4U42A

Map4k4 t181e mutant bound to inhibitor compound 1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
295
structure length
282
Chain Sequence
SSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
publication title Structural Plasticity and Kinase Activation in a Cohort of MAP4K4 Structures
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 83
structure length 282
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u42A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u42A01
4HYSA 5C27A 5AFVA 4E93A 5EQYA 3NR9A 4GJ3A 4C35A 1QL6A 3B2WA 3F3VA 3IKAA 5I9VA 2PE0A 2O63A 2XCHA 3TUCA 1JKTA 4CEGA 4FEQA 2OFUA 2JBOA 1U54B 1T46A 3HYHA 2R2PA 3L9PA 5JFWA 3A61A 1F5QA 5M4UA 5BVFA 4FTTA 3R8ZA 3ZM4A 4XP2A 4YLLA 1SM2A 5FLFA 3EQGA 2XJ1A 1UU7A 4FKVA 4AA5A 5HTCA 2FSLX 2WQOA 4J98A 3BEAA 2IWIA 3I81A 4O86A 3W2CA 2B9JA 3L8SA 4UMPA 5DRBA 5BX0A 1Q8YA 3SQQA 4FV5A 3CR0A 4MBLA 4YC3A 5AP5A 4EOSA 3CTQA 4BZDA 2OK1A 1J91A 3VBTA 1PXOA 1A48A 4DTBA 3FL4A 4L6QA 1XH9A 3BYSA 2B7AA 3KVWA 3DDQA 4IFGA 5J5TA 3IECA 3C4ZA 2RIOA 4QP6A 5CSWA 4DA5A 4AGUA 4JL9A 5AJQA 1ZLTA 5CANA 4AW2A 3QX4A 4F64A 2JBPA 1OM1A 4PMPA 4NIFA 2BDWA 2JDVA 3O7LD 2BVAA 2R3QA 3EQDA 5ANJA 5D7AA 1SVGA 2WQEA 5T3QA 2QLUA 2JDRA 1H25A 4JBOA 5CEQA 4LV8A 5TT7A 4ALWA 1Z57A 4AZWA 4FT3A 3DCVA 4FKUA 4LGGA 4A4LA 2VTIA 2DWBA 3EHAA 3UP7A 3SKCA 1NT2A 5AV1A 4EH3A 4DG2E 5C26A 3FZSA 3C0HA 3LJ2A 4R7HA 3BX5A 4UMUA 2Q0BA 3ZLXA 3K5VA 5DLSA 5A3XA 5FTGA 3QFVA 5E1EA 2ZV2A 2J50A 1XH5A 5HIDA 3IDCA 5AP7A 3VUIA 3UO5A 4IJPA 5AV2A 3HA6A 1Q24A 3L9LA 4FGBA 3TM0A 3F5UA 1H07A 2RGPA 2IVSA 2YCQA 3QL8A 3COHA 3KQ7A 4IC8A 4EOOA 4YU2A 5IA1A 5D12A 4E6QA 4YO6A 4BI0A 5J1WA 2X8EA 3R8MA 1E1VA 3DQXA 5AP4A 3OUKA 3QZGA 1TKIA 4CMUA 1SZMA 4I5MA 4UX9A 2YIQA 2X81A 3AGLA 4G5JA 2YM6A 4JG8A 4CG9A 2YABA 3KMWA 3PLSA 4J8NA 1MP8A 5A9UA 3FMMA 4WBOA 4IZ7A 5D9HA 3RPRA 4BC6A 3AOXA 2E9VA 5HI2A 3MA3A 1J7UA 4HNIA 4J1RA 2E9PA 2PVHA 2J5FA 2X4FA 4WIHA 4MD9E 3L9MA 4Y5HA 2OFVA 3QQLA 2W7XA 4AZSA 1P4OA 4OTDA 5EOBA 4TWOA 4E6AA 5H9BA 2JIIA 2W99B 2W9FB 3UGCA 1IG1A 3QKKA 3N9XA 2HY81 2WIHA 3T3VA 5TF9A 5LWMA 3GI3A 3L8PA 1FVRA 3GENA 3LFEA 4HW7A 3KK8A 2OXDA 4FKPA 3FSKA 3EB0A 2C0TA 4Z3VA 3JUHA 4FG7A 4DT8A 1ZOEA 2VWXA 4DT9A 4O83A 4D9UA 5CX9A 4QQ5A 4H3QA 4IVCA 2Y0AA 4FKIA 3QD3A 1PMNA 2VTNA 2YM5A 3DTWA 4GUBA 1L8TA 3C5IA 4MQ2A 3T9IA 2XNPA 2YLEA 4S31A 4O82A 4K77A 3OW4A 5KMNA 5IA2A 2JKQA 4MX9A 1B6CB 2EB2A 2I0HA 2GQSA 4NSTA 3U9NA 5HLPA 1H4LA 3VBXA 2QU5A 1YXXA 5M57A 4DEGA 1VZOA 3ZUVA 4RC4A 5B2LA 5I9ZA 5BVDA 1YDSE 5KKRC 3U51A 3JVRA 4F7SA 4GJ2A 4GYGA 4XUFA 5JZNA 3VUMA 4YTFA 4RIWA 4EOMA 4YZ9A 2ZMDA 3KULA 3W16A 4OGRA 4UYAA 4KKHA 3FC2A 3SOAA 4G6NA 3P86A 3E3BX 5AMNA 5FQDC 1NY3A 4F09A 2VTQA 4M97A 5CXZA 4GKIA 4ZJIA 2OI4X 3RPYA 1REJA 4B7TA 5KMKA 4FSMA 3R63A 4PTGA 5IU2A 4IFCA 4P5ZA 5L6OA 1RJBA 1W8CA 4PMTA 5IQGA 2PMLX 2PULA 3AG9A 4V01A 3S4QA 4IWQA 5J7BA 1M2PA 1LEWA 2C6IA 3PWYA 2LAVA 4MXYA 3VQUA 4JT3A 3VS3A 5EH0A 4YLJA 2P2HA 4NW6A 4M15A 3RHXA 4KBKA 5IQCA 4E4LA 1JNKA 3EFLA 2FH9A 3S2PA 2ITNA 3M2WA 3QUDA 3I5NA 3CLYA 1B39A 2PY3A 3AC8A 4OTPA 5AAGA 2OBJA 3UO4A 2YAKA 3QBNA 3NNVA 3LAUA 3CXWA 3SA0A 5FTOA 5H2UA 4DEBA 1ZYJA 3WF8A 3ZC6A 2GHGA 3BHUA 2QR7A 4E26A 3R1NA 5HVJA 1YOLA 2ONLA 4ALVA 3MJ2A 2JITA 4BGQA 1LPUA 4EHGA 5ETIA 4TT7A 3HV7A 4YZDA 5FDPA 4IH8A 2RFNA 4ORKA 4U40A 4F1MA 4GFOA 4O7ZA 2IJMA 4IDVA 4PL4A 2PZPA 4EK6A 2ZJWA 2VV9A 3RGFA 4X2GA 2FA2A 3D94A 4BFMA 3LLTA 3UQFA 4RWLA 3BU3A 3OWKA 4BDKA 2CNVA 3CPCA 4JLCA 3GUBA 4IVAA 3KN6A 4YJNA 4F6SA 2Y4IC 1UKHA 1ZYCA 4CTBA 5EHOA 3OROA 4IWOA 3EN5A 1IEPA 3QKMA 1U59A 4E5BA 1UWJA 1DAYA 4QD6A 2ITUA 2GNJA 4S32A 4W4WA 2J0LA 4O2ZA 4PMSA 5HHWA 1O9UA 4C0TA 3DKOA 1BYGA 1QMZA 5FXQA 3U6IA 2X2LA 5I4NA 3PVGA 4WA9A 1H1QA 4R7BA 4RVTA 4M69B 4DCAA 5JRSA 5CEMA 1XBBA 3CIKA 3NYNA 2XEYA 3UOHA 1KOBA 1PXNA 4G9CA 4FSNA 3RPOA 4D2RA 3EQHA 2YCFA 3R28A 4AFEA 4RJ4A 3L8VA 3RAKA 1H8FA 1PW2A 5DEWA 4F70A 5HVKA 5EI6A 3ULZA 2W96B 4BKJA 4TNDA 4XMOA 3ENHA 4L45A 3ET7A 3MW1A 4QPMA 4A7CA 4OAVB 2HXQA 3VVHA 3P4KA 1ZOHA 4LOPA 5BVOA 4FEWA 4MNFA 2GNGA 2R3KA 5CU2A 5CYIA 2RG5A 5ANOA 5K0XA 3GU7A 2WIPA 3HEGA 3PXRA 4AE6A 4C37A 3LFAA 4CT1A 4XJ0A 1ZYDA 2F7XE 3CE3A 4YHFA 2OZOA 4Y8DA 2I6LA 2QODA 4DHFA 1HCKA 4ZSJA 4HVGA 5HE3A 2XB7A 3LQ3A 3R7OA 4IANA 4BBMA 2B55A 5ANEA 4LMUA 1CMKE 3WIGA 1ZZLA 2H9VA 1KE5A 2OSCA 2UW4A 3LQ8A 2HIWA 2ERZE 4B4LA 4MXCA 4X6RA 2C6TA 3C13A 3NIEA 4IHPA 3R83A 2CCIA 3JPVA 3MYGA 5K3YA 5IDNA 5KBQA 3QQGA 4LFIA 4BKZA 1VEBA 2YA9A 4D2TA 4DGOA 2X8IA 5A4EA 3IOKA 5C8NA 5M07A 2B9FA 3A2CA 5AV3A 4DEIA 2ITTA 4E5WA 3BPRA 3MVMA 4M13A 3TNQB 2Z02A 4JDHA 3UBDA 4AFJA 1VYZA 3R8VA 3VUTA 4DE4A 1P5EA 2UZEA 4AG8A 2OICA 3ALOA 1GOLA 5LXMA 3AT3A 2IZUA 4PWNA 5JKGA 1YOMA 4CRSA 3EQCA 2DYLA 2XCKA 3R01A 4AZVA 1RW8A 3EN9A 1S9IA 4G31A 2WTCA 3EH9A 2XKCA 3NAXA 4BIEA 3W55A 3FMJA 2DUVA 3QRTA 3WOWA 3FJQE 4ZTQA 4OTRA 2QOOA 2HZNA 2IZTA 3U6HA 2XNMA 2PVKA 3KRXA 4UXQA 3WZUA 4I21A 2JFLA 3G9LX 4BI2A 3ANRA 2VO6A 4JR7A 3RK5A 3BGPA 4LRKA 3HV4A 3ROCA 3QF9A 1M2QA 3TACA 1E9HA 5HE1A 2G01A 2BZIB 3Q4CA 2GS7A 2UZVA 2VRXA 1SVEA 3NUAA 2O0UA 1XJDA 4EUUA 4FMQA 5JN2A 3DZOA 2WGJA 5ETFA 5HOAA 3MH1A 3FDNA 5M09A 1ZYLA 4DFLA 3BELA 4GIIA 1NVRA 1Z5MA 5EM6A 5HKMA 3W32A 3RVGA 3DXNA 4MCVA 4MVFA 3I0OA 2PU8A 4JRVA 4F99A 4FTIA 2WO6A 4ZTSA 2Z7LA 4LL5A 4FZ7A 5BVKA 3LM0A 2VWVA 2FVDA 4IAIA 3ORTA 4BR3A 3EKNA 5CEIA 3SAYA 4IAAA 4ANOA 3REPA 3A7GA 4MNEB 4ZTLA 4IB3A 3A7IA 3BLHA 4Y5QA 4IWDA 4S30A 1TVOA 5HBJA 1Q99A 3DNDA 2A4LA 3MB6A 3Q32A 4QYHA 4QTBA 2BROA 1WBOA 2FGIA 2OW3A 3DB6A 3G33A 3A4OX 5LMKC 1AD5A 3AMAA 4LL0A 3VS5A 2X7FA 2OU7A 4LI5A 4FSWA 2Y4IB 2E9NA 4GT3A 3C0GA 5HG8A 3VJOA 3GB2A 4DFZE 3OCSA 3HMIA 5BYZA 4AP7A 1URWA 1WVYA 3MBLA 2XKEA 4GKHA 3R7VA 2BKKA 4NCTA 4NFMA 4CFNA 3AD5A 3PJ1A 4UYNA 3OXZA 3PXYA 4F9AA 4HVDA 4AZEA 5CU3A 4JXFA 1G8AA 3TZ9A 2XM8A 3KXHA 2CGWA 4E4MA 3FQHA 1JOWB 2BAQA 3DGKA 1WVXA 3MSSA 3SGCA 1GIJA 1SMHA 4UMRA 4OBQA 3QA0A 4ZZNA 3F2AA 5LJJA 1T45A 3GC9A 2B4SB 2OIDA 4W9WA 4F63A 3A62A 3QGWA 4R78A 1HOWA 3QQKA 1G3NA 2DQ7X 2RKUA 3D14A 3LW0A 3NW6A 4I5PA 3O50A 4UWYA 3E8CA 3KRWA 4RRVA 4FKGA 2WELA 1XH6A 1JKSA 1UNGA 5IA5A 5DT4A 5AA8A 2V7AA 5GNKA 1XQZA 4F9YA 4QMQA 5J1VA 3E8DA 3GFEA 3EYGA 3FI3A 1QPJA 4K2RA 5AADA 4FKSA 3DK7A 4IVDA 4E5AX 3LFDA 3A8WA 3GQLA 4N57A 5CSHA 3IDBA 3EQBA 4R5YA 3TV6A 4RX5A 1H01A 5FBOA 2C0OA 2IVTA 3FMEA 3OP5A 3EYHA 4IEBA 2CHLA 2W1FA 4YJRA 1Y6AA 2GNFA 4DH1A 4M0ZA 2C3LA 3DFAA 2XIXA 2V5QA 3KB7A 4RFMA 2VTLA 4W4XA 2J6MA 3THBA 4UXLA 2J7TA 4I5HA 4KSPA 3E7OA 5I9UA 5IUIA 4BCNA 1UU8A 4GU9A 1FBNA 4KIKA 2XP2A 3DTCA 3QTZA 4X2JA 5IEVA 1OKZA 2OIQA 3GC8A 4IAZA 4JOAA 3F2RA 4YSMA 2YZAA 3FLZA 5E8VA 3RALA 4B9DA 2IW8A 5L2TA 5I9XA 1Y6BA 2OO8X 5HX8A 4RT7A 3LFFA 3U4WA 4C62A 3F9NA 5DHJA 4WSQA 3AC4A 1H24A 2VX0A 1PKDA 3PXZA 3LXPA 2BAKA 3E5AA 4AN3A 3ZEWA 3LQ5A 2QKWB 4B6LA 3PA5A 3V5JA 4KKGA 4ZTMA 1WAKA 3BQRA 3WZKA 4USEA 4EZ5A 4JDJA 2RF9A 4BGGA 2RFDA 2OIBA 2BCJA 3ZOSA 1VYWA 3Q4UA 4R1VA 4YJTA 4MD8E 3FI8A 1JSTA 3QRUA 3CJGA 4YPSA 3MDYA 2QO2A 4KS7A 4A9SA 1IRKA 1G5SA 4CNHA 4FF8A 4I4FA 4L00A 3E92A 5F1ZA 4G2FA 1PXIA 4HPTE 2A1AB 3BIZA 3C4FA 1AQ1A 1OITA 5IMEA 4R3CA 4HZRA 1GNGA 2HWOA 3ZLSA 4HGTA 4RA4A 4H05A 3C4EA 4TL0A 2PPQA 4C34A 4RPVA 4FZAB 1H0VA 3UG1A 3NUNA 3R8UA 2VN9A 2WTVA 3P9JA 5AIKA 3KA0A 4N6ZA 4BDEA 2G2IA 4GRBA 4PQNA 3ZRMA 1KSWA 3F61A 1KE8A 4KRDA 5HBEA 4IW0A 2YWPA 4RX9A 4ACDA 2RL5A 4ASZA 4C59A 5ANDA 2QOHA 3MH0A 2WEIA 3E87A 1GZ8A 3C50A 3NS9A 3HMMA 1IR3A 4RJ3A 3LE6A 3KF7A 1Y8GA 2GNIA 4KINA 3T8OA 1H27A 3OOGA 4G34A 3VBWA 3BBWA 4IACA 4O7NA 4BDAA 1YXUA 1ZOGA 4IJ9A 5JGAA 3FUPA 1Q3DA 4AW0A 1JKLA 1YWNA 2BRGA 2Y8OA 5IH6A 4HCTA 1J3HA 3ETAA 3CD8A 4Q9SA 4FNXA 3PJ8A 4LG4A 5DA3A 1Q8TA 4FV1A 3IW8A 4ZTNA 3LJ0A 3U54A 4KABA 1ZAOA 4Y83A 4MH7A 4FSTA 3QWJA 3R7GA 3ZFMA 3LCKA 2BZKB 2QI8A 3IDPA 1DAWA 4PY1A 4IXPA 5D7VA 4BIDA 4YUQA 3VAPA 4BBEA 5E8WA 2PHKA 3RTPA 4ZIMA 4CCBA 1J7LA 5E8TA 3DLSA 3QD0A 4I0TA 1OVEA 3IW5A 4C2VA 2W4JA 4FUXA 5IQAA 4TWCA 2YLFA 3CQWA 4IQ6A 4KWPA 3TV4A 3KVXA 3AT2A 4Q5EA 3DZQA 5AIRA 3TI1A 4EOIA 4K18A 3NX8A 5BYYA 1B38A 2X1NA 2RFSA 3G5DA 3KCKA 2QONA 4EK3A 4G3FA 4W8DA 2HOGA 3MV5A 3TTIA 4EWHA 3NUUA 4ZLZA 4KIPA 2C5OA 3QZHA 1JSVA 3OF0A 2UZBA 2WNTA 3ZBFA 3PPZA 2ITZA 5HLNA 4RJ7A 3MS9A 4C4IA 4F6UA 4F1TA 3RCJA 1ZMWA 2PVNA 3BV3A 5FDXA 4EKKA 5EQEA 2PZRA 2XNEA 1U54A 5DG5A 1KWPA 4FOBA 3QXOA 2GS2A 2P2IA 2H8HA 4L52A 3HLLA 4FV3A 2X9EA 3PY3A 4FT9A 3ORMA 3ZTXA 3AGMA 2ZV7A 2WD1A 4QP9A 4USDA 3W33A 3UPXA 2VTJA 4NYEA 3R2BA 3H30A 4GS6A 1ZMUA 4J8MA 2OJFE 4YC6A 3FE3A 3V5TA 3EQRA 4BYJA 2XNNA 4K1BA 5CT7A 5CEPA 2GCDA 4WBBB 3I60A 4UY9A 2WTDA 4XG2A 3BE9A 4O0VA 1CM8A 4YJQA 4D1SA 4GIHA 1BI8A 3FXXA 3QLGA 5HX6A 5JFSA 4JX3A 4M8TA 3F5XA 1OBDA 3FYJX 2W1GA 3NMUF 4XRLA 4RLLA 1PXPA 2C6OA 2G1TA 2VTPA 3HP2A 4GCJA 4W8EA 2UVZA 2XRUA 4QYGA 4TYEA 4XNEA 4FTNA 3OD6X 2C3IB 2F49A 2XKDA 4G3DA 4QP4A 1FQ1B 3JVSA 4YGAA 3TKIA 4O0XA 4S34A 4FVQA 4KSQA 5E8YA 5CAOA 5T6KA 4D9TA 5EKNA 3EQFA 4W9XA 4YJPA 3UC3A 4D58A 4DEHA 2CPKE 3HVCA 3JYAA 2ZB0A 3ID6C 3PA3A 4ASXA 5M4FA 1V0BA 5CI7A 3UYTA 4D4VA 2UZWE 4IIRA 3BKBA 3VUDA 5BNJA 4OTWA 3I6WA 1O6YA 3QRJA 3DAKA 3GFWA 3FZRA 2YJRA 2WQMA 3MH2A 3FMKA 5CY3A 3GP0A 5CF8A 3R21A 4D1XA 2NP8A 2PUUA 4DBNA 4WRGA 3LOKA 4TNBA 2VGOA 4G17A 4M67A 2I0YA 1NXKA 5H3QA 4EHEA 5FGKA 3R6XA 4FL1A 3SOCA 3VS1A 5EDPA 4A07A 4ERWA 4UMTA 4XG6A 3GOKA 4RMZA 4JJRA 3CGFA 3IW6A 5HD7A 5M08A 5I3OA 3PP1A 3PPKA 3ZBXA 3BYMA 4O1OA 3MY5A 3ZZWA 3FY0A 5E91A 5IQEA 2XJ0A 3RPVA 3GOPA 4YP8A 4WG3A 5EHLA 4JBVA 1YHWA 1YXSA 1YVJA 3L1SA 4OTIA 2XK6A 2JIVA 2GNHA 3B8QA 2I7QA 3DAJA 4FK3A 2UZOA 3R7UA 3CEKA 4IM3A 3ZXTA 3I1AA 5D1JA 5CT0A 5ANGA 4ZLOA 4YJUA 3ZO3A 3RAHA 1Z9XA 4X3JA 2ZM1A 4U5JA 4APCA 3D5VA 2OZAB 2ZB1A 4XG8A 3GCSA 4FICA 5FXRA 3DBDA 1PMVA 2C1BA 5ITAA 2Q0NA 5A4LA 5E92A 5KMLA 3V6SA 2PZIA 3C5UA 5DT0A 5HORA 3G15A 4MK0A 2DS1A 2J5EA 4PV0A 2CGUA 3KFAA 2WOTA 4F0GA 3F2NA 4YJOA 2C5XA 5JT2A 3VBQA 3SXSA 3OFMA 3BU5A 3UMXA 5AUXA 5E8SA 4CMOA 2BHHA 4DLJA 4QYEA 4U3YA 1PXKA 2XZSA 4PF4A 2O65A 4OAUC 5GINE 2PL0A 1PMEA 2J90A 5AUYA 3WF5A 1I44A 3CTJA 5DGZA 3MH3A 1OL2A 3R8LA 3TZ8A 3N4VA 1J1BA 4DC2A 4C4FA 2EXMA 2ZDTA 3D7TB 1XH7A 2C0IA 4U79A 3CJFA 2WMUA 4JS8A 2WMBA 5AWMA 2PSQA 3PJCA 3QYZA 2NPQA 4FV7A 4FYNA 2WU7A 4QMMA 3LXKA 4R7IA 5LVLA 4KUJA 5K4IA 4G9RA 2QCSA 2F2UA 2VTHA 2GNLA 2OF2A 4DFXE 4N4SA 3SW7A 3QUEA 3R9HA 2W1ZA 2WB8A 4WNOA 2XF0A 4D4SA 3PDTA 3G6HA 1H08A 4WO5A 3AC2A 2ZV8A 3SXRA 2F9GA 4FKTA 4FTLA 2GPHA 1Y8YA 3Q60A 2XBAA 4FK6A 1YRPA 2FSTX 2HK5A 3PJ2A 1UU3A 3F3WA 3OEFX 4JG7A 4ZY6A 2ESMA 4X6QC 3WYXA 4PP7A 4Z55A 5CLPA 2FO0A 4XX9A 3CKXA 1YWRA 2EUFB 3GCQA 1YI6A 2NRUA 2PZ5A 3QZIA 4L9IA 3ZH8A 2BAJA 4NWMA 5CENA 1YXVA 3I6UA 4DFUA 2QHMA 4X0MA 2WTJA 4D0XA 5BYLA 3ZLWA 2QOBA 2VO0A 4EUTA 1GIIA 5AP3A 4MXAA 4BB4A 2QQ7A 4A06A 3QQJA 5ICPA 3UP2A 4IWPA 3ORKA 3LFQA 4E4NA 5CTPA 5E1SA 2QNJA 2QOCA 4MXXA 2PWLA 3QQUA 1RDQE 2W4KA 2OWBA 3MIYA 3NVKI 4R3RA 4UB7A 5LVNA 4L53A 2VWWA 3COKA 5GZ9A 4O27B 3O8TA 5B0XA 1UV5A 4L43A 3BYOA 4ANNA 4IC7A 2WKMA 3NRMA 2Z7QA 4FIIA 4M3QA 5EM5A 4EK8A 5J79A 2W1EA 3QAME 4JQ8A 1W98A 4FOCA 4CZYB 3R9RA 2F2CB 3Q9ZA 5GJGA 5J95A 4RIXB 3O8PA 3UOLA 4YJVA 3E64A 5D41A 2Y6MA 4CFUA 5FXSA 4FV9A 3RNYA 3VQHA 2R3JA 2R3RA 4IADA 4Q9ZA 4BTKA 3R7EA 1KOAA 2CLQA 1BX6A 4TYHB 5CNOA 2QHNA 2X6DA 2VX1A 3ZEPA 5IQFA 2ONLC 4CZUA 3II5A 2XEZA 3QQHA 5KHXA 3P23A 3VF8A 3Q9YA 3AXWA 3VF9A 3VUKA 4KIOA 1PRYA 2E2BA 5EI2A 3U8WA 3WE4A 3FY2A 4J97A 5AR3A 3PRIA 3K2LA 4EK4A 4FSUA 5IPJA 1GZOA 3NYVA 4PX6A 4Y85A 3ATTA 4FTUA 2CMWA 4FG9A 4XBUA 3QA8A 4M69A 3SRVB 4EOJA 3PTGA 4CYJA 2A2AA 5J9YA 2YCRA 3OCGA 5CF5A 4CD0A 4RIYB 3FKNA 1KE9A 5EFQA 4D2PA 4IDTA 4OTFA 4F0IA 1S9JA 4IM2A 4IAFA 2BALA 3QTQA 4J53A 4ZSEA 1OIYA 1A06A 4I20A 2O8YA 4EOPA 3DS6A 3GC7A 4I4EA 3A7HA 4PNKA 4BGHA 4EC8A 3AMYA 3GNIB 2XIYA 4QTDA 4IZ5A 3AT4A 2JFMA 3HAMA 4GYIA 3NW5A 3R9NA 3LCSA 4FKQA 3M42A 1OPJA 1L3RE 1KV1A 2J2IB 2YAAA 3F3ZA 4NFNA 3O51A 4YMJA 2AUHA 3E7VA 3FXZA 4OLIA 5B2MA 5C8MA 4BF2A 4I6BA 4OUCA 4ZY4A 4RJ8A 4EBVA 4LQMA 4M7IA 4PL3A 1ZARA 3FEGA 2W9ZB 3QRIA 2WXVA 1AGWA 2JDTA 2XJ2A 3OC1A 5IEXA 4LGDA 1M7QA 2R0IA 2YFXA 3FC1X 4ANLA 2VGPA 2YM4A 4NM3A 5A46A 4YBKA 2RSVA 2X0GA 3QC4A 4OBPA 4RC2A 4JQ7A 4RIOA 3ZC5A 2WMRA 4DH5A 4C4GA 4F0FA 4W4YA 4N70A 2G2HA 3LFSA 4NM0A 3UPZA 3UQGA 4FI1A 2R3HA 2JEDA 3FMLA 4JBPA 3RINA 4KB8A 4RVMA 3DK3A 4OTQA 3ITZA 4DGGA 3MY0A 1Y57A 4Y46A 2H34A 2UW9A 3BGQA 4DG0E 1R0PA 2OGVA 1WBVA 3FL5A 1YWVA 1CKIA 4RSSA 4EONA 2IW6A 1UKIA 4ITHA 1OIQA 5DIAA 4KD1A 5IKWA 3UODA 4AOIA 4GV1A 3NVMB 3S95A 4CKRA 1SNXA 4JRNA 4TKSA 2RG6A 2EXEA 1P14A 1OIRA 1UU9A 3AQVA 3WIKA 3CQUA 3ELJA 2V55A 4OW8A 4KS8A 4AWIA 4Y73A 5KMIA 4PDPA 3NGAA 5CEOA 3F7ZA 1TQPA 4FGRA 4DYMA 4JAJA 3VUHA 3W2SA 3ZUTA 3FI4A 3O7LB 2GU8A 2ZAZA 5DBXA 3DJ7A 5DN3A 3E3PA 3MFSA 3Q9XA 3F69A 4EQCA 3PY0A 4YBJA 4CQEA 3CD3A 4I3ZA 3D0EA 2BDJA 4FNZA 5AR2A 3D83A 1X8BA 4O81A 3H9FA 5KE0A 3DOGA 3VS4A 4O0WA 2R3NA 3QALE 3TL8A 4BDBA 2XK7A 1J1CA 4ACHA 3MESA 5L8KA 1MRYA 4BDCA 4BHNA 4L01A 4QMOA 3IW4A 4MNEA 2R3MA 4XG7A 2YJSA 3HA8A 3TJDA 3WILA 4O7LA 5L2IA 3PXQA 3VRZA 2Y9QA 2PVLA 4BKYA 1ZY4A 4XV9A 4EKLA 1XHAA 5FP5A 2OKRA 3WF6A 3QZFA 3ANQA 3UZPA 3K54A 1ZYSA 4NU1A 5AP2A 3C1XA 2PVRA 2ZMCA 5KKRB 3VW6A 2UV2A 2R0UA 4L3JA 2YEXA 4IBMA 2X7GA 5AM6A 5JEBA 4KKEA 3U4UA 2GQRA 4O96A 4L42A 2YHVA 5LQFA 4C4JA 4O0UA 1W83A 1WMKA 2BDFA 2NNWB 2J9MA 3I5ZA 2BIKB 1M14A 1H1RA 4FIEA 1J7IA 3Q52A 4X3FC 1R78A 4QP1A 3VBYA 2QOLA 2FSOX 5LCJA 3WYYA 1URCA 4G3EA 4CMTA 4FKOA 2PUIA 2OH4A 4CZTA 4EZ7A 2C47A 3LLAA 4HOKA 2HZ0A 1SYKA 2JAVA 3BRBA 4CV9A 5IA3A 2ETKA 3PUPA 5TKDA 4H58A 4BCHA 2QG5A 4O84A 3M1SA 3ORLA 4F08A 4DINA 4NKSA 3TIZA 5H8EA 4X2NA 5L2SA 1OGUA 1HCLA 2GTNA 3HV3A 3LFCA 3QTUA 4P2KA 5L8LA 4I6QA 4ZSLA 4O0YA 1WBSA 2JC6A 4ACMA 2PZYA 2FSMX 4H3BA 5FEDA 2GFCA 3LCDA 3NSZA 3GEQA 5BUEA 3K3JA 3KL8A 5AUUA 3R1QA 4ZJJA 2OJ9A 3DAEA 5C1QB 3SXFA 4PTEA 3TNHA 3R02A 1BUHA 2X7OA 3QTIA 3V3VA 5HIEA 5I3RA 4QYFA 4NL0A 4FTMA 3G6GA 3KXMA 1ZMVA 3ZLYA 1KE6A 2V0DA 5CZHA 3PY1A 4DEDA 4E20A 3COMA 3R22A 2WTIA 4QOXA 4V05A 1W7HA 4ZTRA 3BHHA 3BYUA 4U42A 5BMMA 2C5NA 4BDFA 3LCOA 5KMMA 4LGHA 5CQWA 3RP9A 1GY3A 2GHLA 4YZBA 2YIYA 4TW9A 3VS7A 4BCMA 2PK9A 3Q3BA 4QP7A 1OZ1A 3G9NA 4FTCA 2NRYA 2VO3A 2VNWA 4PDOA 4HYIA 1YDTE 4ALUA 3HGKA 5TE0A 4PL5A 4XCUA 3SV0A 2QO7A 2VTSA 4L46A 4NW5A 5ACKA 1NVQA 3IO7A 3NDMA 5TO8A 1Q62A 4FX3A 5CEKA 3ZXZA 2F4JA 2W05A 2UW5A 4LOOA 1OBGA 4YZNA 5L6WL 3KU2A 4GG5A 3BWJA 4FTKA 3PE1A 3RBWA 4GVJA 4WNMA 3FMHA 3MVHA 4TYJA 4BWKA 3UOJA 1QPDA 2B9HA 4TZRA 3D4QA 3SVVA 1QPCA 2BPMA 4FKWA 1R0EA 1EH4A 2YITA 4WKQA 2PMIA 2J51A 2OXXA 5E7RA 2JAMA 2PVMA 2JDSA 3MA6A 3C4WA 3MIAA 4QMSA 5J8IA 4PPAA 3PZHA 5ANKA 3OT3A 3R7YA 3W2PA 2JKMA 3FKLA 5EW8A 3ACKA 2X6EA 2C6DA 4JAIA 4K33A 3Q2MA 4TY1A 3ZDIA 5JFVA 4J52A 3O96A 4HVHA 4LUEA 1XR1A 4IB5A 4CLIA 4DTAA 2P3GX 5CU6A 4FNYA 4MWHA 2R4BA 3P79A 5HTIA 3IK3A 5KMJA 1FMKA 4YJSA 5CVFA 5HNGA 2B52A 4X2FA 5E8XA 2BFXA 3I4BA 3LZBA 3QRKA 4FG8A 1XO2B 4FSRA 4WHZA 4C3RA 5IA4A 2RFEA 3H0YA 3S3IA 4R5SA 4DGMA 3LMIA 5DMZA 1K2PA 4EBWA 2QKRA 3KRRA 4GH2A 4ZY5A 3QQFA 5CAVA 3ZM9A 3PLAE 2XKFA 4RFYA 3LFBA 2EWAA 3RM6A 3TNWA 2VZ6A 3VWAA 2BHEA 4C7TA 3E93A 4RJ5A 3ZDUA 3KN5A 3QTRA 2YDJA 1ZZ2A 3EFWA 4U81A 2Z8CA 5CSPA 3DT1A 5LMKA 3NCGA 2ITWA 2R3OA 4U41A 3WE8A 4QQCA 2YM7A 5K0KA 5IQBA 4BRXA 1RE8A 3NNXA 3ALNA 4RWIA 2CCHA 4O6EA 2P55A 4D0WA 3PWDA 3R00A 3OOMA 3UVRA 3GU4A 1OL7A 2OJJA 4G6LA 4FTAA 3BGZA 1Q8ZA 1Q3WA 2UVXA 4IX4A 1UWHA 2UZLA 5CS6A 2HXLA 4J99A 4LRMA 4X3FB 4MBIA 4CFFA 2SRCA 2Z2WA 4HGLA 4RQKA 4ASEA 3QHRA 4ID7A 4AW5A 3EKKA 3QWKA 1BLXA 1LR4A 2W4OA 3BHVA 4I5CA 4OBOA 4O91A 1JSUA 2WMWA 5DWRA 5ETAA 1CSNA 2KTYA 4RFZA 5C9CA 4C3PA 4F9BA 3W2OA 3ZRLA 2IG7A 4J96A 3PE2A 4QP8A 4TRLA 3L9NA 2I1MA 3TNPC 5IG1A 3G51A 2IO6A 3MVJA 2XA4A 4JNWA 4CYIA 4U3ZA 4ZMFA 5GIPE 2BMCA 3JY9A 3BZ3A 3ZFYA 2EVAA 4GEOA 4M68A 5EM7A 4NUSA 3VW8A 3VIDA 4AT4A 5D10A 4ANBA 3WF9A 2G9XA 1V1KA 1PY5A 2FB8A 3GBZA 1OUYA 2IN6A 5DOSA 5AX9A 4H1JA 3QCQA 4EWQA 2OJGA 5BMSA 3GU6A 3G0FA 4JQEA 5IEYA 2ZYBA 4FYOA 1H1PA 4CTCA 4IZAA 4RWJA 5KZIA 3NUYA 2ERKA 2Q83A 3DPKA 2UW7A 4YNOA 4HCUA 5HO8A 3F5GA 3SD0A 4DH3A 2XUUA 3IG7A 3AD6A 4L44A 4XRJA 2WAJA 2YM8A 2UW0A 4HGEA 5JH6A 3SC1A 2VTMA 3D2KA 4RC3A 3EFJA 4GK4A 2VU3A 1WBPA 3OT8A 4FUYA 4FNWA 1P2AA 3V5PA 1FGKA 1OUKA 4CG8A 4NKAA 1OI9A 4O1PA 4O7YA 2YIRA 4PDSA 4PRJA 4B0GA 3HZTA 4DGNA 3QXPA 2CLXA 5M06A 4BDJA 1ZY5A 2C6MA 4BI1A 3JS2A 4DAWA 5JMSA 3PYYA 4WSYA 2QO9A 4BDDA 4F65A 5EG3A 4DFNA 3DKFA 5AR7A 3MFTA 4FTJA 3P08A 4QMWA 3PFQA 5L3AA 3I0QA 2R3GA 4JX7A 3DB8A 4G5PA 4KBAA 4BCGA 2H6DA 4IAYA 4A9RA 1R39A 3F5PA 1PF8A 3NAYA 4FBXA 2OH0E 2WU6A 4FSQA 2IPXA 2C5VA 2PUNA 3DJ5A 2BKZA 2PVFA 2PTKA 4ZAUA 4X2KA 4D5HA 3UMWA 3RK7A 4HJOA 3P7CA 2REIA 3TNIA 2BTSA 4G3CA 3RKBA 5HQ0A 2XNOA 3P7BA 3BEGA 3VNTA 3E63A 5B2KA 5F9EA 1M17A 3SX9A 3UG2A 3AC5A 3S1HA 4AF3A 2YZLA 3SG8A 3HNGA 3FKOA 4AN9A 3AD4A 3GVUA 4F7NA 4DF3A 4EOQA 3DY7A 5CU4A 3CY3A 3POZA 4D4RA 3ORPA 5GIOE 2WHBA 3JY0A 3ODYX 4M84A 5A54A 5HLWA 1MRUA 2R64A 3KMMA 3R1YA 3CGOA 1BI7A 1FINA 2BIYA 3EL7A 3DDPA 1MRVA 4IAKA 1JBPE 5J87A 4OTGA 4D4YA 1PXLA 2Z7RA 3MVLA 3PIZA 3ERKA 3IGGA 4GFMA 1YHSA 3FZTA 4FTOA 4U7ZA 5AR5A 4GK3A 4QP3A 1QCFA 3LXNA 5CZIA 3UIBA 4USFA 2IVVA 3FQEA 5L6PA 1BL6A 5A4QA 4HVSA 3CQEA 3HRBA 2JKOA 4CT2A 5FEQA 4AAAA 3M11A 4E7WA 2VD5A 4IX5A 3EN7A 3VO3A 3UIXA 2R3LA 3MTLA 5L2WA 3N4TA 4EOKA 2OF4A 3P1AA 2WQNA 2OZAA 3KXZA 3LIJA 3OMVA 5FD2A 3W1FA 4GK2A 4DITA 2F7ZE 3DJ6A 5A6OA 3DKCA 4FV4A 3D9VA 2ITYA 1M2RA 3OW3A 3Q9WA 4MF0A 5A6NA 4O7WA 4JVGA 2YERA 4ANQA 4YNEA 4ZXTA 4BY9E 4FV2A 4ZK5A 4EQUA 1WVWA 3A8XA 3N51A 3A60A 3ULIA 4M12A 3ZFXA 3QD4A 3OXTA 1FVTA 4YZCA 2XIRA 4RVLA 3H10A 4A9UA 2B0QA 3UDBA 4FV8A 2WMAA 4D5KA 4FT5A 3RK9A 3TZMA 4L7FA 3PVWA 5E90A 2HZ4A 3FZOA 1PMUA 3QYWA 4QO9A 5HG7A 3D7TA 4FKRA 3JXWA 2HYYA 2W5BA 4NH1A 4U80A 5H8BA 3DKGA 3FAAA 4TYHA 4BDGA 4XOZA 5HO7A 2R7IA 4EH5A 4EH2A 4FTQA 4NM7A 3BCEA 2NO3A 4GT5A 3RHKA 3QCSA 1APME 4V0GB 3RNIA 1JAMA 4UMQA 5HCXA 3OWJA 1MQBA 4ZJVA 2GS6A 4I92A 3QC9A 4I0SA 2JKKA 3DV3A 1ZWSA 5J9ZA 3TKUA 3QUPA 4XS2A 3NNWA 1ERKA 4U6RA 4XG9A 3ZS5A 2BTRA 2YIWA 3WBLA 3TG1A 4C8BA 2PUPA 5HG9A 3FZ1A 4TWNA 2C3JA 5IMXA 3C7QA 4BYIA 2YWVA 2PMOX 3CPBA 3V51A 3FLQA 2W0JA 3OCBA 3NYXA 4DBXA 3CSVA 5HBHA 4P7EA 4P90A 3ZO2A 4QPSA 4L67A 3ZSHA 3UO6A 4L68A 4EC9A 3LXLA 3R0TA 4JG6A 4AT3A 3QHWA 4EI4A 4V04A 4XV2A 2YN8A 4CFMA 4Z16A 4ZEGA 2JD5A 4IVBA 4LRJA 3R71A 4I41A 3GU8A 4KRCA 2W17A 5LOHA 5CWZA 1U5QA 2UW8A 2UVYA 1LEZA 1MQ4A 2F7EE 3KY2A 3MY1A 5CU0A 4FE2A 4AA0A 2UZTA 4F7LA 4CKJA 4X7QA 2XK9A 1RQQA 4TYGA 1WBWA 3F3UA 5HTBA 4XBRA 1JKKA 4BCQA 5EDQA 3PVUA 4Q5HA 2I40A 3AMBA 3FHRA 3GC0A 3HP5A 4RIXA 4MXZA 5EOLA 4AA4A 5JFXA 2E9UA 4AGCA 3PZEA 1XBCA 5CASA 2HW7A 3E88A 5IISA 1V0PA 3IQ7A 4AS0A 3OUNB 5AR8A 3V04A 1K9AA 3EQPA 4QMUA 2X9FA 1WBNA 3LCTA 3EFKA 4FR4A 4JIKA 2QD9A 4RQVA 5KMOA 4O7TA 1Q8WA 3F66A 4I0RA 4M0YA 4BN1A 5DR2A 5L8JA 5G6VA 2UW3A 3UYSA 2UW6A 2WOUA 3BV2A 5CVHA 2XNBA 3V6RA 3FMNA 1NVSA 1R1WA 1FPUA 2C30A 4XV1A 3HUCA 1Q41A 4WG4A 3KGAA 3LPBA 3LHJA 2WTWA 3BWFA 2C3KA 4WOVA 3NLBA 3DU8A 3G0EA 3POOA 2ZOQA 3TDVA 1JQHA 3SRVA 4ZLYA 3DBEA 4QMNA 3CTHA 3UIUA 3HMPA 3ODZX 5J5SA 5DR6A 2YM3A 2R3FA 3QD2B 3QTSA 4MQ1A 4RIYA 3KKVA 4YSJA 4XEYA 3QLFA 3PPJA 4RBLA 4FL2A 4BICA 1JVPP 3FPMA 5AP1A 5L2QA 5LVOA 3Q6WA 4AT5A 2QURA 3ZZEA 3IW7A 5IF1A 4ZTHA 4YO4A 2HAKA 3DBCA 1OECA 2AYPA 3W8QA 3OG7A 1YHVA 2BILB 3PP0A 5HVYA 1Q5KA 4EHZA 5JQ5A 4JIAA 3NW7A 3R9DA 3KXNA 5HICA 2CNUA 4O21A 5EKOA 2F57A 1E1XA 2YISA 3H4JA 1DI9A 3QGYA 4GUEA 5HCYA 2QR8A 3L8XA 4R1YA 1YOJA 2BRHA 5BVWA 2HZIA 5HESA 2B53A 4BZOA 2C5YA 3BU6A 1H00A 2XVDA 4QMPA 4OT5A 4RX7A 4UZHA 5HE2A 4CFXA 4D2VA 4ARKA 5CF4A 1FMOE 5KX8A 2CNQA 3EL8A 4QTEA 3F82A 3NPCA 4M66A 5BVNA 1M52A 4EOLA 4QQTA 4K6ZA 2BUJA 4RA5A 1NA7A 2QOFA 2YCSA 2ZVAA 4QRCA 4C58A 1ZRZA 4GMYA 4NIFB 3MPTA 3HRCA 3BYVA 3FHIA 4G3GA 4RLKA 4EZ3A 3LMHA 2PMNX 3OY3A 4NTSA 5J9LA 2C4GA 2R3PA 4I23A 3UVQA 3DBFA 3HDNA 3D5UA 4AXAA 2LGCA 5EQPA 3WF7A 4C61A 1BKXA 5CNNA 2XYUA 4F9CA 4O7SA 3Q96A 2PE1A 3MGYA 4ZZOA 4FEUA 4RWKA 1XKKA 2HY0A 3DXPA 4HPUE 4ITIA 4KA3A 5HEZA 3V01A 2QU6A 4AOJA 3R2YA 5BPYA 4TWPA 3OWLA 4P4CA 3TV7A 1YDRE 4RGJA 4QMLA 3VHKA 5K9IA 2CGVA 3OZ6A 4O22A 4MYGA 4PPCA 4XHKB 2UUEA 4OTHA 5HIBA 1PKGA 5AAFA 2QVSE 3CY2A 3ZO4A 2WMVA 3H9RA 4LMNA 4BDIA 4WD5A 4D1ZA 1H1SA 4DH7A 3EN6A 4H3PA 4XLVA 3LVPA 4YLKA 4ITJA 3EWHA 4YTHA 4NZWB 5FM3A 2C1AA 4QMVA 4I22A 1W82A 3PIYA 4PMMA 5GJFA 4DCEA 3PSCA 5CI6A 5DRDA 1UNHA 3V8WA 4XOYA 4ZOGA 5EW9A 5AV4A 1SNUA 3D15A 5AUTA 4AOTA 1IAHA 4BHZA 1PXMA 4F9WA 4AU8A 2JLDA 4EJNA 3IGOA 4PTCA 4HGSA 4GL9A 5AM7A 3VULA 3D7ZA 3LFNA 5AP0A 4NJ3A 5F4NA 4AGDA 4DH8A 4CCUA 3ZMMA 2B54A 4Z9LA 3UNKA 4ASDA 1JWHA 3GT8A 3EIDA 1DS5A 3PXFA 4E1ZA 4JBQA 5I9WA 3WZDA 5C4KA 2CN5A 3FMDA 5EYDA 3GCVA 4O2PA 5GZAA 2WTKC 2BRBA 2C6KA 3VUGA 2W1CA 2BZHB 3CP9A 4FEVA 1H28A 5BQ0A 5DI1A 5JRQA 4BDHA 1OKWA 2OG8A 4IB1A 3U9CA 4EL9A 4RZVA 1GAGA 4EH9A 2ITVA 2CSNA 2XIKA 3EZRA 4A9YA 3FLWA 2X4ZA 1YXTA 3F7WA 3R73A 1VJYA 1WCCA 4X21A 2A19B 5IUHA 2BR1A 2Z60A 3ZSIA 5EYCA 1DI8A 1GZNA 2GTMA 4ZS0A 4ZZMA 4I24A 2ITPA 5JGBA 3P0MA 3QX2A 1ATPE 4FTRA 4NJDA 1UVRA 5C8KA 5M44A 4P5QA 1PXJA 3UOKA 2VWIA 3NEWA 4BCKA 2HCKA 3DK6A 3SDJA 3KRLA 3RPSA 4RG0A 4FV6A 4TN6A 2J0MB 3ENMA 3KREA 4BBFA 3PSBA 4LYNA 2BZJA 4G16A 4NTTA 5ACBC 4R6VA 4W4VA 3OTUA 3EN4A 4Y72A 3ORIA 5A14A 3TWJA 3W18A 4WNPA 3WZEA 3HUBA 5KO1A 5AUWA 3HKOA 5GZ8A 3SG9A 3V5LA 4RIWB 2Z7SA 1REKA 2GDOA 3KULB 3ZRKA 5KBRA 5DE2A 2WPAA 3RZBA 4UALA 4U44A 4QMXA 2GMXA 4UN0C 4FEXA 4D2SA 5K5NA 3F88A 5HNBA 4DFBA 2WMSA 4JDIA 5E8UA 3KF4A 3QU0A 4R3PA 2VWBA 3N4UA 3TDWA 4BCOA 4QNYA 3H9OA 2CJMA 2HW6A 3KEXA 2QC6A 5CSVA 5FWKK 4A4OA 1PHKA 4ACGA 3TUDA 1FVVA 3C4CA 4LV5A 3IONA 3WARA 3CBLA 3Q4ZA 4L7SA 4UBAA 2BRNA 4Z7HA 4YHJA 5ANIA 3RM7A 3U55A 1TQIA 2W06A 3FWQA 3KRJA 1UNLA 4FV0A 1O6KA 2QOIA 2ZDUA 4O0RA 5EI8A 3VHEA 4B8MA 4DFYA 4GW8A 2E9OA 2VTTA 4JDKA 1CDKA 1IASA 2EB3A 4ANMA 5AA9A 5CALA 3VJNA 5HD4A 2IZSA 2P0CA 2P4IA 3FXWA 4S2ZA 4YURA 3G90X 5G1XA 4GG7A 3EZVA 4M14A 3C51A 2X8DA 5DEYA 5FG8A 2XRWA 4BL1A 2X2KA 2VAGA 2B9IA 3T9TA 4EH7A 2VX3A 1XH8A 5AV0A 5HCZA 3MFUA 3C9WA 1YKRA 2XMYA 3A4PA 4L3LA 5DR9A 4E6CA 4K0YA 4ZS4A 3G2FA 4U45A 4ZMEA 4J7BA 3PXKA 3D5XA 3HL7A 3TJCA 4C3FA 4EORA 3AC3A 4FKJA 3SHEA 4UWBA 4FC0A 2W1IA 4QTAA 4WNKA 5LARA 3U87A 3DNEA 3ATSA 2QOKA 1KV2A 3LM5A 3RI1A 3GU5A 3AC1A 4C38A 1H26A 5C4LA 4C4HA 3HDMA 4HVIA 5DPVA 4UWCA 1OKYA 3T3UA 1YQJA 4G6OA 3V8TA 4APPA 2O5KA 4MBJA 5CAPA 4BTMA 2QOQA 1FOTA 1YI4A 1OL5A 1Q8UA 4BWPA 3UC4A 2ETRA 4NCTC 2CDZA 3NZ0A 3E8EA 1CKJA 4GT4A 4D28A 3P78A 4XYFA 5M4IA 2WQBA 3VBVA 1XBAA 2R9SA 3OTVA 4FIHA 4CFWA 3R1SA 1H0WA 4MAOA 1K3AA 2XIZA 2XM9A 4XG4A 4ZSGA 3E8NA 4A4XA 4DTKA 5M51A 2G2FA 4U97A 2VWUA 4MTAA 3R7IA 1LUFA 3FI2A 1U46A 4LOQA 2ACXA 1IAJA 4MXOA 5CQUA 3DXQA 4EQMA 2ITXA 3UNJA 2W5AA 4GVAA 2V62A 5DYJA 3NCZA 4EHVA 1PJKA 3DLZA 2V7OA 4KIQA 3W10A 4EJ7A 3ZYAA 3CS9A 4FL3A 2WTKB 3FSFA 2R5TA 3TTJA 4CXAA 5HZNA 2CKQA 3O17A 3Q5ZA 3DFCB 3ZU7A 4FVRA 4DEEA 1Q97A 2VTAA 2VO7A 1OL1A 5EW3A 3RAWA 4EH6A 4ACCA 4FVPA 1P4FA 4C4EA 2QG7A 5BUIA 3GGFA 2G15A 3OHTA 3SW4A 5LCKA 1WFCA 2YDKA 2HENA 2CKOA 3H3CA 2X2MA 3BLQA 2GQGA 3D5WA 3GXLA 3D2IA 4I6FA 1STCE 3IOPA 5TR6A 3TZ7A 4TTHB 5K4JA 4CKIA 3HMNA 2J0IA 5M4CA 1R3CA 2UZNA 4QNAA 1H1WA 3IS5A 3NWWA 3O0GA 5F94A 1OL6A 5BVEA 1WBTA 4FIFA 3ZHPC 4XP0A 4PNIA 5JK3A 1OIUA 4YTIA 2XBJA 3W2RA 3HECA 4X3FA 3R8PA 3BBTB 5IH4A 5GHVA 3UNZA 1XWSA 4FT0A 5CF6A 5LWNA 2V22A 3OVVA 4S33A 3GCPA 4EH4A 5K5XA 3JR1A 3RJCA 2VUWA 2WEVA 5CXHA 5B7VA 3UVPA 3FLSA 4AZFA 3Q53A 3QKLA 4I94A 5CAQA 4AACA 2YDIA 3TN8A 2YIXA 4TPTA 3P7AA 2O2UA 2PYWA 3E62A 3RZFA 1LP4A 2YACA 3NNUA 5IQDA 2PE2A 4K11A 3FLNC 2I0EA 3KMUA 3ORNA 5DFPA 4BVUA 4QMYA 4C33A 3QCYA 4IM0A 4ENXA 2J0KA 5FTQA 4ENYA 1WZYA 4PDYA 3VS0A 4CVAA 4EEVA 4II5A 3HX4A 4D2WA 3S0OA 4FIJA 3LMGA 4K8AA 1U4DA 3PJ3A 4F7JA 4R8QA 2XK8A 1OMWA 3DQWA 5TOZA 5FUTA 3TXOA 3FQSA 5IDPA 4XLIA 3BHYA 2AC5A 3OY1A 1GJOA 5HO6A 2PVYA 4MKCA 4FT7A 4RZWA 2J4ZA 4U0IA 4FSZA 1XH4A 2WMQA 5IZFA 5HG5A 3ZUUA 2C6EA 2J0JA 4GFGA 4O6LA 1YI3A 3PRFA 4E6DA 3PG1A 5HNIX 4BWXA 2HWPA 3GQIA 3NUXA 4WUNA 4IE9A 5EK7A 3H0ZA 5CAUA 5KUPA 1JLUE 2JIUA 3C0IA 4GSBA 2CN8A 3TKHA 4YC8A 4YHTA 3MI9A 5F20A 5HGIA 2KULA 2W1DA 4MEDA 4QQJA 1PYXA 3KK9A 3O23A 4AW1A 4BIBA 5DT3A 3KCFA 4TXCA 4MF1A 5JQ8A 4J95A 2XH5A 2B1PA 2WMXA 5L4QA 4O38A 4QT1A 3EOCA 4G1WA 2C68A 3MPMA 5JSMA 4QP2A 5D11A 4WRSA 5M53A 4KNBA 4B99A 3R9OA 4O7RA 2OXYA 4DGLC 3OCTA 3Q6UA 3VC4A 3ZONA 3Q04A 4CRLA 4AN2A 4YR8A 4PP9A 4MD7E 1O6LA 3TUBA 2HELA 4AZTA 5T68A 1DM2A 3ORXA 3F3TA 3R04A 3O71A 2BFYA 3DBQA 3NUPA 4H36A 5ETCA 3TIYA 2IZRA 2UZDA 4CQGA 4Q2AA 3WZJA 4YTCA 5EHYA 4O0TA 2FYSA 3HV6A 4BTFA 3K3IA 4UZDA 5M55A 1I09A 2CKEA 5C03A 4HYUA 4C02A 2GSFA 2O3PA 2W1HA 4IX3A 3TT0A 4ZSAA 5A4TA 2FUMA 4BCJA 4DG3E 2C6LA 1ND4A 2GHMA 3RMFA 3GCUA 1Q61A 2VWYA 3QTWA 4IMYA 2VNYA 1IA9A 2OLCA 3MFRA 5IH5A 2Y7JA 3R30A 2WFYA 2XYNA 4C36A 2VTRA 3IPHA 2H96A 4FSYA 4L8MA 4QTCA 4QYYA 4DLIA 3F6XA 3MJ1A 5FM2A 3ORZA 4IB0A 4HZSA 3PSDA 4BTJA 5M56A 1A9UA 3O2MA 4RJ6A 4Y95A 5H8GA 4FZDB 3OWPA 3TCPA 3A7JA 4NT4A 3EQIA 3OBGA 2XS0A 1CTPE 3UZTA 3Q2JA 3COIA 3HRFA 4F6WA 2VWZA 4ANSA 1W0XC 3BQCA 4BCFA 3MTFA 3EJ1A 5E9EA 4AUAA 4EK5A 2Y4PA 3QCXA 3KC3A 3MPAA 5EDRA 1MUOA 3V5WA 5LVMA 2WMTA 4FIGA 1W84A 4DEAA 3A7FA 5CSXA 4B8LA 3KXXA 4I93A 1OB3A 1KE7A 4CGAA 3PVBA 4FZFB 4MHAA 5DNRA 3C4XA 5KZ0A 3PIXA 3RCDA 4AQCA 4E8AA 4E4XA 2XK3A 1CKPA 3V5QA 2EU9A 1YW2A 4BCPA 3FPQA 5EM8A 5AUVA 5LMBA 1NW1A 3NUSA 2Y6OA 4N6YA 4KIKB 4XV3A 3MWUA 4CLJA 5AEPA 2CGXA 4RX8A 3DA6A 4F4PA 3W8LA 5DVRA 4AE9A 4U43A 3ZO1A 2JDOA 5E8ZA 5E4HA 5HU3A 5J7HA 5FEEA 5DH3A 2PVJA 5A4CA 4EYJA 4H1MA 1M7NA 4KBCA 2R3IA 3A99A 3RWPA 4CSVA 3FLYA 3PA4A 3CCNA 1BL7A 4PPBA 1OPKA 5I9YA 3KXGA 5AR4A 3VS6A 3BHTA 4OT6A 1Q4LA 4BZNA 1U5RA 4LM5A 4I6HA 5GJDA 3CKWA 3HMOA 3S00A 3MB7A 4V0GA 4BCIA 2I0VA 5KCVA 3OBJA 4NEUA 4XH6A 2A27A 4ONAA 5LMAA 2W5HA 3WI6A 2IVUA 4XP3A 4A9TA 4QMTA 4OR5A 3LJ1A 5HE0A 3TEIA 5KHWA 4XG3A 1G8SA 2AC3A 4O0SA 5HU9A 4FA2A 1ZXEA 3ZCLA 3I7CA 4YZMA 5JZJA 3NYOA 3OXIA 1TQMA 2ITOA 4IZYA 5AP6A 2GFSA 3CC6A 3BLRA 3VRYA 4HNFA 4EYMA 4ERKA 4UEUA 4C57A 5I5ZA 4KAOA 2ITQA 4QPAA 5FP6A 3ACJA 4AGWA 1OPLA 3B2TA 5EYKA 2X39A 1V0OA 2OJIA 2P33A 1F3MC 4LUDA 4HYHA 5BUJA 4E3CA 2ETMA 3P5KA 4JR3A 3FZPA 5IA0A 5AX3A 4O7VA 4FODA 2ZM3A 3B8RA 3FBVA 4WT6A 1GZKA 4IX6A 5LVPA 3MN3A 2C69A 3I7BA 4C2WA 1KUTA 4J71A 4YPDA 3LKMA 3K5UA 4U8ZA 3QTXA 1IA8A 5FBNC 3BE2A 2UZUE 4EH8A 1Y91A 2WZJA 3UJGA 3PG3A 3Q4TA 3ZSGA 4NK9A 4NM5A 4CV8A 4U9AA 4DN5A 5I0BA 3W2QA 5IQIA 4K9YA 3VN9A 4R77A 4MWIA 4TYIA 2BRMA 4JI9A 4PUZA 3SLSA 1OKVA 4AX8A 4F1OA 1GIHA 3HV5A 3OEZA 4D55A 1JPAA 3RAIA 4E73A 1BMKA 2O64A 3UIMA 4WG5A 1FGIA 1SVHA 5FRIA 4CFVA 4FKLA 4FZ6A 2A0CX 3UZRA 3FV8A 5EYMA 2CKPA 4GU6A 3UTOA 2VTOA 3OS3A 5AUZA 3V8SA 2XK4A 2EXCX 3FYKX 1F0QA 1UA2A 3Q5IA 5AAEA 5IUGA 2QLQA 1PYEA 1VR2A 3NIZA 2ZV9A 5C01A 4Z7GA 4ZP5A 4H39A 4QMZA 2ZM4A 2JGZA 3UQCA 3HAVA 1QPEA 5JGDA 4RVKA 3VS2A 4L3PA 3UE4A 4WUAA 5KNJA 2XNGA 5F95A 2IW9A 3EMGA 4I1ZA 4UV0A 3U6JA 3I79A 3RWQA 2R7BA 3BI6A 3ROYA 5IQHA 3O8UA 4N0SA 5CVGA 4HCVA
chains in the Genus database with same CATH superfamily
4HYSA 5C27A 5AFVA 4E93A 5EQYA 3NR9A 4GJ3A 4C35A 1QL6A 3B2WA 3AKLA 3F3VA 3IKAA 5I9VA 2PE0A 2O63A 2XCHA 3TUCA 1JKTA 4CEGA 4FEQA 3PFYA 2OFUA 2JBOA 1U54B 1T46A 3HYHA 2R2PA 3L9PA 5JFWA 3A61A 4QEBA 1F5QA 5M4UA 5BVFA 4FTTA 3R8ZA 3ZM4A 4XP2A 4YLLA 1SM2A 5FLFA 3EQGA 2XJ1A 1UU7A 4FKVA 4AA5A 5HTCA 2FSLX 2WQOA 4J98A 3BEAA 2IWIA 3I81A 4O86A 3W2CA 2B9JA 3L8SA 4UMPA 5DRBA 5BX0A 1Q8YA 3SQQA 4FV5A 3CR0A 4MBLA 4YC3A 5AP5A 4EOSA 3CTQA 4BZDA 2OK1A 1J91A 3VBTA 1PXOA 1A48A 4DTBA 3FL4A 4L6QA 1XH9A 3BYSA 2B7AA 3KVWA 3DDQA 4IFGA 5J5TA 3IECA 3C4ZA 2RIOA 4QP6A 4MUQA 5CSWA 4DA5A 4AGUA 4JL9A 5AJQA 1ZLTA 5CANA 4AW2A 3QX4A 4F64A 2A98A 2JBPA 1OM1A 4PMPA 4NIFA 2BDWA 2JDVA 3O7LD 2BVAA 2R3QA 3EQDA 5ANJA 5D7AA 1SVGA 2WQEA 5T3QA 3W0QA 5BV3A 2QLUA 2JDRA 1H25A 4JBOA 5CEQA 4LV8A 5TT7A 4ALWA 1Z57A 4AZWA 4FT3A 3DCVA 4FKUA 4LGGA 3NFFB 4A4LA 2VTIA 2DWBA 3EHAA 3UP7A 3SKCA 1NT2A 5AV1A 4EH3A 4DG2E 5C26A 3FZSA 3C0HA 3LJ2A 4R7HA 3BX5A 4UMUA 2Q0BA 3ZLXA 3K5VA 5DLSA 5A3XA 5FTGA 3QFVA 5E1EA 2ZV2A 2J50A 1XH5A 5HIDA 3IDCA 5AP7A 3VUIA 3UO5A 4IJPA 5AV2A 3HA6A 1Q24A 3L9LA 4FGBA 3TM0A 3F5UA 1H07A 2RGPA 2IVSA 2YCQA 3QL8A 3COHA 3KQ7A 4IC8A 4EOOA 4YU2A 5IA1A 5D12A 4E6QA 4YO6A 4BI0A 5J1WA 2X8EA 1TFFA 3R8MA 1E1VA 3DQXA 5AP4A 3OUKA 3QZGA 1TKIA 4CMUA 1SZMA 4I5MA 4UX9A 2YIQA 2X81A 3AGLA 4G5JA 2YM6A 4JG8A 4AXDA 4CG9A 2YABA 3KMWA 3PLSA 4J8NA 1MP8A 5A9UA 3FMMA 4WBOA 4IZ7A 5D9HA 3RPRA 4BC6A 3AOXA 2E9VA 5HI2A 3MA3A 1J7UA 4HNIA 4J1RA 2E9PA 2PVHA 2J5FA 2X4FA 4WIHA 4MD9E 3L9MA 4Y5HA 2OFVA 3QQLA 2W7XA 4AZSA 1P4OA 4OTDA 5EOBA 4TWOA 4E6AA 5H9BA 2JIIA 2W99B 2W9FB 3UGCA 1IG1A 3QKKA 3N9XA 2HY81 2WIHA 3T3VA 5TF9A 5LWMA 3GI3A 3L8PA 1FVRA 3GENA 3LFEA 4HW7A 3KK8A 2OXDA 4FKPA 3FSKA 3EB0A 2C0TA 4Z3VA 3JUHA 4FG7A 4DT8A 1ZOEA 2VWXA 4DT9A 4O83A 4D9UA 5CX9A 4QQ5A 4H3QA 4IVCA 2Y0AA 4FKIA 3QD3A 1PMNA 2VTNA 2YM5A 3DTWA 4GUBA 1L8TA 3C5IA 4MQ2A 3T9IA 2XNPA 2YLEA 4S31A 4O82A 4K77A 3OW4A 5KMNA 5IA2A 2JKQA 4MX9A 1B6CB 2EB2A 2I0HA 2GQSA 4NSTA 3U9NA 5HLPA 4AXCA 1H4LA 3VBXA 2QU5A 1YXXA 5M57A 4DEGA 1VZOA 3ZUVA 4RC4A 5B2LA 5I9ZA 5BVDA 1YDSE 5KKRC 3U51A 3JVRA 4F7SA 4GJ2A 4GYGA 4XUFA 5JZNA 3VUMA 4YTFA 4RIWA 4EOMA 4YZ9A 2ZMDA 3KULA 3W16A 4OGRA 4UYAA 4KKHA 3FC2A 3SOAA 4G6NA 3P86A 3E3BX 5AMNA 5FQDC 1NY3A 4F09A 2VTQA 4M97A 5CXZA 4GKIA 4ZJIA 2OI4X 3RPYA 1REJA 4B7TA 5KMKA 4FSMA 3R63A 4PTGA 5IU2A 4IFCA 4P5ZA 5L6OA 1RJBA 1W8CA 4PMTA 5IQGA 2PMLX 2PULA 3AG9A 4V01A 3S4QA 4IWQA 5J7BA 1M2PA 1LEWA 2C6IA 3PWYA 2LAVA 4MXYA 3VQUA 4JT3A 3VS3A 5EH0A 4YLJA 2P2HA 4NW6A 4M15A 3RHXA 4KBKA 5IQCA 4E4LA 1JNKA 3EFLA 2FH9A 3S2PA 2ITNA 3M2WA 3QUDA 3I5NA 3CLYA 1B39A 2PY3A 3AC8A 4OTPA 5AAGA 2OBJA 3UO4A 2YAKA 3QBNA 3NNVA 3LAUA 3CXWA 3SA0A 5FTOA 5H2UA 4DEBA 1ZYJA 3WF8A 3ZC6A 2GHGA 3BHUA 2QR7A 4E26A 3R1NA 5HVJA 1YOLA 2ONLA 4ALVA 3MJ2A 4QDEA 2JITA 4BGQA 1LPUA 4EHGA 5ETIA 4TT7A 3HV7A 4YZDA 5FDPA 4IH8A 2RFNA 4ORKA 4U40A 4F1MA 4GFOA 3AKKA 4O7ZA 2IJMA 4IDVA 4PL4A 2PZPA 4EK6A 2ZJWA 2VV9A 3RGFA 4X2GA 2FA2A 3D94A 4BFMA 3LLTA 3UQFA 4RWLA 3BU3A 3OWKA 4BDKA 2CNVA 3CPCA 4JLCA 3GUBA 4IVAA 3KN6A 4YJNA 4F6SA 2Y4IC 1UKHA 1ZYCA 4CTBA 5EHOA 3OROA 4IWOA 3EN5A 1IEPA 3QKMA 1U59A 4E5BA 1UWJA 1DAYA 4QD6A 2ITUA 2GNJA 4S32A 3W0SA 4W4WA 2J0LA 4O2ZA 4PMSA 5HHWA 1O9UA 4C0TA 3DKOA 1BYGA 1QMZA 5FXQA 3U6IA 2X2LA 5I4NA 3PVGA 4WA9A 1H1QA 4R7BA 4RVTA 4M69B 4DCAA 5JRSA 5CEMA 1XBBA 3CIKA 3NYNA 2XEYA 3UOHA 1KOBA 1PXNA 4G9CA 4FSNA 3RPOA 4D2RA 3EQHA 2YCFA 3R28A 4AFEA 4RJ4A 3L8VA 3RAKA 1H8FA 1PW2A 5DEWA 4F70A 5HVKA 4BJJB 5EI6A 3ULZA 2W96B 4BKJA 4TNDA 4XMOA 3ENHA 4L45A 3ET7A 3MW1A 4QPMA 4A7CA 4OAVB 2HXQA 3VVHA 3P4KA 1ZOHA 4LOPA 5BVOA 4FEWA 4MNFA 2GNGA 2R3KA 5CU2A 5CYIA 2RG5A 5ANOA 5K0XA 3GU7A 2WIPA 3HEGA 3PXRA 4AE6A 4C37A 3LFAA 4CT1A 4XJ0A 1ZYDA 2F7XE 3CE3A 4YHFA 2OZOA 4Y8DA 2I6LA 2QODA 4DHFA 1HCKA 4ZSJA 4HVGA 5HE3A 2XB7A 3LQ3A 3R7OA 4IANA 4BBMA 2B55A 5ANEA 4LMUA 1CMKE 3WIGA 4DDIA 1ZZLA 2H9VA 1KE5A 2OSCA 2UW4A 3LQ8A 2HIWA 2ERZE 4B4LA 4MXCA 4X6RA 2C6TA 3C13A 3NIEA 4IHPA 3R83A 2CCIA 3JPVA 3MYGA 5K3YA 5IDNA 5KBQA 3QQGA 4LFIA 4BKZA 1VEBA 2YA9A 4D2TA 4DGOA 2X8IA 5A4EA 3IOKA 5C8NA 5M07A 2B9FA 3A2CA 5AV3A 4DEIA 2ITTA 4E5WA 3BPRA 3MVMA 4M13A 3TNQB 2Z02A 4JDHA 3UBDA 4AFJA 1VYZA 3R8VA 3VUTA 4DE4A 1P5EA 2UZEA 4AG8A 2OICA 3ALOA 1GOLA 5LXMA 3AT3A 2IZUA 4PWNA 5JKGA 1YOMA 4CRSA 3EQCA 2DYLA 2XCKA 3R01A 4AZVA 1RW8A 3EN9A 1S9IA 4G31A 2WTCA 3EH9A 2XKCA 3NAXA 4BIEA 3W55A 3FMJA 2DUVA 3QRTA 3WOWA 3FJQE 4ZTQA 4OTRA 2QOOA 2HZNA 2IZTA 3U6HA 2XNMA 2PVKA 3KRXA 4UXQA 3AKJA 3WZUA 4I21A 2JFLA 3G9LX 4BI2A 3ANRA 2VO6A 4JR7A 3RK5A 3BGPA 4LRKA 3HV4A 3ROCA 3QF9A 1M2QA 3TACA 1E9HA 5HE1A 2G01A 2BZIB 3Q4CA 2GS7A 2UZVA 2VRXA 1SVEA 3NUAA 2O0UA 1XJDA 4EUUA 4FMQA 5JN2A 3DZOA 2WGJA 5ETFA 5HOAA 3MH1A 3FDNA 5M09A 1ZYLA 4DFLA 3BELA 4GIIA 1NVRA 1Z5MA 5EM6A 5HKMA 3W32A 3RVGA 3DXNA 4MCVA 4MVFA 3I0OA 2PU8A 4JRVA 4F99A 4FTIA 2WO6A 4ZTSA 2Z7LA 4LL5A 4FZ7A 5BVKA 3LM0A 2VWVA 2FVDA 4IAIA 3ORTA 4BR3A 3EKNA 5CEIA 3SAYA 4IAAA 4ANOA 3REPA 3A7GA 4MNEB 4ZTLA 4IB3A 3A7IA 3BLHA 4Y5QA 4IWDA 4S30A 1TVOA 5HBJA 1Q99A 3DNDA 2A4LA 3MB6A 3Q32A 4QYHA 4AAYA 4QTBA 2BROA 1WBOA 2FGIA 2OW3A 3DB6A 3G33A 3A4OX 5LMKC 1AD5A 3AMAA 4LL0A 3VS5A 2X7FA 2OU7A 4LI5A 4FSWA 2Y4IB 2E9NA 4GT3A 3C0GA 5HG8A 3VJOA 3GB2A 4DFZE 3OCSA 3HMIA 5BYZA 4AP7A 1URWA 1WVYA 3MBLA 2XKEA 4GKHA 4FRFA 3R7VA 2BKKA 4NCTA 4NFMA 4CFNA 3AD5A 3PJ1A 4UYNA 3OXZA 3PXYA 4F9AA 4HVDA 4AZEA 5CU3A 4JXFA 1G8AA 3TZ9A 2XM8A 3KXHA 2CGWA 4E4MA 3FQHA 1JOWB 2BAQA 3DGKA 1WVXA 3MSSA 3SGCA 1GIJA 1SMHA 4UMRA 4OBQA 3QA0A 4ZZNA 3F2AA 5LJJA 1T45A 3GC9A 2B4SB 2OIDA 4W9WA 4F63A 3A62A 3QGWA 4R78A 1HOWA 3QQKA 1G3NA 2DQ7X 2RKUA 3D14A 3LW0A 3NW6A 4I5PA 3O50A 4UWYA 3E8CA 3KRWA 4RRVA 4FKGA 2WELA 1XH6A 1JKSA 1UNGA 5IA5A 5DT4A 5AA8A 2V7AA 5GNKA 1XQZA 4F9YA 4QMQA 5J1VA 3E8DA 3GFEA 3EYGA 3FI3A 1QPJA 4K2RA 5AADA 4FKSA 3DK7A 4IVDA 4E5AX 3LFDA 3A8WA 3GQLA 4N57A 5CSHA 3IDBA 3EQBA 4R5YA 3TV6A 4RX5A 1H01A 5FBOA 2C0OA 2IVTA 3FMEA 3OP5A 3EYHA 4IEBA 2CHLA 2W1FA 4YJRA 1Y6AA 2GNFA 4DH1A 4M0ZA 2C3LA 3DFAA 2XIXA 2V5QA 3KB7A 4RFMA 2VTLA 4W4XA 2J6MA 3THBA 4UXLA 2J7TA 4I5HA 4KSPA 3E7OA 5I9UA 5IUIA 4BCNA 1UU8A 4GU9A 1FBNA 4KIKA 2XP2A 3DTCA 3QTZA 4X2JA 5IEVA 1OKZA 2OIQA 3GC8A 4IAZA 4JOAA 3F2RA 4YSMA 2YZAA 3FLZA 5E8VA 3RALA 4B9DA 2IW8A 5L2TA 4Z55A 5I9XA 1Y6BA 4FJVA 2OO8X 5HX8A 4RT7A 3LFFA 3U4WA 4C62A 3F9NA 5DHJA 4WSQA 3AC4A 1H24A 2VX0A 1PKDA 3PXZA 3LXPA 2BAKA 3E5AA 4AN3A 3ZEWA 3LQ5A 2QKWB 4B6LA 3PA5A 3V5JA 4KKGA 4ZTMA 1WAKA 3BQRA 3WZKA 4USEA 4EZ5A 4JDJA 2RF9A 4BGGA 2RFDA 2OIBA 2BCJA 3ZOSA 1VYWA 3Q4UA 4R1VA 4YJTA 4MD8E 3FI8A 3BLAA 1JSTA 3QRUA 3CJGA 4YPSA 3MDYA 2QO2A 4KS7A 4A9SA 1IRKA 1G5SA 4CNHA 4FF8A 4I4FA 4L00A 3E92A 5F1ZA 4G2FA 1PXIA 4HPTE 2A1AB 3BIZA 3C4FA 1AQ1A 1OITA 5IMEA 4R3CA 4HZRA 1GNGA 2HWOA 3ZLSA 4HGTA 4RA4A 4H05A 3C4EA 4TL0A 2PPQA 4C34A 4RPVA 4FZAB 1H0VA 3UG1A 3NUNA 3R8UA 2VN9A 2WTVA 3P9JA 5AIKA 3KA0A 4N6ZA 4BDEA 2G2IA 4GRBA 4PQNA 3ZRMA 1KSWA 3F61A 3TYKA 1KE8A 4KRDA 5HBEA 4IW0A 2YWPA 4RX9A 4ACDA 2RL5A 4ASZA 4C59A 5ANDA 2QOHA 3MH0A 2WEIA 3E87A 1GZ8A 3C50A 3NS9A 3HMMA 1IR3A 4RJ3A 3LE6A 3KF7A 1Y8GA 2GNIA 4KINA 3T8OA 1H27A 3OOGA 4G34A 3VBWA 3BBWA 4IACA 4O7NA 4BDAA 1YXUA 1ZOGA 4IJ9A 5JGAA 3FUPA 1Q3DA 4AW0A 1JKLA 1YWNA 2BRGA 2Y8OA 5IH6A 4HCTA 1J3HA 3ETAA 3CD8A 4Q9SA 4FNXA 3PJ8A 4LG4A 5DA3A 1Q8TA 4FV1A 3IW8A 4ZTNA 3PUFC 3LJ0A 3U54A 4KABA 1ZAOA 4Y83A 4MH7A 4FSTA 3QWJA 3R7GA 3ZFMA 3LCKA 2BZKB 2QI8A 3IDPA 1DAWA 4PY1A 4IXPA 5D7VA 4BIDA 4YUQA 3VAPA 4BBEA 5E8WA 2PHKA 3RTPA 4ZIMA 4CCBA 1J7LA 5E8TA 3DLSA 3QD0A 4I0TA 1OVEA 3IW5A 4C2VA 2W4JA 4FUXA 5IQAA 4TWCA 2YLFA 3CQWA 4IQ6A 4KWPA 3TV4A 3KVXA 3AT2A 4Q5EA 3DZQA 5AIRA 3TI1A 4EOIA 4K18A 3NX8A 5BYYA 1B38A 2X1NA 2RFSA 3G5DA 3KCKA 2QONA 4EK3A 4G3FA 4W8DA 2HOGA 3MV5A 3TTIA 4EWHA 3NUUA 4ZLZA 4KIPA 2C5OA 3QZHA 1JSVA 3OF0A 2UZBA 2WNTA 3ZBFA 3PPZA 2ITZA 5HLNA 4RJ7A 3MS9A 4C4IA 4F6UA 2IF8A 4F1TA 3RCJA 1ZMWA 2PVNA 3BV3A 5FDXA 4EKKA 5EQEA 2PZRA 2XNEA 1U54A 5DG5A 1KWPA 4FOBA 3QXOA 2GS2A 2P2IA 2H8HA 4L52A 3HLLA 4FV3A 2X9EA 3PY3A 4FT9A 3ORMA 3ZTXA 3AGMA 2ZV7A 2WD1A 4QP9A 4USDA 3W33A 3UPXA 2VTJA 4NYEA 3R2BA 3H30A 4GS6A 1ZMUA 4J8MA 2OJFE 4YC6A 3FE3A 3V5TA 3EQRA 4BYJA 2XNNA 4K1BA 5CT7A 5CEPA 2GCDA 4WBBB 3I60A 4UY9A 2WTDA 4XG2A 3BE9A 4O0VA 1CM8A 4YJQA 4D1SA 4GIHA 1BI8A 3FXXA 3QLGA 5HX6A 5JFSA 4JX3A 4M8TA 3UDTA 3F5XA 1OBDA 3FYJX 2W1GA 3NMUF 4XRLA 4RLLA 1PXPA 2C6OA 2G1TA 2VTPA 3HP2A 4GCJA 4W8EA 2UVZA 2XRUA 4QYGA 4TYEA 4XNEA 4FTNA 3OD6X 2C3IB 2F49A 2XKDA 4G3DA 4QP4A 1FQ1B 3JVSA 4YGAA 3TKIA 4O0XA 4S34A 4FVQA 4KSQA 5E8YA 5CAOA 5T6KA 4D9TA 5EKNA 3EQFA 4W9XA 4YJPA 3UC3A 4D58A 4DEHA 2CPKE 3HVCA 3JYAA 2ZB0A 3ID6C 3PA3A 4ASXA 5M4FA 1V0BA 5CI7A 3UYTA 4D4VA 2UZWE 4IIRA 3BKBA 3VUDA 5BNJA 4OTWA 3I6WA 4O4EA 1O6YA 3QRJA 3DAKA 3GFWA 3FZRA 2YJRA 2WQMA 3MH2A 3FMKA 5CY3A 3GP0A 5CF8A 3R21A 4D1XA 2NP8A 2PUUA 4DBNA 4WRGA 3LOKA 4TNBA 2VGOA 4G17A 4M67A 2I0YA 1NXKA 5H3QA 4EHEA 5FGKA 3R6XA 4FL1A 3SOCA 3VS1A 5EDPA 4A07A 4ERWA 4UMTA 4XG6A 3GOKA 4RMZA 4JJRA 3CGFA 3IW6A 5HD7A 5M08A 5I3OA 3PP1A 3PPKA 3ZBXA 3BYMA 4O1OA 3MY5A 3ZZWA 3FY0A 5E91A 5IQEA 2XJ0A 3RPVA 3GOPA 4YP8A 4WG3A 5EHLA 4JBVA 1YHWA 1YXSA 1YVJA 3L1SA 4OTIA 2XK6A 2JIVA 2GNHA 3B8QA 2I7QA 3DAJA 4FK3A 2UZOA 3R7UA 3CEKA 4IM3A 3ZXTA 3I1AA 5D1JA 5CT0A 5ANGA 4ZLOA 4YJUA 3ZO3A 3RAHA 1Z9XA 4X3JA 2ZM1A 4U5JA 4APCA 3D5VA 2OZAB 2ZB1A 4XG8A 3GCSA 4FICA 5FXRA 3DBDA 1PMVA 2C1BA 5ITAA 2Q0NA 5A4LA 5E92A 5KMLA 3V6SA 2PZIA 3C5UA 5DT0A 5HORA 2NYAA 4MK0A 3G15A 2DS1A 2J5EA 4PV0A 2CGUA 3KFAA 2WOTA 4F0GA 3F2NA 4YJOA 3W0NA 2C5XA 5JT2A 3VBQA 3SXSA 3OFMA 3BU5A 3UMXA 5AUXA 5E8SA 4CMOA 2BHHA 4DLJA 4QYEA 4U3YA 1PXKA 2XZSA 4PF4A 2O65A 4OAUC 5GINE 2PL0A 1PMEA 2J90A 5AUYA 3WF5A 1I44A 3CTJA 5DGZA 3MH3A 1OL2A 3R8LA 3TZ8A 3N4VA 1J1BA 4DC2A 4C4FA 2EXMA 2ZDTA 3D7TB 1XH7A 2C0IA 4U79A 3CJFA 2WMUA 4JS8A 2WMBA 5AWMA 2PSQA 3PJCA 3QYZA 2NPQA 4FV7A 4FYNA 2WU7A 4QMMA 3LXKA 4R7IA 5LVLA 4KUJA 5K4IA 4G9RA 2QCSA 2F2UA 2VTHA 2GNLA 2OF2A 4DFXE 4N4SA 3SW7A 3QUEA 3R9HA 2W1ZA 2WB8A 1VLRA 4WNOA 2XF0A 4D4SA 3PDTA 3G6HA 1H08A 4WO5A 3AC2A 2ZV8A 3SXRA 2F9GA 4FKTA 4FTLA 2GPHA 1Y8YA 3Q60A 2XBAA 4FK6A 1YRPA 2FSTX 2HK5A 2X0PA 1UU3A 3F3WA 3OEFX 3PJ2A 4JG7A 2ESMA 4X6QC 4ZY6A 3WYXA 4PP7A 1OGYA 5CLPA 2FO0A 4XX9A 3CKXA 1YWRA 2EUFB 3GCQA 1YI6A 2NRUA 2PZ5A 3QZIA 4L9IA 3ZH8A 2BAJA 4NWMA 5CENA 1YXVA 3I6UA 4DFUA 2QHMA 4X0MA 2WTJA 4D0XA 5BYLA 3ZLWA 2QOBA 2VO0A 4EUTA 1GIIA 5AP3A 3NFGB 4MXAA 4BB4A 2QQ7A 4A06A 3QQJA 5ICPA 3UP2A 4IWPA 3ORKA 3LFQA 4E4NA 5CTPA 5E1SA 2QNJA 2QOCA 4MXXA 2PWLA 3QQUA 1RDQE 2W4KA 2OWBA 3MIYA 3NVKI 4R3RA 4UB7A 5LVNA 4L53A 2VWWA 3COKA 5GZ9A 4O27B 3O8TA 5B0XA 1UV5A 4L43A 3BYOA 4ANNA 4IC7A 2WKMA 3NRMA 2Z7QA 4FIIA 4M3QA 5EM5A 4EK8A 5J79A 2W1EA 3QAME 4JQ8A 1W98A 4FOCA 4CZYB 3R9RA 2F2CB 3BL7A 3Q9ZA 5GJGA 5J95A 4RIXB 3O8PA 3UOLA 4YJVA 3E64A 5D41A 2Y6MA 4CFUA 5FXSA 4FV9A 3RNYA 3VQHA 2R3JA 2R3RA 4IADA 4Q9ZA 4BTKA 3R7EA 1KOAA 2CLQA 1BX6A 4TYHB 5CNOA 2QHNA 2X6DA 2VX1A 3ZEPA 5IQFA 2ONLC 4CZUA 3II5A 2XEZA 3QQHA 5KHXA 3P23A 3VF8A 3Q9YA 3AXWA 3VF9A 3VUKA 4KIOA 1PRYA 2E2BA 5EI2A 3U8WA 3WE4A 3FY2A 4J97A 5AR3A 3PRIA 3K2LA 4EK4A 4FSUA 5IPJA 1GZOA 3NYVA 4PX6A 4Y85A 3ATTA 4FTUA 2CMWA 4FG9A 4XBUA 3QA8A 4M69A 3SRVB 4EOJA 3PTGA 4CYJA 2A2AA 5J9YA 2YCRA 3OCGA 5CF5A 4CD0A 4RIYB 3FKNA 1KE9A 5EFQA 4BJJA 4D2PA 4IDTA 4OTFA 4F0IA 1S9JA 4IM2A 4IAFA 2BALA 3QTQA 4J53A 4ZSEA 1OIYA 1A06A 4I20A 2O8YA 4EOPA 3DS6A 3GC7A 4I4EA 3A7HA 4PNKA 4BGHA 4EC8A 3AMYA 3GNIB 2XIYA 4QTDA 4IZ5A 3AT4A 2JFMA 3HAMA 4GYIA 3NW5A 3R9NA 3LCSA 4FKQA 3M42A 1OPJA 1L3RE 1KV1A 2J2IB 2YAAA 3F3ZA 4NFNA 3O51A 4YMJA 2AUHA 3E7VA 3FXZA 4OLIA 5B2MA 5C8MA 4BF2A 4I6BA 4OUCA 4ZY4A 4RJ8A 4EBVA 4LQMA 4M7IA 4PL3A 1ZARA 3FEGA 2W9ZB 3QRIA 2WXVA 1AGWA 2JDTA 2XJ2A 3OC1A 5IEXA 4LGDA 1M7QA 2R0IA 2YFXA 3FC1X 4ANLA 2VGPA 2YM4A 4NM3A 5A46A 4YBKA 2RSVA 2X0GA 3QC4A 4OBPA 4RC2A 4JQ7A 4RIOA 3ZC5A 2WMRA 4DH5A 4C4GA 4F0FA 4W4YA 4N70A 2G2HA 3LFSA 4NM0A 3UPZA 3UQGA 4FI1A 2R3HA 2JEDA 3FMLA 4JBPA 3RINA 4KB8A 4RVMA 3DK3A 4OTQA 3ITZA 4DGGA 3MY0A 1Y57A 4Y46A 2H34A 2UW9A 3BGQA 4DG0E 1R0PA 2OGVA 1WBVA 3FL5A 1YWVA 1CKIA 4RSSA 4EONA 2IW6A 1UKIA 4ITHA 1OIQA 5DIAA 4KD1A 5IKWA 3UODA 4AOIA 4GV1A 3NVMB 3S95A 4CKRA 1SNXA 4JRNA 4TKSA 2RG6A 2EXEA 1P14A 1OIRA 1UU9A 3AQVA 3WIKA 3CQUA 3ELJA 2V55A 4OW8A 4KS8A 4AWIA 4Y73A 5KMIA 4PDPA 3NGAA 5CEOA 3F7ZA 1TQPA 4FGRA 4DYMA 4JAJA 3VUHA 3W2SA 3ZUTA 3FI4A 3O7LB 2GU8A 2ZAZA 5DBXA 3DJ7A 5DN3A 3E3PA 3MFSA 3Q9XA 3F69A 4EQCA 3PY0A 4YBJA 4CQEA 3CD3A 4I3ZA 3D0EA 2BDJA 4FNZA 5AR2A 3D83A 1X8BA 4O81A 3H9FA 5KE0A 3DOGA 3VS4A 4O0WA 2R3NA 3QALE 3TL8A 4BDBA 2XK7A 1J1CA 4ACHA 3MESA 5L8KA 1MRYA 4BDCA 4BHNA 4L01A 4QMOA 3IW4A 4MNEA 2R3MA 4XG7A 2YJSA 3HA8A 3TJDA 3WILA 4O7LA 5L2IA 3PXQA 3VRZA 2Y9QA 2PVLA 4BKYA 1ZY4A 4XV9A 4EKLA 1XHAA 5FP5A 2OKRA 3WF6A 3QZFA 3ANQA 3UZPA 3K54A 1ZYSA 4NU1A 5AP2A 3C1XA 2PVRA 2ZMCA 5KKRB 3VW6A 2UV2A 2R0UA 4L3JA 2YEXA 4IBMA 2X7GA 5AM6A 5JEBA 4KKEA 3U4UA 2GQRA 4O96A 4L42A 2YHVA 5LQFA 4C4JA 4O0UA 1W83A 1WMKA 4DLIA 2BDFA 2NNWB 2J9MA 3I5ZA 2BIKB 1M14A 1H1RA 4FIEA 1J7IA 3Q52A 4X3FC 1R78A 4QP1A 3VBYA 2QOLA 2FSOX 5LCJA 3WYYA 1URCA 4G3EA 4CMTA 4FKOA 2PUIA 2OH4A 4CZTA 4EZ7A 2C47A 3LLAA 4HOKA 2HZ0A 1SYKA 2JAVA 3BRBA 4CV9A 5IA3A 2ETKA 3PUPA 5TKDA 4H58A 4BCHA 2QG5A 4O84A 3M1SA 3ORLA 4F08A 4DINA 4NKSA 3TIZA 5H8EA 4X2NA 1G8KA 5L2SA 1OGUA 1HCLA 2GTNA 3HV3A 3LFCA 3QTUA 4P2KA 5L8LA 4I6QA 4ZSLA 4O0YA 1WBSA 2JC6A 4ACMA 2PZYA 2FSMX 4H3BA 5FEDA 2GFCA 3LCDA 3NSZA 3GEQA 5BUEA 3K3JA 3KL8A 5AUUA 3R1QA 4ZJJA 2OJ9A 3DAEA 5C1QB 3SXFA 4PTEA 3TNHA 3R02A 1BUHA 2X7OA 3QTIA 3V3VA 5HIEA 5I3RA 4QYFA 4NL0A 4FTMA 3G6GA 3KXMA 1ZMVA 3ZLYA 1KE6A 2V0DA 5CZHA 3PY1A 4DEDA 4E20A 3COMA 3R22A 2WTIA 4QOXA 4V05A 1W7HA 4ZTRA 3BHHA 3BYUA 4U42A 5BMMA 2C5NA 4BDFA