4U42A

Map4k4 t181e mutant bound to inhibitor compound 1
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
295
structure length
282
Chain Sequence
SSLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNTKGNTLKEDWIAYISREILRGLAHLHIHHVIHRDIKGQNVLLTENAEVKLVDFGTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMRALFLIPRNPPPRLKSKKWSKKFFSFIEGCLVKNYMQRPSTEQLLKHPFIRDQPNERQVRIQLKDHIDRTR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Plasticity and Kinase Activation in a Cohort of MAP4K4 Structures
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase kinase kinase kinase 4
total genus 83
structure length 282
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2014-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4u42A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4u42A01
4FTAA 2IZUA 4XLVA 4I4FA 4D9TA 1WFCA 3LQ3A 3KFAA 4FTUA 3HVCA 3KVXA 3D5UA 2CGVA 3K5UA 4Y5HA 3TUDA 3SX9A 3KULA 4NW6A 4L7SA 4YLJA 3OT8A 4AW0A 4LOOA 2OXXA 1DS5A 2JBOA 2V55A 3F61A 4YJOA 5AADA 5E92A 2GTNA 3ULZA 2P2HA 4D1ZA 5IQBA 3I79A 3R8PA 5HD7A 2IN6A 4EH4A 4FIGA 4FV9A 3QQKA 5FEEA 2Z7QA 3UC4A 1WBPA 4R78A 2FSOX 1JVPP 3FI2A 4GW8A 1Z57A 4J53A 4B7TA 4O6EA 5F20A 2Q83A 3KRRA 3Q9YA 4DG0E 4IDTA 2QOQA 2JD5A 3KXGA 5CU6A 4RIWA 3D4QA 5C27A 3ZSIA 3E3BX 3TIZA 2YM3A 4G9CA 3SA0A 1FMKA 3RPSA 2BILB 2YJSA 3HV5A 4IB0A 4RFMA 3CXWA 3R7UA 3KXNA 4CXAA 1GZKA 2W1CA 4ANSA 1GJOA 4EOMA 3AGLA 4U9AA 4CYJA 2BAQA 2ZV7A 4IZ5A 2QQ7A 3R9HA 4RMZA 1ERKA 2PVNA 3GOPA 1KV1A 4AU8A 2YFXA 3E87A 1OZ1A 4RWLA 3Q5ZA 4FG8A 4TYHB 2DQ7X 4E4NA 4C57A 1MRUA 2RF9A 3CC6A 5DHJA 3RI1A 3TDWA 4ZSJA 2BRBA 3ZO3A 4IEBA 4EHEA 2VWBA 2WO6A 4FSRA 2WTVA 5A4CA 3EKNA 3C13A 4HCTA 3RCJA 3FMKA 2F49A 4RX7A 3PJCA 5F4NA 3R00A 4CCUA 5IEYA 5HIDA 2B0QA 3GEQA 3K3JA 3W2PA 4ACCA 4D5HA 3FE3A 3CTHA 2YLEA 4I5HA 2R3NA 2Y4PA 3BWFA 1JAMA 3RHKA 3EN5A 4NJ3A 4YZCA 4JR7A 3OCBA 4JR3A 2F9GA 3F5UA 4BL1A 5HNIX 4XS2A 3COMA 3DAJA 4KKGA 4FZ6A 1OMWA 3ANQA 3OZ6A 3GQLA 2C5NA 5D7AA 4CKJA 4ORKA 5IQDA 4U41A 2RL5A 3ZDIA 2WQOA 3CSVA 4FV6A 2GHMA 2QR7A 3QUPA 3JUHA 4RA4A 4XLIA 4X6RA 2JLDA 4RIOA 4XH6A 2R3JA 5EOLA 2PU8A 4YC6A 4NFNA 5A6NA 2R4BA 5H3QA 3GU6A 3NCZA 4FA2A 1KV2A 5BUIA 2O8YA 2FYSA 3WF8A 1H24A 4C38A 2VO7A 3ZTXA 4YO6A 3LCOA 4O2ZA 4F64A 4QQJA 3LCKA 3ORIA 2ZYBA 4FSZA 4I3ZA 4UYAA 2CCHA 5C9CA 3F3WA 3DGKA 1OITA 2B53A 2FB8A 2VWXA 2QNJA 1IASA 3PSCA 4I24A 4ZZOA 1XO2B 2C3IB 4L3PA 3DXPA 1FOTA 4HCUA 2ZV2A 3ZM4A 3GCSA 3QQLA 3MA6A 3W2CA 4NM3A 3OTVA 3M1SA 1Q8YA 2WMBA 2R3PA 4IAZA 4DGLC 2BZIB 4Y8DA 4RX5A 4MXOA 1PXLA 4ZTSA 3VW6A 3GC8A 1YDRE 4QNYA 4BDFA 3V5WA 4X2GA 2R0IA 4QP9A 1H07A 3PA5A 4O0RA 1R0EA 1YI3A 5CX9A 5JK3A 5CU0A 3G2FA 2BCJA 2OIDA 2XF0A 1JKLA 3R2YA 2BFYA 1APME 2WMSA 4IVBA 2IZTA 4D2SA 3LFAA 3EYGA 3LZBA 2XIKA 5EQEA 3FLYA 3QC9A 3F3VA 1SZMA 2P55A 2OJJA 1WCCA 4IX5A 4U43A 4E5BA 4DITA 4M97A 3DBQA 3PZHA 5HG9A 2QHMA 3BGPA 4EQCA 3DA6A 4I20A 3K2LA 2I0VA 4PPCA 2Z7LA 3VUMA 2IVSA 2QLUA 5IDNA 1O9UA 1WVXA 1GIIA 1H1PA 3MSSA 1PW2A 2VTJA 3ORNA 3P78A 5IUIA 1I44A 4B8LA 2PZIA 2ONLC 2FO0A 3PXKA 4ZY5A 4I4EA 4RBLA 4IAIA 5HX6A 2QODA 3NW5A 3FXXA 2JFLA 2B9FA 5I0BA 4KABA 3E63A 2DUVA 5KBRA 2WELA 2WMTA 3RPYA 5ACBC 2JC6A 2BHHA 3U9CA 3LFDA 4BRXA 2C3JA 4C2VA 3BQRA 5E7RA 5J9ZA 4NTSA 2WZJA 4ALVA 5HOAA 1GIHA 1H1SA 2ZMCA 2W96B 3D7TA 4FTNA 4XHKB 3TWJA 3Q32A 4EOSA 4G6NA 2A2AA 3KB7A 3QKKA 2R3MA 1TQPA 3FAAA 4KINA 3PP1A 5EM8A 4HYUA 5A6OA 5CAPA 4A9RA 4FV1A 2FUMA 4QPSA 4TWNA 4L44A 4BCJA 3UIUA 3DZOA 2J0MB 4DFLA 4GT4A 3LFFA 4O91A 2B55A 5KNJA 4MD9E 5L2WA 4O0TA 3FMDA 3KC3A 3ET7A 4ZTRA 1XH5A 4FI1A 4F4PA 4ENYA 5LJJA 4AZFA 4JL9A 3SD0A 2O3PA 2ZDUA 3QTIA 3VUGA 1PYEA 4O7RA 4DEAA 3DAEA 3PZEA 4RX8A 1YQJA 2OZAA 2UW9A 2XUUA 3L9MA 3SHEA 5BUJA 2G15A 1OM1A 3VHKA 3NUAA 3TUBA 3MB6A 3F2AA 4XRLA 3WIGA 3LCSA 4BDEA 4Q5EA 3QTUA 5HHWA 4FIEA 3BE9A 4I41A 4FTQA 4HOKA 2CN5A 3C0HA 3CPCA 2PE0A 1BI7A 4N6ZA 3QQFA 5EQPA 1VJYA 3O8UA 2WOUA 4RZWA 3SC1A 2IZSA 4FC0A 3FY0A 4FGRA 2UZEA 5D9HA 5EHLA 2C6IA 4GK3A 2XM8A 5FDXA 5IA1A 4C36A 5HG8A 4RVMA 2PVMA 3NYOA 4BCMA 5CNOA 4HGTA 4ID7A 4V01A 2QONA 4IJ9A 3PXYA 3HAVA 3TTIA 5IQEA 3RWQA 5AM7A 4IB5A 1DM2A 2GNIA 1E9HA 4NM7A 3RBWA 4ANBA 1REJA 4HNIA 3IOKA 2XK7A 3PWDA 4UZHA 5HKMA 5J87A 3SW4A 5KO1A 2PMIA 4RFZA 5C4KA 4FG9A 1K3AA 3H9OA 4ZTQA 4L8MA 3O0GA 5EHOA 2DYLA 3FWQA 2XJ0A 5HICA 3HV6A 3LAUA 3TUCA 2JDOA 5CI6A 1Y57A 3A60A 3LXLA 4BC6A 2PUPA 1JSTA 2AYPA 4JIAA 1PMVA 5IG1A 3R28A 5I9UA 4IWPA 5CALA 2FA2A 2BRHA 5AUZA 4XBRA 1IR3A 4OAVB 5CEKA 4NIFB 1RDQE 4XYFA 1LP4A 2ERKA 3RALA 1URWA 2UZLA 2W17A 2QI8A 3POZA 4MBLA 4CGAA 1ZARA 2GHLA 1U5RA 1YXVA 4FKIA 4J7BA 4NJDA 3CQUA 4OTGA 2XK6A 5JGDA 3UNJA 4YNEA 2FSMX 3WZDA 3IDCA 3BRBA 3P5KA 2PTKA 1U54B 4ITJA 5B2LA 3PE1A 5LXMA 2WQNA 3D83A 4KKEA 2C6OA 4Q2AA 3R9NA 2C3KA 4YC3A 4ZSLA 3U51A 3F2RA 2J5EA 4GK2A 3GFWA 5EDQA 4E5AX 4BR3A 4HYIA 3WE4A 4F0GA 3QLGA 4D28A 4HJOA 4C4IA 3KMMA 5CSHA 1UA2A 2ITOA 4BZOA 3PRIA 3RVGA 3OC1A 5BYZA 3RK9A 3JYAA 3ROYA 4BCIA 4D4RA 5EI6A 2UVYA 5G1XA 3CKWA 5CLPA 5AIRA 2IZRA 1PXOA 1VR2A 2W4JA 4ZS0A 5AR5A 3PJ2A 4DA5A 3DKGA 4YNOA 4EK5A 5BVKA 4DT9A 3QTQA 4UMTA 5TO8A 4N70A 4KUJA 3C4ZA 4MBJA 5DT4A 4ZTLA 4XP0A 3H3CA 3MS9A 4MQ1A 5HE1A 2B54A 4UN0C 5HLNA 5E9EA 3KGAA 3O50A 4DEGA 3LLTA 3BGQA 3DQWA 3AC8A 2ZOQA 3AMAA 4H39A 3ZU7A 4YZDA 3H30A 2IJMA 4H3PA 4F1OA 4EK3A 4YJRA 4F7LA 1YHWA 4LGDA 4RJ8A 5JEBA 2ITQA 4GKIA 2X2KA 2VTNA 1XJDA 2X1NA 3OTUA 3LW0A 2X6EA 5ACKA 1U46A 2BTSA 4MXAA 3VS2A 4W4VA 5CTPA 4E3CA 4ZTNA 1UWJA 3QA8A 4ANLA 4BICA 4E73A 2LAVA 1M7NA 5AR4A 4CRLA 3JR1A 5EG3A 1PMEA 5KMLA 2GNFA 2VTOA 3OEFX 1EH4A 4ANQA 4GFOA 1ZYJA 4K33A 3NNUA 3ZXTA 3EQPA 3L9LA 2BTRA 1W8CA 3ZS5A 5IA2A 1U59A 4O0WA 1CSNA 5GIOE 4E20A 4TPTA 5BQ0A 4EHGA 5E1SA 2PPQA 3OWJA 4XP2A 3CY3A 5HLPA 4C3PA 3U6IA 4OBOA 4EL9A 4EWQA 3QRTA 2GNGA 2UZDA 4QMZA 4JAIA 3SKCA 1UU9A 3B2WA 2FH9A 3DFAA 3EN6A 1AGWA 5TE0A 1YXTA 2CKQA 5AP1A 3WE8A 2BRNA 5CVFA 1FBNA 3GCQA 4XG2A 4JX7A 3TNPC 4PQNA 4X6QC 2P3GX 5HU3A 4K8AA 1UU7A 3MBLA 3H9FA 1STCE 4C4FA 4C02A 4ZAUA 4FZ7A 1GOLA 2WMXA 2WAJA 3NDMA 3R0TA 3KXZA 4V0GA 3TNHA 4KRDA 5D7VA 1JQHA 1M7QA 4XG7A 1FVVA 3N4TA 2YDKA 5LOHA 4TYJA 2W1ZA 5EW8A 2J4ZA 2X39A 3GVUA 5HG5A 4MQ2A 3HMMA 5AP6A 3A7GA 4A4OA 4DH7A 3UZTA 2OH0E 3SLSA 4TW9A 4AP7A 2CGWA 4M8TA 4MD8E 4RWKA 3CPBA 4D9UA 5I9YA 4AWIA 4EYMA 1XBCA 2H9VA 4IZYA 4FK3A 4AXAA 1ZMWA 3AD6A 3ODZX 4G17A 4U80A 3WOWA 2DWBA 2VN9A 5AR3A 5A14A 4E4XA 4WG3A 4FKJA 4RIYA 4R7HA 4TXCA 4C62A 4GG7A 4EOOA 2W1IA 1R78A 1H26A 2XKDA 2XNOA 3Q4TA 2G2FA 4J52A 4CD0A 4DF3A 2R3FA 1OPJA 4NTTA 5FBNC 3ZC6A 4FV8A 2X4ZA 4HPTE 3NUPA 1SVEA 5JRQA 3EQCA 5F1ZA 1OKZA 5HEZA 3FLSA 2J0LA 2Z7SA 4CVAA 3C4CA 1J7IA 2QR8A 3CR0A 4GT3A 2WMAA 4F0IA 2VTTA 2YM7A 4EHVA 4PMMA 2A0CX 4IACA 5CAOA 4MAOA 3FXZA 4I94A 3C7QA 3D5VA 3ZONA 5KMMA 4S31A 2G01A 2QVSE 4IX4A 4M14A 3NPCA 5DEWA 3WZJA 2W0JA 3D7TB 5FTQA 2WD1A 4QD6A 3F7ZA 3OP5A 2V0DA 1ZZ2A 4FUXA 3FLWA 1XH9A 3QCXA 5DPVA 2OWBA 1IA8A 5EHYA 4FSTA 2A19B 2CCIA 3OROA 1WBOA 2NP8A 4U40A 3WF5A 4DFZE 1W98A 1BL6A 3MDYA 3NSZA 4RJ7A 3SG8A 4C3RA 4E5WA 2X2LA 4IAFA 2HWPA 4GYGA 2VV9A 2OIQA 4I1ZA 4NM0A 5CEPA 3OW3A 2XS0A 3V5LA 5DE2A 4BHZA 4TYEA 2EB2A 4BTJA 1OL5A 4DTBA 4AW1A 1H0VA 3NRMA 3PA3A 4P7EA 3DY7A 1MRVA 1WBTA 5L2QA 4OTWA 4CTBA 4MNEB 4RIXB 4TTHB 3R8MA 4QMPA 3M11A 3FSFA 5K9IA 3R71A 5LMKC 4F1TA 3V01A 1NW1A 4L42A 4JRNA 4L01A 2VWUA 4E7WA 3DT1A 4ASZA 2J90A 3F5GA 2NO3A 1W84A 4PTCA 4UALA 4WRGA 3VJOA 3QC4A 2YIYA 3C4XA 3OEZA 3HL7A 3NEWA 4QRCA 3CGFA 4YR8A 4IFCA 4N4SA 2HY0A 4LYNA 3FPMA 1KE9A 2W99B 3QZHA 3UE4A 3CS9A 2XK3A 4PP9A 5EM5A 3COIA 1YXSA 2GMXA 3G5DA 1H08A 2CKPA 3DTWA 3HMOA 3OWLA 5C8NA 5LVNA 4X2JA 4O81A 4WKQA 4RJ6A 5C03A 3VS4A 2Q0NA 3LM5A 4RQKA 5I9VA 2EVAA 4GK4A 5E8WA 2QKWB 2V7AA 4NCTA 3AQVA 5L2IA 3O8PA 5CF8A 1H1QA 3LMIA 2PYWA 4U45A 5IISA 3U55A 4UY9A 5H8EA 1SMHA 1YXXA 1WZYA 4CKRA 5GZAA 4RC4A 4CLIA 4J97A 3A7FA 3GC9A 3RGFA 3TCPA 3VUHA 1KOBA 4ANNA 5KKRC 1UWHA 3AC5A 3GC0A 3MVLA 4R5YA 2BVAA 4IVAA 3RNYA 3EWHA 3A8WA 2FSTX 2J2IB 2PVKA 2HZNA 2XP2A 5FBOA 2YIXA 5IUHA 4CNHA 1CKJA 1SNXA 4MX9A 1PF8A 4C4GA 2BHEA 4F1MA 3WF9A 1Y6AA 1M14A 2OH4A 2CLXA 3TV6A 5AP7A 3RWPA 1J3HA 1OIUA 2HCKA 2H34A 2OXDA 4LRJA 3CP9A 4X2KA 3OCSA 5CEOA 3BX5A 5JH6A 2ONLA 5ANJA 5M51A 2HZ4A 3QX4A 2ZMDA 4B9DA 4AT4A 2R5TA 3F66A 5EK7A 3MPTA 4ALWA 4EOLA 2YWPA 5CSXA 5DT0A 4DBXA 2XKEA 4FL2A 4GU6A 5CI7A 3VS7A 1SVGA 3C0GA 3BYSA 3KN6A 4FT9A 4FV3A 4WUAA 5J8IA 4DH3A 4UWYA 4CFMA 4CFVA 4O7ZA 4PX6A 4RWIA 4NU1A 1K9AA 5HCXA 4USEA 4CV9A 4R6VA 2UZVA 3HP5A 3R83A 1A06A 3AT4A 3QYZA 1TKIA 2OSCA 1BKXA 4DHFA 4S34A 4JG8A 5AAEA 2GQGA 2X7GA 4ZEGA 4ENXA 4IC8A 3KF7A 5EYDA 3R73A 4FZAB 5HO8A 3SXSA 4EH6A 5BYYA 3ZZWA 4FEXA 1Q99A 3DB8A 2REIA 4FMQA 3FDNA 3I7CA 5CS6A 4UMPA 1NY3A 4GU9A 5E8YA 2XRWA 1IAHA 3QRJA 2OJFE 3TV7A 5FXSA 5IH5A 3PXZA 3PYYA 3LFNA 3UOHA 4G3EA 5G6VA 1GZ8A 4FTJA 4GG5A 4IM0A 5C4LA 4UB7A 4CTCA 3OBGA 2UW5A 2QU5A 5AMNA 1K2PA 3Q6WA 4G3FA 3WYXA 3K3IA 3L8VA 4DH8A 1LEWA 3HA6A 4APCA 3VUTA 2JKKA 3PLSA 4RGJA 5LMBA 2OO8X 2WU7A 5AM6A 2I0EA 2BIYA 5T3QA 1H01A 5KKRB 3KF4A 5HVJA 5JT2A 2V22A 2R3OA 4BIEA 4CMUA 2CGXA 3TKIA 5J7HA 4RVKA 2X9FA 5ICPA 4EJ7A 1BUHA 4I23A 3EQBA 1ZOGA 1AD5A 3E92A 4KS7A 1Q5KA 2E9PA 1IAJA 3EL7A 3ROCA 5IQAA 3CGOA 4O27B 3AT2A 4OTHA 4Q9SA 4TL0A 5FLFA 3AC1A 1ZRZA 1V0PA 3ZO4A 3ZLYA 3Q3BA 4BDCA 4D4SA 5KMOA 2JFMA 5LQFA 3MFSA 4WSQA 2QG5A 4Q5HA 3VBWA 4C4HA 1UNGA 3Q2JA 3V6SA 3C4FA 4MBIA 4LOPA 3UMXA 3NX8A 4NEUA 3TI1A 5CSWA 2B4SB 4Z9LA 3BHUA 3POOA 1W7HA 4F6UA 3OOMA 4M0YA 4JQ8A 1OKVA 3DJ5A 3DU8A 4KRCA 3V5QA 1MQ4A 2GU8A 4XP3A 5CU3A 3KY2A 4E6AA 2W9FB 3PSBA 4RG0A 4XV9A 5IDPA 5AV2A 3UNZA 1VYWA 4GCJA 2YCFA 1OECA 1XHAA 2ITYA 3QQUA 5AP0A 4AA5A 3V8TA 2B9IA 4L67A 3UQCA 5AR7A 4ZJIA 5E8SA 5GJGA 1UKHA 1URCA 4QMLA 3DK6A 3SGCA 1PXJA 3C5UA 1VYZA 3BYOA 3TZ9A 4CZTA 2G2IA 3LXNA 3FY2A 4M67A 4KA3A 2XJ1A 3LE6A 5JKGA 4JBOA 4YHTA 2V7OA 4AN9A 2X8EA 4LI5A 3DJ6A 3MFTA 4KBAA 1KOAA 4B4LA 3QGYA 4BGQA 3KQ7A 3I60A 3IPHA 3S1HA 4AOTA 3BU6A 4GFMA 3EH9A 3ZXZA 5HE3A 5JMSA 2CNQA 3VF9A 4D2PA 5DEYA 4K9YA 5CU2A 3RM7A 4FOBA 4O0XA 4I0SA 4Y95A 1BLXA 2YM4A 4FSUA 4O82A 4ZSAA 1OBDA 5CEMA 3VAPA 2VTMA 2QOKA 2OZOA 3LFQA 4YBKA 3GU4A 4IE9A 5DR2A 1ZLTA 2EWAA 2IVUA 2OW3A 1OIRA 3LQ5A 3O2MA 4IH8A 4LQMA 4EH8A 4DE4A 5DIAA 4DTKA 5BMSA 4D0WA 4F99A 2IPXA 4FIHA 4XOZA 2PUNA 4BWPA 1OUKA 2B9JA 3D5XA 5AA8A 3MN3A 4IB1A 4ONAA 3FC2A 3REPA 3PSDA 3QX2A 4LRMA 4QMMA 2BUJA 3F5PA 3QF9A 4NSTA 5T68A 4YGAA 4O0VA 4RC3A 3MA3A 3VULA 4QTEA 3LLAA 4FV4A 3EN9A 2XM9A 3C51A 4F63A 3R9RA 1UVRA 4FOCA 4JNWA 4AFJA 5JFXA 2PWLA 3QWKA 3VQUA 3WILA 4X3JA 3G6GA 3TXOA 5EH0A 4R1YA 5L6WL 3QKMA 3TACA 4DGNA 2R3KA 5CASA 4BDIA 2C5YA 1IEPA 3LFCA 5A4QA 3ERKA 3OXIA 4MXCA 2X8IA 3FKLA 4BCPA 1JBPE 3ZFMA 4YSMA 5EYKA 4DH5A 5GHVA 5DT3A 2RFDA 2W1DA 3LJ0A 4U44A 4XX9A 2V5QA 2OU7A 5CT0A 2C4GA 1WBNA 1WMKA 1KSWA 4PMPA 2PUUA 3C50A 3HZTA 4JDHA 1QPJA 4E6QA 3U6HA 4I6BA 3V8SA 4UWBA 4EC9A 3IW6A 3WZEA 1MQBA 2C0TA 4FZFB 4F08A 1HOWA 3BHHA 4ERWA 2E2BA 1JKTA 5L6OA 2BAKA 3PG1A 2QOBA 4PL3A 4BDHA 4AGUA 4QMNA 2WTWA 3UBDA 4CYIA 4U81A 3E3PA 4EOPA 4EC8A 1X8BA 3E62A 3I6UA 4AA0A 4BN1A 1WBVA 3BHYA 4B99A 3FZ1A 3PY3A 1XH6A 3SDJA 2IW8A 2W06A 1BYGA 3L9PA 2ITUA 5AUYA 4YTIA 2XBAA 4RT7A 5H2UA 3NWWA 4FVPA 3VS1A 1MP8A 1SNUA 3MGYA 4YZBA 4F70A 4YURA 3QCQA 3R9OA 5CZHA 2HY81 3HUBA 3U4WA 4BDDA 3UPZA 4CMOA 3QFVA 2O5KA 3DK3A 5GJFA 3BLQA 4O21A 4KWPA 4O7LA 4GRBA 2H6DA 5M09A 3ATTA 1P4OA 2IW6A 3BBWA 3GCUA 3OXZA 5AEPA 5HESA 4QYFA 2UZOA 3MJ2A 2YZLA 5DRBA 3W16A 3I5ZA 5AR2A 1H8FA 2BZHB 2R64A 3PRFA 4CEGA 2W7XA 1GAGA 1QPDA 4L45A 4D5KA 4NW5A 1GNGA 3R8LA 4TWOA 1ZMUA 4OBPA 5AAGA 3SXFA 4AZWA 3VBVA 1KE7A 3PJ8A 4MVFA 3G9LX 4GMYA 4YJSA 4YZMA 4BF2A 2C0IA 1J7UA 2PVRA 5BYLA 4EQUA 3HMNA 3F2NA 3FSKA 1IG1A 4L9IA 4KNBA 3ZBXA 2JGZA 3BYMA 4FT3A 4ZMEA 5M08A 2VGOA 2OG8A 2IVTA 2VO0A 3S2PA 5EQYA 3LXPA 1OPLA 3UP2A 5AUXA 4RIYB 5FGKA 3R1YA 3FZOA 1P4FA 3ZEPA 4C3FA 2RKUA 4O22A 4TY1A 4F9BA 4ZSEA 4FV0A 4GUEA 2I0YA 3A62A 4PL4A 4QP2A 3DXNA 1I09A 5DMZA 5J1VA 4RVTA 4OAUC 1JSVA 4JJRA 4FTMA 5ETIA 4FEVA 3ELJA 3V5TA 5TF9A 3MY0A 4H1MA 5HE2A 4AFEA 1YI6A 2C6EA 3A4PA 3FYJX 4U3YA 3A4OX 4EOQA 3OF0A 4ZLYA 3IDPA 2KTYA 3ID6C 2YAAA 4V0GB 5B7VA 2PVJA 5E8ZA 5IQHA 1F0QA 3D2KA 3Q53A 5IQFA 3EQFA 3NYXA 3WZKA 2WXVA 2VO3A 3KVWA 2BRGA 5JFSA 2J0JA 5HTBA 3BELA 5K0KA 4YBJA 3FL5A 5GNKA 4I5MA 1Y91A 4JS8A 3W2QA 4QQTA 3KK9A 4OTIA 4C59A 5AV0A 4WBBB 4D2VA 1UV5A 2Y4IC 2GS6A 2YWVA 2UZWE 3KEXA 4I5CA 2BFXA 1Q62A 3C4EA 4OT6A 5AWMA 4EKLA 4EORA 4IW0A 1OGUA 3ZUUA 3Q4ZA 5HVYA 4BDJA 3VS3A 5CXHA 4J99A 5HTCA 4Q9ZA 2WIPA 2ITVA 3JPVA 2RFNA 3LFSA 1R39A 1ZY5A 3BQCA 3C1XA 5CEQA 4BTFA 4K18A 2P0CA 4QMYA 1YDTE 2HW7A 2XIYA 4F9WA 1FVRA 5D12A 1Q8TA 5BPYA 3GU8A 4Y73A 3TL8A 3PP0A 1UNHA 3ORXA 4JRVA 3BE2A 1RQQA 1YWVA 3GP0A 3DZQA 4EH3A 4LV5A 4Y72A 3THBA 4ERKA 2EUFB 5HZNA 1SVHA 5LVOA 2XNPA 1OPKA 2HK5A 5AP5A 1YI4A 2WTKC 3I81A 3GENA 4FR4A 2X2MA 3F3TA 1WBSA 1OL1A 5AJQA 3A8XA 3I0OA 3UPXA 1E1XA 4N57A 4O84A 4I92A 3C9WA 4QYHA 4S30A 5E4HA 1OUYA 4FUYA 3SQQA 3I4BA 3ZUTA 4UYNA 1SM2A 3A7HA 1L3RE 2W1HA 3H0ZA 4ZJJA 4FEUA 5CNNA 5FXRA 5KMKA 2A1AB 2OK1A 3FQSA 1O6LA 4RC2A 3HMIA 1YRPA 3LMHA 1DAWA 3AD5A 3FJQE 3ZFYA 5DNRA 2ZV9A 4Z7HA 4R77A 5KZ0A 2ITWA 3IK3A 5BUEA 5IH4A 1JSUA 1YXUA 4FSQA 3RK7A 4FTTA 3FZTA 4LMUA 3RKBA 3SV0A 3LJ2A 5FQDC 3ZC5A 4AOJA 2GS7A 2WMWA 4CRSA 3H10A 1FMOE 3HMPA 4MK0A 2LGCA 4C4JA 2Y0AA 4G3GA 4C4EA 3NIZA 1FINA 3E8NA 3LCTA 3BGZA 3IG7A 4AT5A 4PWNA 5IA3A 2VGPA 3DTCA 3TJCA 1B39A 3MESA 3FL4A 4LL5A 3JY9A 3IS5A 4PV0A 2NRUA 3UO4A 2Y4IB 4BI2A 3EMGA 3AMBA 2ZM4A 4V05A 3QZGA 1YOJA 3UYTA 1Q41A 3MH1A 2PZRA 1KE8A 2I40A 3QD4A 4ZZMA 5DA3A 4EOKA 3IGOA 2FVDA 2ETRA 3NNWA 5AUWA 4C8BA 5L4QA 2CLQA 4JT3A 4FV2A 1DAYA 3FMHA 4Y85A 3WIKA 2XH5A 5LVPA 2WTIA 4G3CA 2PHKA 3BBTB 2UW7A 3QQHA 3CY2A 3GI3A 4ACDA 2R9SA 3DCVA 4FIFA 4QT1A 3FV8A 1UU8A 5BX0A 4FTLA 3EHAA 4FKVA 4PMTA 5EM7A 3NZ0A 4BCGA 4YTCA 3HRFA 2UZUE 1QCFA 2RSVA 4D2RA 2V62A 4DAWA 5FUTA 3PPZA 5CF5A 4RLLA 3RPRA 5C26A 3EFWA 2XK8A 3A61A 2VTQA 4NKAA 4OLIA 4QMWA 3E8DA 3AT3A 2QOHA 3IO7A 4BY9E 5DLSA 2CNVA 2BALA 1RW8A 4ACHA 2QLQA 4PTGA 1KUTA 5BVWA 5J7BA 3KMUA 3GXLA 5LVMA 4MEDA 4NFMA 2GTMA 5DFPA 1WBWA 5DGZA 3AGMA 3K54A 1ZWSA 2YITA 5J5TA 3PVGA 3F5XA 4PL5A 3FKNA 3PY0A 3R04A 5HI2A 2HXQA 4PP7A 4RWJA 3MTFA 1VZOA 3W55A 4DLJA 4F7NA 3EB0A 5M4IA 3BU5A 4HPUE 3UNKA 3ZM9A 3OMVA 4UMQA 4XBUA 3H9RA 4ZJVA 4YPSA 2YM6A 4I5PA 1G3NA 4YJUA 3W32A 4WD5A 4AZVA 2W1EA 5I4NA 3RPOA 2C6KA 3S95A 1Z9XA 2GNJA 4HCVA 3FZPA 3CTQA 4IQ6A 3VS6A 2PMOX 3D0EA 3SRVB 4KD1A 4FNWA 1LPUA 3FKOA 3HGKA 4DG3E 5CAQA 4IIRA 4RJ5A 3OBJA 1HCLA 3FMJA 3LFBA 2HXLA 4FTRA 2Y6OA 4FNYA 3LCDA 2JIVA 5ETFA 4B8MA 4NZWB 3F9NA 3NR9A 3U87A 3V5JA 4QP4A 3PJ3A 1M52A 4NK9A 4BCKA 2UW8A 4ZTHA 4AAAA 2Z8CA 1R1WA 4YJQA 4K11A 3O23A 4MH7A 4KIOA 5D41A 3QRUA 5FM2A 4JQEA 3UP7A 2PVHA 4IAKA 2J7TA 1JNKA 2JKQA 3NUXA 4R3CA 3KREA 2G1TA 3IOPA 1V1KA 1M2RA 3UTOA 2JEDA 1JPAA 3TNIA 3ZHPC 3AMYA 2ERZE 3OY1A 4AUAA 4UMUA 2CPKE 5GZ8A 3COHA 4OTDA 2IVVA 1E1VA 4UX9A 4I0TA 1ZXEA 3VNTA 2YCQA 5HBJA 2WTJA 5L3AA 3SW7A 2VNWA 2R3IA 3COKA 5H8GA 3HAMA 2Y8OA 4S33A 4ZMFA 3HNGA 2VNYA 5EDRA 3RZBA 1Z5MA 2VO6A 2WMVA 3UMWA 3ZBFA 1CKIA 2JAVA 5JN2A 1ND4A 3KA0A 1AQ1A 2F4JA 4USDA 5AX3A 3ATSA 1TVOA 3AC2A 2I7QA 2JIUA 2OBJA 1JWHA 5BVOA 3WI6A 4AT3A 3EFLA 3ORPA 4WT6A 4WG5A 2W9ZB 3OW4A 2R3QA 4PDOA 4A9UA 5JQ5A 3OHTA 1NXKA 2XKCA 2WMUA 4II5A 5A46A 3F82A 4HYHA 4IVCA 3BEGA 1H27A 2C5XA 2GS2A 3HDNA 5DOSA 4DBNA 4NWMA 2JDTA 4G5JA 3BYUA 1XR1A 3DLZA 1J7LA 3ENHA 4QMXA 4ANOA 2CGUA 2Y6MA 4BYIA 4D2TA 4QTDA 2QCSA 4CQEA 3E88A 2C6TA 3Q9XA 4QPMA 4QP8A 5DWRA 3C5IA 5C8KA 1YVJA 5L8KA 1PXPA 4O7WA 2BDJA 2PZPA 4X7QA 4PNIA 4E6DA 3QA0A 5BVDA 4TKSA 1Q8WA 4GJ3A 4P5ZA 1OIQA 1V0OA 4AZTA 2GSFA 3QXOA 3MVMA 3NYNA 4CMTA 4C61A 2HAKA 5E8VA 1YW2A 4ASDA 3Q9ZA 4J1RA 4ZP5A 4WSYA 3C4WA 3CJFA 4TN6A 5CQUA 2CSNA 3DXQA 5IA0A 2QHNA 3BKBA 5FEQA 4YPDA 5KMNA 3TG1A 4NIFA 2ETKA 4GFGA 4IWDA 3MH3A 4O0YA 4DEEA 3QUEA 4QTCA 4G34A 4U79A 3MTLA 4FKLA 4D1XA 2CDZA 4ITHA 4QTBA 5LARA 3MH0A 2XBJA 2VD5A 3LOKA 4BVUA 5KUPA 1ZMVA 5HCZA 3ZLXA 3N51A 3MYGA 4O6LA 5IF1A 2ITNA 1XBBA 3GGFA 3VS5A 4K6ZA 5H8BA 3EZRA 1Q3DA 2ZDTA 5J95A 1P2AA 3HECA 3ZOSA 4DLIA 2UVXA 4W8DA 3OUKA 4FSMA 3R8ZA 2QD9A 2I6LA 2OXYA 3MY1A 4EZ7A 3Q96A 4XV1A 5EW9A 3GNIB 2ITPA 4FT5A 4J8NA 4RZVA 4I6FA 3DFCB 4BTMA 3R8UA 5C1QB 4QOXA 1FGIA 3F7WA 5KBQA 5AUUA 1PMNA 2HW6A 5J79A 4ALUA 2P33A 4DN5A 3QRKA 2R3HA 5IU2A 1KE5A 5CSVA 5E90A 5CF6A 5I3OA 3QCSA 2Z7RA 5F95A 2F2UA 4EK8A 5ANOA 4KBCA 4KKHA 3VC4A 3GCPA 2YAKA 3GU7A 3FMMA 2VTIA 4D0XA 4CLJA 3UO6A 2YCRA 2QO2A 2WKMA 2OZAB 2QC6A 4CG8A 3R02A 4AZSA 4TT7A 5BVFA 2SRCA 3Q2MA 3H0YA 4XOYA 4BDGA 5I5ZA 3E64A 3QHWA 3QQJA 4R8QA 3OCGA 4DYMA 3O7LD 4E26A 4HNFA 4IVDA 3HKOA 4W8EA 5EI2A 3NUUA 4FV7A 2YM5A 2GQRA 3NW7A 4BWXA 2W5AA 4BI0A 2E9OA 3TZ7A 3IW7A 4FEWA 4GL9A 3FZSA 3ANRA 1O6KA 3UDBA 3G90X 5HORA 3VN9A 3WARA 2GFCA 4BCNA 3ALNA 2G9XA 1T46A 3FMEA 5HU9A 5GJDA 4IXPA 4RIWB 5TKDA 2VX0A 1QMZA 4YZNA 3TZ8A 1Q4LA 1RJBA 3CD3A 3HUCA 3VUIA 3HA8A 3DBEA 3WBLA 5KZIA 3G9NA 3R63A 4IX3A 4D58A 1OB3A 3BV2A 4WNOA 4YTHA 5A4EA 2UW6A 2BKKA 5KX8A 3DBDA 3QD2B 3SVVA 1XH4A 2JDRA 3Q6UA 4FL3A 3NCGA 3DNEA 4GUBA 4A9TA 2JAMA 3KU2A 4I21A 3KL8A 4DEBA 1J1BA 2WU6A 3TZMA 5JGAA 3FBVA 3UIXA 5C8MA 2BIKB 4FIJA 1O6YA 3IW5A 3UGCA 4ZK5A 4C58A 2YACA 3EQHA 1VEBA 3EFJA 3MB7A 3R8VA 4QMOA 3ACJA 2RG6A 3FMNA 4WIHA 4K0YA 4BHNA 2YLFA 5AAFA 2CKEA 2O65A 2VTAA 5DG5A 1WVYA 4M0ZA 4XEYA 5IEXA 4BBEA 4C37A 2FGIA 4APPA 1OI9A 3CQEA 1PHKA 2J0IA 2XVDA 4OTRA 1U5QA 5AV3A 3TKUA 3RAWA 3S4QA 1R3CA 3CBLA 3FI3A 2YABA 4PDPA 1OL6A 3TEIA 3FQHA 4FKUA 2QKRA 4QNAA 3D7ZA 3ORZA 3DOGA 4QMSA 4XG8A 2QOIA 3Q4UA 4O0SA 4YP8A 5HGIA 4ZSGA 5HIEA 3UQGA 2NNWB 4IANA 3M42A 3S3IA 4PPBA 5FP5A 4DFYA 4WG4A 5DI1A 5BMMA 4NYEA 2Z02A 1XKKA 2HENA 4YUQA 4ITIA 2VWVA 3UZPA 2VAGA 3W2OA 3A7JA 5CENA 4DINA 5M4FA 2XNNA 2PZYA 2RIOA 3ETAA 3JY0A 2JIIA 4RFYA 3TV4A 2JDVA 4DCAA 2YIRA 3D15A 2WB8A 3OWPA 3T3UA 3TNWA 4RLKA 2JBPA 2XB7A 3ZRKA 3TT0A 4IM3A 4RVLA 3VW8A 3OY3A 4FKWA 4WNMA 1XQZA 4J8MA 4AN3A 4Z16A 4IWQA 4YLLA 3AD4A 3UVQA 3OOGA 3W1FA 4A06A 5J9YA 3IW4A 3I6WA 3QQGA 4L46A 3LJ1A 1XBAA 5AR8A 4HVGA 4J98A 2ITZA 4EJNA 4FT0A 3RTPA 4AN2A 3P23A 3ZRMA 4BKYA 5CAVA 2RGPA 4FICA 3QLFA 5HBHA 1XWSA 4FZDB 4AGWA 3WZUA 5H9BA 4U6RA 4RX9A 5EYCA 3RP9A 2IWIA 3P79A 4ASXA 4BZDA 5HNBA 3W8LA 3HV3A 2YCSA 4YSJA 4HGLA 1BL7A 4M69A 4FTCA 3KMWA 3WF6A 5AUVA 2UW4A 5E8TA 5C01A 3II5A 4EZ3A 3R01A 2XEYA 4M69B 4WUNA 2KULA 3SOCA 1GZNA 5ANDA 4W9XA 4TYGA 3VUDA 3CLYA 1U4DA 4EH9A 4IDVA 4AZEA 3ZFXA 3W10A 3UZRA 2PVYA 3FZRA 3KKVA 4CFNA 5A54A 3MV5A 5I9XA 3E8CA 4QMQA 1P5EA 3FLQA 2BR1A 3EN4A 3UOLA 4AF3A 5F9EA 4FT7A 1H1RA 1OIYA 2NPQA 3AG9A 3CJGA 3V8WA 3PIYA 4EQMA 4Y46A 3KRLA 2XNMA 4Z55A 5EKNA 5FTGA 3MWUA 1JKKA 2XMYA 5IA5A 4EUTA 2AUHA 1CM8A 4HZSA 4OUCA 3OG7A 2UV2A 3BHTA 2CNUA 4GV1A 1JOWB 4R1VA 4YHFA 3AOXA 4BFMA 3AXWA 3NNVA 5CQWA 2VWZA 4MYGA 4UZDA 5HG7A 3PIXA 3LPBA 4MKCA 1P14A 2B1PA 4IADA 2VRXA 4DGOA 1GZOA 4FKRA 5CZIA 4J71A 3QTZA 5KHXA 2OJGA 1UKIA 3KXHA 4FKTA 3I7BA 3ZRLA 2BDFA 4IBMA 3R30A 4PF4A 4JXFA 1A9UA 3O8TA 3VBXA 3FYKX 4AX8A 3G6HA 3FC1X 4EOIA 1IA9A 1B38A 3BI6A 4YZ9A 5EI8A 3RNIA 3ITZA 4ACMA 4FKQA 3QCYA 3WYYA 1G8SA 1Q8UA 4DGMA 3S00A 3ORLA 4BZNA 2NRYA 3BYVA 5KMJA 3P9JA 3KXMA 1FQ1B 3DBFA 3P1AA 5DN3A 3W18A 4DFUA 3RAIA 5ETAA 1ZAOA 4J95A 4JOAA 2HIWA 3VUKA 1A48A 3D94A 4AGCA 2G2HA 3LFEA 1PXMA 2GPHA 5B0XA 4F09A 1S9JA 1G5SA 2OFUA 2J0KA 2XJ2A 5FDPA 4A7CA 2GNLA 5JZJA 5D11A 5LWNA 3UIBA 4M68A 3PVUA 4H36A 4Y5QA 4F9YA 5M53A 1QL6A 2BRMA 4L00A 3OD6X 2JITA 3A7IA 3P7AA 2C47A 3E8EA 4FSNA 1M2QA 2GQSA 4JLCA 4LV8A 4L7FA 4U0IA 3KULB 3LVPA 3R7EA 4JQ7A 4C2WA 5IQGA 4E1ZA 2WQMA 4A9YA 5M06A 3B8RA 3EQIA 3QRIA 2CMWA 2VTRA 1OVEA 3F88A 4O1OA 3RM6A 4HVHA 3R1SA 4H58A 5JFWA 5A9UA 4CG9A 2OICA 2R3GA 1ZZLA 2OF2A 3ORTA 1Q3WA 3W2SA 4GVJA 2R3RA 2WFYA 5AP2A 3EL8A 2C69A 4GIIA 4A9SA 4NCTC 2GNHA 1OL7A 2ZAZA 3GBZA 5J1WA 4LUDA 4BBMA 2F2CB 3NW6A 2ZM1A 5CY3A 2OFVA 5CVHA 5AX9A 2WTKB 5HNGA 3EN7A 4Z3VA 1PY5A 5EKOA 4BWKA 4RA5A 4C35A 4DEHA 4EWHA 3E5AA 2OKRA 4IAAA 3P7CA 4K2RA 4WOVA 1YHVA 2PUIA 5AV1A 3CEKA 4L3LA 2W5BA 2BAJA 3HX4A 3MW1A 1FGKA 3PVBA 2Z2WA 4R3RA 2BROA 3N4UA 4FTIA 1Y8YA 3UVRA 3PY1A 4XV3A 1WAKA 4KIKA 3F6XA 3I5NA 3O7LB 3I0QA 3NGAA 3VIDA 4BTKA 2VX1A 4MF1A 2OJIA 4D55A 2F7XE 3PTGA 4JBVA 3MFRA 2ZV8A 5A4TA 1FVTA 1ZY4A 4NUSA 4ZS4A 3QTRA 4AE6A 4BKZA 3KK8A 3R1QA 4FIIA 4M7IA 1ZYLA 4F7SA 1L8TA 1CTPE 4FV5A 5TT7A 3D5WA 4CFWA 4M15A 3KRXA 4U5JA 3CD8A 4YMJA 5L2SA 3S0OA 4FBXA 2WGJA 2XNEA 2O63A 2C0OA 3PPJA 3R7VA 3CIKA 5M56A 4NH1A 4LL0A 2XCHA 2GFSA 4GYIA 4ZIMA 3ZDUA 4HVDA 3U9NA 5DR6A 4TNDA 1H4LA 4MWHA 4CCBA 2Y9QA 4UXQA 4D4YA 5LMKA 5B2KA 2C3LA 5GINE 4NT4A 3VO3A 5FRIA 2WQBA 2VWWA 4DEIA 5TOZA 5M4CA 2WTCA 3VBQA 4FE2A 4O7YA 4UEUA 3UJGA 4TYIA 4FF8A 4FKPA 3FUPA 3OXTA 4C0TA 5HE0A 4TNBA 2R7BA 4PTEA 5KHWA 2CHLA 4BCFA 3T3VA 2FSLX 4BCHA 4MTAA 3MH2A 3LKMA 5IQCA 3HLLA 1YWNA 5L8JA 3R7OA 4G6OA 4C34A 4QMVA 1NT2A 3UOJA 3BLHA 3TJDA 4GVAA 3KRJA 5JSMA 5AA9A 4Z7GA 1PKDA 4EKKA 4BYJA 3P7BA 4F6SA 3BWJA 3PIZA 2C68A 3QALE 4FL1A 4LGGA 4TWPA 3ZO1A 4I6HA 4O7NA 4R7BA 3LXKA 1CMKE 3PXRA 1ZYSA 4IJPA 4QQCA 5ANGA 5HVKA 3PWYA 2P4IA 2WPAA 2XIXA 5BVEA 3T9TA 3EOCA 2Y7JA 4BDBA 3OFMA 3FI4A 3TIYA 4DH1A 3DB6A 5JZNA 3JVRA 3QZFA 3TM0A 4MNEA 4RIXA 5T6KA 5K4JA 2ZB0A 2PVFA 2QURA 2PVLA 3ORKA 3N4VA 3SG9A 2WQEA 4IX6A 3LIJA 1M2PA 4BDAA 1PMUA 4S2ZA 4U7ZA 4DCEA 5BVNA 3EQDA 2R3LA 3ACKA 2O64A 3PJ1A 4JDKA 2PZ5A 4RPVA 4EK6A 4DGGA 1G8AA 5LVLA 2PE1A 1NVQA 5M55A 3ZYAA 3QD0A 2BPMA 4PDYA 3MJ1A 4EH2A 2X81A 2HOGA 3I1AA 4RJ4A 4G9RA 4GT5A 4AGDA 3LM0A 4HVIA 4IB3A 4EH5A 2QG7A 1H28A 4MF0A 5FXQA 4O0UA 5J9LA 2EXCX 2W4KA 3DK7A 3F3UA 2YDIA 3NLBA 4MWIA 4L68A 4FGBA 3EYHA 4U42A 4JBQA 4E8AA 4JDJA 1OL2A 2A4LA 2Z60A 1W0XC 4CV8A 3IGGA 4D2WA 3B2TA 4N6YA 4WBOA 4OTQA 3UYSA 5HO6A 4I22A 3D14A 3MVHA 1DI8A 4P4CA 4TZRA 4HW7A 3QL8A 4W4WA 2YZAA 2F57A 3D2IA 4BCOA 5CANA 4K1BA 1BI8A 4KB8A 2XIRA 2X7OA 3L9NA 1OBGA 4FTKA 4ZLZA 5IQIA 4G16A 2EXMA 3V51A 3GQIA 3PPKA 3TTJA 3PE2A 4DEDA 3SRVA 3AC3A 4F6WA 3QAME 4MHAA 4WNPA 3FLZA 2PL0A 5D1JA 3B8QA 5EYMA 3QKLA 3G15A 4CFUA 2YIWA 3GFEA 4M66A 4W9WA 1Q61A 3BV3A 2YISA 4H3BA 2HELA 1QPEA 3CTJA 3BLRA 4CT2A 2WTDA 4ZXTA 5JGBA 5EDPA 1YOMA 3IECA 2QOFA 3MVJA 4P2KA 5TR6A 5K5XA 4YJPA 4PNKA 2EXEA 4O86A 5DBXA 1PRYA 1IRKA 2OJ9A 3BIZA 4EYJA 2XRUA 2UZTA 3PLAE 3E93A 4A07A 4I6QA 3Q9WA 3FPQA 4E93A 5AP4A 3DKCA 4NKSA 1F5QA 1PYXA 2UVZA 2OGVA 2W1FA 4X21A 5EM6A 1J1CA 3FHRA 3R7YA 3SOAA 3VWAA 3ZLWA 3ALOA 4FTOA 4KIPA 5CF4A 4GEOA 2ZJWA 2XYNA 3NS9A 1S9IA 3PVWA 1NVRA 3BPRA 3QUDA 3FLNC 4OTFA 3V5PA 2XA4A 4DG2E 4YHJA 3NUSA 2C6DA 3Q60A 3RJCA 4DFBA 2GDOA 2HYYA 4CZUA 3LQ8A 4U3ZA 5EW3A 3P4KA 3Q5IA 4LUEA 5M07A 2RG5A 5K3YA 3W33A 2HWOA 4I0RA 4KSQA 4XJ0A 5HIBA 3R1NA 5IH6A 4R5SA 4FK6A 4DT8A 2YIQA 2UW0A 4JG7A 2JDSA 3HV7A 3P86A 4JX3A 4OTPA 3HEGA 3L8XA 4ZTMA 3R21A 2QOCA 3Q4CA 5AV4A 3UG1A 2DS1A 3V3VA 4KAOA 1CKPA 4PDSA 4QPAA 5FD2A 3EFKA 4EEVA 3MFUA 3ZMMA 1RE8A 2BMCA 3SXRA 5HO7A 2C6LA 2XK4A 3UO5A 3OUNB 3N9XA 3VHEA 2C5VA 1NVSA 3VRYA 1M17A 3GCVA 4C7TA 5DRDA 4JAJA 4O96A 4X3FA 4EOJA 5L6PA 3TDVA 2B7AA 4MXZA 1YWRA 4L43A 1LUFA 4H3QA 4ACGA 4QYEA 4R3PA 4O1PA 5IPJA 3DS6A 5E8XA 2CKOA 3OT3A 2OIBA 3BZ3A 2F7ZE 2VUWA 2ZM3A 1H25A 4YC8A 4M13A 4F65A 3O71A 3NUNA 4F9CA 1GY3A 4AE9A 3R6XA 2PSQA 4O2PA 2VZ6A 2YDJA 4UV0A 5HLWA 4E4LA 5JFVA 4IAYA 5J5SA 2PE2A 1MUOA 3NAYA 4KIQA 4DFNA 4EZ5A 4TWCA 4A4XA 1PXKA 4MD7E 5FTOA 3H4JA 1NA7A 1ZOHA 5CSPA 2PK9A 4MCVA 3RINA 1V0BA 1W83A 5JRSA 2C1BA 4OGRA 3RK5A 3V6RA 4YO4A 5CAUA 3GB2A 2X9EA 4OBQA 4L52A 3EJ1A 4WRSA 5I9ZA 3QGWA 2H96A 5K0XA 2YHVA 3QD3A 2XNGA 1XH7A 4XG6A 1W82A 2RFEA 4O38A 4BGHA 3ZH8A 3QWJA 4QP3A 3EQRA 5K4IA 4MXXA 3DDQA 3Q52A 1PJKA 2C5OA 3R2BA 2BZKB 3ORMA 4L6QA 4WHZA 2UUEA 4BDKA 4FNXA 2ACXA 5IMXA 3PDTA 4QTAA 3DBCA 3KRWA 1FPUA 1U54A 2R2PA 4KBKA 4X3FB 5F94A 3L8PA 4UXLA 4ZY4A 3OCTA 2F7EE 3U4UA 3CQWA 3L8SA 4QMTA 4FKSA 4PMSA 4HGEA 1YOLA 4IHPA 4OW8A 3VF8A 4EBVA 3UOKA 3NVMB 4BGGA 2WNTA 4KS8A 4GKHA 2OI4X 2XK9A 4IC7A 4W4YA 3DAKA 4JI9A 2VTLA 4MNFA 3DKOA 4XG4A 5EOBA 2YM8A 4RQVA 5E1EA 4QQ5A 3HDMA 3KCFA 4XG3A 4I93A 4H1JA 2JKOA 1Y8GA 3ZSHA 4IZAA 4JDIA 3QTWA 5IKWA 3RAKA 1B6CB 2WEIA 3NYVA 4FYNA 3VBTA 4ASEA 4BIBA 5CXZA 4NM5A 3RAHA 2YEXA 3FXWA 4JG6A 2IW9A 3EZVA 1UU3A 3VS0A 4AOIA 5KMIA 2BKZA 4PRJA 3UIMA 2E9NA 3VQHA 5IA4A 3G51A 2ZVAA 1GIJA 3G0FA 2BDWA 4M84A 2WEVA 1HCKA 1UNLA 4GS6A 4HVSA 3UC3A 4O7SA 4HZRA 2O2UA 4CSVA 4F9AA 3QXPA 5CVGA 3TNQB 4CZYB 4GH2A 4A4LA 3BHVA 2YA9A 2YN8A 3BU3A 1LEZA 4LFIA 3EQGA 3V04A 4EONA 4FX3A 3T9IA 1DI9A 3U54A 2J5FA 2XYUA 3LHJA 4AS0A 4BKJA 2QOLA 3P0MA 4XMOA 4BIDA 4F7JA 1QPCA 5AUTA 1PXNA 3ZLSA 5L8LA 2C6MA 4DTAA 4FVRA 5JQ8A 2J50A 3IDBA 3SAYA 5ANKA 2HZIA 1Q97A 5LWMA 2W4OA 4KIKB 1JLUE 2X8DA 5FP6A 3ULIA 1H1WA 1YDSE 3HRCA 4W4XA 3NAXA 1KWPA 5ANIA 2QO9A 4N0SA 2H8HA 2E9UA 4PPAA 4XNEA 2AC5A 3O17A 5CEIA 4LG4A 1SYKA 4H05A 4FSWA 1CDKA 3D9VA 3DNDA 4Y83A 4YJVA 4X2NA 2ESMA 4BBFA 4LRKA 3FQEA 1BX6A 1PKGA 2VWIA 2W1GA 1REKA 3HYHA 4X3FC 5A4LA 3GUBA 2QOOA 1ZYDA 2J6MA 2X6DA 2P2IA 4B0GA 4IM2A 3RHXA 5B2MA 2X4FA 1J91A 3QYWA 4QP6A 2X7FA 2PMLX 3Q04A 2WMQA 4EUUA 2IG7A 3EKKA 4YJNA 2RFSA 3ODYX 4BI1A 4IMYA 3DJ7A 4QMUA 1TQIA 3OVVA 4BB4A 4DFXE 2XZSA 3IKAA 2I1MA 3RCDA 3U8WA 4RRVA 5AFVA 2B9HA 4QO9A 2IO6A 4AW5A 4JIKA 5K5NA 1OKWA 3QTSA 5ANEA 1WVWA 4FKOA 3NNXA 4DC2A 4AG8A 4OT5A 5I3RA 4ZZNA 1Y6BA 2VU3A 3DKFA 3VVHA 2A27A 5DYJA 2I0HA 3O51A 4WNKA 4CQGA 2VX3A 4TRLA 3E7VA 2UZBA 3MIAA 3RMFA 3ENMA 3OS3A 4ARKA 3EIDA 1MRYA 1OKYA 2J9MA 3QTXA 2ZB1A 3HV4A 3R7GA 4G31A 4J96A 4X0MA 2J51A 5EFQA 4FODA 4HGSA 5L2TA 3CE3A 2UW3A 3DDPA 3F69A 3L1SA 4FKGA 4UBAA 4UWCA 3R7IA 3NUYA 3PA4A 5FWKK 3M2WA 3QZIA 4LM5A 3ZZEA 4CT1A 2OLCA 4O7VA 2O0UA 3QU0A 2GHGA 5GIPE 1ZOEA 1ATPE 3DV3A 5CYIA 4CFXA 2QU6A 5A3XA 4G6LA 4BCQA 4LOQA 2BZJA 4YJTA 1KE6A 3LMGA 3NIEA 3ZEWA 4USFA 4PY1A 4K77A 2B52A 3BCEA 4FYOA 3A99A 4M3QA 2VTHA 4FEQA 3QHRA 2CJMA 3O96A 2ETMA 4ZY6A 5IZFA 2JKMA 4XCUA 4GJ2A 4UMRA 3JXWA 4WO5A 1H0WA 2VTPA 3NMUF 4E6CA 3DQXA 2WIHA 3PG3A 4G3DA 4C33A 1BMKA 1LR4A 4LGHA 4IFGA 5D10A 3G33A 4FSYA 1T45A 4QP7A 1TQMA 3G0EA 3OWKA 5AP3A 2VTSA 4G2FA 4YTFA 1R0PA 2XIZA 4XG9A 3E7OA 3FMLA 3UG2A 5IMEA 2Q0BA 4YU2A 2EU9A 5HD4A 3RZFA 1YHSA 3DLSA 3IQ7A 5FM3A 4RSSA 4HYSA 4G1WA 3MIYA 5HQ0A 4JBPA 3DPKA 4JVGA 4XUFA 3T8OA 5HTIA 2W5HA 3IW8A 3W2RA 2XNBA 4AA4A 4D1SA 3UODA 4M12A 1XH8A 3ZUVA 2GCDA 3PXQA 4KSPA 4GSBA 5LMAA 3MI9A 3CCNA 3FEGA 3ZSGA 3PFQA 4EI4A 3GC7A 5LCKA 3TKHA 5IUGA 3FHIA 4U8ZA 4YLKA 5HBEA 5HCYA 2UZNA 3W8QA 3TN8A 5KCVA 5CU4A 5M44A 3MPAA 2YERA 3JS2A 4PUZA 4RJ3A 4EK4A 2R7IA 2X0GA 4EH7A 2PULA 4AQCA 1YKRA 4QYGA 1Q24A 5CWZA 5E91A 5GZ9A 3KN5A 2C1AA 4L3JA 3K5VA 3P08A 4P5QA 4B6LA 2AC3A 4F0FA 3UQFA 5DVRA 5AIKA 1JKSA 3BEAA 5I9WA 4EHZA 4L53A 4FVQA 1F3MC 2E9VA 2XEZA 4CKIA 4AW2A 5HX8A 4QYYA 1ZYCA 5LCJA 4O83A 2WHBA 2WMRA 5M4UA 4P90A 3HP2A 4XV2A 3R9DA 5ITAA 2PY3A 4ZLOA 4EBWA 3KCKA 4ANMA 2XCKA 3GT8A 4U97A 3ZCLA 3PUPA 3WF7A 2R0UA 5IEVA 3IONA 2EB3A 4OR5A 4CFFA 4QP1A 4TYHA 3VRZA 2C30A 3MPMA 2W05A 3FI8A 4LMNA 4S32A 3U6JA 3C0IA 5ETCA 4AACA 4E4MA 2CN8A 3VJNA 4D4VA 3QBNA 2HZ0A 3HRBA 2ITTA 3JVSA 4FNZA 3PXFA 4XRJA 2QO7A 1PXIA 2YJRA 3UVPA 4ZOGA 4FG7A 4O7TA 5DR9A 3VBYA 5FEDA 1H00A 2XKFA 4MXYA 4GIHA 5KE0A 3F3ZA 3ZO2A 3A2CA 3AC4A 3CKXA 4X2FA 3NVKI 4V04A 4NL0A 5BNJA 1Q8ZA 3GOKA 4IZ7A 4WA9A 3RPVA 2VWYA 3R22A 4IWOA 4R7IA 5E8UA 2PMNX 3KXXA 5FG8A 5DH3A 3MY5A 4G5PA 5CT7A 5M57A 2ITXA 3GU5A 2WOTA 2OF4A
chains in the Genus database with same CATH superfamily
4FTAA 2IZUA 4XLVA 4I4FA 4D9TA 1WFCA 3LQ3A 3KFAA 4FTUA 3HVCA 3KVXA 3D5UA 2CGVA 3K5UA 4Y5HA 3TUDA 3SX9A 3KULA 4NW6A 4L7SA 4YLJA 3OT8A 4AW0A 4LOOA 2OXXA 1DS5A 2JBOA 2V55A 3F61A 4YJOA 5AADA 5E92A 2GTNA 3ULZA 2P2HA 4D1ZA 5IQBA 3I79A 3R8PA 5HD7A 2IN6A 4EH4A 4FIGA 4FV9A 3QQKA 5FEEA 2Z7QA 3UC4A 1W2CA 1WBPA 4R78A 2FSOX 1JVPP 3FI2A 4GW8A 1Z57A 4J53A 4B7TA 4O6EA 5F20A 2Q83A 3KRRA 3Q9YA 4DG0E 3UDTA 4IDTA 2QOQA 2JD5A 3KXGA 5CU6A 4RIWA 3D4QA 5C27A 3ZSIA 1OGYA 3E3BX 3TIZA 2YM3A 4G9CA 3SA0A 1FMKA 3RPSA 2BILB 2YJSA 3HV5A 4IB0A 4RFMA 3CXWA 3R7UA 3KXNA 4CXAA 1GZKA 2W1CA 4ANSA 1GJOA 4EOMA 3AGLA 4U9AA 4CYJA 2BAQA 2ZV7A 4IZ5A 2QQ7A 3R9HA 4RMZA 1ERKA 2PVNA 3GOPA 1KV1A 4AU8A 2YFXA 3E87A 1OZ1A 4RWLA 3Q5ZA 4FG8A 4TYHB 2DQ7X 4E4NA 4C57A 1MRUA 2RF9A 3CC6A 5DHJA 3RI1A 3TDWA 4ZSJA 2BRBA 3ZO3A 4IEBA 4EHEA 2VWBA 2WO6A 4FSRA 2WTVA 5A4CA 3EKNA 3C13A 4HCTA 3RCJA 3FMKA 2F49A 4RX7A 3PJCA 5F4NA 3R00A 4CCUA 5IEYA 5HIDA 2B0QA 3GEQA 3K3JA 3W2PA 4ACCA 4D5HA 3FE3A 3CTHA 2YLEA 4I5HA 2R3NA 2Y4PA 3BWFA 1JAMA 3RHKA 3EN5A 4NJ3A 4YZCA 4JR7A 3OCBA 4JR3A 2F9GA 3F5UA 4BL1A 5HNIX 4XS2A 3COMA 3DAJA 4KKGA 4FZ6A 4LV7A 1OMWA 3ANQA 3OZ6A 3GQLA 2C5NA 5D7AA 4CKJA 4ORKA 5IQDA 4U41A 2RL5A 3ZDIA 2WQOA 3CSVA 4FV6A 2GHMA 2QR7A 3QUPA 3JUHA 4RA4A 4XLIA 4X6RA 2JLDA 4RIOA 4XH6A 2R3JA 5EOLA 2PU8A 4YC6A 4NFNA 5A6NA 2R4BA 5H3QA 3GU6A 3NCZA 4FA2A 1KV2A 5BUIA 2O8YA 2FYSA 3WF8A 1H24A 4C38A 2VO7A 3ZTXA 4YO6A 3LCOA 4O2ZA 4F64A 4QQJA 3LCKA 3ORIA 2ZYBA 4FSZA 4I3ZA 4UYAA 2CCHA 5C9CA 3F3WA 3DGKA 1OITA 2B53A 2FB8A 2VWXA 2QNJA 1IASA 3PSCA 4I24A 4ZZOA 1XO2B 2C3IB 4L3PA 3DXPA 1FOTA 4HCUA 2ZV2A 3ZM4A 3GCSA 3QQLA 3MA6A 3W2CA 4NM3A 3OTVA 3M1SA 1Q8YA 2WMBA 2R3PA 4IAZA 4DGLC 2BZIB 4Y8DA 4RX5A 5BV3A 4MXOA 1PXLA 4ZTSA 3VW6A 3GC8A 1YDRE 4QNYA 4BDFA 3V5WA 4X2GA 2R0IA 4QP9A 1H07A 3PA5A 4O0RA 1R0EA 1YI3A 5CX9A 5JK3A 5CU0A 3G2FA 2BCJA 2OIDA 2XF0A 1JKLA 3R2YA 2BFYA 1APME 2WMSA 4IVBA 2IZTA 4D2SA 3LFAA 3EYGA 3LZBA 2XIKA 3P5JC 5EQEA 3FLYA 3QC9A 3F3VA 1SZMA 2P55A 2OJJA 1WCCA 4IX5A 4U43A 4E5BA 4DITA 4M97A 3DBQA 3PZHA 5HG9A 2QHMA 3BGPA 4EQCA 3DA6A 4I20A 3K2LA 2I0VA 4PPCA 2Z7LA 3VUMA 2IVSA 2QLUA 5IDNA 1O9UA 1WVXA 1GIIA 1H1PA 3MSSA 1PW2A 2VTJA 3ORNA 3P78A 5IUIA 1I44A 4B8LA 4DHJA 2PZIA 2ONLC 2FO0A 3PXKA 4ZY5A 4I4EA 4RBLA 4IAIA 5HX6A 2QODA 3NW5A 3FXXA 2JFLA 2B9FA 5I0BA 4KABA 3E63A 2DUVA 5KBRA 2WELA 2WMTA 3RPYA 5ACBC 2JC6A 2BHHA 3U9CA 3LFDA 4BRXA 2C3JA 4C2VA 3BQRA 5E7RA 5J9ZA 4NTSA 2WZJA 4ALVA 5HOAA 1GIHA 1H1SA 2ZMCA 2W96B 3D7TA 4FTNA 4XHKB 3TWJA 3Q32A 4EOSA 4G6NA 2A2AA 3KB7A 1VLRA 3QKKA 2R3MA 1TQPA 3FAAA 4KINA 3PP1A 5EM8A 4HYUA 5A6OA 5CAPA 4A9RA 4FV1A 2FUMA 4QPSA 4TWNA 4L44A 4BCJA 3UIUA 3DZOA 2J0MB 4DFLA 4GT4A 3LFFA 4O91A 2B55A 5KNJA 4MD9E 5L2WA 4O0TA 4FRFA 3FMDA 3KC3A 3ET7A 2XANA 4ZTRA 1XH5A 4FI1A 4F4PA 1G8JA 4ENYA 5LJJA 4AZFA 4JL9A 3SD0A 2O3PA 2ZDUA 3QTIA 3VUGA 1PYEA 4O7RA 4DEAA 3DAEA 3PZEA 4RX8A 1YQJA 2OZAA 2UW9A 2XUUA 3L9MA 3SHEA 5BUJA 2G15A 1OM1A 3VHKA 3NUAA 3TUBA 3MB6A 3F2AA 4XRLA 3WIGA 3LCSA 4BDEA 4Q5EA 3QTUA 5HHWA 4FIEA 3BE9A 4I41A 4FTQA 4HOKA 2CN5A 3C0HA 3CPCA 2PE0A 1BI7A 4N6ZA 3QQFA 5EQPA 1VJYA 3O8UA 2WOUA 4RZWA 3SC1A 2IZSA 4FC0A 3FY0A 4FGRA 2UZEA 5D9HA 5EHLA 2C6IA 4GK3A 2XM8A 5FDXA 5IA1A 4C36A 3BL7A 5HG8A 4RVMA 2PVMA 3NYOA 4BCMA 5CNOA 4HGTA 4ID7A 4V01A 2QONA 4IJ9A 3PXYA 3HAVA 3TTIA 5IQEA 3RWQA 5AM7A 4IB5A 1DM2A 2GNIA 1E9HA 4NM7A 3RBWA 4ANBA 1REJA 4HNIA 3IOKA 2XK7A 3PWDA 4UZHA 5HKMA 5J87A 3SW4A 5KO1A 2PMIA 4RFZA 5C4KA 4FG9A 1K3AA 3H9OA 4ZTQA 4L8MA 3O0GA 5EHOA 2DYLA 3FWQA 2XJ0A 5HICA 3HV6A 3LAUA 3TUCA 2JDOA 5CI6A 1Y57A 3A60A 3LXLA 4BC6A 2PUPA 1JSTA 2AYPA 4JIAA 1PMVA 5IG1A 3R28A 5I9UA 4IWPA 5CALA 2FA2A 2BRHA 5AUZA 4XBRA 1IR3A 4OAVB 5CEKA 4NIFB 1RDQE 4XYFA 1LP4A 2ERKA 3RALA 1URWA 2UZLA 2W17A 2QI8A 3POZA 4MBLA 4CGAA 1ZARA 2GHLA 1U5RA 1YXVA 4FKIA 4J7BA 4NJDA 3CQUA 4OTGA 2XK6A 5JGDA 4AXCA 3UNJA 4YNEA 2FSMX 3WZDA 3IDCA 3BRBA 3P5KA 2PTKA 1U54B 4ITJA 5B2LA 3PE1A 5LXMA 2WQNA 3D83A 4KKEA 2A98A 2C6OA 4Q2AA 3R9NA 2C3KA 4YC3A 4ZSLA 3U51A 3F2RA 2J5EA 4GK2A 3GFWA 5EDQA 4E5AX 4BR3A 4HYIA 3WE4A 4F0GA 3QLGA 4D28A 4HJOA 4C4IA 3KMMA 5CSHA 1UA2A 2ITOA 4BZOA 3PRIA 3RVGA 3OC1A 5BYZA 3RK9A 3JYAA 3ROYA 4BCIA 4D4RA 5EI6A 2UVYA 5G1XA 3CKWA 5CLPA 5AIRA 2IZRA 1PXOA 1VR2A 2W4JA 4ZS0A 5AR5A 3PJ2A 4DA5A 3DKGA 4YNOA 4EK5A 5BVKA 4DT9A 3QTQA 4UMTA 5TO8A 4N70A 4KUJA 3C4ZA 4MBJA 5DT4A 4ZTLA 4XP0A 3H3CA 3MS9A 4MQ1A 5HE1A 2B54A 4UN0C 5HLNA 5E9EA 3KGAA 3O50A 4DEGA 1TFFA 3LLTA 3BGQA 3DQWA 3AC8A 2ZOQA 3AMAA 4H39A 3ZU7A 4YZDA 3H30A 2IJMA 4H3PA 4F1OA 4EK3A 4YJRA 4F7LA 1YHWA 4LGDA 4RJ8A 5JEBA 2ITQA 4GKIA 2X2KA 2VTNA 1XJDA 2X1NA 3OTUA 3LW0A 2X6EA 5ACKA 1U46A 2BTSA 4MXAA 3VS2A 4W4VA 5CTPA 4E3CA 4ZTNA 1UWJA 3QA8A 4ANLA 4BICA 4E73A 2LAVA 1M7NA 5AR4A 4CRLA 3JR1A 5EG3A 1PMEA 5KMLA 2GNFA 2VTOA 3OEFX 1EH4A 4ANQA 4GFOA 1ZYJA 4K33A 3NNUA 3ZXTA 3EQPA 3L9LA 2BTRA 1W8CA 3ZS5A 5IA2A 1U59A 4O0WA 1CSNA 5GIOE 4E20A 4TPTA 5BQ0A 4EHGA 5E1SA 2PPQA 3OWJA 4XP2A 3CY3A 5HLPA 4C3PA 3U6IA 4OBOA 4EL9A 3KIOC 4EWQA 3QRTA 2GNGA 2UZDA 4QMZA 4JAIA 3SKCA 1UU9A 3B2WA 2FH9A 3DFAA 3EN6A 1AGWA 5TE0A 2XALA 1YXTA 2CKQA 5AP1A 3WE8A 2BRNA 5CVFA 1FBNA 3GCQA 4XG2A 4JX7A 3TNPC 4PQNA 4X6QC 2P3GX 5HU3A 4K8AA 1UU7A 3MBLA 3H9FA 1STCE 4C4FA 4C02A 4ZAUA 4FZ7A 1GOLA 2WMXA 2WAJA 3NDMA 3R0TA 3KXZA 4V0GA 3TNHA 4KRDA 5D7VA 1JQHA 1M7QA 4XG7A 1FVVA 3N4TA 2YDKA 5LOHA 4TYJA 2X0QA 2W1ZA 5EW8A 2J4ZA 2X39A 3GVUA 5HG5A 4MQ2A 3HMMA 5AP6A 3A7GA 4A4OA 4DH7A 3UZTA 2OH0E 3SLSA 4TW9A 4AP7A 2CGWA 4M8TA 4MD8E 4RWKA 3CPBA 4D9UA 5I9YA 4AWIA 4EYMA 1XBCA 2H9VA 4IZYA 4FK3A 4AXAA 1ZMWA 3AD6A 3ODZX 4G17A 4U80A 3WOWA 2DWBA 2VN9A 5AR3A 5A14A 4E4XA 4WG3A 4FKJA 4RIYA 4R7HA 4TXCA 4C62A 4GG7A 4EOOA 2W1IA 1R78A 1H26A 2XKDA 2XNOA 3Q4TA 2G2FA 4J52A 4CD0A 4DF3A 2R3FA 1OPJA 4NTTA 5FBNC 3ZC6A 4FV8A 2X4ZA 4HPTE 3NUPA 1SVEA 5JRQA 3EQCA 5F1ZA 1OKZA 5HEZA 3FLSA 2J0LA 2Z7SA 4CVAA 3PUFC 3C4CA 1J7IA 2QR8A 3CR0A 4GT3A 2WMAA 4F0IA 2VTTA 2YM7A 4EHVA 4PMMA 2A0CX 4IACA 5CAOA 4MAOA 3FXZA 4I94A 3C7QA 3D5VA 3ZONA 5KMMA 4S31A 2G01A 2QVSE 4IX4A 4M14A 3NPCA 5DEWA 3WZJA 2W0JA 3D7TB 5FTQA 2WD1A 4QD6A 3F7ZA 3OP5A 2V0DA 1ZZ2A 4FUXA 3FLWA 1XH9A 3QCXA 5DPVA 2OWBA 1IA8A 5EHYA 4FSTA 2A19B 2CCIA 3OROA 1WBOA 2NP8A 4U40A 3WF5A 4DFZE 1W98A 1BL6A 3MDYA 3NSZA 4RJ7A 3SG8A 4C3RA 4E5WA 2X2LA 4IAFA 2HWPA 4GYGA 2VV9A 2OIQA 4I1ZA 4NM0A 5CEPA 3OW3A 2XS0A 3V5LA 5DE2A 4BHZA 4TYEA 2EB2A 4BTJA 1OL5A 4DTBA 4AW1A 1H0VA 3NRMA 3PA3A 4P7EA 3DY7A 1MRVA 1WBTA 5L2QA 4OTWA 4CTBA 4MNEB 4RIXB 4TTHB 3R8MA 4QMPA 3M11A 3FSFA 5K9IA 3R71A 5LMKC 4F1TA 3V01A 1NW1A 4L42A 4JRNA 4L01A 2VWUA 4E7WA 2XAMA 3DT1A 4ASZA 2J90A 3F5GA 2NO3A 1W84A 4PTCA 4UALA 4WRGA 3VJOA 3QC4A 2YIYA 3C4XA 3OEZA 3HL7A 3NEWA 4QRCA 3CGFA 4YR8A 4IFCA 4N4SA 2HY0A 4LYNA 1G8KA 3FPMA 1KE9A 2W99B 3QZHA 3UE4A 3CS9A 2XK3A 4PP9A 5EM5A 3COIA 1YXSA 2GMXA 3G5DA 1H08A 2CKPA 3DTWA 3HMOA 3OWLA 5C8NA 5LVNA 4X2JA 4O81A 4WKQA 4RJ6A 5C03A 3VS4A 2Q0NA 3LM5A 4RQKA 5I9VA 2IF8A 2EVAA 4GK4A 5E8WA 2QKWB 2V7AA 4NCTA 3AQVA 5L2IA 3O8PA 5CF8A 1H1QA 3LMIA 2PYWA 4U45A 5IISA 3U55A 4UY9A 5H8EA 2AEGA 1SMHA 1YXXA 1WZYA 4CKRA 5GZAA 4RC4A 4CLIA 4J97A 3A7FA 3GC9A 3RGFA 3TCPA 3VUHA 1KOBA 4ANNA 5KKRC 1UWHA 3AC5A 3GC0A 3MVLA 4R5YA 2BVAA 4IVAA 3RNYA 3EWHA 3A8WA 2FSTX 2J2IB 2PVKA 2HZNA 2XP2A 5FBOA 2YIXA 5IUHA 4CNHA 1CKJA 1SNXA 4MX9A 1PF8A 4C4GA 2BHEA 4F1MA 3WF9A 1Y6AA 1M14A 2OH4A 2CLXA 3TV6A 5AP7A 3RWPA 4BJJA 1J3HA 1OIUA 2HCKA 2H34A 2OXDA 4LRJA 3CP9A 4X2KA 3OCSA 5CEOA 3BX5A 5JH6A 2ONLA 5ANJA 5M51A 2HZ4A 3QX4A 2ZMDA 4B9DA 4AT4A 2R5TA 3F66A 5EK7A 3MPTA 4ALWA 4EOLA 2YWPA 5CSXA 5DT0A 4DBXA 2XKEA 4FL2A 4GU6A 5CI7A 3VS7A 1SVGA 3C0GA 3BYSA 3KN6A 4FT9A 4FV3A 4WUAA 5J8IA 4DH3A 4UWYA 4CFMA 4CFVA 4O7ZA 4PX6A 4RWIA 4NU1A 1K9AA 5HCXA 4USEA 4CV9A 4R6VA 2UZVA 3HP5A 3R83A 1A06A 3AT4A 3QYZA 1TKIA 2OSCA 1BKXA 4DHFA 4S34A 4JG8A 5AAEA 2GQGA 2X7GA 4ZEGA 4ENXA 4IC8A 3KF7A 5EYDA 3R73A 4FZAB 5HO8A 3SXSA 4EH6A 5BYYA 3ZZWA 4FEXA 1Q99A 3DB8A 2REIA 4FMQA 3FDNA 3I7CA 5CS6A 4UMPA 1NY3A 4GU9A 5E8YA 2XRWA 1IAHA 3QRJA 2OJFE 3TV7A 5FXSA 5IH5A 3PXZA 3PYYA 3LFNA 3UOHA 4G3EA 5G6VA 1GZ8A 4FTJA 4GG5A 4IM0A 5C4LA 4UB7A 4CTCA 3OBGA 2UW5A 2QU5A 5AMNA 1K2PA 3Q6WA 4G3FA 3WYXA 3K3IA 3L8VA 4DH8A 1LEWA 3HA6A 4APCA 3VUTA 2JKKA 3PLSA 4RGJA 5LMBA 2OO8X 2WU7A 5AM6A 2I0EA 2BIYA 5T3QA 1H01A 5KKRB 3KF4A 5HVJA 5JT2A 2V22A 2R3OA 4BIEA 4CMUA 2CGXA 3TKIA 5J7HA 4RVKA 2X9FA 5ICPA 4EJ7A 1BUHA 4I23A 3EQBA 1ZOGA 1AD5A 3E92A 4KS7A 1Q5KA 2E9PA 1IAJA 3EL7A 3ROCA 5IQAA 3CGOA 4O27B 3AT2A 4OTHA 4Q9SA 4TL0A 5FLFA 3AC1A 1ZRZA 1V0PA 3ZO4A 3ZLYA 3Q3BA 4BDCA 4D4SA 5KMOA 2JFMA 5LQFA 3MFSA 4WSQA 2QG5A 4Q5HA 3VBWA 4C4HA 3W0PA 1UNGA 3Q2JA 3V6SA 3BLAA 3C4FA 4MBIA 4LOPA 3UMXA 3NX8A 4NEUA 3TI1A 5CSWA 2B4SB 4Z9LA 3BHUA 3POOA 1W7HA 4F6UA 3OOMA 4M0YA 4JQ8A 1OKVA 3DJ5A 3DU8A 4KRCA 3V5QA 1MQ4A 2GU8A 4XP3A 5CU3A 3KY2A 4E6AA 2W9FB 3PSBA 4RG0A 4XV9A 5IDPA 5AV2A 3UNZA 1VYWA 4GCJA 2YCFA 1OECA 1XHAA 2ITYA 3QQUA 5AP0A 4AA5A 3V8TA 2B9IA 4L67A 3UQCA 5AR7A 4ZJIA 5E8SA 5GJGA 1UKHA 1URCA 4QMLA 3DK6A 3SGCA 1PXJA 3C5UA 1VYZA 3BYOA 3TZ9A 4CZTA 2G2IA 3LXNA 3FY2A 4M67A 4KA3A 2XJ1A 3LE6A 5JKGA 4JBOA 4YHTA 2V7OA 4AN9A 2X8EA 4LI5A 3DJ6A 3MFTA 4KBAA 1KOAA 4B4LA 3QGYA 4BGQA 3KQ7A 3I60A 3IPHA 3S1HA 4AOTA 3BU6A 4GFMA 3EH9A 3ZXZA 5HE3A 5JMSA 2CNQA 3VF9A 4D2PA 5DEYA 4K9YA 5CU2A 3RM7A 4FOBA 4O0XA 4I0SA 4Y95A 1BLXA 2YM4A 4FSUA 4O82A 4ZSAA 1OBDA 5CEMA 3VAPA 2VTMA 2QOKA 2OZOA 3LFQA 4YBKA 4AQKA 3GU4A 4IE9A 5DR2A 1ZLTA 2EWAA 2IVUA 2OW3A 1OIRA 3LQ5A 3O2MA 4IH8A 4LQMA 4EH8A 4DE4A 5DIAA 4DTKA 5BMSA 4D0WA 4F99A 2IPXA 4FIHA 4XOZA 2PUNA 4BWPA 1OUKA 2B9JA 3D5XA 5AA8A 3MN3A 4IB1A 4ONAA 3FC2A 3REPA 3PSDA 3QX2A 4LRMA 4QMMA 2BUJA 3F5PA 3QF9A 4NSTA 5T68A 4YGAA 4O0VA 4RC3A 3MA3A 3VULA 4QTEA 3LLAA 4FV4A 3EN9A 2XM9A 3C51A 4F63A 3R9RA 1UVRA 4FOCA 4JNWA 4AFJA 5JFXA 2PWLA 3QWKA 3VQUA 3WILA 4X3JA 3G6GA 3TXOA 5EH0A 4R1YA 5L6WL 3QKMA 3TACA 4DGNA 2R3KA 5CASA 4BDIA 2C5YA 1IEPA 3LFCA 5A4QA 3ERKA 3OXIA 4MXCA 2X8IA 3FKLA 4BCPA 1JBPE 3ZFMA 4YSMA 5EYKA 4DH5A 5GHVA 5DT3A 2RFDA 2W1DA 3LJ0A 4U44A 4XX9A 2V5QA 2OU7A 5CT0A 2C4GA 1WBNA 1WMKA 1KSWA 4PMPA 2PUUA 3C50A 3HZTA 4JDHA 1QPJA 4E6QA 3U6HA 4I6BA 3V8SA 4UWBA 4EC9A 3IW6A 3WZEA 1MQBA 2C0TA 4FZFB 4F08A 1HOWA 3BHHA 4ERWA 4F78A 2E2BA 1JKTA 5L6OA 2BAKA 3PG1A 2QOBA 4PL3A 4BDHA 4AGUA 4QMNA 2WTWA 3UBDA 4CYIA 4U81A 3E3PA 4EOPA 4EC8A 1X8BA 3E62A 3I6UA 4AA0A 4BN1A 1WBVA 3BHYA 4B99A 3FZ1A 3PY3A 1XH6A 3SDJA 2IW8A 2W06A 1BYGA 3L9PA 2ITUA 5AUYA 4YTIA 2XBAA 4RT7A 5H2UA 3NWWA 4FVPA 3VS1A 1MP8A 1SNUA 3MGYA 4YZBA 4F70A 4YURA 3QCQA 3R9OA 5CZHA 2HY81 3HUBA 3U4WA 4BDDA 3UPZA 4CMOA 3QFVA 2O5KA 3DK3A 5GJFA 3BLQA 4O21A 4KWPA 4O7LA 4GRBA 2H6DA 5M09A 3ATTA 1P4OA 2IW6A 3BBWA 3GCUA 3OXZA 5AEPA 5HESA 4QYFA 2UZOA 3MJ2A 2YZLA 5DRBA 3W16A 3I5ZA 5AR2A 1H8FA 2BZHB 2R64A 3PRFA 4CEGA 2W7XA 3W0RA 1GAGA 1QPDA 2NYAA 4L45A 4D5KA 4NW5A 1GNGA 3R8LA 4TWOA 1ZMUA 4OBPA 5AAGA 3SXFA 4AZWA 3VBVA 1KE7A 3PJ8A 4MVFA 3G9LX 4GMYA 4YJSA 4YZMA 4BF2A 2C0IA 1J7UA 2PVRA 5BYLA 4EQUA 3HMNA 3F2NA 3FSKA 1IG1A 4L9IA 4KNBA 3ZBXA 2JGZA 3BYMA 4FT3A 4ZMEA 5M08A 2VGOA 2OG8A 4O4EA 2IVTA 2VO0A 3S2PA 5EQYA 3LXPA 1OPLA 3UP2A 5AUXA 4RIYB 5FGKA 3R1YA 3FZOA 1P4FA 3ZEPA 4C3FA 2RKUA 4O22A 4TY1A 4F9BA 4ZSEA 4FV0A 4GUEA 2I0YA 3A62A 4PL4A 4QP2A 3DXNA 1I09A 5DMZA 5J1VA 4RVTA 4OAUC 1JSVA 4JJRA 4FTMA 5ETIA 4FEVA 3ELJA 4QDVA 3V5TA 5TF9A 3MY0A 4H1MA 5HE2A 4AFEA 1YI6A 2C6EA 3W0MA 3A4PA 3FYJX 4U3YA 3A4OX 4EOQA 3OF0A 4ZLYA 3IDPA 2KTYA 3ID6C 2YAAA 4V0GB 5B7VA 2PVJA 5E8ZA 5IQHA 1F0QA 3D2KA 3Q53A 5IQFA 3EQFA 3NYXA 3WZKA 2WXVA 2VO3A 3KVWA 2BRGA 5JFSA 2J0JA 5HTBA 3BELA 5K0KA 4YBJA 3FL5A 5GNKA 4I5MA 1Y91A 4JS8A 3W2QA 4QQTA 3KK9A 4OTIA 4C59A 5AV0A 4WBBB 4D2VA 1UV5A 2Y4IC 2GS6A 2YWVA 2UZWE 3KEXA 4I5CA 2BFXA 1Q62A 3C4EA 4OT6A 5AWMA 4EKLA 4EORA 4IW0A 1OGUA 3ZUUA 3Q4ZA 5HVYA 4BDJA 3VS3A 5CXHA 4J99A 5HTCA 4Q9ZA 2WIPA 2ITVA 3JPVA 2RFNA 3LFSA 1R39A 1XMLA 1ZY5A 3BQCA 3C1XA 5CEQA 4BTFA 4K18A 2P0CA 4QMYA 1YDTE 2HW7A 2XIYA 4F9WA 1FVRA 5D12A 1Q8TA 5BPYA 3GU8A 4Y73A 3TL8A 3PP0A 1UNHA 3ORXA 4JRVA 3BE2A 1RQQA 1YWVA 3GP0A 3DZQA 4EH3A 4LV5A 4Y72A 3THBA 4ERKA 2EUFB 5HZNA 1SVHA 5LVOA 2XNPA 1OPKA 2HK5A 5AP5A 1YI4A 2ZFYA 2WTKC 3I81A 3GENA 4FR4A 2X2MA 3F3TA 1WBSA 1OL1A 5AJQA 3A8XA 3I0OA 3UPXA 1E1XA 4N57A 4O84A 4I92A 3C9WA 4QYHA 4S30A 5E4HA 1OUYA 4FUYA 3SQQA 3I4BA 3ZUTA 4UYNA 1SM2A 3A7HA 1L3RE 2W1HA 3H0ZA 4ZJJA 4FEUA 5CNNA 5FXRA 5KMKA 2A1AB 2OK1A 3FQSA 1O6LA 3NFFB 4RC2A 3HMIA 1YRPA 3LMHA 1DAWA 3AD5A 3FJQE 3ZFYA 5DNRA 2ZV9A 4Z7HA 4R77A 5KZ0A 2ITWA 3IK3A 5BUEA 5IH4A 1JSUA 1YXUA 4FSQA 3RK7A 4FTTA 3FZTA 4LMUA 3RKBA 3SV0A 3LJ2A 5FQDC 3ZC5A 4AOJA 2GS7A 2WMWA 4CRSA 3H10A 1FMOE 3HMPA 4MK0A 2LGCA 4C4JA 2Y0AA 4G3GA 4C4EA 3NIZA 1FINA 2XAOA 3E8NA 3LCTA 3BGZA 3IG7A 4AT5A 4PWNA 5IA3A 2VGPA 3DTCA 3TJCA 1B39A 3MESA 3FL4A 4LL5A 3JY9A 3IS5A 4PV0A 2NRUA 3UO4A 2Y4IB 4BI2A 3EMGA 3AMBA 2ZM4A 4V05A 3QZGA 1YOJA 3UYTA 1Q41A 3MH1A 2PZRA 1KE8A 2I40A 3QD4A 4ZZMA 5DA3A 4EOKA 3IGOA 2FVDA 2ETRA 3NNWA 5AUWA 4C8BA 5L4QA 2CLQA 4JT3A 4FV2A 1DAYA 3FMHA 4Y85A 3WIKA 2XH5A 4AXDA 5LVPA 2WTIA 4G3CA 2PHKA 3BBTB 2UW7A 3QQHA 3CY2A 3GI3A 4ACDA 2R9SA 3DCVA 4FIFA 4QT1A 3FV8A 1UU8A 5BX0A 4FTLA 3EHAA 4FKVA 4PMTA 5EM7A 3NZ0A 4BCGA 4YTCA 3HRFA 2UZUE 1QCFA 2RSVA 4D2RA 2V62A 4DAWA 5FUTA 3PPZA 5CF5A 4RLLA 3RPRA 5C26A 3EFWA 2XK8A 3A61A 2VTQA 4NKAA 4OLIA 4QMWA 3E8DA 3AT3A 2QOHA 3IO7A 4BY9E 5DLSA 2CNVA 2BALA 1RW8A 4ACHA 2QLQA 4PTGA 1KUTA 5BVWA 3W0NA 5J7BA 3KMUA 3GXLA 5LVMA 4MEDA 4NFMA 2GTMA 5DFPA 1WBWA 5DGZA 3AGMA 3K54A 1ZWSA 2YITA 5J5TA 3PVGA 3F5XA 4PL5A 3FKNA 3PY0A 3R04A 5HI2A 2HXQA 4PP7A 4RWJA 3MTFA 1VZOA 3W55A 4DLJA 4F7NA 3EB0A 5M4IA 3BU5A 4HPUE 3UNKA 3ZM9A 3OMVA 4UMQA 4XBUA 3H9RA 4ZJVA 4YPSA 2YM6A 4I5PA 1G3NA 4YJUA 3W32A 4WD5A 4AZVA 2W1E