBQA 4CTBA 2ZAZA 5ANEA 3MVMA 4X3JA 4XX9A 5TO8A 2HYYA 2J0IA 4I92A 5IUGA 3VS2A 4HOKA 4FZDB 3QRIA 2BAJA 4AW2A 1GZ8A 4HVDA 4RT7A 4EH5A 4BWPA 3GU8A 4ZTNA 4TWPA 3RJCA 3ZC5A 2X0GA 3SW7A 4GFMA 3JYAA 1JLUE 1GZNA 4RJ7A 4IAKA 3NNVA 1ZYJA 1XBBA 2Y4PA 2H9VA 5IH6A 4JOAA 2E9UA 4CT1A 3TZ8A 3EN6A 2VTTA 3FMEA 4MCVA 2HIWA 4TWNA 3DAKA 3UVPA 3R28A 2HAKA 4UALA 3Q9YA 1Q62A 3K54A 3QHWA 5A54A 3C0IA 2NPQA 3G9LX 4XRJA 2XK8A 4QOXA 4ZP5A 4M68A 4D9UA 3G6GA 4MF0A 4Q9ZA 3R7UA 3R1YA 4DFYA 3C4XA 2QKRA 3PP1A 3R73A 4IMYA 3O7LD 1UVRA 1DAWA 4YZCA 3ZSGA 4E6AA 2YA9A 5C8NA 3M11A 2OXYA 3HV7A 2BDFA 2WOUA 4R1VA 4QP3A 1HCKA 3QUEA 2R3QA 2GHGA 2XIZA 3BGQA 1KV1A 3BHTA 3QA0A 5ETFA 3PIXA 1CTPE 2OFVA 3TWJA 3L9LA 4NEUA 4DEBA 1BKXA 5CANA 3R30A 4FYNA 4FV3A 1YXVA 5L2TA 4D5KA 5KZ0A 1O6YA 1PKDA 2ITXA 3LFQA 1W83A 4FKRA 4OTIA 5DVRA 3D4QA 4BCJA 3AC5A 3VVHA 4C37A 4AZVA 5KNJA 1LUFA 4TWOA 4XV3A 1V0OA 2H96A 1OKYA 4R3CA 4AE6A 4DN5A 2PVKA 2A1AB 2GCDA 4MAOA 4YJTA 3ZTXA 3FI3A 2R5TA 3Q96A 4EOJA 5E1SA 4D58A 5HBJA 2XBAA 3D5UA 2Z7SA 3OP5A 4YZDA 4NT4A 4HVHA 1MP8A 5LVMA 2G9XA 2C5XA 3AC8A 2W1CA 2R4BA 3MFSA 4RVLA 4F99A 4BICA 1E9HA 3QX2A 3MH3A 5JKGA 3HP5A 1WMKA 4FGBA 4AZFA 5IUIA 2VGPA 4YJRA 1Y8YA 1YHWA 3QQKA 2EXMA 4O96A 5IH5A 2UW0A 3VUKA 1Q8TA 4QMOA 5CSHA 4Q5HA 5CNOA 4M7IA 5EH0A 4EHGA 2WMWA 3R04A 2G2FA 3U6IA 2O2UA 4PP9A 2IZTA 4AGUA 4Y83A 3P08A 2WTIA 4J96A 4OT6A 3PXRA 4TNDA 4IEBA 3R8VA 3PTGA 4KKEA 2ERZE 5E92A 5L8JA 3D94A 3FHRA 4WBBB 3RCDA 4EOKA 2IO6A 5CSWA 2J5EA 4KAOA 4S32A 3KXZA 4EOMA 4EOOA 2FA2A 2J9MA 2VNWA 4K33A 3TV6A 5AV4A 3A2CA 4BCOA 4HVGA 5HZNA 3DAJA 3FLYA 4GG5A 4MQ2A 4FKPA 3WF5A 3SOCA 3FZRA 3R6XA 4NJDA 1VEBA 4CFVA 1J1BA 2W0JA 3BBTB 3WZKA 3NCZA 4USFA 5HU3A 4B6LA 5CALA 4D1ZA 3CKWA 5C9CA 3OY3A 1TQMA 2PZRA 3FMMA 1OB3A 3P23A 3VS7A 3DFAA 3VUGA 4RPVA 3Q52A 4XCUA 1U59A 2W1DA 2J0JA 5HIDA 4QRCA 5BPYA 4NWMA 4ZJIA 2G1TA 4M8TA 4XUFA 3HLLA 1YKRA 2XM9A 3H9RA 4M69B 5EKOA 3UGCA 5IG1A 4L44A 4Y46A 3VIDA 3AQVA 2I6LA 4AT4A 2BRGA 3G51A 4JBQA 3TNHA 4GVAA 4DGLC 1Q4LA 4KSPA 1M17A 5CWZA 2PVRA 5ANDA 4EWHA 3Q2MA 3SRVB 1LEZA 4PNIA 2OG8A 3VRYA 3NWWA 3AD6A 4KSQA 5AP7A 2PWLA 2OXXA 3GP0A 1E1XA 4YTCA 3E92A 4G5JA 1H25A 2HXQA 3ANRA 2YAKA 1YXXA 4HVSA 3NZ0A 3UIMA 3MJ2A 3MY5A 1KE9A 5HCXA 2FSTX 3BRBA 4HGSA 2R3FA 5CXZA 3C1XA 3SAYA 2A19B 2BRMA 4BC6A 4FKWA 2ZV2A 3F3VA 4MBJA 4E20A 4CZYB 2E9OA 3OHTA 5FQDC 5AR4A 3ZSHA 2CGUA 1R78A 1R0EA 4P5ZA 3H30A 3RAWA 3C4CA 4O2PA 1PY5A 3PJ3A 3WILA 3Q53A 3SV0A 2BTSA 4GUBA 4IVBA 4G31A 4D55A 4WIHA 4XRLA 5A14A 3PJ8A 2RFDA 5K3YA 4IFGA 3S0OA 3PA4A 3FXWA 3PY0A 1NY3A 4XP0A 3AMAA 2JD5A 3B8QA 5CS6A 4FV4A 4TWCA 1PF8A 5CTPA 2GNIA 2W4KA 4W4XA 4YZMA 1KE8A 5AMNA 3HKOA 1REKA 3H0YA 1RW8A 2YDIA 2Y7JA 1H00A 3TNIA 4K18A 4N6YA 2GS6A 3LVPA 3CJFA 2R3OA 3R2YA 4TL0A 3RHKA 2V7OA 4YJOA 5HGIA 5JZNA 2QOHA 4U80A 2WAJA 3OXZA 3OEFX 4X3FB
chains in the Genus database with same CATH superfamily
3LXLA 5FEEA 4UZDA 2VTMA 2JIIA 3ALNA 4JAJA 4NK9A 4ZSAA 2OW3A 1XH7A 2C69A 4ITJA 3PYYA 4OTQA 4LRMA 4YTIA 2HZNA 3FLZA 3PXKA 4FT3A 4S34A 4PDPA 4HPTE 3QD4A 2C0OA 3Q5ZA 4X3FC 1SMHA 1UNHA 2OBJA 5EHOA 4IZYA 3UVQA 3CTQA 3IKAA 2WMVA 4RIWA 3D5WA 5HVJA 4IB3A 4ZZNA 4QMXA 2RSVA 3COIA 2EB3A 4L3JA 2W5HA 4Q9SA 5HORA 4QTAA 3R7VA 1PYEA 3NUXA 4E3CA 3LFAA 1OZ1A 4AOTA 2A27A 4QO9A 3LIJA 3E5AA 4K77A 4F0GA 2UZVA 3FC2A 3V6SA 3L8SA 3SVVA 2UVYA 1LP4A 3FMNA 3NGAA 3QCSA 1CM8A 3DGKA 4L43A 4I0TA 5AR8A 3RAIA 3TIZA 5J5SA 4ASZA 5D7VA 3C4ZA 4L00A 4A07A 1Q99A 1DM2A 2PVNA 2B7AA 2PVMA 5DBXA 3KKVA 4IJPA 2JAMA 3R8MA 3B2TA 1M7QA 2C0TA 2KTYA 4TYGA 1SYKA 4UYAA 4YHJA 3OT3A 3Q60A 4AA0A 2RIOA 3FXXA 3RZFA 3V8TA 3G33A 4CQEA 2Y9QA 5EHYA 3VHEA 4BGQA 3DNDA 3A8WA 3E63A 4YC6A 4FTOA 2Y0AA 4O4FA 2YJSA 4XH6A 2WD1A 4AX8A 1MUOA 1J91A 5B2KA 1RQQA 2O0UA 2X8IA 3FZSA 1P14A 4I24A 1PKGA 3DZQA 4A9SA 2W9FB 2CCHA 4ZJJA 3MTFA 1Q8WA 3VS1A 5ANKA 1XHAA 4HNIA 1R1WA 4KKHA 2XNMA 3V5TA 4C2VA 3GU7A 1X8BA 3G9NA 4LRJA 2WO6A 4PMPA 3ZO3A 4ITIA 4M0ZA 5AAEA 2RG5A 2VWZA 4IDTA 4O4CA 3ZMMA 5HBHA 5IA4A 5HG9A 4FT0A 4MK0A 2B52A 4DLIA 3E88A 2QOCA 3NYVA 3EFLA 4O4DA 3LLTA 4BIEA 4F6SA 2XK6A 3EZRA 3QLGA 4XG2A 2X1NA 3DZOA 4IANA 5KMIA 2X2MA 3Q04A 4S30A 5BYZA 3FMJA 3KXXA 2X8EA 3PSBA 2PMLX 2P2IA 5AUXA 3WARA 4KS7A 4PNKA 5KO1A 4QYFA 3MN3A 3UQGA 4EH3A 4FVPA 3R83A 2P4IA 3ZH8A 2W4OA 4PF4A 4GUEA 1H28A 5HQ0A 4R3RA 4X21A 4FTAA 5HX6A 3BYMA 2P0CA 5E8VA 5K0KA 4C4GA 4IADA 2AC3A 3HUCA 4DG0E 2UZUE 2YEXA 3NCGA 5L8KA 2C6EA 2YCQA 1Y57A 3WYXA 1PHKA 3QQUA 3LQ5A 1GIIA 4JRNA 4DFZE 3FL4A 1ZLTA 2WB8A 2XIXA 3R8PA 1JQHA 5I0BA 3O96A 2QOOA 1H8FA 1WAKA 4BL1A 5CQWA 5FM2A 4BHZA 4ITHA 5K4IA 1NA7A 4QMZA 4WNKA 3D83A 4M3QA 4O4EA 3TNWA 5IEXA 3UG1A 3TNPC 4RVKA 2QCSA 5ANIA 3BIZA 5EOLA 4GJ2A 1W8CA 4G3CA 4CRSA 4Q2AA 4C57A 5ITAA 4G6OA 2BIYA 2RG6A 4MBIA 3RK7A 4MBLA 5A3XA 4AGCA 5AP2A 3LJ1A 4D2RA 1I09A 4BYIA 3D7TA 2ACXA 2YM8A 4MWHA 5HIEA 4FODA 2R3KA 4F4PA 1OL5A 4KS8A 5FRIA 4QQCA 5AUWA 3UZTA 4JG7A 3BE9A 4QT1A 4UB7A 4BKZA 2CGWA 4CRLA 3DAEA 2VU3A 3EYHA 3IECA 4F1TA 3TZMA 4EOSA 4QTEA 2XRUA 2WQEA 2X8DA 5LQFA 4GK2A 5HICA 4QP8A 3PIZA 4M14A 3UIBA 2RGPA 2C30A 4CKJA 3VUTA 4HYSA 3W8LA 1JBPE 1Q8YA 4KIKA 4LV8A 4O27B 3D2KA 3OCBA 3UTOA 4F0FA 2ZM4A 3PPKA 1IA8A 4MQ1A 3KC3A 4YJPA 5FEQA 4EC8A 1CSNA 4PPAA 1YHVA 4PTGA 5IISA 2Y4IB 2WEVA 4TYIA 3L8VA 4O0UA 1YDTE 3ET7A 1P2AA 3C9WA 5EDQA 3QZGA 1W0XC 5C03A 2OIDA 3PY3A 4IB1A 4JG8A 3D2IA 2GQGA 4I23A 1KE6A 3IQ7A 3EIDA 3MY1A 2KULA 3NSZA 2Y4IC 4ANSA 3PVUA 5DWRA 3ZDIA 3RK9A 3LFSA 1BYGA 3R2BA 4KA3A 4YLKA 2C5NA 3MWUA 1OUYA 3CKXA 4XG4A 3MFRA 2PSQA 3PSDA 2R3RA 3WF6A 4EBWA 3EFJA 3AC4A 2ITWA 3HRFA 4FTLA 4D4RA 5AR3A 4EHZA 2HWPA 4RJ8A 3ZCLA 2YLFA 4JQEA 1H01A 4F63A 4GVJA 1PXNA 2UZEA 2VTLA 4FKLA 1SZMA 4XBUA 3S3IA 3UNZA 4K2RA 4DBNA 1Q3DA 4GV1A 3E3PA 4JR7A 4LI5A 5CAPA 4EYJA 4UXLA 4M69A 1YHSA 3TI1A 3CLYA 1CKIA 3EN4A 4YC3A 3W10A 3QU0A 1JNKA 4FSMA 1M52A 2C6DA 3ZLXA 5IA2A 4GJ3A 4FYOA 4K11A 2ZV8A 4GT5A 5KBQA 5HE0A 2C68A 2HENA 1OI9A 5HTIA 3DJ7A 3MPTA 3SRVA 3LJ0A 3HMPA 3LW0A 3FDNA 4P90A 4C35A 2UVXA 4DFNA 5ANGA 2XEZA 1H27A 4LM5A 3TNQB 4DGGA 5LMAA 2B54A 4RX7A 2HW6A 5CT7A 5KZIA 3O51A 3WZUA 2GHLA 3ELJA 5J1VA 3FLNC 1PJKA 1CKJA 3II5A 3QA8A 3WBLA 3WF7A 4CXAA 3TACA 2BDWA 4FV6A 3OCGA 4C61A 1OIYA 3EQPA 5HVYA 2VTRA 5M51A 1H1QA 2XEYA 5DR9A 4LOOA 2SRCA 3F82A 4JG6A 3LFNA 4QMPA 5AV3A 5LVLA 4TT7A 3UC4A 5E8XA 4CVAA 3RZBA 5DNRA 4FA2A 4OTPA 2VO7A 2YM5A 3V01A 4EUTA 5E8UA 3F88A 4JIAA 5FEDA 3RM7A 4A06A 2PE2A 3OUNB 1PXPA 5LVNA 2OJ9A 2OIQA 4GL9A 4YHTA 5E1EA 4EHEA 3T9TA 5K0XA 2QURA 3THBA 4YTFA 3QBNA 3VF9A 3UMWA 3ORPA 2YM7A 3PRIA 4XNEA 4Y95A 2BZIB 3EL7A 5HNBA 2WU6A 3BQRA 3C4EA 4MXYA 3A7HA 2YM4A 3MPAA 2WHBA 4J98A 4S33A 2CN8A 2DYLA 3F3TA 5CSVA 5J79A 1FQ1B 4NFMA 4PTEA 3PE1A 1K3AA 5KMNA 3UPZA 3JPVA 4AN2A 3KRWA 3POZA 4RVMA 4P4CA 2PMNX 3IG7A 4I6HA 3TJCA 5L2WA 4O38A 1OMWA 3DKFA 4AE9A 3HMOA 3FY0A 4F7NA 5KHWA 2E2BA 4C02A 4JX7A 3RHXA 4I20A 4BDFA 3RNYA 4FL1A 4BDCA 3I0QA 3QCQA 4L3LA 2B9JA 4U6RA 4EWQA 4CCUA 4RX9A 4H3BA 3BQCA 3KULA 2GFSA 4X0MA 4RA4A 3UMXA 4A4LA 4DEHA 2FSMX 3QGWA 4Z55A 3IOKA 3PXZA 5BNJA 2W7XA 4BBFA 5HG5A 2JDTA 2QI8A 2FO0A 2WKMA 3DLZA 4X2KA 2C6LA 4BCFA 3VC4A 4ACHA 2FH9A 4ANNA 3PG1A 5A46A 4I41A 3ACKA 4NSTA 3HVCA 2J51A 2HZ4A 4J52A 4AOJA 1O9UA 3MIYA 2QD9A 4UMPA 2J7TA 3TT0A 1H1SA 3HA6A 1KV2A 3L1SA 2YCSA 3NX8A 5T6KA 3E8DA 4H36A 3WZJA 5J5TA 4CFUA 1A06A 3MY0A 3WZDA 4W8EA 3MA6A 5BMSA 2PVJA 2UZOA 2R3LA 4OTWA 3OWJA 4B0GA 5CEOA 4KD1A 4IB5A 3ORMA 4L68A 4AGWA 3AGMA 3OCSA 4EUUA 1YDSE 3R9DA 2OXDA 2I0HA 4M15A 3P7CA 3QAME 3ZM4A 3UO4A 4RIWB 3AD5A 3EQGA 4DCEA 3MGYA 3RNIA 4PQNA 3TZ7A 4I6FA 4NIFB 5LXMA 2WMAA 1CMKE 2FVDA 3O8PA 3KN5A 4WSQA 3EWHA 4YPDA 1PXKA 4RLKA 3G90X 5HLWA 3UO6A 4QNAA 3UDBA 1XR1A 3KXNA 3VBVA 4E93A 4QTBA 4UMUA 2CDZA 2C4GA 1JAMA 4A9UA 4EHVA 4HZRA 5FXSA 4E8AA 1LEWA 2WTKB 2PY3A 2PVHA 1PMNA 4YZ9A 3SHEA 1OKVA 2CGXA 2OWBA 4C4HA 4B8MA 2DQ7X 3LCKA 3CQWA 5CF8A 4HCUA 4FI1A 3B8RA 1RDQE 4LQMA 4U5JA 2IW6A 2BZHB 3QTUA 4M12A 5CF5A 4L6QA 4GS6A 4E7WA 4X2NA 2ESMA 2WTKC 4WG4A 3HX4A 2YJRA 3VWAA 4EOQA 5JGBA 2W05A 4O21A 4HYUA 2XNOA 3KK9A 4TYHA 3GI3A 4TXCA 4IWQA 3Q32A 4U40A 4ZTLA 5ICPA 3V6RA 3OW3A 4X2JA 4AZEA 1XH6A 4L46A 4B99A 2PHKA 2EXCX 4WOVA 3CPBA 2HZIA 2OKRA 3KMMA 4YP8A 3DS6A 4L42A 4LL0A 2G2HA 4PL4A 4M67A 1URCA 4I0RA 3GENA 2BZJA 3OD6X 3D14A 4EK4A 5CEKA 5AR5A 2YWPA 4YLLA 3D5XA 2PK9A 1FMKA 2OSCA 2QLUA 3L9PA 4RFZA 3ROYA 1XJDA 2VO0A 3RPSA 4B7TA 2CSNA 4G2FA 4RQKA 2RKUA 3CD8A 3BYSA 4QMUA 3QTSA 4U97A 2O65A 3COHA 2JBOA 3M42A 2W17A 2W06A 1OECA 2R7BA 3HA8A 3OBJA 3PE2A 3CR0A 3PUPA 3PXYA 3EQFA 3LJ2A 3QZFA 4H3PA 4LG4A 4W9WA 5H3QA 3NLBA 3UP2A 3QTZA 3KRLA 3AT2A 2PE0A 3C4WA 3DCVA 5DN3A 4BCIA 3FXZA 3QRJA 4AW1A 2BCJA 1YI6A 4AT3A 2JFMA 3MFUA 2YCRA 4TN6A 1UV5A 3ZRLA 4IIRA 5AEPA 4CSVA 5AUVA 4APPA 5L6OA 5BUJA 2OJFE 4QP6A 1Q3WA 4FTKA 3GCSA 3S1HA 4YR8A 4D4YA 4A7CA 5F94A 2F2UA 4BCMA 2BPMA 1SM2A 5CEMA 2YABA 2GFCA 3DB8A 4EK8A 2Q0BA 2C6OA 4ZOGA 3ZOSA 4UY9A 3W1FA 3E8EA 2QO2A 3EN9A 4G34A 2R9SA 4O1PA 1OKZA 4PMSA 4QQTA 2I0YA 3CP9A 4YJVA 4W4WA 2WNTA 4FNWA 4I6QA 4QYHA 2OH4A 3OUKA 2ZV7A 5AJQA 5EI6A 5HE1A 4A9YA 5DMZA 3I6WA 3D7TB 4E4LA 5D1JA 1FPUA 3ZO4A 1UU3A 4IWOA 5AUUA 3F5PA 1T45A 3LZBA 4L3PA 5E8TA 2JDRA 2WMSA 1OL1A 4FTNA 2YDKA 2YITA 4WRGA 1EH4A 2RF9A 5JEBA 3NYNA 1BLXA 1U5QA 3UOHA 2ZDTA 1JKSA 2PL0A 5AP5A 4FTCA 4KIKB 3VAPA 3ZDUA 3SD0A 4BDGA 4ZZOA 3QXOA 5EYMA 4KIPA 2P2HA 3Q6WA 4JT3A 4X6RA 4ZLZA 5HCYA 3UC3A 5FXRA 3G2FA 4J95A 4O22A 4W8DA 3VS6A 3VHKA 3FMDA 2R3MA 3LXNA 3PFQA 1XQZA 4R8QA 2CN5A 2CJMA 4ANMA 4F1OA 4FK3A 4XV9A 4BVUA 1O6KA 4I6BA 4TNBA 4WBOA 2ITYA 3BE2A 4ZK5A 5TKDA 4DH7A 4JIKA 4MVFA 4FEQA 1DS5A 4BWKA 2CPKE 4ALUA 4IACA 3OCTA 2A0CX 2JITA 3FI4A 3I5ZA 4HNFA 3P1AA 4CNHA 1W7HA 4BYJA 4XV2A 5FXQA 5JK3A 4R3PA 5I9XA 4OUCA 3QYWA 2CLQA 5ACKA 3HV3A 1KWPA 3KK8A 3LFBA 2ETMA 3W32A 2B9IA 4F70A 2R3JA 1AD5A 4BZDA 3I6UA 4EOPA 3NAYA 3R21A 4BF2A 4FG9A 4K0YA 3DBFA 3TV4A 3NYXA 3CTHA 5CQUA 3EH9A 4ANLA 3DDPA 3BCEA 4L9IA 3FYKX 1MQ4A 3ZBXA 2LGCA 4J8NA 1WVWA 2EWAA 3JUHA 4O0VA 3A62A 5AAGA 2J90A 3QD0A 4QP7A 3ULIA 4GU9A 4F7SA 5F4NA 3KEXA 2YACA 5BX0A 2XIYA 2OU7A 2G15A 4RZVA 3RM6A 4WA9A 3ZUUA 3NEWA 5CU3A 1FINA 2JFLA 4QMLA 3FLWA 2HZ0A 3ZXTA 3GCVA 4X6QC 2ZYBA 2W1IA 3R9NA 1MRYA 3L8PA 3PA5A 5HOAA 2WQBA 2XS0A 3F7ZA 3O8TA 4C2WA 5CT0A 2REIA 2QONA 4IB0A 5HCZA 4QQJA 2ZV9A 3DBQA 3HDMA 3ZZEA 3F6XA 4OTFA 2WTJA 3DK7A 4OTDA 2LAVA 4D0XA 2J4ZA 3FHIA 2A98A 4BDDA 2X2KA 2GPHA 3RPOA 2JKOA 3HRCA 3MVHA 1OKWA 2R7IA 3VNTA 2X7OA 3DQXA 3RVGA 4GYIA 1ZOGA 2PVYA 4QYEA 1ZZLA 5JFXA 3P7AA 3PG3A 2QR8A 1J3HA 4O1OA 5CEQA 5CU4A 3M1SA 4XG7A 3FMKA 4CMTA 3OWLA 1KE7A 3O2MA 3Q9WA 3QX4A 2QO9A 3ZU7A 3RKBA 4NFNA 2VTIA 2OGVA 5DR6A 3A7JA 4U45A 2C5YA 4NKSA 3GOKA 5TF9A 4FT9A 2W96B 3JY9A 4EK6A 3OROA 3U9CA 2OF4A 4FOCA 4JLCA 4RIXA 2EU9A 2XKEA 3GVUA 5BMMA 3PVGA 4YGAA 5HU9A 4X2FA 2XZSA 5CYIA 1LR4A 4EBVA 1YVJA 3UJGA 5M55A 2O3PA 5I3RA 5KKRB 4BDHA 5H2UA 5H8EA 4MD7E 1Z5MA 4BDKA 2C5VA 3G5DA 4RSSA 3ZLYA 5JH6A 2YERA 3FQEA 5HVKA 3LCSA 4A9RA 2P33A 2WMBA 2JDOA 3NAXA 4R5YA 3OFMA 3ZXZA 5IPJA 4WRSA 4C59A 3A61A 4BBMA 3OT8A 5EW8A 1JKLA 3LE6A 4M66A 4MH7A 5F95A 3CPCA 3JXWA 4RQVA 3R7OA 1ATPE 5HESA 5JMSA 4AQCA 5JSMA 2W9ZB 3WE8A 3ZBFA 4AZTA 5IA0A 2BTRA 1DI8A 1V1KA 4AF3A 1OL7A 3DA6A 1U46A 1AQ1A 1Y8GA 2QODA 2V22A 3KULB 4U8ZA 5HG8A 3ZUTA 3COKA 4C3FA 5CU2A 4E6DA 2C0IA 4G6LA 4LL5A 3VS5A 3CS9A 3KF4A 4QMYA 1M2QA 3MBLA 2VWUA 5A6OA 4FV9A 5CF4A 4M84A 3UOJA 5CAQA 4C4JA 1DI9A 2G01A 3EZVA 4IVDA 1F5QA 5HIBA 3W16A 4YJUA 4OBOA 3A99A 3HV4A 3D15A 3QZIA 2BZKB 4K9YA 2ITZA 3DTWA 3F9NA 4YBJA 3MH2A 3WE4A 5I9WA 3MVLA 2OZOA 4BDJA 2JAVA 4BN1A 5FDPA 4KINA 4LRKA 4YZNA 4NIFA 4DH8A 3U6HA 4AXAA 4EH9A 3LM0A 2HY0A 3FKLA 3NDMA 4G5PA 4U3YA 3E7VA 1JPAA 1TQPA 5BUIA 2XYNA 3ULZA 5JGAA 2IN6A 4ZY6A 4IHPA 3BLRA 2YM3A 2UZDA 4ASXA 4C7TA 4L67A 1YRPA 2CKEA 4JDJA 5KE0A 3U4UA 2R3HA 3Q4UA 3T9IA 4PUZA 4R5SA 1U54A 3FC1X 4IX6A 4CLIA 1UKHA 2BFYA 3C5UA 4L01A 3I5NA 5BVFA 3HL7A 3ZC6A 1YI4A 4MX9A 5GJFA 2YAAA 4FSRA 4IAFA 4AP7A 4XMOA 5D9HA 2W1ZA 5BQ0A 1O6LA 2GNFA 3D0EA 3FZOA 1VJYA 3EKNA 4XLVA 4BTFA 4PRJA 4FTQA 5EYCA 4O0RA 4F9CA 1REJA 3DV3A 4FIGA 4UWYA 4ENYA 5AUTA 4M0YA 2JC6A 2BRNA 3CE3A 2X0PA 4ZS0A 4GT3A 4ZXTA 4HYIA 2FSLX 2DS1A 1ZY4A 2R3NA 4ZLOA 5FG8A 4OAVB 4C4EA 4FL2A 4LGGA 3DPKA 3P78A 1ZMUA 3R1NA 4G17A 4GCJA 3QF9A 4I5PA 3CGFA 4ZZMA 3TKUA 5LCKA 4TYHB 3ZFXA 4IM2A 5BVDA 3KN6A 3GFEA 2WPAA 4G3EA 4U0IA 3OBGA 1YOMA 4FSYA 4I21A 4DHFA 2ETRA 5DLSA 4ERKA 3I7BA 4O0XA 4TW9A 3U51A 3ZRMA 3F69A 3H9OA 3ZLWA 4FMQA 4H3QA 3AC3A 4RFMA 3OS3A 4QMWA 2W1FA 4IM3A 5D12A 2JKQA 5CZIA 1JKTA 1KE5A 5KHXA 4A4OA 5ANJA 5FD2A 3LFEA 4JDIA 5E8YA 4YURA 4DLJA 3W33A 3VJOA 2WOTA 2V7AA 4UMRA 3DBDA 2VTNA 2BROA 2V5QA 3KVXA 5M4FA 4ZIMA 2XBJA 1H1RA 1Y91A 3EQHA 4IC8A 4MXOA 3G0FA 3LOKA 3DLSA 4E73A 3AGLA 1XH5A 4A9TA 3QUPA 2QO7A 3K3JA 1ZYCA 2JBPA 4U7ZA 3F3UA 2JDVA 5H8BA 1G3NA 4HGEA 3QRTA 3V3VA 5C1QB 3C0HA 1LPUA 1MRVA 3ZO1A 4LGHA 3QTRA 4O6EA 5EI2A 5BVWA 1YW2A 3OG7A 1PXMA 4ASEA 5LWMA 3VQUA 5G1XA 4WSYA 3E3BX 1I44A 3E62A 2IVTA 4FK6A 4LOPA 4RWIA 2B9HA 4D2TA 4RIYA 4C33A 1URWA 4L53A 5KUPA 3W8QA 4LV5A 5AA9A 3FQSA 4FICA 3QWKA 3KCFA 3QGYA 5E90A 5K4JA 4BTJA 5FDXA 3DDQA 3QKMA 4CEGA 4MNEB 4F0IA 3VS3A 1FVVA 3CQUA 1BI7A 2QHMA 4WUNA 4J97A 4EEVA 3HYHA 2YIYA 4DGMA 5H8GA 4FIEA 5J9LA 3E8NA 3LM5A 3KRJA 5L8LA 1ZAOA 3PWDA 3R63A 3S00A 1TKIA 5E8WA 3GCPA 2IZRA 3AD4A 2A4LA 2IZSA 3Q3BA 4XG8A 3R71A 1XBAA 2QQ7A 4F64A 3P86A 4IX5A 3EQBA 3GU4A 2IJMA 2BHHA 3EYGA 5IA5A 4DH1A 4XG6A 2WQMA 3GCQA 2XK4A 3MB6A 4WNOA 3MSSA 3VUDA 3Q4CA 5IZFA 4WHZA 3QWJA 3W18A 5EM6A 5KBRA 4XV1A 3DJ6A 3D9VA 2UVZA 3BZ3A 2C6MA 4E4XA 4HCTA 5I9ZA 2QHNA 4Y85A 4CFFA 4R7IA 4EL9A 1BL6A 4N6ZA 5EM8A 3KCKA 3CD3A 4MEDA 2XKFA 3MJ1A 3BEAA 4YJQA 5FP6A 5HG7A 3QALE 3QKKA 1ZMVA 5FWKK 3WOWA 4D0WA 1PW2A 2WTWA 2YZAA 2AUHA 2BMCA 4EK5A 4DTKA 4W9XA 4YMJA 4BGGA 5AV0A 4N70A 3FPMA 2ZM1A 3LHJA 2WFYA 2Z7RA 5CNNA 3BLHA 1M7NA 5LARA 1GOLA 2DUVA 3I0OA 3R22A 2H8HA 5EYDA 4AN9A 5M4CA 3NYOA 3CQEA 4IZAA 4AW5A 5AAFA 1GAGA 2YISA 3NW7A 2Q0NA 4FIFA 3LXPA 4JVGA 4JL9A 4C3PA 2ITNA 1IEPA 4RWLA 3VBYA 2AYPA 1H4LA 4Z7HA 5EK7A 4RX5A 3OZ6A 2E9VA 4QYYA 4IQ6A 4EH8A 5TR6A 3ALOA 2WMUA 3PWYA 2VGOA 4P7EA 4YPSA 4PDOA 3EKKA 3VW8A 3HNGA 3WZEA 1UKIA 4I94A 3LFFA 3NR9A 2IVVA 4LYNA 3QQLA 1Q8ZA 1CDKA 2QOBA 2PZIA 4S2ZA 3H10A 4YNEA 4AU8A 4I4EA 4PP7A 5M56A 4LGDA 3TKIA 5JN2A 3AXWA 2OH0E 4HVIA 4QPSA 4I5CA 4RC4A 2XNNA 3TN8A 1UA2A 2BVAA 4DINA 5DPVA 5AP0A 1Y6BA 2B1PA 2QU5A 4CFWA 4ZTMA 4J1RA 3DY7A 3E64A 4RJ6A 5LCJA 5D41A 5CY3A 2O63A 1APME 4NCTA 3ZYAA 3KVWA 3P5KA 3EN7A 1B6CB 1JKKA 1RJBA 3P79A 4B9DA 5IH4A 4UXQA 5A6NA 4TTHB 4LUDA 4Y5HA 5CEPA 3IO7A 5KMMA 2CLXA 2XK7A 4GMYA 2JLDA 2UZNA 5B2MA 3D7ZA 3BV2A 3A7IA 5CAOA 2XJ2A 4BDAA 4JAIA 4KWPA 4DFLA 4XS2A 4ANQA 5E8SA 1YWVA 3MFTA 3QTIA 4U43A 5FLFA 4Y8DA 3COMA 1J1CA 3U9NA 1FMOE 3C4FA 4MYGA 5CLPA 2VAGA 3S95A 4C8BA 5DH3A 3FV8A 5CENA 2VWWA 4EH4A 2FYSA 4BDBA 4ZY5A 3NUPA 4IZ5A 4E1ZA 3L8XA 2Z7LA 1TZDA 3IS5A 2R3IA 3MI9A 3O8UA 5HNIX 3RWPA 3GC0A 4D4VA 4ALWA 2YIXA 4FZAB 5A4EA 2BALA 4D1XA 2R3GA 4UMTA 5IUHA 3OVVA 3ORXA 3EQDA 3FLQA 1ZWSA 3CIKA 2C1BA 4YHFA 3GGFA 1XBCA 4KBCA 3TEIA 2BAQA 4CD0A 5IA1A 5DI1A 3DK3A 4RIXB 5A9UA 3OMVA 4BZNA 1SVEA 4RX8A 2Y8OA 3HV6A 4AACA 4CCBA 4RZWA 4FTJA 2VV9A 4Y73A 3MTLA 4WNPA 3V5QA 4UWCA 4F08A 4YUQA 4ACMA 4BHNA 3G0EA 3PLSA 2YCFA 2BKZA 5EW9A 4BTKA 5LMKA 5EW3A 3RP9A 3KF7A 3UG2A 3FE3A 2QNJA 3HMNA 4ZSGA 5A4QA 3R7GA 3KB7A 3E8CA 3JY0A 4XJ0A 4F6UA 2XCKA 1W84A 1W82A 2AC5A 2YIRA 3NIEA 4PY1A 3BV3A 4GU6A 5DFPA 3H9FA 4CYIA 4IFCA 4RC2A 4L7FA 2OIBA 2C3KA 4KABA 3SKCA 2XIKA 4D4SA 3ORTA 4QTDA 3VN9A 2ITUA 4L7SA 5IKWA 2GSFA 2VX3A 1U4DA 3AC2A 1VZOA 4RG0A 3I79A 4YSJA 3UNKA 5AA8A 3CC6A 2UW3A 4IAZA 3VBQA 4UX9A 4JBVA 4QMTA 4R6VA 4BGHA 5ETCA 3V51A 5M57A 2GMXA 4UMQA 1V0BA 4Z9LA 4O0YA 5B0XA 3I81A 2R64A 3AT4A 3QQJA 5GJDA 4ZJVA 3UO5A 4CZTA 2WGJA 3UNJA 1WFCA 2B55A 3PSCA 2UZTA 5G6VA 3IDBA 3EQCA 3Q4TA 4MXCA 2W1GA 2GHMA 4RIOA 4FBXA 1GIHA 5HLNA 4QPMA 3R8ZA 4EQCA 2ZMDA 3RAHA 2E9NA 4G1WA 4C4IA 4E26A 4QMNA 3ORNA 4G3GA 3QC4A 5HI2A 3R7YA 2QR7A 3PVWA 3UP7A 1W98A 2OO8X 2J0KA 2XNBA 1WBTA 1YXUA 3FKOA 5A4TA 2XNEA 3A4PA 2YFXA 3IDPA 3GC7A 1FGKA 3MW1A 2BDJA 4XG9A 3NNWA 4FNYA 5ANOA 3UBDA 1H07A 4FC0A 5I9UA 3KQ7A 3ZLSA 4FKIA 1BUHA 4G16A 4EC9A 1U54B 1W2DA 4YBKA 1IASA 5C8KA 2W1EA 2R3PA 4DEDA 4ID7A 4UZHA 4EK3A 3Q9ZA 5B2LA 3KXHA 3UIUA 1ZMWA 4AFEA 3KY2A 4RWJA 3NUNA 4NKAA 4EOIA 1WVXA 5K5NA 3ENHA 1WZYA 2F9GA 2CGVA 2WMRA 1WBNA 3UZPA 4FZ6A 1H08A 3OWKA 3A8XA 2I40A 2O64A 3O71A 4FKJA 4IWPA 5HD7A 4LUEA 4JS8A 5HBEA 3GBZA 4AG8A 4F9WA 1T46A 4EQMA 4IJ9A 2I0VA 5AP3A 3QC9A 3A4OX 4EH6A 3DBCA 3ZZWA 3BKBA 4FTUA 4ZEGA 4MHAA 2NO3A 1XH4A 2F57A 4DG3E 3F5UA 3V5PA 3G6HA 3Q6UA 4G3FA 5BUEA 2GU8A 5AR2A 3RPRA 2GDOA 2YDJA 3L9NA 4U79A 1KSWA 4FUYA 3KXMA 3TV7A 4NJ3A 4FZ7A 5LJJA 2ZJWA 3K5VA 3NIZA 3O50A 4EQUA 4FIIA 3CJGA 3NRMA 2C47A 3GXLA 3GC9A 3KFAA 1UNGA 1ZY5A 3OOGA 3ZONA 4B8LA 4FV8A 4LMNA 3RAKA 2BR1A 2ITPA 4XG3A 1DAYA 3PZHA 4FSZA 4AT5A 4WKQA 1SVHA 4RFYA 3POOA 3SDJA 1WCCA 4PWNA 2V62A 1PMVA 3WIGA 5AP6A 4CMUA 4GFGA 3SOAA 3FWQA 4NM5A 4O0TA 3TIYA 3FMLA 4I1ZA 2W5BA 4BDIA 4U41A 4CFNA 1S9IA 4FX3A 4WUAA 1OIQA 1BL7A 2BHEA 2HELA 1XKKA 2XMYA 4HGLA 2XUUA 3QQHA 2P3GX 4MXZA 4GRBA 4AUAA 2ZM3A 4PX6A 4BCNA 3F66A 4GK3A 3RK5A 4MWIA 5DT0A 3VULA 3DKGA 4F9BA 2WTVA 2F7EE 3ORKA 1UWJA 3T8OA 2NP8A 5DGZA 4RJ3A 3K3IA 1B38A 3P0MA 2GNJA 3S4QA 1GNGA 4C62A 3GUBA 4IWDA 5K5XA 1OPLA 2VZ6A 3FI2A 4ACGA 4MNEA 4QMSA 2EUFB 3MDYA 1JOWB 3BU5A 3IK3A 5B7VA 4W4YA 4FSUA 4RC3A 4YO4A 4IX4A 4M13A 3MPMA 3AMBA 4FKUA 4CMOA 2W4JA 5L3AA 2W1HA 1NVSA 3S2PA 3UOLA 3LQ8A 1ZYLA 3GNIB 4RIYB 4UBAA 4DEIA 2WMTA 3R00A 2JGZA 4FKGA 4ANOA 2IWIA 5JQ8A 5L2SA 3IW4A 1R0PA 3ACJA 4D2PA 2VO3A 1QPCA 4AGDA 3BHUA 3PVBA 1OUKA 4JJRA 1HCLA 1VR2A 3EJ1A 4AOIA 4CYJA 5JFWA 4EI4A 4CLJA 4AW0A 1IR3A