4U42A

Map4k4 t181e mutant bound to inhibitor compound 1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
295
structure length
282
Chain Sequence
SSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity and Kinase Activation in a Cohort of MAP4K4 Structures
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
total genus 83
structure length 282
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u42A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u42A01
2W4KA 4J8MA 4LMNA 2OJJA 4U80A 1GIIA 4UMRA 3I60A 5CEMA 4GIIA 3LQ8A 4HCVA 4YJNA 3NUYA 1URCA 4W4XA 3UG1A 3CSVA 3E63A 3VUHA 4O7YA 3EMGA 2W1GA 3DBQA 3EN9A 4U3ZA 1OL1A 3PIZA 5HKMA 3Q52A 2JDOA 3QKLA 3QCSA 3DB8A 2JKQA 3NR9A 3P08A 5C9CA 4LGHA 4EK4A 1J3HA 5KHXA 2WAJA 3OT8A 3VIDA 4R7IA 3LLTA 3W32A 3EN4A 2RG5A 3OCSA 3RBWA 5KUPA 2O63A 3A61A 4WNKA 2X2KA 4X2NA 2LAVA 1W8CA 3DU8A 3JR1A 4U45A 1UNHA 4YTFA 3Q6WA 2G2IA 4FOCA 3ORLA 4AA4A 2H9VA 2PE0A 4EH2A 3LLAA 4FTOA 4Y8DA 2PZRA 2XKCA 5TKDA 2WQNA 2QOIA 5DNRA 1VZOA 3FPQA 2XYNA 2HIWA 4KKGA 5EM7A 1SVEA 2PMLX 2A19B 4BGGA 2OXDA 4FYOA 3IO7A 4GL9A 3OW4A 5F95A 3ZO1A 5CXZA 3POZA 5KMKA 5M4UA 4L42A 3RWPA 2W17A 2OLCA 3TNPC 4AE9A 1GIJA 2C3LA 1KE8A 4MEDA 4L01A 4QMLA 5M56A 3ATSA 2YABA 3FUPA 2ZB1A 5CI6A 5FTQA 5J8IA 3ZLYA 5KCVA 2W5AA 2QG5A 3I6WA 4FG8A 4PPAA 4D4VA 1QL6A 5CU0A 4GFGA 3GUBA 1LUFA 5DPVA 5CALA 4EOPA 4EK8A 4AT4A 3CIKA 3UPXA 1BI7A 1BKXA 2DS1A 3AC3A 3F3ZA 3GQLA 3PPJA 4JBQA 2XIYA 4GU9A 3PXRA 1PKDA 4CKJA 3WZUA 4C4FA 4RRVA 2R3NA 2XK6A 3UOLA 2J5EA 2P3GX 2V55A 4O1PA 5D9HA 3ZBFA 4IJPA 5CAQA 3EZRA 3TZMA 2Z02A 2DWBA 4KINA 1Q99A 4NKAA 2JLDA 2C6OA 5EK7A 2IVVA 4EC8A 4UYAA 3VUKA 5I4NA 2WTJA 2ZAZA 4EL9A 1P14A 3HAVA 4LFIA 3SGCA 2R4BA 2WTDA 3P1AA 4C35A 3PXYA 2OFUA 3QRKA 4NZWB 3DBFA 2YM4A 3A4PA 4YTIA 3COKA 4M3QA 2VO7A 3MN3A 4G3EA 2QC6A 4MNEB 2FGIA 1NW1A 2PK9A 2X9EA 3FZOA 3H4JA 4ANMA 5J7BA 4M7IA 3LMIA 4RJ4A 4E5WA 5HE1A 1IA9A 3ALOA 4KSPA 4O6LA 3QXPA 1BL7A 2B9HA 3NPCA 5ETIA 3VUMA 2BRMA 2NRUA 4J95A 4IBMA 4UWBA 1H1RA 4O7ZA 3D5VA 3GI3A 3TJDA 4I5PA 1KWPA 3P86A 4L43A 4CYJA 5IU2A 5LCKA 5HIBA 2X8EA 4F1TA 2YCFA 3KMWA 5JZNA 1J1CA 3DJ6A 4CG9A 3A7JA 2P4IA 4YHTA 5EHOA 3R00A 2OBJA 2PE2A 3C1XA 3ENMA 4NKSA 4F0FA 4EORA 2C69A 2I40A 4HPTE 3EKNA 5HLPA 4JX7A 3VULA 2HY81 5JZJA 2P0CA 4NW6A 3VBQA 5M4IA 3PA4A 5AP1A 3GFWA 2RL5A 2VNWA 2Z7SA 5HX8A 5HO7A 4XV3A 2ZV9A 2X6EA 3KMMA 4KSQA 3UBDA 3GU4A 4CEGA 1OPJA 5J87A 3E87A 2UZOA 3D7TA 2H8HA 3E62A 1G3NA 2AC5A 3NAXA 3O71A 3EQIA 4P2KA 5DT3A 4ACGA 5K5XA 4C59A 1TKIA 1ZYSA 3TUDA 3UZRA 5FM3A 3SAYA 1H0VA 3NNUA 3W16A 3MA6A 3ZUVA 4IM0A 4PL3A 4OGRA 4CKIA 3FSFA 3MIAA 5GINE 1CSNA 3NS9A 3VO3A 3OWPA 2PUNA 3OROA 4ZS4A 4RIWB 4BTKA 1OUYA 2YIWA 3ZOSA 3D5UA 5IZFA 2C6TA 2WOTA 4E3CA 3ZZEA 4CQGA 3NDMA 3PTGA 3HUCA 3T3UA 4E6CA 4CFMA 5BVOA 2VTLA 3PLAE 2HOGA 1U59A 3UQGA 5A46A 3TG1A 5AP4A 2HWPA 3VBVA 4AZVA 4FZAB 4YURA 5JGDA 4O0TA 4KWPA 5AADA 1F5QA 1LR4A 4HYHA 3BHHA 4YLLA 5ETCA 4MWHA 4EZ3A 4XX9A 1O6LA 3A60A 4FKVA 2E9PA 5FQDC 4U9AA 4PF4A 3UNKA 4DYMA 4IC8A 4QQJA 2R3LA 4EH4A 4RVKA 1KSWA 2XEYA 2PE1A 3CJGA 4FSYA 3QRUA 2X2MA 3DBDA 4WG5A 5AUXA 5JN2A 4DTAA 2XCHA 1QPJA 3DK7A 4TWCA 3CE3A 1V1KA 4X7QA 3V01A 3AT3A 3VBTA 4O0SA 3QYWA 4UMPA 4DT8A 5ETAA 4AWIA 3M42A 2I0HA 3MA3A 3QQFA 2X6DA 1CM8A 1HOWA 4CNHA 3SG8A 2VU3A 3HV6A 5A4LA 5C8NA 2I1MA 4X3FA 3WARA 3LFAA 4N0SA 3LJ2A 3W8QA 2WEIA 4FBXA 1U54B 1MQBA 2PMOX 4GJ2A 4AW0A 2OIBA 5HG5A 3S0OA 5L3AA 4ZY5A 1YDRE 3PJ2A 5AR8A 4UWYA 3F2NA 3IW7A 4I23A 3BU5A 4AT5A 1XKKA 3OXIA 2GNLA 4FL1A 3OW3A 3O0GA 1DAYA 5C03A 5JFVA 3SV0A 3A62A 3O96A 3CKXA 2WMAA 3GT8A 4ACHA 1OUKA 1VJYA 2WMUA 4JL9A 3EN5A 2FSOX 4U43A 2ZM4A 3F3UA 3V8SA 3FQHA 5AEPA 4J71A 3QALE 5BYYA 2O8YA 4J52A 3FXWA 3BKBA 5M55A 4X2JA 4IAFA 4J96A 4DITA 2VTIA 4QYYA 5JRQA 2BZHB 3QKKA 3DNEA 4D1ZA 4LGGA 4QYHA 2IO6A 5GJFA 4RIWA 2VTPA 4NM7A 5E8VA 2UVZA 2CGWA 4D55A 1O9UA 4E93A 5E7RA 3PZEA 5AAGA 4XRLA 4E20A 1XBAA 4RWKA 4C02A 3R2YA 2QCSA 4RLKA 3JVRA 4FT0A 1P2AA 4G34A 4KIOA 4MXYA 4XYFA 1GY3A 3OEFX 4OTFA 3RAHA 5A14A 4JDJA 3QTSA 3R7VA 4FTCA 1OZ1A 4ZLYA 2XJ1A 2BAJA 1BI8A 3I79A 3BGQA 4QP6A 4L8MA 4ZSEA 4EUUA 5HICA 2PVFA 2WU6A 5CASA 2UVXA 3IECA 1H01A 4GSBA 1YOMA 3OP5A 3CGFA 4DCEA 3IK3A 1M2RA 5IA1A 3DLZA 3FZTA 3ZU7A 5GZAA 1MRVA 1OIRA 4OBPA 4UX9A 3COMA 4EK6A 4IZ7A 3O8TA 4K11A 1OGUA 5FM2A 3LCOA 5D7VA 3EL7A 5M57A 4IFCA 2CPKE 3H9RA 4CFNA 2YISA 1JOWB 3HKOA 4I5CA 3V5WA 5L2TA 2CJMA 1U54A 3BZ3A 4FICA 4RA5A 4GG7A 5DBXA 5LVPA 5CNOA 4CVAA 1ZYJA 2QHMA 5HNGA 3QWJA 4GT3A 3P7AA 4B8LA 3AOXA 5GIOE 4FT5A 2GSFA 3SX9A 1XQZA 1JSUA 4MQ1A 4R1YA 3NNWA 4HJOA 2WB8A 3D94A 1R1WA 2ZM1A 3Q4TA 3FI2A 5IA4A 1IAJA 4GFMA 3V8TA 1HCKA 3C0HA 2YM6A 3KVWA 4TYHA 4BTFA 1Y57A 5C01A 4JT3A 2C47A 4QMQA 5DN3A 4GS6A 3DKCA 5K0XA 1OL7A 2WMWA 2GFSA 4EHZA 2YWVA 2BUJA 3NIZA 4Z7GA 3BGZA 4C37A 3LKMA 3NYOA 5DR2A 3SD0A 3UVQA 4P5ZA 3T9IA 2I0YA 2J7TA 2XK9A 1ZMWA 2BVAA 3QRJA 4EONA 3MY1A 4W8EA 3BCEA 3F5UA 1M7NA 4GUBA 5DFPA 4F9CA 5CSHA 1G5SA 2QLQA 2VTJA 4IVAA 2OICA 4IAKA 1APME 4L3JA 2JBOA 5CVGA 5FLFA 3ZC6A 4APCA 2H96A 3KULB 3PXFA 3ENHA 5HCZA 2O65A 1UVRA 2BDJA 4L9IA 3BHYA 2I6LA 3ZFMA 3WI6A 5AAEA 4ZMFA 3G9NA 4R3PA 4FVQA 4TY1A 1OITA 4FT3A 4KBAA 4DH8A 4UXQA 1YHSA 3R73A 4BIDA 4OUCA 4QP3A 1TVOA 3TV4A 2H34A 4TN6A 1I44A 3UIXA 3LM5A 3N9XA 4FTMA 2CLQA 2Y0AA 5K5NA 4AZFA 4FIHA 4YC8A 4RJ6A 5B2LA 4O0XA 5EDPA 4YZ9A 3R01A 4GH2A 2WTIA 3JUHA 3AC8A 3VHKA 4EOMA 2PPQA 4YJSA 4FIJA 2Y8OA 3PLSA 1R0PA 2VTTA 2WELA 4FV9A 4X3FC 4BCJA 4YJQA 3NZ0A 5LVNA 4KKHA 1H28A 4IX6A 5CYIA 5EHLA 5L2IA 5GJDA 3AMBA 5CZHA 3WOWA 4FX3A 3PA5A 3FXZA 4XG8A 5H8GA 3BE9A 3IONA 5GZ9A 3UIBA 4H05A 3EQRA 2C3JA 3MFUA 4BIBA 4R7BA 2OG8A 5I3RA 4XP0A 2A1AB 1SNUA 4JQ7A 1F3MC 3VQHA 4AGCA 1VYZA 4BTJA 5ACBC 2V62A 3R30A 3VBWA 3EFWA 3EKKA 4M97A 3QHRA 4EZ5A 4OAVB 4ASXA 3UO6A 2RSVA 3WZDA 5DEWA 4ORKA 5HLNA 5CXHA 2XK3A 5AM6A 3R21A 3VS4A 5JEBA 3CPCA 4D2TA 3IW4A 3MV5A 3W2RA 4CG8A 4OR5A 4EHVA 1YXXA 4YO6A 2JIVA 2BMCA 2YZAA 4BF2A 4F9YA 3NIEA 3PVBA 4HZRA 3WBLA 2JKMA 3KCFA 4DG3E 3UZTA 3B8RA 5C27A 4G3DA 1ZAOA 3RNYA 3NSZA 4IB5A 4V0GA 1IAHA 4QMXA 3TNHA 4GG5A 3H0YA 4A4XA 2JDTA 3WYYA 4PQNA 1I09A 4KS8A 5HOAA 4M67A 5GJGA 2GNJA 3UIUA 4Y5HA 1UV5A 5HGIA 4FTLA 5FTOA 3ORIA 4L7FA 2W1IA 4YU2A 4M14A 5L8LA 3L1SA 4A4OA 2C1BA 4JG7A 4BCKA 2VNYA 1DI8A 1PXLA 3D5WA 5I9UA 4FIGA 4C38A 4O6EA 4NUSA 3GXLA 3OG7A 3UQCA 5IEXA 1FVRA 4FK6A 2VV9A 4XNEA 2WU7A 1OL5A 4G16A 2WZJA 3FXXA 4NCTA 4BBEA 4O7RA 4TW9A 4BWXA 2WTKB 4OT6A 2GCDA 4FKPA 3KREA 5AUVA 5IG1A 4IACA 5TOZA 3SXFA 5CF6A 1FGKA 1XJDA 5IA3A 1REJA 5CEPA 3R0TA 3VHEA 4O84A 3R8UA 4BB4A 4BDHA 4FUYA 2PVMA 3EYGA 4R5YA 4CFVA 2XIRA 4LG4A 3E3BX 4TRLA 4V05A 4F63A 2KTYA 3PSBA 1QMZA 2OJIA 4FTKA 5CU2A 3V5TA 2XNPA 3HZTA 3KRWA 2JAVA 2CNQA 2R7BA 2Q0BA 4IAIA 2FSMX 4XHKB 2VTHA 5EDRA 2X7OA 4CFUA 4HW7A 2BALA 4F9AA 4YJVA 5CEKA 2P33A 3N4VA 3HEGA 1JSVA 2W1ZA 4AZTA 3R8LA 1QPEA 4MNEA 4G17A 4APPA 5HBEA 5FEDA 2Y4IC 4IZ5A 2R64A 4HGTA 4O0RA 2WQOA 4Q2AA 1H1WA 2UW4A 5AP5A 4IDTA 3Q53A 3VJOA 3RHKA 4UALA 3A4OX 1T45A 2OJGA 2Y6MA 3JY0A 3GOPA 3LFEA 4ANLA 4O38A 1FMKA 3LHJA 3DAJA 3F3WA 4FSNA 4G9RA 5K0KA 4DG2E 3Q3BA 1UA2A 3FZSA 4AT3A 3RK7A 4BZDA 5JKGA 4EHGA 3FKOA 4D2RA 4EQCA 3P7BA 3ORXA 5G1XA 4IB3A 5AUTA 2WMRA 5KMOA 5LVMA 2GNHA 2UZNA 4L45A 2BPMA 3L9MA 5KZIA 4TYEA 4M13A 3LMGA 3KXMA 4I94A 2HY0A 2VRXA 2RGPA 3T8OA 4FEVA 4DBNA 1XR1A 4HCTA 3MH0A 2EUFB 2OZAB 2JIUA 4FSZA 4G2FA 5HE0A 3AC2A 4CFFA 2G2HA 4XG9A 3ZBXA 1OKWA 5F1ZA 3ORKA 4P5QA 4AZWA 4XUFA 3HUBA 4Y72A 3ERKA 5JQ5A 2XUUA 2OU7A 5IQHA 2R3PA 5DYJA 3G51A 2FH9A 3DQWA 3MBLA 4ASEA 4ZS0A 5C4KA 2C0OA 2CLXA 2J0MB 4QTBA 1WBWA 4BBFA 4CV8A 5LVOA 2BAKA 4FIFA 4RJ3A 2BROA 5AA9A 2UZWE 4OTRA 3GU5A 3K54A 4IVCA 5IEYA 5ANDA 2PUPA 5BMMA 2YM8A 3IW6A 4FSMA 3DKFA 4JBVA 4B9DA 1UKIA 1K2PA 3NCGA 1FMOE 4GVJA 1ZXEA 2RFEA 3G0EA 4KRDA 4H1MA 1JNKA 1ZYCA 2VX1A 1H00A 3L8SA 4KA3A 5BVNA 2IW6A 5DWRA 4AFEA 2BZJA 3U6JA 4U0IA 3ZXTA 3M1SA 4Y73A 4ZSGA 1J7IA 5E9EA 3FI3A 2VWBA 4FKRA 4WSQA 3RAWA 3UVRA 1UU8A 3K3JA 4TNBA 5FEEA 2ITYA 3KKVA 4CFXA 1IEPA 1H24A 3OWLA 4NIFB 3ZRMA 4EOOA 2QOCA 4WKQA 3EN7A 4IIRA 4DA5A 2IJMA 3G0FA 1PXPA 1H1QA 4BCIA 4GT4A 4OBOA 4Z3VA 3DAKA 4RFZA 1A48A 3EFLA 3F61A 2J0LA 3IDBA 4RQKA 4WNPA 1PXJA 4YC3A 5H3QA 2ESMA 3TKHA 1R78A 2HXLA 3ZSGA 3ZH8A 3PY1A 1KV2A 3KF7A 2GS2A 3VS2A 3F5GA 2FUMA 4LYNA 2IW8A 2A27A 3OHTA 2OIDA 4AA5A 4FV5A 2NRYA 1FQ1B 3Q9XA 2YFXA 4V01A 5J79A 3VS7A 5HEZA 3OS3A 2P55A 5DOSA 4N6ZA 3ULIA 2ETKA 3ALNA 4FNZA 4AS0A 1YWNA 3EH9A 3H30A 4JIKA 3QGWA 5FP5A 2W4OA 5HCYA 3K2LA 4I21A 3QTUA 5E1SA 4JDKA 4DC2A 1FPUA 3C4XA 4BI0A 4L44A 5E1EA 3QX2A 2QKWB 3EYHA 2VO0A 3FZPA 4NCTC 1YRPA 3FYJX 3VRYA 3OMVA 5D11A 3GVUA 4ASDA 3ID6C 1Q8ZA 3VQUA 4GV1A 3HA8A 2W96B 4BC6A 4GJ3A 2EVAA 4KBCA 4X6RA 3NYXA 2XBAA 4LOPA 4UB7A 4XRJA 2FVDA 3UZPA 1PRYA 3FMJA 3BI6A 4FKLA 3MH1A 3LXLA 3VBXA 5EQPA 4DH3A 4U7ZA 2BRNA 5AUWA 3Q9YA 3TV7A 1Z57A 4KD1A 4C57A 5TO8A 2RF9A 4FVRA 4KRCA 5AUUA 3HP5A 2C5OA 2XRUA 4WA9A 2PUIA 1WFCA 2QO9A 1YXVA 4XEYA 4ZTMA 1MQ4A 3IG7A 5EOBA 3ODYX 4IADA 2XIXA 2G2FA 3LVPA 2YWPA 2J0KA 5ANJA 3C4CA 4PV0A 2HK5A 2R3QA 4U44A 5HE2A 4IB1A 4BZNA 5K9IA 4PL5A 5M06A 3ZMMA 4FVPA 2VWXA 4Y5QA 2WMQA 2VTNA 4PMPA 2ZV2A 1LEWA 5HESA 3PIXA 1H25A 2BILB 1ZZ2A 1RJBA 2YACA 2R3IA 2J0IA 3BYOA 3AD5A 2C6DA 1XBCA 4IEBA 3ZRLA 2O64A 3B2WA 3R9OA 1Z9XA 2BTSA 2GNIA 2ZJWA 3CR0A 3P0MA 4QP1A 3RPVA 4V04A 5FXRA 3MPTA 4EWQA 4HZSA 1YWVA 3E92A 5AR4A 3SW4A 4F7NA 3UO5A 1ATPE 5J1WA 5CT7A 5AP6A 3DFAA 3MWUA 4XV9A 4EYJA 4RZWA 4JBPA 4AW2A 3NVMB 4F4PA 4FZDB 3NWWA 4JBOA 1Q41A 2IG7A 4G5PA 5AP2A 2CCIA 3KL8A 3P7CA 3UMWA 2UZVA 4AN2A 1S9IA 4JDIA 4D9UA 4UN0C 1KE9A 5K4IA 3CCNA 4UMQA 3W2SA 4BCNA 1FGIA 3L8VA 4QMSA 5IF1A 4QP8A 3VUGA 4BHNA 4MBLA 3PVWA 4NEUA 4X21A 3MB6A 3U9NA 4AX8A 1XWSA 4DEAA 5H8EA 1ZY5A 1S9JA 5HHWA 4Y83A 2P2HA 4EOKA 2DYLA 4S2ZA 3DBCA 3GB2A 4G1WA 3OUNB 3DTWA 3EL8A 4DEBA 2ITNA 1VR2A 4B6LA 3HECA 4RX7A 3UGCA 3L8PA 3ZS5A 2WMVA 3V5JA 3UYSA 5CLPA 4D2VA 2YJRA 5EG3A 3FQEA 1Q8YA 1M14A 1UNGA 3PUPA 2V7OA 3HV3A 4HYSA 1NXKA 3OUKA 1OECA 2V5QA 1OL6A 4MK0A 2C5VA 4FG7A 4OTGA 4DAWA 4GVAA 3UC3A 3GQIA 3GC9A 5E8SA 4D5HA 2A4LA 4YJRA 4Q9ZA 1U5QA 1XBBA 3MIYA 2Z2WA 2XB7A 5IDNA 4BCQA 4B0GA 3VAPA 4ITHA 4PP7A 3FMMA 5BVFA 5C8KA 4QMTA 2IPXA 2UUEA 3V5QA 2IZRA 3DTCA 4BWPA 2C3IB 3MFTA 5AP0A 4G3FA 3I7CA 5L6WL 2XNMA 4NWMA 5AR7A 4GYIA 4S30A 3W2OA 4CTCA 2E9NA 2CN8A 3QZHA 1GAGA 2WIHA 1PW2A 1SMHA 2F2CB 3I5NA 1OPKA 3W2QA 3OC1A 4W9XA 2X8DA 3CXWA 3FEGA 2XNNA 4YJPA 3EHAA 2PMNX 3ORMA 4EBWA 2PZPA 5HI2A 4PDSA 4C4EA 4RIXB 1B39A 2J2IB 2R3JA 3LFQA 4MF1A 5AIRA 2I7QA 2XK4A 3E8CA 5K3YA 4K8AA 2Q83A 1ZLTA 3O17A 3Q2MA 4YZBA 3UNZA 1ZYDA 1ZYLA 3HMNA 5EHYA 3MH2A 4QP4A 5IDPA 3CS9A 1XH4A 3FMHA 2PUUA 5J1VA 4JIAA 3VW8A 4Q5HA 5E8YA 3D7TB 5LMKC 4XBRA 3OF0A 4Y85A 5GHVA 3FMEA 3F3TA 3ORPA 4FEWA 2QU5A 5EQEA 5IQEA 3TWJA 4U41A 4GT5A 5KE0A 4IVDA 2CDZA 2WEVA 3HGKA 3MSSA 3NNXA 4BI2A 4LOOA 4UWCA 5A4CA 3HAMA 1U5RA 4I1ZA 4EOLA 5HG7A 4I6QA 3HV5A 4Z9LA 2BDFA 1VYWA 4AW5A 2QR7A 4FOBA 4ITIA 3AD6A 3BRBA 4E7WA 3CQWA 1W83A 4AW1A 3QZGA 3COIA 4EOIA 3R7GA 4Q5EA 3MY5A 1BUHA 4DGMA 2IZSA 4O7WA 4XV2A 3E88A 3LW0A 2W9FB 4BDBA 4AOTA 2W05A 3BEAA 4U79A 4GUEA 3JY9A 3FY0A 4WRGA 5FXSA 3TTJA 5L4QA 3DXPA 2CN5A 2JDVA 1PJKA 3QTXA 4DGGA 3DFCB 3TNIA 5C4LA 4JS8A 3V5PA 4FI1A 5BQ0A 2GHLA 1OMWA 3D0EA 4UMTA 5HU3A 4WD5A 2HYYA 3TZ9A 3P4KA 4P90A 4RC2A 2WFYA 2YCSA 4LM5A 4AE6A 2A2AA 5J5SA 3ULZA 3AD4A 5DRDA 2JITA 4JR7A 1OVEA 1URWA 4YLJA 3MFRA 4RX5A 4A9RA 3ROYA 2GPHA 3WZKA 4QPAA 5CENA 3OFMA 1BYGA 4IHPA 3GGFA 4OTDA 5IQCA 2ZB0A 4AGUA 5AM7A 3SRVA 2QQ7A 4NH1A 4ITJA 2G01A 4GK2A 4WHZA 4DFBA 5I9ZA 3CQEA 2W1CA 4JRNA 2Y9QA 1IG1A 4H3BA 3BBTB 3GBZA 2PWLA 2F7EE 3KK8A 1DI9A 3ACKA 4KIKA 4M0YA 3QD3A 1L8TA 2OJ9A 3QKMA 4ZZOA 4UY9A 4CLIA 4FTNA 2F57A 4PDPA 4R1VA 3C51A 4ONAA 2QO7A 3PJ1A 1HCLA 4YZCA 2RFSA 1PY5A 4RSSA 2PU8A 4BKYA 4S33A 4AGDA 5HQ0A 1YXSA 2J4ZA 2YITA 3QTWA 2X4FA 4JRVA 4N4SA 4WIHA 2CCHA 5EM8A 4U97A 3JYAA 2YJSA 3FMNA 4RQVA 1GZOA 4G6LA 3SDJA 5IMXA 4BR3A 3TN8A 1YVJA 2JKKA 3DDPA 1BLXA 3ACJA 3OWKA 3RPOA 2ITOA 3OEZA 4IQ6A 3R6XA 3S2PA 4GK3A 4AAAA 2VO3A 3EQGA 3M11A 5DR6A 4OTWA 4KABA 3MY0A 5DI1A 4B7TA 3RAKA 5C26A 1WZYA 4I6BA 4ID7A 4RFYA 2WOUA 1YHWA 3AT2A 3ZSIA 2UZBA 4C3FA 5HG9A 3ZM4A 4YSJA 3JS2A 5T68A 4UBAA 3SQQA 3HDNA 4CFWA 4IWDA 3BLQA 1IR3A 3ZO4A 5C1QB 3HV7A 2R7IA 2V0DA 4LRMA 4XP2A 1YW2A 2YN8A 3P9JA 3VUIA 4A07A 1M17A 1SYKA 4YHJA 4A9SA 2PVNA 3D9VA 3OWJA 4FIEA 5CU6A 4XG6A 4O82A 4O86A 1XHAA 2OZAA 4IAYA 4PTGA 2F7ZE 3BV3A 5CQWA 4C2WA 4AGWA 3N4TA 2J50A 2OGVA 2XH5A 4DH7A 1JSTA 3R1QA 4MHAA 4PDOA 2B7AA 3AGLA 4DF3A 3P5KA 3I7BA 4L52A 2E9VA 4JOAA 3C50A 3R1SA 2E9OA 2QOQA 4MXXA 4ZXTA 2X7GA 2XRWA 2XZSA 2YIYA 3A8WA 2J5FA 4NW5A 5ACKA 5AJQA 1O6KA 1JLUE 3F3VA 1PMVA 3SA0A 1PXMA 3NUSA 4R8QA 2YDKA 4W4WA 3U6HA 4KIKB 3R7IA 4ZJIA 4C4JA 4EJNA 1RQQA 5LMKA 4FNXA 5L8KA 3AC5A 5LVLA 1UU7A 1Y6BA 4TL0A 4CV9A 4BTMA 2QOOA 4TYIA 4CSVA 3KB7A 2XA4A 4EH9A 3FKNA 4O0UA 3WILA 5KO1A 5HO8A 4F1MA 4C34A 5EYDA 4TWPA 4RZVA 4W4VA 5HVYA 3CD8A 3VVHA 3MS9A 1DM2A 3ZUTA 4CD0A 2NP8A 1U4DA 5TR6A 4CMOA 4RBLA 3WF9A 5EQYA 4O2PA 3EJ1A 4CTBA 4L67A 3QTZA 5D10A 3ZFYA 5J9LA 4PP9A 4EWHA 4QMWA 4N57A 4O27B 5DHJA 3MYGA 4F09A 4C8BA 2YLEA 3D83A 2WHBA 3HVCA 4MNFA 5HBHA 5DT0A 4F0GA 5IEVA 2I0VA 4L68A 5HZNA 3N4UA 1FOTA 3QZFA 5EOLA 2ITPA 5AR3A 2JD5A 3U9CA 2F49A 3DJ5A 3QCXA 4FL2A 3HMOA 3JXWA 2C30A 4JAIA 2QG7A 2F4JA 4C2VA 4FT7A 2JBPA 3SXRA 3AG9A 2ZM3A 3HYHA 4MTAA 1YHVA 1M52A 1YDSE 4O0YA 4AU8A 3AMYA 4EKKA 3D2KA 5BMSA 3OT3A 2VWIA 2B55A 2OO8X 3NUPA 2OH4A 4TPTA 1UNLA 3DZOA 4ZMEA 5E8ZA 5A3XA 4MXOA 3PXZA 5EI2A 4WBOA 4F08A 4IM2A 3I81A 4MVFA 3RJCA 3A2CA 4QMPA 3ETAA 3F5PA 3NYVA 2XNGA 3FC1X 3Q5ZA 3KCKA 4FSTA 4RFMA 2FYSA 2VTOA 4RIXA 5LARA 5HORA 1BX6A 5BPYA 3UPZA 2R3MA 4X2FA 3R7UA 3RCDA 4YR8A 5HD7A 1OIUA 4G3GA 4D1XA 2GHMA 3E3PA 5AFVA 5ANEA 4LUEA 4EK5A 4EEVA 5CTPA 3RM7A 4FIIA 3ZUUA 4WOVA 3PPKA 2C5NA 3PY0A 3RPSA 2GQGA 4B99A 5D12A 5BUIA 3FI4A 1R3CA 4UXLA 4I41A 2X0GA 3FHIA 2PTKA 3HLLA 2PSQA 3EWHA 3ZXZA 2B9FA 4ZY4A 2C6KA 3DLSA 4XG3A 3KN5A 4I6FA 5L2QA 1SVGA 3UE4A 3VF8A 4OTPA 4EH8A 5IA2A 5BVDA 2UV2A 3DV3A 2VO6A 3LCTA 3QRTA 3ZEPA 3IGGA 2E2BA 4BDEA 4BY9E 4MD9E 2DUVA 4PL4A 4C33A 3CQUA 4XOYA 4QMYA 3ZEWA 3UDBA 4FV6A 4PWNA 4EBVA 1MP8A 3OTUA 3DQXA 4JAJA 3LFSA 3NUXA 4QPSA 2PVRA 3U55A 4U8ZA 3Q2JA 1CTPE 3SW7A 2XIKA 2CKOA 4LL0A 5KMNA 3KRRA 3QLGA 3FYKX 4NT4A 4YMJA 1ZOEA 5E90A 3GC8A 2R3OA 2PZIA 3E8DA 1B6CB 4D58A 2WMTA 2YAKA 2GQSA 3BQRA 4C62A 4FK3A 2G1TA 2X2LA 4FTJA 4YZNA 3R83A 1H4LA 2HELA 4TXCA 5AWMA 4H36A 4L53A 2YDJA 3K5UA 5EYKA 4Z7HA 2PMIA 5HLWA 2C5XA 2QOKA 2GNFA 4RC4A 3DK3A 4PNKA 1H1SA 2WIPA 3L9LA 3QQGA 3W33A 5BUJA 3BYUA 3F66A 5CAOA 3HRCA 2JKOA 4GEOA 4FV3A 2R0IA 3UYTA 2GU8A 4F1OA 2XVDA 3VC4A 1RW8A 4PUZA 5CAVA 4P7EA 1UKHA 3NCZA 4LL5A 5IUHA 2ZYBA 2QR8A 3E64A 3HV4A 5EDQA 3QCQA 4BZOA 5CZIA 4MBJA 5DVRA 5HO6A 5HTIA 4ZTQA 4E4LA 4FEUA 3CY2A 3C7QA 1ZRZA 3FMKA 4OTIA 3PFQA 3CP9A 1ZOHA 4ZEGA 3PVUA 4QP2A 1WVXA 3G9LX 2IZUA 3GNIB 3LJ0A 4H1JA 1QPDA 4TWNA 3C4WA 4M8TA 4Y95A 4BYIA 2XJ0A 3CD3A 2OSCA 2PZ5A 3ORZA 4QNYA 2J90A 2YZLA 4O21A 3DXQA 3F7ZA 3EOCA 1OKYA 3OBJA 4GRBA 3LE6A 3MVHA 4FZ6A 5DA3A 2Y6OA 3R2BA 3OZ6A 1WBTA 3Q9ZA 4DINA 4L46A 4IB0A 3LXPA 4TYJA 4M68A 3TL8A 3SVVA 4X0MA 5AV4A 3FLZA 2B52A 4X3JA 3FZRA 1BL6A 4YJUA 2Z8CA 4BDKA 2YAAA 4FTUA 1W7HA 4BICA 2CKEA 5DLSA 4X2GA 4DTKA 2VZ6A 4TZRA 3AC1A 5I3OA 3E8EA 4QTAA 2J9MA 5ANIA 4CYIA 2IVTA 2OK1A 4YC6A 5CSPA 3WF5A 4ENXA 3HMPA 3EQHA 3SOCA 5F4NA 5AA8A 5M08A 3ITZA 3FY2A 2RG6A 3RCJA 3GENA 2GNGA 4HGEA 2O0UA 4I0RA 5HNIX 4S32A 3D5XA 4C4IA 4UEUA 3VS1A 2PHKA 1Q3WA 5BVEA 4E4XA 4ZLOA 3C5IA 3FJQE 4K2RA 3KF4A 3QTRA 4R77A 3VS6A 3R02A 4H58A 4L7SA 5TT7A 1Y8GA 4FV1A 5CAUA 4J53A 3MVMA 2ACXA 4C0TA 1J7UA 4O7TA 1B38A 5FG8A 3PWDA 1Y6AA 1Q4LA 4E5AX 4J8NA 4D9TA 4JNWA 4ZP5A 3R22A 4CCUA 3AGMA 4IE9A 2ZV7A 5E8UA 5DMZA 1JKTA 4BKJA 2ZV8A 4QD6A 4NK9A 2OH0E 4QPMA 3NNVA 2G15A 4G3CA 5EFQA 4AOJA 3PE2A 4RX9A 1RE8A 2O3PA 3QUPA 4XMOA 4KB8A 5FWKK 4W4YA 3Q04A 5CVFA 2ITXA 2SRCA 4LRKA 3FMLA 2WTWA 3IW8A 4TKSA 4WRSA 4AOIA 4BDAA 4DH5A 1WVYA 2RFDA 5CF4A 3F82A 4U3YA 3QQUA 4PNIA 4W8DA 1OI9A 4PY1A 4ALWA 4EH3A 3BWFA 3KA0A 4EHEA 4IZYA 5D1JA 4HVSA 2HAKA 4RJ7A 4U81A 5B0XA 3TIZA 2W5HA 2HWOA 5LMBA 5AMNA 3SXSA 4CGAA 4JLCA 4O7LA 2C5YA 2VX3A 4S31A 3VBYA 1W0XC 1H07A 4FYNA 5KMIA 3GOKA 4AACA 4ANBA 4JR3A 3OCGA 3OVVA 1OIYA 3ZCLA 4TTHB 4CXAA 3GC0A 3K5VA 1M7QA 2E9UA 2R9SA 2WTVA 3B8QA 3P78A 4FV7A 5E91A 2JEDA 3ZDUA 3ZO2A 5BUEA 3ZDIA 3QA0A 1QPCA 3BLHA 5HVKA 4M0ZA 4USDA 3VS0A 4ZZNA 2CNVA 3KVXA 4DE4A 2VWWA 5JQ8A 4FTRA 3NVKI 4G6OA 4U40A 4IMYA 3IGOA 3HRBA 4ZTNA 1J1BA 3CBLA 4GKIA 5J9ZA 1WVWA 4AUAA 3PXQA 2XKEA 3L9NA 1PYEA 4OTHA 2VAGA 3A99A 4QO9A 1TQPA 2R0UA 4AN3A 3ANRA 5M4CA 1P5EA 1Q3DA 4O83A 5KHWA 4O91A 4OTQA 4EYMA 5B2MA 1H1PA 3CTHA 5EW9A 1QCFA 4F0IA 4JG6A 4A9UA 3FLWA 4XOZA 3SRVB 2AC3A 4Z16A 4JQ8A 2BCJA 5IQDA 3ZC5A 3QYZA 2WMSA 4QT1A 2QI8A 3FPMA 4EOJA 3PG1A 3FZ1A 2BZIB 1SZMA 2BRBA 4RWLA 5LWMA 3O7LB 3R9DA 5KZ0A 2R3GA 2Z7RA 4EH6A 5T6KA 3MGYA 2OF4A 4YTCA 5H2UA 3U54A 5DIAA 4DGNA 4D2WA 3DKGA 4FR4A 2GS6A 3KEXA 4IFGA 3O8PA 4FE2A 4C3RA 3W10A 4FZ7A 1NA7A 2BFYA 4S34A 3WF6A 4ANSA 4CRLA 1NVQA 4JX3A 1IA8A 3KULA 3GU6A 3II5A 4IWPA 3V3VA 5IA0A 3D4QA 3ZFXA 3DNDA 3TI1A 4EOSA 5AIKA 1PF8A 4E1ZA 3IOKA 5CVHA 2BIYA 4EJ7A 3UQFA 1OPLA 2YDIA 3RVGA 2R2PA 4F7JA 2FO0A 3BEGA 2W99B 4X6QC 4XG4A 5FP6A 1SNXA 2Y7JA 3L8XA 4WNMA 2J0JA 3DOGA 4M69A 5KX8A 4LI5A 3DS6A 4HVHA 4HGSA 1OKZA 3PYYA 3KXNA 2QU6A 3Q9WA 3G33A 4RVTA 1OM1A 3PWYA 5IH6A 4U5JA 2QNJA 3LMHA 3QL8A 4X3FB 3R1YA 4BN1A 4PDYA 3A8XA 4F7SA 4U6RA 4JQEA 4B4LA 4FV0A 4O22A 3D2IA 4YNOA 4WO5A 4ZOGA 3RINA 1GIHA 3KN6A 2W9ZB 3EN6A 3HL7A 4BWKA 3IDPA 3PSDA 5KKRB 5KBRA 3ZONA 3G2FA 3GEQA 4LMUA 4MYGA 4AF3A 4JVGA 5LCJA 3UC4A 3TJCA 2X1NA 3R7YA 2C6IA 5EM5A 3TZ7A 4ZIMA 3WE8A 4IANA 4MQ2A 4DFLA 4RMZA 5DRBA 5DE2A 4BCHA 4N70A 3PSCA 4CT1A 1PXOA 1UU3A 3IS5A 4H3PA 3QTIA 3OY1A 4K9YA 4KIPA 4D4SA 5A9UA 1JWHA 4RIYB 4D0XA 3F88A 4NSTA 2Z60A 2X81A 5A4TA 2X4ZA 3M2WA 3QFVA 1OKVA 2QONA 3EZVA 1VEBA 5CU3A 5CX9A 3VUTA 3S1HA 2FA2A 2FSTX 3UOHA 2B1PA 3WIGA 3W8LA 4PPCA 2XKFA 3NUUA 2WKMA 3OOGA 4I93A 4QMNA 5M53A 4E73A 4ZSJA 1L3RE 5FD2A 2PVYA 2QD9A 2YM5A 2VX0A 4FKIA 1K9AA 1JKSA 3E93A 4KIQA 3ATTA 3FLYA 4C4HA 4ENYA 5M51A 2ITWA 5TF9A 5AR2A 3MI9A 5HTCA 3OCTA 2Z7LA 2VWYA 4AG8A 3IQ7A 3ZHPC 2PVLA 4D2PA 3A7IA 4RWJA 5A54A 4KKEA 3UG2A 3I4BA 4XCUA 1NY3A 1X8BA 5G6VA 2ZDUA 5L8JA 1H26A 3NUAA 4QMVA 3E8NA 3NEWA 4I4FA 3DZQA 3QWKA 2JDRA 4I0TA 5F20A 3FC2A 4EH7A 4M12A 2YM3A 4G31A 4K6ZA 4YNEA 2ETRA 3LFBA 2CMWA 3REPA 2VTAA 1CMKE 3TIYA 3Q5IA 3RK5A 4O1OA 4AZSA 1RDQE 3ZLSA 4R5SA 3KY2A 1EH4A 4BGHA 4XS2A 5LMAA 3PRFA 4YBJA 3MDYA 4E8AA 1Q61A 1H27A 3FE3A 2VWVA 4A06A 4RIYA 1U46A 1JVPP 3FLQA 4F9WA 3KK9A 3W55A 5I9WA 2XEZA 4AQCA 3UMXA 4DEGA 1FVTA 3SOAA 4A9YA 4MXAA 2DQ7X 2XBJA 4GU6A 4I24A 4MXCA 3CC6A 4WT6A 5BVKA 3RTPA 1OBDA 5FGKA 3PDTA 4WNOA 1WAKA 2HW7A 3KRXA 4QOXA 4LUDA 3W18A 1E1XA 1KE7A 3NW7A 4GK4A 3QXOA 3R8PA 3RAIA 2LGCA 4O7NA 5JFSA 4BDJA 2JFMA 4ERWA 4ARKA 3OCBA 5KMLA 3EQCA 1LPUA 2PYWA 4WSYA 5AV2A 3PVGA 4IW0A 3PXKA 5CF5A 2OFVA 4WUAA 2OIQA 5ANKA 5ITAA 3Q6UA 3ZM9A 4HNFA 3H9OA 2XM9A 2OWBA 4FF8A 3TNWA 4MXZA 3MTFA 2BDWA 3AMAA 2X9FA 5EKNA 4V0GB 2XCKA 3IDCA 1UU9A 4RVMA 4DGOA 4O2ZA 2GMXA 3MVJA 5IQFA 4KBKA 3DJ7A 3LOKA 5AV3A 4E26A 5JK3A 4MD7E 4HPUE 2BR1A 1Q62A 1M2PA 4FGRA 4FMQA 4A4LA 2CNUA 4O96A 3IW5A 3PP1A 4ANNA 3QRIA 4FKUA 4KNBA 3RM6A 2BKKA 3JVSA 4DLJA 2C3KA 1CKIA 3FWQA 1IRKA 4RGJA 5E8XA 4QMUA 1MRUA 3LFNA 1O6YA 3BGPA 3GC7A 4WUNA 4PX6A 4QP9A 4D5KA 1REKA 3FL5A 2IWIA 5DR9A 3V8WA 2OXYA 2WQMA 5CT0A 3HDMA 4IAZA 4WBBB 2ETMA 2J51A 1CKJA 4NFMA 3VNTA 3ZLXA 5LOHA 3PIYA 5AR5A 4IX4A 4F64A 3GCVA 4C61A 5KBQA 3GCUA 3I5ZA 3MTLA 1E1VA 2XNEA 3DCVA 5I5ZA 4HCUA 2PULA 3MJ2A 3DBEA 4FGBA 2ERZE 2VTMA 2CSNA 2OJFE 4USEA 5M44A 3KXHA 3V5LA 2XKDA 5IH4A 2QODA 1SVHA 2Q0NA 3QU0A 3CTJA 3BE2A 5KMJA 2ITQA 5HTBA 3LZBA 2XNOA 2OI4X 3SKCA 4WG4A 2QVSE 4GW8A 3QC9A 3DB6A 5EI6A 1PMEA 2XP2A 4IM3A 4K18A 3RALA 4RLLA 1ND4A 5DGZA 5LQFA 4E4MA 1J91A 5AAFA 3KFAA 3OXZA 3CJFA 5A6OA 3MJ1A 3MW1A 4F65A 4QMZA 3ROCA 5IQIA 3B2TA 3DKOA 2AYPA 3THBA 3VS3A 4KS7A 4BDDA 4MCVA 2ITUA 5HNBA 5L6OA 1JKLA 2ITVA 4WG3A 4NIFA 4W9WA 4ZJVA 4YZDA 3LFCA 5CQUA 2YCRA 3RZBA 3U87A 5CU4A 1WBVA 4PTCA 3NMUF 4ACMA 2JC6A 2IVUA 2X8IA 2GFCA 4IH8A 4OAUC 1MUOA 3P79A 4JDHA 2XK7A 4F6WA 2YIRA 3EFJA 4MBIA 4QMOA 2CGXA 2C6LA 3QCYA 4ZSLA 2C6MA 1Q97A 4BL1A 5I0BA 3Q96A 3BHVA 3C5UA 5I9VA 2OKRA 2REIA 1XH5A 4DFYA 4RT7A 3TTIA 3V04A 2PY3A 2B4SB 2QOLA 5CF8A 1BMKA 2FB8A 2WXVA 5AV1A 4DEDA 2VTRA 3RWQA 3S95A 5HU9A 5J9YA 1LEZA 1GNGA 3LAUA 4BGQA 4NM3A 4UV0A 2XNBA 3D7ZA 4HVIA 1OIQA 4ZAUA 2WTKC 1G8AA 4I92A 2ZVAA 2Y4PA 4DFNA 3AQVA 5B7VA 3MH3A 1P4FA 1WBOA 4BCFA 4EH5A 5HIEA 4YGAA 1YDTE 3ELJA 3PRIA 2YEXA 3QD0A 3WF7A 4OT5A 4AA0A 4BBMA 4J7BA 5CY3A 1P4OA 5DG5A 3VRZA 3HMIA 2XF0A 3WZEA 5I9XA 5EW8A 4I20A 2W1EA 5TE0A 3QLFA 4H3QA 5D41A 4EKLA 4RJ8A 3QD4A 3Q4ZA 3ZRKA 3FLNC 3R7OA 5JGAA 4NJDA 2RKUA 2WTCA 1ZARA 1JPAA 2A0CX 2WNTA 3GU7A 3LJ1A 3OY3A 5CSVA 3Q32A 3CGOA 4R3RA 3L9PA 4QYFA 4BKZA 4YJOA 4EUTA 1K3AA 3BYMA 3K3IA 3VN9A 4YO4A 5LXMA 3TKIA 4D0WA 2BAQA 3KRJA 3LCDA 2B0QA 2W1FA 3BHUA 3QZIA 4ZTHA 3S3IA 1ZOGA 3R8ZA 2F9GA 3EFKA 4IXPA 4CCBA 3LXKA 3FKLA 3KMUA 5CWZA 5IQBA 3EQBA 2Y4IB 4IJ9A 4F7LA 4RWIA 3S00A 5HVJA 4LV8A 5ICPA 2W7XA 2ITZA 2ZOQA 5AV0A 3OD6X 5A6NA 3BQCA 3AC4A 4IWQA 4Q9SA 3SHEA 1TQMA 2BRGA 4G6NA 3CY3A 3QUDA 4Y46A 4O7VA 4TYGA 1H0WA 5FBNC 1GJOA 2G9XA 3R1NA 4M69B 5H8BA 5JFXA 5FDXA 1XH7A 3U51A 4EQUA 2IW9A 4F99A 4DCAA 1NVRA 3FDNA 1XH9A 2IN6A 4FC0A 3G15A 4D1SA 2UW8A 4O7SA 4MKCA 3F2AA 2CHLA 2W1DA 3LQ5A 3BPRA 3NAYA 4OLIA 1PHKA 4DFXE 4ERKA 4F6UA 2UZLA 2OZOA 3FLSA 3NYNA 3RKBA 2VTSA 3QTQA 2JFLA 1TQIA 3NW6A 3C0IA 3QQLA 4XG2A 5ANGA 1CKPA 3LFFA 4ZLZA 5JT2A 5GIPE 1YI6A 2BIKB 2EXMA 3GP0A 4BCOA 3C9WA 4YP8A 4YHFA 5CEOA 4ZSAA 4AFJA 4C58A 3HP2A 2JAMA 1Q24A 4E6QA 2W0JA 3IPHA 4FSWA 1ZMUA 4LOQA 5M4FA 2CKQA 2RFNA 3QX4A 4DFUA 1M2QA 4J98A 4X2KA 3DAEA 3TACA 4Z55A 3RZFA 4RA4A 3ORTA 3V51A 3UP7A 3VJNA 4DGLC 4O81A 3VWAA 3RI1A 2UW7A 3GU8A 4DEEA 2WQEA 2UVYA 2NO3A 5EH0A 2H6DA 5BNJA 3MPAA 3G90X 4DHFA 3DT1A 4FSUA 2HW6A 1DAWA 3A7FA 2B9IA 2UW6A 4E6DA 3DPKA 1UWJA 3TNQB 2FSLX 3F9NA 5E8TA 1LP4A 3PP0A 4N6YA 1YKRA 2HZIA 3G6GA 4XJ0A 1J7LA 3UOJA 4FODA 3ANQA 3R04A 4F6SA 4NFNA 1NVSA 3MPMA 2Z7QA 4II5A 2WMXA 4EK3A 3HA6A 4RG0A 4U42A 1CDKA 4YBKA 4DEHA 1R0EA 2QKRA 4B8MA 2UZTA 1ZZLA 3QC4A 4FT9A 5DT4A 4GKHA 4IZAA 3ZYAA 5JRSA 5A4EA 4IVBA 2QURA 1ZWSA 1AGWA 3U4UA 2JIIA 1YOJA 2F7XE 3BELA 4OW8A 3ZSHA 2QHNA 4ZTRA 4D2SA 3BU6A 4ZTSA 3RMFA 5EKOA 3GCPA 5HX6A 4CT2A 5BVWA 5EW3A 5CS6A 2VTQA 3U8WA 5B2KA 3QA8A 3KXGA 3LCKA 4J99A 4AXAA 1OB3A 3E7VA 4QP7A 4QTDA 3FL4A 3R8MA 4F9BA 4HVDA 4EOQA 5IA5A 3BWJA 3GCQA 3FBVA 3TUCA 4RIOA 4IAAA 3EB0A 4NM5A 1H8FA 1KOAA 4XP3A 3W2PA 5K4JA 1V0OA 5J5TA 3LCSA 4EZ7A 4FKSA 3DXNA 2VGPA 4TYHB 3BX5A 4FV8A 1W84A 4FEQA 3BYVA 2UW3A 4L6QA 1ZY4A 3TV6A 4TNDA 4ANOA 2IVSA 4QQCA 4NL0A 3CLYA 2R5TA 4K1BA 1V0PA 4NYEA 3DK6A 1SM2A 3FI8A 4CKRA 2UW5A 3CEKA 2HENA 4YJTA 3O51A 5EM6A 4BCPA 5BYLA 4USFA 3G5DA 1Z5MA 5EYCA 2B54A 4FL3A 3UP2A 2BHEA 2V7AA 4CRSA 3UODA 3T9TA 3WYXA 4MF0A 4DLIA 2ERKA 3BBWA 4FUXA 4RX8A 3KGAA 5HIDA 3F5XA 3RHXA 3A7GA 4GYGA 3U6IA 5CEIA 2QO2A 1MRYA 5J95A 4DN5A 4NM0A 3EQFA 3G6HA 3R63A 5IUGA 2BZKB 2QOBA 1FVVA 2ITTA 2P2IA 3EQPA 3PA3A 4AZEA 4FV4A 3BHTA 4PRJA 4YSMA 1NT2A 4CZYB 4K0YA 3QF9A 4I0SA 2WD1A 1V0BA 4KAOA 3FHRA 4BYJA 2J6MA 2UZEA 5M09A 4UYNA 4BDFA 2YM7A 4MD8E 3TDVA 4FSRA 1GZNA 3R9NA 4FTQA 1PMUA 4G5JA 5IMEA 1PYXA 3I0OA 1R39A 2PZYA 4M66A 2IZTA 3AXWA 4A7CA 5LWNA 5J7HA 1WBPA 2WMBA 4I4EA 2X39A 1JAMA 3OTVA 4K77A 1YQJA 5E92A 5IQGA 3LPBA 2R3KA 2HZNA 2C6EA 4L3LA 4QNAA 2PVJA 4ACCA 1PXKA 3QD2B 1PXIA 3EQDA 3P23A 3OOMA 3QQHA 5HE3A 3PPZA 3RNIA 4BHZA 5FBOA 2ZMCA 2OF2A 2YHVA 1A9UA 3MB7A 3VF9A 3F69A 1ERKA 3R9HA 3R8VA 1GOLA 3TT0A 3F6XA 5HBJA 1A06A 3CKWA 1JBPE 3GCSA 3UIMA 2X7FA 4CLJA 1H08A 2C68A 4GIHA 3GFEA 3MVLA 1OBGA 5CANA 4KUJA 2YA9A 4P4CA 5KKRC 2QOFA 4DBXA 4LGDA 3QGYA 4HGLA 3Q4CA 3W1FA 5T3QA 4XG7A 3A7HA 1YOLA 3PJ8A 1Y8YA 4FKGA 4GMYA 4L00A 4XLVA 3C13A 4YPDA 4E6AA 2CGUA 2KULA 2YIQA 5FEQA 3RK9A 3SC1A 4R78A 4O0VA 5GNKA 3ZO3A 3WE4A 5CSWA 2XIZA 1E9HA 2QOHA 5FUTA 5EI8A 5JFWA 4HYUA 1YI3A 4FKWA 3KQ7A 3PJCA 2B9JA 2EB2A 1ZMVA 2XMYA 1Q5KA 2W1HA 3C4ZA 3BU3A 4YZMA 4MAOA 4R3CA 4ASZA 3BV2A 1OL2A 1WCCA 3KU2A 4XBUA 4R7HA 3VW6A 3HMMA 1W82A 3LFDA 1FINA 4L3PA 4RVLA 5CAPA 3N51A 3KXXA 2AUHA 5LJJA 4YLKA 4MX9A 1YXTA 3ZTXA 1GZKA 3PY3A 4YTHA 2F2UA 4C7TA 4M15A 4MH7A 2BFXA 3PG3A 2VWZA 2HZ4A 3FMDA 4EI4A 4ZK5A 1KUTA 3TDWA 1KOBA 3C4EA 4C3PA 5JH6A 2ONLA 3ZZWA 3HX4A 4HNIA 1PKGA 2ZDTA 2VGOA 3QAME 3IOPA 3TXOA 3V6RA 3WIKA 3JPVA 3H9FA 2YERA 5KNJA 2YLFA 4E5BA 2XYUA 4CMUA 2HZ0A 2QLUA 2EXCX 4LRJA 4I5HA 4BDGA 4DFZE 3SG9A 4ALUA 5HD4A 5E4HA 3OBGA 4D4YA 4XLIA 4K33A 4LV5A 2YCQA 4IC7A 5DH3A 5IKWA 2UZDA 1XH6A 3OXTA 4IX3A 3RP9A 3DGKA 3PJ3A 2EWAA 5IH5A 1Y91A 3BIZA 4NU1A 5ANOA 3I6UA 4I22A 1DS5A 4RJ5A 5HCXA 5HG8A 3DA6A 5D7AA 4E4NA 4QQ5A 4RC3A 5FRIA 4BDIA 2UW0A 3KRLA 3RPYA 3PZHA 4PTEA 1Q8WA 2GHGA 4YPSA 2C4GA 1XO2B 5BX0A 1W98A 3LIJA 2GTMA 3O7LD 3Q4UA 1F0QA 4I5MA 4LQMA 2GTNA 3V6SA 1PMNA 2C0IA 2PVKA 5JSMA 2EXEA 3QQJA 1JQHA 2O2UA 5AX3A 4QMMA 2JDSA 3LM0A 4NTSA 3UVPA 3O50A 5DEYA 4FEXA 1WBSA 4FTTA 4NJ3A 2R3RA 4QTCA 3UTOA 5I9YA 3VUDA 4FKJA 1YI4A 3R28A 4FTAA 4C4GA 2BHHA 4ANQA 4DH1A 2UW9A 4ZTLA 4QYGA 3WF8A 3C4FA 3HNGA 4FSQA 3R71A 1WBNA 4RPVA 2EU9A 2VD5A 3F7WA 2GDOA 4PMMA 3FAAA 3MFSA 2VN9A 5EYMA 3COHA 4FA2A 5IQAA 2WGJA 2PVHA 4JI9A 2W5BA 3RGFA 2CKPA 3TCPA 4BCGA 3CTQA 2WO6A 3FV8A 4FKTA 4FKOA 2WQBA 4JXFA 5ETFA 3T3VA 4FKQA 1YXUA 4QRCA 1GZ8A 3PE1A 1YWRA 1KE5A 4CZUA 4M84A 3TUBA 4ZJJA 3S4QA 5AP3A 2XJ2A 4UZDA 3E5AA 4ZZMA 3NGAA 5IUIA 5CEQA 4ALVA 4BDCA 2PL0A 3FSKA 3NUNA 4FG9A 2VWUA 2XK8A 4JG8A 5AX9A 2R3FA 4J97A 4DTBA 3O23A 5FTGA 3NX8A 5CI7A 3C0GA 4DEIA 2O5KA 4PPBA 5FXQA 5L2SA 4DT9A 2NPQA 5BYZA 2W06A 3QQKA 3QUEA 5A4QA 4PMTA 4R6VA 4XH6A 2WPAA 1UWHA 3U4WA 2BTRA 3ET7A 4IDVA 4MWIA 4UZHA 4GCJA 4D4RA 1IASA 3H0ZA 3H3CA 4CQEA 2VUWA 2RIOA 1KV1A 4UMUA 4EC9A 3ORNA 4HOKA 4C36A 3CPBA 3NRMA 4XV1A 4I3ZA 3UNJA 4DG0E 3TKUA 4G9CA 2ZMDA 1PXNA 3O2MA 4FTIA 4D28A 1Q8TA 4FNYA 3LQ3A 2B53A 3D14A 4IWOA 2NNWB 3MESA 3BYSA 3FQSA 3VS5A 1Q8UA 3H10A 3KXZA 1JKKA 3O8UA 3KC3A 5AUZA 5KMMA 2BRHA 3D15A 3TZ8A 2CGVA 2W4JA 2XM8A 3AT4A 3POOA 4IX5A 4TT7A 4PMSA 2GQRA 3R9RA 2HXQA 2OW3A 3W2CA 2GS7A 3ZLWA 3UOKA 2BKZA 4GFOA 4HVGA 5C8MA 4FNWA 4BRXA 2YIXA 3I0QA 3QHWA 4BVUA 4H39A 3Q60A 1STCE 3HRFA 3QBNA 2C0TA 5E8WA 4HYIA 5L2WA 5F94A 5JMSA 2EB3A 3DDQA 3F2RA 4NTTA 2JGZA 1AD5A 1FBNA 2I0EA 3ODZX 3EIDA 4TWOA 5CNNA 1AQ1A 2OXXA 1XH8A 4EQMA 4AP7A 5IPJA 3DY7A 4BFMA 4OBQA 4AN9A 3E7OA 3NW5A 5CSXA 3SLSA 4BCMA 4QQTA 4O0WA 3WZJA 2ONLC 1T46A 5F9EA 1KE6A 5M07A 3UO4A 4CMTA 3IKAA 4J1RA 4QYEA 2UZUE 4ZY6A 4ACDA 5IISA 3TEIA 4CZTA 3LXNA 5AP7A 3RPRA 5FDPA 4BIEA 4F70A 4YUQA 4JJRA 2HCKA 3BLRA 3I1AA 2R3HA 3R7EA 5L6PA 4BI1A 5AUYA 2V22A 1WMKA 3NLBA 4FV2A 5JGBA 3UJGA 4A9TA 5H9BA 1G8SA 4QTEA 4FZFB 5GZ8A 3TM0A 4I6HA 2C1AA 2XS0A
chains in the Genus database with same CATH superfamily
2W4KA 4J8MA 4LMNA 2OJJA 4U80A 1GIIA 4UMRA 3I60A 5CEMA 4GIIA 3LQ8A 4HCVA 4YJNA 3NUYA 1URCA 4W4XA 3UG1A 3CSVA 3E63A 3VUHA 4O7YA 3EMGA 2W1GA 3DBQA 3EN9A 4U3ZA 1OL1A 3PIZA 5HKMA 3Q52A 2JDOA 3QKLA 3QCSA 3DB8A 2JKQA 3NR9A 3P08A 5C9CA 4LGHA 4EK4A 1J3HA 5KHXA 2WAJA 3OT8A 3VIDA 4R7IA 3VONA 3LLTA 3W32A 3EN4A 2RG5A 3OCSA 3RBWA 5KUPA 2O63A 3A61A 4WNKA 2X2KA 4X2NA 2LAVA 1W8CA 3DU8A 3JR1A 4U45A 1UNHA 4YTFA 3Q6WA 2G2IA 4FOCA 3ORLA 4AA4A 2H9VA 2PE0A 4EH2A 3LLAA 4FTOA 4Y8DA 2PZRA 2XKCA 5TKDA 2WQNA 2QOIA 5DNRA 1VZOA 3FPQA 2XYNA 2HIWA 4KKGA 5EM7A 1VLRA 1SVEA 2PMLX 2A19B 4BGGA 2OXDA 4FYOA 4O4EA 3IO7A 4GL9A 3OW4A 5F95A 3ZO1A 5CXZA 1ST0A 3POZA 5KMKA 5M4UA 4L42A 3RWPA 2W17A 2OLCA 3TNPC 4AE9A 1GIJA 2C3LA 1KE8A 4MEDA 4L01A 4QMLA 5M56A 3ATSA 2YABA 3FUPA 2ZB1A 5CI6A 5FTQA 5J8IA 3ZLYA 5KCVA 2W5AA 2QG5A 3I6WA 4FG8A 4PPAA 4D4VA 1QL6A 5CU0A 4GFGA 3GUBA 1LUFA 5DPVA 5CALA 4EOPA 4EK8A 4AT4A 3CIKA 3UPXA 1BI7A 1BKXA 2DS1A 3AC3A 3F3ZA 3GQLA 3PPJA 4JBQA 2XIYA 4GU9A 3W0PA 3PXRA 1PKDA 4CKJA 3WZUA 4C4FA 4RRVA 2R3NA 2XK6A 3UOLA 2J5EA 2P3GX 2V55A 4O1PA 5D9HA 3ZBFA 4IJPA 5CAQA 3EZRA 3TZMA 2Z02A 2DWBA 4KINA 1Q99A 4NKAA 2JLDA 2C6OA 5EK7A 2IVVA 4EC8A 4UYAA 3VUKA 5I4NA 2WTJA 2ZAZA 4AQKA 4EL9A 1P14A 3HAVA 4LFIA 3SGCA 2R4BA 2WTDA 3P1AA 4C35A 3PXYA 2OFUA 3QRKA 4NZWB 3DBFA 2YM4A 3A4PA 4YTIA 3COKA 4M3QA 2VO7A 3MN3A 4G3EA 2QC6A 4MNEB 2FGIA 1NW1A 2PK9A 2X9EA 3FZOA 3H4JA 4ANMA 5J7BA 4M7IA 3LMIA 4RJ4A 4E5WA 5HE1A 1IA9A 3ALOA 4KSPA 4O6LA 3QXPA 1BL7A 2B9HA 3NPCA 5ETIA 3VUMA 2BRMA 2NRUA 4J95A 4IBMA 4UWBA 1H1RA 4O7ZA 3D5VA 3GI3A 3TJDA 4I5PA 1KWPA 3P86A 4L43A 4CYJA 5IU2A 5LCKA 5HIBA 2X8EA 4F1TA 2YCFA 3KMWA 5JZNA 1J1CA 3DJ6A 4CG9A 1W2FA 2P4IA 3A7JA 4YHTA 5EHOA 3R00A 2OBJA 2PE2A 3C1XA 3ENMA 4NKSA 4F0FA 4EORA 2C69A 2I40A 4HPTE 3EKNA 5HLPA 4JX7A 3VULA 2HY81 5JZJA 2P0CA 3AKJA 4NW6A 3VBQA 5M4IA 3PA4A 5AP1A 3GFWA 2RL5A 2VNWA 2Z7SA 5HX8A 5HO7A 4XV3A 2ZV9A 2X6EA 3KMMA 4KSQA 3UBDA 3GU4A 4CEGA 1OPJA 5J87A 3E87A 2UZOA 3D7TA 2H8HA 3E62A 1G3NA 2AC5A 3NAXA 3O71A 3EQIA 4P2KA 5DT3A 4ACGA 5K5XA 4C59A 1TKIA 1ZYSA 3TUDA 3UZRA 5FM3A 3SAYA 1H0VA 3NNUA 3W16A 3MA6A 3ZUVA 4IM0A 4PL3A 4OGRA 4CKIA 3FSFA 3MIAA 5GINE 1CSNA 3NS9A 3VO3A 3OWPA 2PUNA 3OROA 4ZS4A 4RIWB 4BTKA 1OUYA 2YIWA 3ZOSA 3D5UA 5IZFA 2C6TA 2WOTA 4E3CA 3ZZEA 4CQGA 3NDMA 3PTGA 3HUCA 3T3UA 4E6CA 4CFMA 5BVOA 2VTLA 3PLAE 2HOGA 1U59A 3UQGA 5A46A 3TG1A 5AP4A 2HWPA 3VBVA 4AZVA 4FZAB 4YURA 5JGDA 4O0TA 4KWPA 5AADA 1F5QA 1LR4A 4HYHA 3BHHA 4YLLA 5ETCA 4MWHA 4EZ3A 3W0MA 4XX9A 1O6LA 3A60A 4FKVA 2E9PA 5FQDC 4U9AA 4PF4A 3UNKA 4DYMA 4IC8A 4QQJA 2R3LA 4EH4A 4RVKA 1KSWA 2XEYA 2PE1A 3CJGA 4FSYA 3QRUA 2X2MA 3DBDA 4WG5A 5AUXA 5JN2A 4DTAA 2XCHA 1QPJA 3DK7A 4TWCA 3CE3A 1V1KA 4X7QA 3V01A 3AT3A 3VBTA 4O0SA 3QYWA 4UMPA 4DT8A 5ETAA 4AWIA 2XANA 3M42A 2I0HA 3MA3A 3QQFA 2X6DA 1CM8A 1HOWA 4CNHA 3SG8A 4LDTA 2VU3A 3HV6A 5A4LA 5C8NA 2I1MA 4X3FA 3WARA 3LFAA 4N0SA 3LJ2A 3W8QA 2WEIA 4FBXA 1U54B 1MQBA 2PMOX 4GJ2A 4AW0A 2OIBA 5HG5A 3S0OA 5L3AA 4ZY5A 1YDRE 3PJ2A 5AR8A 4UWYA 3F2NA 3IW7A 4I23A 3BU5A 4AT5A 1XKKA 3W0RA 3OXIA 2GNLA 4FL1A 3OW3A 3O0GA 1DAYA 5C03A 5JFVA 3SV0A 3A62A 3O96A 3CKXA 2WMAA 3GT8A 4ACHA 1OUKA 1VJYA 2WMUA 4JL9A 3EN5A 2FSOX 4U43A 2ZM4A 3F3UA 3V8SA 3FQHA 5AEPA 4J71A 3QALE 5BYYA 2O8YA 4J52A 3FXWA 3BKBA 5M55A 4X2JA 4IAFA 4J96A 4DITA 2VTIA 4QYYA 5JRQA 2BZHB 3QKKA 3DNEA 4D1ZA 4LGGA 4QYHA 2IO6A 5GJFA 4RIWA 2VTPA 4NM7A 5E8VA 2UVZA 2CGWA 4D55A 1O9UA 4E93A 5E7RA 3PZEA 5AAGA 4XRLA 4E20A 1XBAA 4RWKA 4C02A 3R2YA 2QCSA 4RLKA 3JVRA 4FT0A 1P2AA 4G34A 4KIOA 4MXYA 4XYFA 1GY3A 3OEFX 4OTFA 3RAHA 5A14A 4JDJA 3QTSA 3R7VA 4FTCA 1OZ1A 4ZLYA 2XJ1A 2BAJA 1BI8A 3I79A 3BGQA 4QP6A 4L8MA 4ZSEA 4EUUA 5HICA 2PVFA 2WU6A 5CASA 2UVXA 3IECA 1H01A 4GSBA 1YOMA 3OP5A 3CGFA 4DCEA 3IK3A 1M2RA 5IA1A 3DLZA 3FZTA 3ZU7A 5GZAA 1MRVA 1OIRA 4OBPA 4UX9A 3COMA 4EK6A 4IZ7A 3O8TA 4K11A 1OGUA 5FM2A 3LCOA 5D7VA 3EL7A 5M57A 4IFCA 2CPKE 3H9RA 4CFNA 2YISA 1JOWB 3HKOA 4I5CA 3V5WA 5L2TA 2CJMA 1U54A 3BZ3A 3W0SA 4FICA 4RA5A 4GG7A 5DBXA 5LVPA 5CNOA 4CVAA 4AXFA 1ZYJA 2QHMA 5HNGA 3QWJA 4GT3A 3P7AA 4B8LA 3AOXA 5GIOE 4FT5A 2GSFA 3SX9A 1XQZA 1JSUA 4MQ1A 4R1YA 3NNWA 4HJOA 2WB8A 3D94A 1R1WA 2ZM1A 3Q4TA 3FI2A 5IA4A 1IAJA 4GFMA 3V8TA 1HCKA 3C0HA 2YM6A 3KVWA 4TYHA 4BTFA 1Y57A 5C01A 4JT3A 2C47A 4QMQA 5DN3A 4GS6A 3DKCA 5K0XA 1OL7A 2WMWA 2GFSA 4EHZA 2YWVA 2BUJA 3NIZA 4Z7GA 3BGZA 4C37A 3LKMA 3NYOA 5DR2A 3SD0A 3UVQA 4P5ZA 3T9IA 2I0YA 2J7TA 2XK9A 1ZMWA 2BVAA 3QRJA 4EONA 3MY1A 4W8EA 3BCEA 3F5UA 1M7NA 4GUBA 5DFPA 4F9CA 5CSHA 1G5SA 2QLQA 2VTJA 4IVAA 2OICA 4IAKA 1APME 4L3JA 2JBOA 5CVGA 5FLFA 3ZC6A 4APCA 2H96A 3KULB 3PXFA 3ENHA 4DHZA 5HCZA 2O65A 1UVRA 2BDJA 4L9IA 3BHYA 2I6LA 3ZFMA 3WI6A 5AAEA 4ZMFA 3G9NA 4R3PA 4FVQA 4TY1A 1OITA 4FT3A 4KBAA 4DH8A 4UXQA 1YHSA 3R73A 4BIDA 4OUCA 4QP3A 1TVOA 3TV4A 2H34A 4TN6A 1I44A 3UIXA 3LM5A 3N9XA 4FTMA 1OGYA 2CLQA 2Y0AA 5K5NA 4AZFA 4FIHA 4YC8A 4RJ6A 5B2LA 4O0XA 5EDPA 4YZ9A 3R01A 4GH2A 2WTIA 3JUHA 3AC8A 3VHKA 4EOMA 2PPQA 4YJSA 4FIJA 2Y8OA 3PLSA 1R0PA 2VTTA 2WELA 4FV9A 4X3FC 4BCJA 4YJQA 3NZ0A 5LVNA 4KKHA 1H28A 4IX6A 5CYIA 5EHLA 5L2IA 5GJDA 3AMBA 5CZHA 3WOWA 4FX3A 3PA5A 3FXZA 4XG8A 5H8GA 3BE9A 3IONA 5GZ9A 3UIBA 4H05A 4FJVA 3EQRA 2C3JA 3MFUA 4BIBA 4R7BA 2OG8A 5I3RA 4XP0A 2A1AB 1SNUA 4JQ7A 1F3MC 3VQHA 4AGCA 1VYZA 4BTJA 5ACBC 2V62A 3R30A 3VBWA 3EFWA 3EKKA 4M97A 3QHRA 4EZ5A 4OAVB 4ASXA 3UO6A 2RSVA 3WZDA 5DEWA 4ORKA 5HLNA 4QDEA 5CXHA 2XK3A 5AM6A 3R21A 3VS4A 5JEBA 3CPCA 4D2TA 3IW4A 3MV5A 3W2RA 4CG8A 4OR5A 4EHVA 1YXXA 4YO6A 2JIVA 2BMCA 2YZAA 4BF2A 4F9YA 3NIEA 3UDTA 3PVBA 4HZRA 3WBLA 3W0QA 2JKMA 3KCFA 4DG3E 3UZTA 3B8RA 5C27A 4G3DA 1ZAOA 3RNYA 3NSZA 4IB5A 4DDIA 4V0GA 1IAHA 4QMXA 3TNHA 4GG5A 3H0YA 4A4XA 2JDTA 3WYYA 4PQNA 1I09A 4KS8A 5HOAA 4M67A 5GJGA 2GNJA 4DHJA 3UIUA 4Y5HA 1UV5A 5HGIA 4FTLA 5FTOA 3ORIA 4L7FA 2W1IA 4YU2A 4M14A 5L8LA 3L1SA 4A4OA 2C1BA 3BL7A 3BLAA 4JG7A 4BCKA 2VNYA 1DI8A 1PXLA 3D5WA 5I9UA 4FIGA 4C38A 4O6EA 4NUSA 3GXLA 3OG7A 3UQCA 5IEXA 1FVRA 4FK6A 2VV9A 4XNEA 2WU7A 1OL5A 4G16A 2WZJA 3FXXA 4NCTA 4BBEA 4O7RA 4TW9A 4BWXA 2WTKB 4I6LA 4OT6A 2GCDA 4FKPA 3KREA 5AUVA 5IG1A 4IACA 5TOZA 3SXFA 5CF6A 1FGKA 1XJDA 5IA3A 1REJA 5CEPA 3R0TA 3VHEA 4O84A 3R8UA 4BB4A 4BDHA 4QDVA 4FUYA 2PVMA 3EYGA 4R5YA 4CFVA 2XIRA 4LG4A 3E3BX 4TRLA 4V05A 4F63A 2KTYA 3PSBA 1QMZA 2OJIA 4FTKA 5CU2A 3V5TA 2XNPA 3HZTA 3KRWA 2JAVA 2CNQA 2R7BA 2Q0BA 1G8JA 4IAIA 2FSMX 4XHKB 2VTHA 5EDRA 2X7OA 4CFUA 4HW7A 2BALA 4F9AA 4YJVA 5CEKA 2P33A 3N4VA 3HEGA 1JSVA 2W1ZA 4AZTA 3R8LA 1QPEA 4MNEA 4G17A 4APPA 5HBEA 5FEDA 2Y4IC 4IZ5A 2R64A 4HGTA 4O0RA 4F78A 2WQOA 4Q2AA 1H1WA 2UW4A 5AP5A 4IDTA 3Q53A 3VJOA 3RHKA 4UALA 3A4OX 1T45A 2OJGA 2Y6MA 3JY0A 3GOPA 3LFEA 4ANLA 4O38A 1FMKA 3LHJA 3DAJA 3F3WA 4FSNA 4G9RA 5K0KA 4DG2E 3Q3BA 1UA2A 3FZSA 4AT3A 3RK7A 4BZDA 5JKGA 4EHGA 3FKOA 4D2RA 4EQCA 3P7BA 3ORXA 5G1XA 4IB3A 5AUTA 2WMRA 5KMOA 5LVMA 2GNHA 2UZNA 4L45A 2BPMA 3L9MA 5KZIA 4TYEA 4M13A 3LMGA 3KXMA 4I94A 2HY0A 2VRXA 2RGPA 3T8OA 4FEVA 4DBNA 1XR1A 4HCTA 3MH0A 2EUFB 2OZAB 2JIUA 4FSZA 4G2FA 5HE0A 3AC2A 2IF8A 4CFFA 2G2HA 4XG9A 3ZBXA 1OKWA 5F1ZA 3ORKA 4P5QA 4AZWA 4XUFA 3HUBA 4Y72A 3ERKA 5JQ5A 2XUUA 2OU7A 5IQHA 2R3PA 5DYJA 3G51A 2FH9A 3DQWA 3MBLA 4ASEA 4ZS0A 5C4KA 2C0OA 2CLXA 2J0MB 4QTBA 1WBWA 4BBFA 4CV8A 5LVOA 2BAKA 4FIFA 4RJ3A 2BROA 5AA9A 2UZWE 4OTRA 3GU5A 3K54A 4IVCA 5IEYA 5ANDA 2PUPA 5BMMA 2YM8A 3IW6A 4FSMA 3DKFA 4JBVA 4B9DA 1UKIA 1K2PA 3NCGA 1FMOE 4GVJA 1ZXEA 2RFEA 3G0EA 4KRDA 4H1MA 1JNKA 1ZYCA 2VX1A 1H00A 3L8SA 4KA3A 5BVNA 2IW6A 5DWRA 4AFEA 2BZJA 3U6JA 4U0IA 3ZXTA 3M1SA 4Y73A 4ZSGA 1J7IA 5E9EA 3FI3A 2VWBA 4FKRA 4WSQA 3RAWA 3UVRA 1UU8A 3K3JA 4TNBA 5FEEA 2ITYA 3KKVA 4CFXA 1IEPA 1H24A 3OWLA 4NIFB 3ZRMA 4EOOA 2QOCA 4WKQA 3EN7A 4IIRA 4DA5A 2IJMA 3G0FA 1PXPA 1H1QA 4BCIA 4GT4A 4OBOA 4Z3VA 1G8KA 3DAKA 4RFZA 1A48A 3EFLA 3F61A 2J0LA 3IDBA 4RQKA 4WNPA 1PXJA 4YC3A 5H3QA 2ESMA 3TKHA 1R78A 2HXLA 3ZSGA 3ZH8A 3PY1A 1KV2A 3KF7A 2GS2A 3VS2A 3F5GA 2FUMA 4LYNA 2IW8A 2A27A 3OHTA 2OIDA 4AA5A 4FV5A 2NRYA 3BL9A 1FQ1B 3Q9XA 2YFXA 4V01A 5J79A 3VS7A 5HEZA 3OS3A 2P55A 5DOSA 4N6ZA 3ULIA 2ETKA 3ALNA 4FNZA 4AS0A 1YWNA 3EH9A 3H30A 4JIKA 3QGWA 5FP5A 2W4OA 5HCYA 3K2LA 4I21A 3QTUA 2XARA 5E1SA 4JDKA 4DC2A 1FPUA 3C4XA 4BI0A 4L44A 5E1EA 3QX2A 2QKWB 3EYHA 2VO0A 3FZPA 4NCTC 1YRPA 3FYJX 3VRYA 3OMVA 5D11A 3GVUA 4ASDA 3ID6C 1Q8ZA 3VQUA 4GV1A 3HA8A 2W96B 4BC6A 4GJ3A 2EVAA 4KBCA 4X6RA 3NYXA 2XBAA 4LOPA 4UB7A 4XRJA 2FVDA 3UZPA 1PRYA 3FMJA 3BI6A 4FKLA 3MH1A 3LXLA 3VBXA 5EQPA 4DH3A 4U7ZA 2BRNA 5AUWA 3Q9YA 3TV7A 1Z57A 4KD1A 4C57A 5TO8A 2RF9A 4FVRA 4KRCA 5AUUA 3HP5A 2C5OA 2XRUA 4WA9A 2PUIA 1WFCA 2QO9A 1YXVA 4XEYA 4ZTMA 1MQ4A 3IG7A 5EOBA 3ODYX 4IADA 2XIXA 2G2FA 3LVPA 2YWPA 2J0KA 5ANJA 3C4CA 2ZFYA 4PV0A 2HK5A 2R3QA 4U44A 5HE2A 4IB1A 4BZNA 5K9IA 4PL5A 5M06A 3ZMMA 4FVPA 2VWXA 4Y5QA 2WMQA 2VTNA 4PMPA 2ZV2A 1LEWA 5HESA 3PIXA 1H25A 2BILB 1ZZ2A 1RJBA 2YACA 2R3IA 2J0IA 3BYOA 3AD5A 2C6DA 1XBCA 4IEBA 3ZRLA 2O64A 3B2WA 3R9OA 1Z9XA 2BTSA 2GNIA 2ZJWA 3CR0A 3P0MA 4QP1A 3RPVA 4V04A 5FXRA 3MPTA 4EWQA 4HZSA 1YWVA 3E92A 5AR4A 3SW4A 4F7NA 3UO5A 1ATPE 5J1WA 5CT7A 5AP6A 3DFAA 3MWUA 4XV9A 4EYJA 4RZWA 4JBPA 4AW2A 3NVMB 4F4PA 4FZDB 3NWWA 4JBOA 1Q41A 2IG7A 4G5PA 5AP2A 2CCIA 3KL8A 3P7CA 3UMWA 2UZVA 4AN2A 1S9IA 4JDIA 4D9UA 4UN0C 1KE9A 5K4IA 3CCNA 4UMQA 3W2SA 4BCNA 1FGIA 3L8VA 4QMSA 5IF1A 4QP8A 3VUGA 4BHNA 4MBLA 3PVWA 4NEUA 4X21A 3MB6A 3U9NA 4AX8A 1XWSA 4DEAA 5H8EA 1ZY5A 1S9JA 5HHWA 4AAYA 4Y83A 2P2HA 4EOKA 2DYLA 4S2ZA 3DBCA 3GB2A 4G1WA 3OUNB 3DTWA 3EL8A 4DEBA 2ITNA 1VR2A 4B6LA 3HECA 4RX7A 3UGCA 3L8PA 3ZS5A 2WMVA 3V5JA 3UYSA 1XMMA 5CLPA 4D2VA 2YJRA 5EG3A 3FQEA 1Q8YA 1M14A 1UNGA 3PUPA 2V7OA 3HV3A 4HYSA 1NXKA 3OUKA 1OECA 2V5QA 1OL6A 4MK0A 2C5VA 4FG7A 4OTGA 4DAWA 4GVAA 3UC3A 3GQIA 3GC9A 5E8SA 4D5HA 2A4LA 4YJRA 4Q9ZA 1U5QA 1XBBA 3MIYA 2Z2WA 2XB7A 5IDNA 4BCQA 4B0GA 3VAPA 4ITHA 4PP7A 3FMMA 5BVFA 5C8KA 4QMTA 2IPXA 2UUEA 3V5QA 2IZRA 3DTCA 4BWPA 2C3IB 3MFTA 5AP0A 4G3FA 3I7CA 5L6WL 2XNMA 4NWMA 5AR7A 4GYIA 4S30A 3W2OA 4CTCA 2E9NA 2CN8A 3QZHA 1GAGA 2WIHA 1PW2A 1SMHA 2F2CB 3I5NA 1OPKA 3W2QA 3OC1A 4W9XA 3UDSA 2X8DA 3CXWA 3FEGA 2XNNA 4YJPA 3EHAA 2PMNX 3ORMA 4EBWA 2PZPA 5HI2A 4PDSA 4C4EA 4RIXB 1B39A 2J2IB 2R3JA 3LFQA 4MF1A 5AIRA 2I7QA 2XK4A 3E8CA 5K3YA 4K8AA 2Q83A 1ZLTA 3O17A 3Q2MA 4YZBA 3UNZA 1ZYDA 1ZYLA 3HMNA 5EHYA 3MH2A 4QP4A 5IDPA 3CS9A 1XH4A 3FMHA 2PUUA 5J1VA 4JIAA 3VW8A 4Q5HA 5E8YA 3D7TB 5LMKC 4XBRA 3OF0A 4Y85A 5GHVA 3FMEA 3F3TA 3ORPA 4FEWA 2QU5A 5EQEA 5IQEA 3TWJA 4U41A 4GT5A 5KE0A 4IVDA 2CDZA 2WEVA 3HGKA 3MSSA 3NNXA 4BI2A 4LOOA 4UWCA 5A4CA 3HAMA 1U5RA 4I1ZA 4EOLA 5HG7A 4I6QA 3HV5A 4Z9LA 2BDFA 1VYWA 4AW5A 2QR7A 4FOBA 4ITIA 3AD6A 3BRBA 4E7WA 3CQWA 1W83A 4AW1A 3QZGA 3COIA 4EOIA 3R7GA 4Q5EA 3MY5A 1BUHA 4DGMA 2IZSA 4O7WA 4XV2A 3E88A 3LW0A 2W9FB 4BDBA 4AOTA 2W05A 3BEAA 4U79A 4GUEA 3JY9A 3FY0A 4WRGA 5FXSA 3TTJA 5L4QA 3DXPA 2CN5A 2JDVA 1PJKA 3QTXA 4DGGA 3DFCB 3TNIA 5C4LA 4JS8A 3V5PA 4FI1A 5BQ0A 2GHLA 1OMWA 3D0EA 4UMTA 5HU3A 4WD5A 2HYYA 3TZ9A 3P4KA 4P90A 4RC2A 3TMOA 2WFYA 2YCSA 4LM5A 4AE6A 2A2AA 5J5SA 3ULZA 3AD4A 5DRDA 2JITA 4JR7A 1OVEA 1URWA 4YLJA 4DDGA 3MFRA 4RX5A 4A9RA 3ROYA 2GPHA 3WZKA 4QPAA 5CENA 3OFMA 1BYGA 4IHPA 3GGFA 4OTDA 5IQCA 2ZB0A 4AGUA 5AM7A 3SRVA 2QQ7A 4NH1A 4ITJA 2G01A 4GK2A 4WHZA 4DFBA 5I9ZA 3CQEA 2W1CA 4JRNA 2Y9QA 1IG1A 4H3BA 3BBTB 3GBZA 2PWLA 2F7EE 3KK8A 1DI9A 3ACKA 4KIKA 4M0YA 3QD3A 1L8TA 2OJ9A 3AKLA 3QKMA 4ZZOA 4UY9A 4CLIA 4FTNA 2F57A 4PDPA 4R1VA 3C51A 4ONAA 2QO7A 3PJ1A 1HCLA 4YZCA 2RFSA 1PY5A 4RSSA 2PU8A 4BKYA 4S33A 4AGDA 5HQ0A 1YXSA 2J4ZA 2YITA 3QTWA 2X4FA 4JRVA 4N4SA 4WIHA 2CCHA 5EM8A 4U97A 3JYAA 2YJSA 3FMNA 4RQVA 1GZOA 4G6LA 3SDJA 5IMXA 4BR3A 3TN8A 1YVJA 2AQXA 2JKKA 1BLXA 3ACJA 3DDPA 3OWKA 2ITOA 3OEZA 4IQ6A 3R6XA 3RPOA 3S2PA 4GK3A 4AAAA 2VO3A 3EQGA 3M11A 5DR6A 4OTWA 4KABA 3MY0A 5DI1A 4B7TA 3RAKA 5C26A 1WZYA 4I6BA 4ID7A 4RFYA 2WOUA 1YHWA 3AT2A 3ZSIA 2UZBA 4C3FA 5HG9A 3ZM4A 4YSJA 3JS2A 5T68A 4UBAA 3SQQA 4AXCA 3HDNA 4CFWA 4IWDA 3BLQA 1IR3A 3ZO4A 5C1QB 3HV7A 2R7IA 2V0DA 4LRMA 4XP2A 1YW2A 2YN8A 3P9JA 3VUIA 4A07A 1M17A 1SYKA 4YHJA 4A9SA 2PVNA 3D9VA 3OWJA 4FIEA 5CU6A 4XG6A 4O82A 4O86A 1XHAA 2OZAA 4IAYA 4PTGA 2F7ZE 3BV3A 5CQWA 4C2WA 4AGWA 3N4TA 2J50A 2OGVA 2XH5A 4DH7A 1JSTA 3R1QA 4MHAA 4PDOA 2B7AA 3AGLA 4DF3A 3P5KA 3I7BA 4L52A 2E9VA 4JOAA 3C50A 3R1SA 2E9OA 2QOQA 4MXXA 4ZXTA 2X7GA 2XRWA 2XZSA 2YIYA 3A8WA 2J5FA 4NW5A 5ACKA 5AJQA 1O6KA 1JLUE 3F3VA 1PMVA 3SA0A 1PXMA 3NUSA 4R8QA 2YDKA 4W4WA 3U6HA 4KIKB 3R7IA 4ZJIA 4C4JA 4EJNA 1RQQA 1W2DA 5LMKA 4FNXA 5L8KA 3AC5A 4FRFA 5LVLA 1UU7A 1Y6BA 4TL0A 4CV9A 4BTMA 2QOOA 4TYIA 4CSVA 3KB7A 2XA4A 4EH9A 3FKNA 4O0UA 3WILA 5KO1A 5HO8A 4F1MA 4C34A 5EYDA 4TWPA 4RZVA 4W4VA 5HVYA 3CD8A 3VVHA 3MS9A 1DM2A 3ZUTA 4CD0A 2NP8A 1U4DA 5TR6A 4CMOA 4RBLA 3WF9A 5EQYA 4O2PA 3EJ1A 4CTBA 4L67A 3QTZA 5D10A 3ZFYA 5J9LA 4PP9A 4EWHA 4QMWA 4N57A 4O27B 5DHJA 3MYGA 4F09A 4C8BA 2YLEA 3D83A 2WHBA 3HVCA 4MNFA 5HBHA 5DT0A 4F0GA 5IEVA 2I0VA 4L68A 5HZNA 3N4UA 1FOTA 3QZFA 5EOLA 2ITPA 5AR3A 2JD5A 3U9CA 2F49A 3DJ5A 3QCXA 4FL2A 3HMOA 3JXWA 2C30A 4JAIA 2QG7A 2F4JA 4C2VA 4FT7A 2JBPA 3SXRA 3AG9A 2ZM3A 3HYHA 4MTAA 1YHVA 1M52A 1YDSE 4O0YA 4AU8A 3AMYA 4EKKA 3D2KA 5BMSA 3OT3A 2VWIA 2B55A 2OO8X 3NUPA 2OH4A 4TPTA 1UNLA 3DZOA 4ZMEA 5E8ZA 5A3XA 4MXOA 3PXZA 5EI2A 4WBOA 4F08A 4IM2A 3I81A 4MVFA 3RJCA 3A2CA 4QMPA 3ETAA 3F5PA 3NYVA 2XNGA 3FC1X 3Q5ZA 3KCKA 4FSTA 4RFMA 2FYSA 2VTOA 4RIXA 5LARA 5HORA 1BX6A 5BPYA 3UPZA 2R3MA 4X2FA 3R7UA 3RCDA 4YR8A 5HD7A 1OIUA 4G3GA 4D1XA 2GHMA 3E3PA 5AFVA 5ANEA 4LUEA 4EK5A 4EEVA 5CTPA 3RM7A 4FIIA 3ZUUA 4WOVA 3PPKA 2C5NA 3PY0A 3RPSA 2GQGA 4B99A 5D12A 5BUIA 3FI4A 1R3CA 4UXLA 4I41A 2X0GA 3FHIA 2PTKA 3HLLA 2PSQA 3EWHA 3ZXZA 2B9FA 4ZY4A 2C6KA 3DLSA 4XG3A 3KN5