3ZFXA

Crystal structure of ephb1
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
283
structure length
267
Chain Sequence
AKEIDVSFVKIEEVIGAFGEVYKGRLKLPGKREIYVAIKTLKAGSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords EPHRIN TYPE-B RECEPTOR 1
publication title Completing the Structural Family Portrait of the Human Ephb Tyrosine Kinase Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 78
structure length 267
sequence length 283
chains with identical sequence B, C, D, E, F, G, H, I
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-12-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zfxA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zfxA01
1ZAOA 3QD2B 4IVDA 4A06A 2X9EA 3LVPA 4IB3A 4C3PA 2RFNA 1DAWA 3R1YA 4BWPA 2QVSE 3AC3A 5JFXA 4C33A 2RIOA 2QC6A 3JY9A 2W4JA 5AX9A 3P7CA 4JG6A 1BUHA 4PDPA 4I23A 4HVHA 3VBTA 3SC1A 3DTWA 3VWAA 1V0BA 5HVJA 2ZV9A 4HPTE 2XNOA 4KSPA 5ANGA 4UMRA 3QTZA 3UZTA 3NMUF 3NVKI 1GIHA 2C4GA 1NVSA 3LM5A 2FYSA 2FA2A 4U43A 3A7FA 3E88A 4GG7A 4XUFA 4I94A 4E93A 4XOYA 2GPHA 2UW9A 5HKMA 5HNGA 2GCDA 3IQ7A 5TF9A 4E7WA 2F7EE 3E93A 2HCKA 3UYSA 5KMNA 3R21A 3QZIA 4B9DA 3A8XA 5FDXA 3DGKA 3OXTA 4ASZA 2PU8A 2VTQA 1ATPE 2J6MA 4FTKA 5IMEA 2IG7A 1OL5A 2PMIA 3IW6A 2HZIA 3ALNA 1OECA 4N0SA 3OCTA 4JG7A 4F9YA 2WQOA 4O6LA 2BDFA 4J96A 4O7VA 3DKCA 4QPAA 4A9TA 4EH4A 4IX3A 4BKYA 3FMMA 2VWUA 3R6XA 3G15A 2XRWA 2EWAA 4IX5A 3KCFA 5CU4A 5KHWA 1YHSA 4YJOA 3ZLXA 4DN5A 5AIRA 2XJ2A 5CS6A 3UZRA 4XLIA 3TACA 2YITA 5BUIA 2W9ZB 3DAEA 3FWQA 2X1NA 3EYHA 2ERKA 4V0GA 4YZDA 2OFUA 4YJNA 3UGCA 5GIOE 1ZZLA 5J9YA 3TNQB 3GUBA 4P90A 2OJFE 4D5KA 3NYVA 1Y57A 3DQXA 5H2UA 4S2ZA 4EOKA 4MYGA 2GS7A 4NJ3A 2PVJA 2R9SA 2FSMX 2R0IA 3LCTA 4EBVA 2XRUA 4TRLA 4Y83A 4JG8A 4HGSA 3S0OA 2VWZA 4FT7A 5AX3A 5BYZA 2C0IA 5E1SA 1BLXA 4DHFA 3QTSA 1Q4LA 2WOUA 4RX9A 3DTCA 4YZBA 3FL5A 3QUPA 4HVGA 3R04A 5IH5A 5CI7A 3AOXA 3JYAA 2EXEA 4GU9A 4W8EA 3U6IA 4I6HA 1PMUA 1YHVA 4NIFB 2X2KA 2VGOA 1UA2A 5IA0A 2VGPA 4BRXA 4K11A 3VBQA 3NYNA 2O8YA 2GS2A 4IAZA 3B2WA 1SVEA 1REJA 3Q9XA 4RJ4A 1H1SA 4EJ7A 2BRHA 4LMUA 4WT6A 5DPVA 5DFPA 4C8BA 4NT4A 2EVAA 4FOBA 4HZRA 5CVGA 4UX9A 4QP1A 3E5AA 5EM8A 2PZRA 5L4QA 5KMOA 2YDJA 4L8MA 4FT5A 3ZMMA 4CD0A 5HQ0A 2JDRA 3TNIA 4WUAA 4BCPA 1PXJA 4QP7A 3OW3A 3DXQA 4FTLA 3DLSA 4J97A 5DT4A 4EORA 4I92A 5CEOA 2CNQA 4J71A 5FP5A 4CRSA 5CF8A 3G0FA 3P23A 2VO6A 4Q9ZA 3PA5A 2UW3A 4MH7A 4ZTSA 3V5WA 3FEGA 3IDBA 1K2PA 2BIKB 5CXHA 2GQGA 3ROCA 5LMBA 1F3MC 1HOWA 5GZ9A 4L7FA 3MFRA 4ASDA 3AGMA 2C68A 3QXOA 3GGFA 1ND4A 3QGWA 4AX8A 1XH8A 3BWJA 4FV4A 2YM4A 2UZDA 3EFKA 3VHEA 5CEKA 3PLAE 3MFSA 4AGDA 4IWOA 3FKOA 3VW6A 3ID6C 5FP6A 1R0EA 3IS5A 4WKQA 4I3ZA 5IA1A 3HV5A 2BZHB 4QQCA 4CQGA 2QR7A 3DB8A 4MQ2A 3DLZA 1WBPA 3KULA 5BNJA 2YLFA 1ZWSA 2JKMA 4O0SA 4JBVA 5JRQA 4OUCA 2OZAA 3NUPA 2J0IA 3U87A 3FMJA 3G51A 4QYEA 1I44A 2QCSA 2XIYA 2IW6A 3W18A 4BDHA 4O0WA 4EH9A 3MV5A 3R8MA 4BDFA 2C1AA 4TTHB 1OKWA 1UVRA 4LRKA 4WNMA 3PY1A 3EIDA 4KAOA 4U41A 3RP9A 4FIHA 3WZJA 2YCSA 3F5PA 3LW0A 3R01A 1JPAA 4ZEGA 3E92A 2WMUA 5HIDA 4DGLC 1J3HA 4A4OA 4AFEA 5I9VA 5FEDA 5AV2A 1OL6A 3BGZA 2BAKA 5M4FA 4YBJA 1M7NA 2VNWA 3NNXA 2A1AB 5E8WA 2WMSA 2VRXA 1Z9XA 3V04A 5L8LA 2Z8CA 1KSWA 2ITYA 4YBKA 4FVRA 5GINE 4D1SA 1JSTA 4UYNA 2Q83A 4IB1A 4MF0A 2W99B 2VO3A 3D5UA 1VJYA 3MSSA 4OTHA 4QP9A 3RAIA 4BWKA 3V5QA 3OXZA 3BGQA 3ZH8A 1YXXA 3BHUA 2UW5A 3UNJA 3PA3A 5AP7A 3ATSA 3LFAA 3AMAA 3E8CA 1W8CA 2F57A 4KRDA 4RQKA 3B8QA 4B8MA 4BCJA 4PPAA 5EDRA 4Y46A 2BVAA 2XNPA 4WNPA 5EYCA 3U6HA 2PPQA 3PXKA 4IBMA 2BDWA 5FRIA 5IQEA 5GIPE 3CGFA 2C3KA 2YM3A 4GRBA 3ZSIA 4NL0A 3RPSA 2PZ5A 4UZDA 4M13A 5AV1A 1JSVA 3GCVA 3P9JA 3QRKA 5HBHA 3BHYA 3HMOA 3GBZA 1PXLA 4FTOA 4M68A 1FGKA 4DEAA 2J5FA 3R7EA 3R8ZA 3DV3A 3DZOA 3U9NA 4TL0A 3EQGA 4QYYA 3H9RA 1BL6A 4ZS0A 5AAEA 2YABA 3DBDA 3PY3A 4QTCA 4O6EA 1BYGA 1UU3A 5CSXA 3Q4TA 5AP6A 1SZMA 4JLCA 3ENHA 4FKTA 3ZSHA 4TYHA 5JRSA 3V5LA 4A9SA 3LLAA 5JK3A 3B2TA 2UZNA 3LCSA 4IDVA 4QP2A 5M55A 4R1VA 3PUPA 5EHOA 5BVKA 3F3TA 3GCPA 5DRDA 4D2VA 3D83A 5M4CA 2OK1A 4FKIA 2J7TA 3C4WA 4M14A 1M17A 2IWIA 4DCEA 1NVQA 1X8BA 2W7XA 4FMQA 5ETFA 4K8AA 4FKOA 2JAVA 2JC6A 2W4OA 3FMLA 2P2IA 3QRTA 5ANEA 3ZO3A 4F65A 4FGRA 5IQBA 2GNIA 4ONAA 3EHAA 2C30A 3VQHA 4EUUA 1YVJA 3ENMA 3QYZA 4O82A 5BYYA 4D1XA 1UWHA 4EOPA 3KA0A 5KBQA 3W8LA 5C8MA 4BBMA 3VULA 2QURA 4CKJA 3KN5A 2IZTA 1ZMUA 4M0YA 1XKKA 4P2KA 1QCFA 1ZOEA 4BYJA 5DOSA 3ZO1A 2XEYA 4MKCA 1OBGA 2XB7A 2XH5A 3FI4A 2OFVA 4YZ9A 4TWPA 5T6KA 5HHWA 1SM2A 3CTQA 2Y9QA 3G6GA 3PJ1A 4BZOA 2O3PA 4IH8A 4BB4A 4F7LA 4DF3A 3C0IA 4NWMA 1GOLA 3QCYA 4ZP5A 2WTVA 5JFSA 3D5VA 5J95A 4RIYA 4RMZA 4QTBA 5K4IA 1M14A 5IH6A 2KTYA 4L01A 4WD5A 5D11A 3RPVA 3PDTA 4C3FA 1B39A 2WTCA 4JQ7A 4ORKA 5A4EA 4BZNA 4DT8A 3Q5IA 4GFGA 1R1WA 2I0HA 4CT2A 5HX8A 3UC3A 4QYHA 1JKLA 5EYKA 3T9IA 5DEYA 5ICPA 2GFSA 2YDKA 2CSNA 5KZ0A 3RGFA 4C3RA 5CSVA 3C13A 2VTSA 4C35A 5IMXA 4PTEA 2BR1A 5HLPA 3NWWA 4BDKA 4Z16A 1PJKA 1QL6A 2WQBA 3HA6A 3VS2A 3GFWA 3UPXA 2ITXA 5J5SA 5KNJA 1FVTA 1YRPA 3G33A 2J0KA 3OW4A 4MWIA 4QMOA 4D2PA 4YJSA 2YHVA 3TI1A 2JDTA 4JX7A 4F6UA 4F7NA 4ZMEA 3H10A 3TEIA 4FZ6A 5K9IA 4IMYA 1FVRA 4O0RA 4C57A 5CAOA 1Q8TA 5DRBA 3CQUA 2WMVA 4UY9A 1PHKA 3AC2A 2RG5A 3W2PA 4EH6A 4CZYB 3EN7A 5AP2A 4DEGA 1GNGA 3O8UA 2XK3A 4ENYA 1A9UA 4RA4A 2UW4A 4OT5A 4XCUA 1IEPA 4JR7A 3LJ1A 3MS9A 4FV7A 3CTHA 4Y5HA 4ZLYA 4QTEA 3Q5ZA 4ERWA 3C9WA 3NGAA 5K0XA 3R02A 1KWPA 4XNEA 2DWBA 3LQ5A 4J99A 4LOQA 4EK4A 2W17A 2XMYA 3GNIB 5CQWA 4CXAA 2XNMA 4RC2A 2C6OA 3RBWA 3OVVA 3WF7A 3PSDA 5A4LA 5HO8A 3EN6A 1FMOE 5LVPA 3G5DA 2YIRA 4F6WA 4MWHA 2PMOX 4ZOGA 4FUYA 2QHMA 3EFLA 3HDMA 4O0YA 3VBXA 5BVWA 3WI6A 1WBOA 1TQMA 4BIDA 3EJ1A 2I6LA 3R1QA 2VTOA 4E20A 3O96A 3E8EA 3V3VA 5B2MA 1WBSA 5IZFA 3BEGA 4DFXE 5AIKA 3UDBA 5EDPA 3NEWA 5KUPA 3FLQA 5A4TA 1TVOA 4RJ3A 1XJDA 4ANLA 5EG3A 2CNUA 2ITTA 5DBXA 4H3PA 4CFMA 4AT3A 3D4QA 3W1FA 3ZLYA 4BTKA 1IRKA 5HVKA 5CEQA 3EYGA 4N6YA 4JIAA 4AOJA 4NTSA 3KU2A 5E8VA 4I5MA 4D58A 2H34A 3BBWA 4EK3A 2UW8A 3UO5A 2G01A 2CKPA 3ZTXA 4HNIA 4C61A 5J5TA 3C5IA 2HOGA 3VUKA 3RZBA 1U5QA 3NNUA 4RWKA 2R3MA 2YN8A 3RCJA 3OWLA 4N6ZA 5EQEA 4F9AA 3TTIA 1XBCA 1SYKA 2B1PA 2XIRA 3A62A 5HG5A 4JI9A 4XG7A 4X3JA 3VHKA 3LE6A 4DITA 5L3AA 3QYWA 1J7LA 4D5HA 4FTTA 4QMMA 1YOMA 1YWVA 3LCDA 2X8IA 5I9WA 4AA4A 5HESA 4AZTA 3Q9WA 3W2CA 3WF8A 5TE0A 4J1RA 3GU4A 3ERKA 4FI1A 2ITWA 2YAAA 3F5UA 3LM0A 5HOAA 3QFVA 3R2YA 3FZ1A 4PRJA 2VWBA 4M69B 4FZAB 4P7EA 4TYEA 3EQBA 3H4JA 5C26A 3SDJA 3GU5A 4UWYA 3E7VA 4MNEA 2FO0A 5AP5A 1JKTA 4L68A 4RVKA 4KIKB 2ZB1A 3EMGA 2C6EA 4YSJA 5E4HA 2ITVA 3FLSA 4U0IA 1NXKA 2VTNA 3JY0A 4BI2A 3RTPA 1CTPE 3IW5A 4IFGA 2OF4A 1Y8YA 4FT3A 3DBCA 1Y6AA 3NVMB 5ETCA 3O2MA 5HCYA 4EWQA 5DYJA 4AA0A 4DLJA 3PRFA 3IGGA 4EOSA 1ERKA 4I5HA 1GIJA 3EQFA 4QNAA 4W4WA 1FQ1B 3VF9A 2NP8A 3ORKA 3BV2A 1H26A 4YC8A 4RLKA 4Y95A 1KE6A 4QMZA 4A9YA 5FXRA 3A7IA 4R7BA 1Y6BA 5C1QB 3OTVA 1FGIA 4L00A 1Q8WA 3NUUA 4AXAA 5TKDA 4RX7A 1Q8UA 2PVHA 3D2IA 4TZRA 1AQ1A 4GJ3A 4DAWA 5IEVA 4I20A 4GFOA 3AD5A 4YHJA 4CNHA 3BEAA 2G2HA 3QBNA 4KBAA 3NUXA 3COHA 4RIXB 4RZWA 4EHEA 4TYHB 3ZUUA 4ZY5A 4EOLA 4IZ5A 5E92A 1OB3A 4FNYA 3WZUA 3EN4A 1DI8A 4X2NA 3SLSA 2FSLX 5M44A 5FM2A 3MH0A 4JOAA 4G6OA 2OI4X 2VWYA 3R1SA 3JUHA 4FSQA 3TUDA 5FTQA 1FOTA 3D7ZA 5KMIA 1WVYA 2OG8A 3DS6A 1BX6A 2UW0A 4FTRA 3DJ7A 2X6DA 1WBWA 3PY0A 4QD6A 4CKIA 5HU3A 3BE2A 1YI3A 5DE2A 4CMUA 4LGDA 1H01A 2Y8OA 4Y85A 4BCKA 4BY9E 1DAYA 4LI5A 1R0PA 4RFMA 5ANOA 4OTWA 4BN1A 2XNEA 3E7OA 4FV3A 2A2AA 4JL9A 5F94A 3HV3A 2REIA 2P55A 2I40A 3R28A 5HG9A 5I9XA 3A7GA 4JBQA 3QF9A 4NIFA 3HL7A 3I81A 4LL0A 4FTQA 1ZYJA 3CE3A 3LAUA 3MPTA 3VS6A 5GJFA 4PPBA 2C5VA 4F4PA 4ZSLA 4O7RA 4DGNA 3W55A 2OZOA 4L52A 2VTAA 5AADA 5DT3A 1PW2A 4R5YA 2UZOA 4BCIA 4DGGA 1UU9A 5ETIA 1UU8A 2WNTA 3EQCA 4BFMA 4E3CA 4IZ7A 4BDAA 3MIAA 4S31A 4F1OA 2Q0BA 3KVWA 2XP2A 3C4ZA 4YSMA 4L3PA 4DFBA 1MQ4A 2VX1A 5J9LA 4O83A 2HAKA 1A06A 2JD5A 2DQ7X 4DH5A 3ZFXA 5I9YA 5LWMA 4BIBA 1F0QA 3CQEA 4JJRA 3DK7A 3NR9A 4Q2AA 2VV9A 3FMNA 3ZLWA 5J9ZA 2BDJA 2X7FA 3AC4A 3V01A 4HW7A 3EKKA 3MJ1A 5DGZA 5EHYA 4D9UA 1YXVA 2WMXA 3MH1A 3QTXA 2YIXA 2X2MA 2QR8A 5ANKA 2E2BA 4YPSA 4CLIA 2X7GA 3DKGA 3FLZA 3FSFA 5HIBA 1HCLA 4AZSA 3UQFA 3BWFA 4I4EA 4E6DA 3FLNC 3TTJA 2OIBA 1LUFA 4GSBA 3PXYA 3TM0A 2PVLA 5C01A 1T46A 4F9BA 4EWHA 4CMTA 3Q52A 4WNOA 2IZUA 4Q5EA 3ANQA 4XX9A 4G3FA 3V5PA 3VUIA 3QQHA 4DCAA 4NCTC 4QMWA 3UIXA 5E8YA 4WO5A 5JQ8A 2YZLA 4BCGA 3DFAA 3OS3A 3EOCA 3IOPA 3KGAA 2PYWA 3QQLA 5T3QA 4L67A 3D5XA 4JRVA 1WAKA 3DT1A 3PJ2A 4BBEA 2WPAA 3KXGA 3PSCA 4O2ZA 4C0TA 3I0OA 3EQHA 5HCXA 3QX2A 3UP7A 3NUNA 5HG8A 5HD7A 4R77A 2PUIA 4WG5A 2HENA 4MVFA 4AE6A 3PXZA 3WZEA 3KXMA 3LXNA 3OEZA 3BLQA 3HRCA 4RT7A 3ODZX 4GKHA 2BFYA 2QOBA 4RA5A 2QO2A 4I0RA 4ANNA 1J1CA 3LMIA 3QKKA 5CZHA 3PE1A 5A4QA 4Z55A 1BKXA 3CC6A 4X2GA 1B6CB 3CBLA 4FSZA 3NLBA 3HAVA 4ACMA 3KMUA 4FX3A 3WBLA 2WTWA 2ITZA 4D0WA 4ITIA 5M4IA 3FHIA 3GEQA 3IK3A 4G5JA 3VBWA 5LVOA 3BPRA 5LMAA 3LQ3A 1XH6A 4UEUA 4CMOA 1G3NA 2GS6A 5L8KA 2R7BA 2V5QA 3R00A 4CFFA 1M2RA 1XWSA 4E5AX 5H8BA 2W1CA 2JBPA 4FG8A 4O1PA 5DMZA 4MCVA 3L9PA 4HYUA 1M2PA 2H6DA 3RPRA 3COMA 4FNXA 1UKIA 5CNNA 5HLNA 1OKZA 4GV1A 2YWPA 4NW5A 4PY1A 2X4ZA 5DIAA 3KREA 4O84A 2AUHA 3HRFA 3QZFA 2CCIA 1ZY5A 3F7WA 4ITJA 4O0XA 4FV8A 4PWNA 2PK9A 2VTIA 1GIIA 3KK9A 1F5QA 4Z9LA 1Q41A 4DEHA 3UODA 4EQCA 2P33A 4G16A 3IW7A 5AR7A 3HA8A 1LPUA 4IZAA 3HP5A 2F2UA 3QKMA 4AT5A 2XJ1A 4HGLA 4OR5A 4C4JA 4FSUA 5EQPA 3CIKA 3FXWA 1OIYA 3GT8A 3PG3A 1JWHA 3MVHA 4YTHA 5KE0A 4AQCA 2XYUA 2QOHA 3OFMA 1PRYA 2GTMA 2O2UA 3FMKA 4MNEB 3EQIA 4U97A 2X8DA 3QTQA 4RJ7A 4U40A 2BRMA 3VF8A 4GK4A 3MESA 3O0GA 4LOPA 4RJ8A 4LUEA 4ZSEA 2R3QA 4XP0A 2CLXA 2VZ6A 3R7GA 1U59A 3RI1A 3VN9A 3CJFA 5E8ZA 4ACCA 1WVWA 2PE1A 2QOKA 2XS0A 4PNKA 3ROYA 5CU0A 4AN9A 3R0TA 4L43A 3DY7A 4FKWA 4WHZA 4NKAA 2WTKC 2XKFA 4BTJA 3VO3A 3MH3A 2F2CB 1RJBA 2C6KA 3FI3A 2J90A 5FQDC 3E3PA 4EZ7A 3TNPC 4M7IA 5K5XA 3C1XA 3VS3A 3IONA 4UYAA 4RJ6A 2XK8A 4JIKA 3I79A 5D12A 5EI6A 1U5RA 4J53A 1CKIA 4DTAA 3QRIA 4JVGA 2W1GA 4O22A 4I24A 1ZMWA 2OJJA 4CFUA 4BR3A 2GNGA 3DXNA 5EM5A 4H3BA 3LJ2A 4YJRA 3O8PA 4AE9A 2CKQA 4GMYA 3IKAA 5M07A 2ITOA 4K77A 4BF2A 3MJ2A 2J5EA 2PZPA 4AW1A 3NW5A 4U7ZA 2YDIA 3EQDA 1PF8A 3K5UA 3MN3A 4FSTA 4XV2A 3WZDA 3ZLSA 5EOBA 3GVUA 1U54B 3RK9A 3ZO2A 3DK3A 5BVDA 5IUHA 4ZSJA 4FK3A 2BKKA 3SD0A 4FL3A 2OXDA 3R83A 5HG7A 1W84A 1FMKA 1WBVA 4JRNA 4C7TA 3FBVA 4F7JA 1W98A 2EXCX 2CLQA 4L46A 3VS0A 3HV6A 4U80A 3CP9A 5FWKK 2IW9A 5BUJA 4S34A 1UWJA 4L53A 3F2NA 2XNBA 3GCSA 4LQMA 4BCNA 4EH5A 4KIQA 4OBQA 4UBAA 2B53A 2XYNA 4C4HA 3P7AA 5CF5A 3SW7A 4NM0A 4ANMA 2QLQA 5IQCA 2VWXA 4FT9A 3LFBA 4E4NA 1YW2A 3QQJA 4ZSGA 5L2QA 4R3PA 4X3FB 4E8AA 3KEXA 4M84A 4XG3A 3L8PA 3FYKX 3C4EA 4RGJA 4FEXA 2LGCA 3HYHA 4GUBA 4F63A 3QRJA 4UV0A 4IWPA 5C9CA 4LG4A 3WZKA 2OIDA 3L9LA 5CTPA 3RINA 5H8EA 3HZTA 1Q97A 2UZLA 2VTPA 4RIWB 4S32A 1FVVA 3DPKA 1JBPE 3PZEA 2QHNA 2ITPA 3AGLA 3JVSA 3A60A 4PMTA 2B54A 3VQUA 4OTPA 3LOKA 4WSYA 1TQIA 2ZMCA 4ZZNA 4O0VA 4ZTLA 4FODA 5AUVA 1XR1A 3R63A 4N70A 3VJOA 4A9RA 5L2IA 1PKDA 2R5TA 4XP3A 3NNWA 3F3ZA 4RX5A 3QC9A 3Q6WA 4JDJA 2O65A 2X9FA 5EW9A 3BBTB 4XEYA 4YLJA 4HNFA 3POOA 4EKKA 3CR0A 1U46A 3ITZA 3OUNB 4IWDA 4FTJA 5CY3A 3AMBA 3FL4A 3K5VA 4IW0A 4GK2A 4FVPA 1YI6A 4LGHA 4YTFA 3QC4A 5JT2A 3ZDIA 4AZVA 2VX3A 3L8SA 4FZFB 4A7CA 4O7WA 5JFVA 3PJ3A 1OKYA 1CKPA 4LFIA 3KMMA 4FTIA 5JFWA 5IQFA 5ANJA 5J8IA 1H4LA 3GENA 3CD3A 2CDZA 1YWRA 2XIKA 4JNWA 5B0XA 3VS7A 3VUGA 2WAJA 4CG9A 3D14A 2CN8A 3QRUA 2Z2WA 5TR6A 3F3VA 4S30A 2P4IA 3WARA 4DLIA 2EB2A 4QOXA 4FEWA 1Q5KA 3FQSA 5I4NA 3VRZA 2VUWA 4ANQA 2HWPA 2R2PA 4G2FA 4MK0A 3FHRA 2BHEA 4ZZMA 3KL8A 4CFVA 4F99A 5I5ZA 3HVCA 3Q53A 3QD4A 3OWPA 3TIYA 4DH1A 4D0XA 5JMSA 3TT0A 2IZSA 5H8GA 4AGWA 2XM8A 1NW1A 1O6YA 3H9OA 2XZSA 2A4LA 3RK5A 1W83A 2I0EA 3HKOA 3DCVA 3FPMA 1BMKA 2R64A 3R22A 4CCUA 4ZLOA 5IU2A 3W2RA 4AW2A 3QQUA 3O8TA 3PIZA 5FD2A 5CZIA 3ATTA 2JKOA 4ANSA 3LPBA 4AW5A 3EL7A 1WZYA 2PMLX 2ZDUA 3QAME 4EC9A 1H25A 2P2HA 4YO4A 5AWMA 4DT9A 1YQJA 2OJIA 3GXLA 4C38A 5JSMA 1G8AA 4OLIA 3UJGA 2PUPA 4N4SA 4A4LA 4N57A 3VS1A 2R3FA 1RW8A 2GDOA 2R3JA 1OI9A 5JZJA 4E6CA 4B8LA 4USDA 4M69A 3UVQA 4XBUA 3VUMA 4DFNA 1ZARA 4YURA 2YAKA 3LCKA 4GK3A 4KIKA 2QOQA 3VUTA 3HX4A 3OCBA 3HUCA 3CCNA 2C6DA 4PDYA 1JKSA 4W9WA 4XG4A 3UO4A 4OBPA 4BTFA 5AUWA 2XBAA 3ZZWA 2EU9A 5HIEA 4U45A 3Q2JA 2IVVA 1SVHA 2E9OA 2QU6A 3DNDA 5M08A 4NYEA 2YIQA 3UMXA 3REPA 2C6LA 2BPMA 5J1VA 5J7HA 3ZFYA 5IQGA 4EZ5A 5CXZA 1NA7A 4F6SA 2VWIA 1XBAA 4IDTA 4DH7A 3ORPA 4IWQA 5F9EA 3DK6A 3NUSA 3ZS5A 3UIMA 2WTKB 4ERKA 2BKZA 5A6NA 1RE8A 4IC8A 4Y8DA 5FBOA 1M7QA 3W16A 3NZ0A 3PVGA 3LFFA 4JBPA 2UZWE 4NKSA 2NNWB 3DDPA 4PL4A 5I0BA 5A3XA 3ORTA 4FV5A 1REKA 1ZZ2A 4PDSA 4D2TA 2XK4A 2YCFA 4TXCA 4WNKA 3KRLA 3RAHA 2HY0A 5CF4A 4RIXA 4FYNA 4GIHA 3G0EA 2ITNA 2WKMA 4O7NA 4F0FA 3I1AA 2XUUA 3R8VA 4BCFA 4MXXA 3PP0A 3BYOA 2QD9A 1NY3A 3M1SA 3MYGA 2RKUA 4USEA 3TIZA 2BTSA 3NUAA 1K3AA 3U55A 2OJ9A 4FIEA 4PL5A 4DA5A 3LZBA 3QTWA 4OTQA 3OWJA 4E5WA 3DKOA 2BZJA 3D7TB 3PIYA 5M09A 4MX9A 5IA3A 5BVFA 4R7IA 4FGBA 3OBJA 4EOOA 3T8OA 2H8HA 4Q5HA 5CVHA 2OKRA 1JVPP 3BHTA 1XH4A 2VTMA 1PMEA 2XM9A 2JGZA 3OT3A 4I5PA 4IACA 5EH0A 5C8KA 3GFEA 3ZRKA 5AR3A 3ZSGA 2PMNX 3QXPA 4NTTA 4G3CA 5CF6A 4PX6A 4HVDA 2ZOQA 5FUTA 4FSRA 3IOKA 5DN3A 3O23A 2ZJWA 4IC7A 4NSTA 4IVCA 4KINA 4CVAA 2CPKE 3AC8A 3SQQA 4ZSAA 2YA9A 5EHLA 4BGHA 3FMDA 3W8QA 4CTBA 4GKIA 5EFQA 5J1WA 2IVTA 4F0IA 2E9NA 3QCQA 3UQGA 4WOVA 3MB7A 4XJ0A 4ALWA 4BHNA 1YOLA 3KXNA 3QHRA 4FKSA 4MF1A 4MBIA 1STCE 3E8DA 4JBOA 3RWPA 4AAAA 4AGUA 4AN2A 5M51A 2WFYA 3CKWA 4TPTA 4BIEA 4KSQA 4EUTA 4RZVA 5ANIA 4AA5A 2PHKA 4ZJVA 3MW1A 3UE4A 1ZMVA 5EYMA 1UV5A 2XK7A 2IN6A 3NAXA 3HGKA 3RPOA 2PZIA 4LM5A 5DI1A 4CRLA 4EHGA 2BRNA 4H58A 5KCVA 4CFWA 5E7RA 3MA6A 4TYGA 5HE3A 2WQMA 3D2KA 3HMPA 3UOJA 4KIPA 4RRVA 3TXOA 4U42A 2C69A 3WILA 1YDSE 2C6MA 4FKJA 1XO2B 3A4PA 3CXWA 2ZDTA 3AD6A 3A8WA 3LFEA 4IJ9A 4QYFA 3F3WA 1H0VA 3D9VA 3FC1X 2YLEA 3GC0A 4GL9A 2A0CX 4B0GA 5ITAA 1MRYA 3F6XA 4EYJA 5M06A 4XG8A 1M52A 3VS4A 4QMXA 4Y73A 5EM6A 2YERA 2FUMA 4XRJA 1QPJA 4X0MA 4M97A 1V0OA 4AW0A 3BZ3A 4UWCA 5AA9A 3CKXA 3KC3A 3P1AA 4F64A 4QMLA 5L2SA 3U51A 3BGPA 3WYYA 1JLUE 4FTNA 5L2TA 5AA8A 1Q3DA 5EI8A 4DBNA 2WD1A 4PUZA 1BL7A 2QG7A 3ETAA 2C5OA 4QQJA 5E91A 2BTRA 3MDYA 4IXPA 2WQEA 1WBTA 4IADA 1SMHA 3MVJA 3TWJA 3DXPA 4TYIA 3VS5A 5CANA 2HW6A 3OXIA 2UZBA 3NNVA 4F1MA 3RJCA 3UBDA 1PYXA 4XV9A 5A14A 2FSTX 2F9GA 3ZDUA 4II5A 2WU7A 2R3RA 3MWUA 2H9VA 4M0ZA 4YLLA 5E8XA 3Q96A 2HELA 2VWWA 3EQPA 1TKIA 3VW8A 3AMYA 4WA9A 4D9TA 4IX4A 4BC6A 3CPCA 2YM6A 2OLCA 2B7AA 3RNYA 3F66A 4EKLA 2GU8A 4EBWA 3MIYA 2WMRA 5F95A 4EK6A 4FICA 4D2SA 3R9OA 3VAPA 3R7UA 3R2BA 5CASA 2QOFA 3ZONA 4QMQA 3QUEA 4BKJA 5L6OA 4FV0A 4FNZA 4GS6A 1VYWA 4R3RA 3O7LB 4RWJA 3W2QA 2BILB 1S9JA 2JITA 4FSWA 3QCSA 3ULIA 3MTLA 2PUNA 4BHZA 4L9IA 3GU7A 4LV5A 4F0GA 2QKRA 2X39A 4RVTA 4A9UA 4I4FA 4YLKA 4AOTA 4KBCA 3G2FA 3FQHA 5CSWA 3PG1A 3LMGA 4IANA 3ORXA 4D4RA 5IA2A 3IDCA 3W2SA 3DKFA 2NRYA 3I6UA 3QU0A 2R3OA 3CJGA 4G9CA 4HGTA 3ZO4A 4J52A 3F69A 2ZMDA 4YJUA 4BDJA 4AFJA 4L3JA 1OBDA 4ALUA 5AR5A 4LRJA 3V6RA 5ACBC 4FSNA 3WF5A 5A9UA 2WTDA 2UZUE 4G3DA 4GT4A 4YJVA 5EI2A 3BYUA 2PE0A 5CENA 3NW7A 2OBJA 3BYMA 4AF3A 4EOQA 4NU1A 3PPKA 2YJSA 3ACKA 4PF4A 2RF9A 3NRMA 3W33A 2JIIA 4MXAA 2HY81 2QOCA 4HYSA 4QRCA 5AUZA 4FNWA 3MPMA 2C5YA 5EM7A 1H0WA 3MTFA 3EH9A 1J91A 3KRWA 3V8WA 1V0PA 4L6QA 4HVIA 2XK6A 3QWKA 5BVNA 4Z7GA 3HLLA 2OWBA 4ZTMA 2W1IA 4QMNA 3ZM9A 3TV7A 2V7AA 3GP0A 3OD6X 4YP8A 3LLTA 1OM1A 4TW9A 4TNDA 4DEBA 2CMWA 4DFYA 4ITHA 3V5TA 5FXQA 4AOIA 4G1WA 2UW7A 5FLFA 2GHMA 3A7HA 5CU3A 3ZXZA 2IO6A 3MVLA 5EQYA 1YHWA 4R5SA 3P7BA 4D2RA 4ZY4A 5KZIA 2GSFA 3ELJA 5JH6A 3FUPA 3A4OX 4XG2A 3O50A 3S1HA 1H1QA 4K1BA 4M3QA 3BIZA 5AM7A 3S3IA 3OUKA 3V6SA 4BYIA 1U54A 4G3GA 4O7SA 2X81A 4MHAA 3R7IA 3CLYA 5HE0A 2LAVA 4ZMFA 4JS8A 4O7LA 2C3JA 1OPLA 3LFDA 3I0QA 1QPCA 5FXSA 2W5BA 3U9CA 1ZRZA 3LMHA 4UXLA 3GCQA 2JLDA 5EK7A 2Y6MA 3BLRA 3ORNA 4EC8A 1XBBA 3BQCA 2B52A 4O96A 4ZJJA 3KXXA 3QCXA 3ZRMA 3JR1A 1JNKA 1J7IA 3HMMA 4ZTQA 5BMMA 1OUYA 4HCUA 4IM2A 1FBNA 4UMQA 4F9WA 4X2KA 5BX0A 1UNHA 2YM5A 3HUBA 3L8XA 5FTGA 3Q4UA 4E1ZA 5D9HA 4D2WA 4DINA 5KX8A 4KWPA 4KBKA 4B6LA 5BUEA 5EOLA 1OUKA 2VWVA 4EEVA 4X3FA 2IVUA 3DAJA 2F49A 3WE4A 2WTJA 4DC2A 3QQFA 3SA0A 2X2LA 1A48A 3RHKA 3NUYA 4IE9A 2QU5A 4RIWA 1H1RA 5G6VA 5EYDA 4IAAA 2ZV2A 4EOMA 4RIOA 4CYIA 3I6WA 2BUJA 2PUUA 2ZV7A 4QMYA 2CKEA 4IFCA 4OW8A 3UG2A 3U54A 2GHLA 4FIGA 4OTIA 4QYGA 3N4TA 4KB8A 1XH5A 2PSQA 4ARKA 4CGAA 2WMWA 2JAMA 4WG3A 2JEDA 5BQ0A 4LUDA 4NCTA 3R8LA 4ZLZA 4JDKA 3N4VA 5GJDA 3L1SA 4GG5A 1XQZA 3U4WA 4RFYA 4IAFA 4F9CA 3C0HA 4U3YA 3U8WA 3DU8A 2OF2A 3K3IA 3OY1A 3R30A 4RQVA 5AUYA 3D15A 3EN5A 3BYVA 4GH2A 5FEQA 4C34A 2UUEA 4QMPA 5C4KA 3MY0A 4NM7A 3FY0A 3Q04A 4EOIA 2UZVA 4APCA 2YISA 2IW8A 1PXIA 3R7YA 2C0TA 3VIDA 4PTCA 4ACDA 2QONA 4FEQA 4APPA 1APME 1ZYLA 4QP4A 5BYLA 2HXQA 1S9IA 4GVJA 3F7ZA 2R3HA 3PZHA 5E8TA 5AFVA 2E9PA 1Z5MA 3TUCA 2UZTA 4X3FC 2B0QA 5KMLA 3CD8A 5FBNC 3FMEA 3Q32A 5E1EA 4PMSA 4OAUC 4L3LA 3W2OA 5DA3A 4YJPA 1FINA 5C03A 3OHTA 3ZEWA 2X6EA 3FMHA 4BKZA 2PULA 2WMQA 4A07A 4C36A 4YU2A 5A4CA 3H3CA 1Q62A 4HGEA 2V0DA 4LOOA 2PVKA 4YGAA 5CSHA 2F7ZE 3I5NA 3AT2A 5I3RA 1LEWA 4MD8E 4ACGA 4I1ZA 1R3CA 5CT7A 5DH3A 2PVNA 2ZM3A 3FLYA 1PYEA 4FSYA 5D10A 3AT4A 1U4DA 4R1YA 4QTDA 3AXWA 3RM6A 4XOZA 1H08A 4P5ZA 3VUHA 2HIWA 3E8NA 5DVRA 4A4XA 2JBOA 5IQHA 3DBEA 3D0EA 5LOHA 3MB6A 3BRBA 5M53A 3DOGA 1DI9A 3F3UA 4C59A 5E8SA 1P4FA 2BFXA 2CGUA 2RL5A 3S00A 4I22A 4KRCA 3T3UA 5FDPA 4RWIA 4WSQA 1O9UA 3ZM4A 4UALA 3RWQA 3IECA 2OU7A 2BAQA 4FBXA 5AR4A 4AP7A 3COIA 5HE1A 3UQCA 1SNUA 3Q9ZA 3ZXTA 3LXKA 2OH4A 3C4XA 5LARA 2WEVA 3MBLA 2W4KA 4NW6A 1L3RE 4QPMA 3PPJA 3D5WA 4JDHA 3SVVA 2IPXA 2C3LA 1Q61A 3ANRA 2Z7QA 4IJPA 4RVMA 3OBGA 4OTFA 4C4GA 4ZXTA 3UMWA 2O63A 3CGOA 3PXRA 4NM3A 4HCVA 4FKQA 5KKRC 1OPKA 1MRUA 2YZAA 2AC3A 4PQNA 2J2IB 3GI3A 3LFNA 1KE8A 3BYSA 4P5QA 3GC7A 1FPUA 4L7SA 4AG8A 1RQQA 4RX8A 4YJTA 3ZHPC 4UN0C 5GZAA 5HBEA 5AJQA 2GQRA 3OP5A 3PSBA 4B99A 3VJNA 1VZOA 4XG9A 4YC3A 4C2VA 1XH7A 2R3LA 1G5SA 3HNGA 3U6JA 3QQGA 4BDCA 5E90A 1OITA 3TKIA 2JKQA 4EK8A 4DG3E 3R8PA 2PY3A 3KY2A 4UB7A 3PVBA 5EKNA 4G6NA 4XS2A 5AAGA 2EXMA 5A46A 3ORIA 5HTBA 3R73A 2UZEA 3THBA 2QODA 3W10A 5JGAA 3BU6A 2I7QA 3D7TA 4I5CA 3UTOA 4MEDA 4BVUA 3N4UA 3TJDA 2OJGA 4E4XA 3UYTA 1IASA 2PZYA 1OGUA 2RGPA 3ZYAA 1K9AA 3S95A 2JIVA 4KS8A 2JFLA 5CT0A 5E9EA 3WF9A 1TQPA 4FSMA 2B9JA 5IF1A 3TDWA 2UW6A 4OAVB 2GQSA 1ZOGA 4CG8A 2ZM1A 5DHJA 1MRVA 3I60A 4FKGA 4MD7E 3VBVA 5JN2A 3NIZA 4TNBA 1H07A 4OTGA 3SRVB 4BCHA 3MGYA 3VRYA 4QPSA 5CQUA 2R3NA 4OTDA 4YTIA 1HCKA 4FL2A 5I9UA 3QZHA 3DDQA 3GB2A 3ULZA 1VR2A 4D4VA 5M4UA 3DBFA 2SRCA 3E63A 3KCKA 2W1ZA 2FB8A 4U79A 4UWBA 2C3IB 5JGDA 3RCDA 4KIOA 4GUEA 2QQ7A 4CEGA 1KUTA 3RNIA 5KMJA 4X2JA 5GZ8A 1Q3WA 5KO1A 2F4JA 1VEBA 4FOCA 4C4IA 4F70A 3L8VA 4MTAA 3LXLA 4G6LA 4ACHA 3C0GA 4UMTA 3VNTA 2PVRA 3ACJA 4FG7A 3UP2A 4Z3VA 5K4JA 3EKNA 3KXHA 2O64A 3I7BA 3KRRA 5CNOA 3AC1A 3NIEA 2OH0E 3QL8A 5JGBA 2DUVA 2R3KA 2XKDA 4O21A 3OG7A 5A54A 4GCJA 4PP9A 3QALE 1Z57A 2YFXA 5LCJA 4DBXA 2XA4A 3NPCA 5GJGA 4HJOA 4O7ZA 3O7LD 3WOWA 4EONA 2HYYA 1EH4A 2XKCA 2QOIA 3R8UA 2XVDA 2QO9A 1R78A 2V7OA 5C8NA 4RC3A 1PXPA 4TKSA 2VTLA 3SOAA 4EH7A 5B2KA 5IISA 4NM5A 4DH3A 2ZM4A 3N51A 4ZIMA 3IDPA 3L9NA 2G1TA 4O86A 4EJNA 3EN9A 4J98A 4HOKA 4NFNA 3IPHA 3QWJA 2AC5A 4K6ZA 3PE2A 3KK8A 4J8NA 4FV1A 2A19B 3P86A 5G1XA 3UG1A 3ZU7A 4BDBA 3O71A 1W82A 3ZRLA 5HLWA 3FE3A 4EL9A 2YCRA 4JQ8A 3F2RA 5AP0A 4QT1A 4WRSA 5AP3A 2WEIA 3P78A 4R6VA 2V62A 4PPCA 2QOOA 2ETRA 3BHHA 4FZDB 3UNZA 2P0CA 4PMPA 2VU3A 4FKRA 4NEUA 3HMIA 3KKVA 4Z7HA 3CQWA 3QA0A 4MBJA 4DEEA 1E1VA 3FZSA 3TNHA 5JKGA 3N9XA 3O51A 3PXFA 5EW3A 3TJCA 2C47A 4YZCA 4ASEA 3FSKA 4O7YA 3OC1A 2QNJA 1GZ8A 5DG5A 2J51A 3ZUTA 2FSOX 1M2QA 4TWNA 3NX8A 5AV4A 3II5A 2OO8X 1J7UA 3NDMA 3DQWA 3PP1A 5HU9A 2ZV8A 5DEWA 4BICA 4D28A 2GNHA 3AQVA 5F4NA 5IDNA 1W0XC 2ZB0A 4F1TA 4TY1A 3DJ6A 4EQUA 3H9FA 3RAWA 3HP2A 2BZKB 5AM6A 2FGIA 3RKBA 5HICA 5HX6A 1YDRE 4FG9A 4FR4A 5J87A 4O27B 1CDKA 3F5XA 3F61A 4P4CA 5KKRB 1IAJA 3CSVA 4YC6A 3KRJA 3PA4A 3FDNA 3C51A 4ZY6A 1KE9A 3WE8A 1URCA 2BRBA 2R4BA 3E3BX 4Q9SA 5FM3A 4BTMA 1YOJA 4H05A 4FEVA 4J95A 5CU6A 5TOZA 3FAAA 1KOBA 2OIQA 3OCSA 4WBOA 5IA5A 3GC8A 3UZPA 5AP1A 1YKRA 4CZUA 4I21A 3NS9A 2Y7JA 5CALA 3PLSA 3NCGA 4FK6A 4DYMA 1H28A 4FKPA 4F08A 4JX3A 3LHJA 4K0YA 4RLLA 4L45A 4DEIA 3FZRA 4BL1A 5IEXA 3VVHA 5AUUA 1UNLA 1H1PA 4F7SA 1G8SA 3OT8A 2UVYA 4O0TA 3TV6A 3FZPA 3L9MA 3UPZA 5GHVA 1KV1A 5AR8A 4B7TA 2JIUA 1L8TA 3OF0A 2YM8A 1YXUA 5TT7A 5AEPA 2X8EA 4U5JA 3M2WA 5GNKA 2H96A 4JQEA 3TNWA 4NK9A 3FLWA 1BI8A 3ORLA 4I6BA 4HCTA 4FZ7A 4H3QA 4YPDA 1O6LA 2Y0AA 3PJ8A 4X6RA 5AAFA 2PWLA 3QLFA 1OL1A 5EDQA 4OBOA 3R9HA 4FTAA 5LXMA 3FKLA 5DR6A 2Z7LA 3G9NA 2PL0A 4GU6A 3QUDA 2XBJA 1URWA 1GZKA 4G17A 5T68A 3UNKA 2WMTA 4BGQA 3GU8A 4EH3A 3QD3A 2YCQA 3FZTA 2GNLA 4IHPA 2Y4PA 4IAKA 4CSVA 4CZTA 5LVLA 2EB3A 4M8TA 2CJMA 3G6HA 4CV8A 3P4KA 4CT1A 1WBNA 4IX6A 2Z02A 1H8FA 4ZK5A 4O81A 4J8MA 3QZGA 3PRIA 1CMKE 1WMKA 3BHVA 3POZA 2WMBA 3Q4ZA 4RPVA 2C1BA 5I3OA 3Q3BA 4C58A 2R3GA 3E62A 4C62A 1LR4A 1WVXA 4FA2A 4H36A 5K3YA 1PY5A 3C4CA 4BI1A 3RPYA 4QNYA 4CQEA 5HO7A 3MY5A 1AGWA 3EZRA 1H1WA 3QGYA 2V22A 2V55A 3ODYX 3PTGA 4H1JA 4XBRA 3TZ7A 4WUNA 4V01A 2A27A 4W4XA 3HV4A 4QQTA 3KFAA 4NH1A 1ZYDA 2VTRA 3A2CA 2HWOA 3FKNA 3EFWA 3H0YA 5CAUA 3QTUA 5CEPA 2UVXA 2R0UA 3DNEA 3V5JA 5D1JA 4HZSA 5FG8A 2XIZA 4G31A 4AUAA 4D1ZA 1OKVA 4CCBA 3BLHA 1QMZA 4QMSA 3PJCA 4FL1A 2FVDA 2Y4IC 1JSUA 4KKHA 4FVQA 4X21A 4I93A 2IJMA 5AUXA 2OXXA 4EHVA 2B55A 2CKOA 1KE5A 2X0GA 5IH4A 4BZDA 3Q60A 4MXCA 2KULA 4RFZA 3ORMA 4QMUA 3V8SA 2GFCA 4O38A 4QQ5A 3M11A 1IA8A 3SOCA 3HMNA 3K3JA 1JOWB 3KMWA 2WIPA 2ETMA 4AGCA 5CEMA 4ZS4A 4AZFA 1SVGA 4ZTHA 2E9UA 4ZJIA 4GIIA 1JQHA 4IB5A 1E1XA 2J0LA 2VAGA 5IUIA 1KOAA 3SAYA 1IAHA 3FY2A 3ZOSA 3NYXA 2YACA 1CKJA 3A99A 3ALOA 4LGGA 5LVMA 2J0JA 2JDSA 4QO9A 4ZTRA 3OROA 2PE2A 2XKEA 4O91A 2B9FA 4R7HA 4RVLA 5CU2A 4ASXA 4EH8A 2ERZE 2VN9A 5HEZA 4AACA 4ENXA 5AV0A 5CLPA 3IO7A 3ZFMA 3UVRA 2GHGA 4AN3A 4BDEA 2VTJA 3P08A 3EZVA 4IVBA 4UMUA 3P0MA 3W32A 1R39A 1H24A 1P4OA 2J50A 4E73A 2RFDA 5FTOA 4TWOA 5D7AA 2ITUA 4U3ZA 5M57A 4V04A 3H0ZA 3I5ZA 3PFQA 4C2WA 4X7QA 2GNFA 4IVAA 3UC4A 4YTCA 4QP8A 4AT4A 4EK5A 2IZRA 5C27A 3VC4A 2DYLA 4EOJA 4DFZE 5BPYA 2JKKA 4F09A 3MA3A 4V0GB 5B2LA 2HZ4A 2I0VA 4UMPA 4LRMA 2XJ0A 4O1OA 5E8UA 3HV7A 3R1NA 1IG1A 3AD4A 3IG7A 4G34A 4O0UA 2JFMA 4XHKB 2J9MA 4IEBA 3C7QA 5DLSA 4LYNA 3TZ8A 3Q9YA 3QKLA 4RBLA 2ZYBA 3TV4A 4AZWA 4XRLA 4JAJA 5ETAA 4TWCA 5B7VA 5AMNA 3FJQE 5DNRA 1ZOHA 3LCOA 4ANOA 3JVRA 2CCHA 2J0MB 3ZBXA 3QX4A 5FGKA 2XNNA 4CLJA 3NAYA 1ZYCA 4BCQA 4U44A 5KHXA 1NT2A 3TKHA 3RAKA 4FTUA 3MI9A 4C4FA 4E4MA 2O0UA 3EQRA 3R9DA 4PTGA 3RVGA 1JAMA 5HE2A 4YR8A 3OCGA 2XNGA 5A6OA 5BVEA 3IW8A 3SW4A 4IQ6A 3LFSA 3FQEA 5CEIA 3IGOA 4FC0A 3UOKA 2VTTA 3SXRA 3Q2MA 5DR2A 2CHLA 1OIRA 4ANBA 4MD9E 3K2LA 2WB8A 4RC4A 4ZTNA 4NUSA 4R8QA 3SKCA 4EI4A 4EH2A 4KKEA 2WXVA 4EQMA 2RFSA 2W1HA 1PMNA 2W05A 2WELA 4S33A 3PPZA 4Y5QA 4WIHA 5F1ZA 3E87A 2WMAA 3OWKA 4KS7A 2RG6A 2W1FA 5HNBA 1Q8YA 2P3GX 3AT3A 2YM7A 2ZAZA 3KXZA 2QO7A 1RDQE 3FZOA 3QTIA 3CEKA 3UIBA 4U9AA 4DE4A 5J79A 1P2AA 1PXNA 2F7XE 5LMKA 2HK5A 4FUXA 5D7VA 4BDDA 1IR3A 1MP8A 3BE9A 4FIIA 4NZWB 2W9FB 2UVZA 4XG6A 5IEYA 1PKGA 1QPDA 5LWNA 3SG8A 3TN8A 4WBBB 5EKOA 1WCCA 4JAIA 4YHFA 3CTJA 4PP7A 4TT7A 2Z7SA 3C5UA 4PNIA 1OL7A 5JZNA 3KULB 5F20A 2PVYA 4FE2A 2WZJA 3BU3A 5HORA 3PYYA 5HTCA 1ZLTA 3NCZA 3FI2A 4RG0A 1Q24A 2OZAB 4FV2A 4YJQA 2Y6OA 4C02A 4WRGA 5L6PA 5AP4A 5CAPA 5JQ5A 1OMWA 3NW6A 4KA3A 3V51A 1W7HA 2CGXA 3MH2A 4E26A 2R7IA 5IUGA 1P5EA 2GTNA 3DA6A 4G9RA 5JEBA 3JPVA 1V1KA 2BRGA 2CGWA 4DGMA 2R3IA 3R7OA 4XV3A 4IAIA 3SRVA 5HCZA 1GZOA 3C50A 4FKUA 3TG1A 4EHZA 2W5AA 3FC2A 4AS0A 4M15A 1OIQA 4MXYA 4E5BA 5IQIA 3JS2A 4QTAA 4GJ2A 5H9BA 2QOLA 4GYIA 2ONLA 4DG0E 1P14A 4QMTA 4HVSA 2C6IA 4B4LA 5AR2A 2Y4IB 1DS5A 2I0YA 1PXOA 4I0TA 4X6QC 4AZEA 4TYJA 4CFNA 1AD5A 2QI8A 4OGRA 3ZC5A 1JKKA 4FIJA 4OT6A 4DGOA 5LMKC 1ZYSA 2BCJA 2W1EA 5HVYA 5H3QA 2XF0A 3GU6A 2BIYA 3BQRA 4K9YA 4PMMA 2BAJA 4FYOA 3UVPA 5CAVA 3PWYA 3NYOA 2ITQA 4BDGA 2RFEA 3WIKA 5IQAA 3P79A 2ETKA 3OOMA 1H27A 1KV2A 4NFMA 4QP6A 5ANDA 3WIGA 4KUJA 5CI6A 3TZMA 3BELA 4R3CA 2VO7A 4LL5A 4MAOA 3MFTA 4QMVA 3RALA 1Y91A 3F5GA 3V8TA 2DS1A 3SV0A 4H39A 3R9RA 1H00A 3LFQA 4DFUA 5BMSA 2IVSA 3R7VA 3A7JA 3WYXA 3B8RA 4ID7A 5ACKA 2C6TA 2QLUA 2WIHA 3GQIA 2NRUA 3R71A 3LFCA 2X4FA 3DZQA 4IM3A 3UOHA 4E4LA 4I0SA 4IZYA 3OZ6A 5HNIX 5M56A 4FV6A 1GY3A 2BMCA 1J1BA 2QG5A 2XK9A 3ZEPA 2I1MA 2XIXA 1PXKA 3GOPA 3GOKA 3CPBA 3EFJA 1OZ1A 3EB0A 3PWDA 4I6QA 5D41A 1CSNA 3UIUA 4GW8A 3MPAA 2C5XA 2PVFA 2ONLC 5EW8A 5K0KA 4W4YA 4D4SA 4E6AA 4YO6A 4HPUE 5L6WL 3HEGA 3OTUA 3I7CA 3DJ5A 4D55A 3KRXA 2VNYA 3G9LX 3KF4A 4Y72A 4M67A 4KD1A 5DR9A 4LV8A 2WQNA 2ACXA 4KKGA 3UO6A 4RJ5A 3A61A 3FXZA 2AYPA 5LJJA 3BI6A 4JT3A 5L2WA 4WG4A 2CNVA 2OICA 5HO6A 4HYIA 3SHEA 4W4VA 1O6KA 3C4FA 4PV0A 2OXYA 4LMNA 5HI2A 5BVOA 5L8JA 3DFCB 1VYZA 4CTCA 4GVAA 1GAGA 4M12A 3GQLA 3RHXA 1YI4A 3OOGA 3OEFX 4I6FA 4MBLA 2X7OA 3LJ0A 4XP2A 2GMXA 4YNEA 5CSPA 3FYJX 1WFCA 2W96B 1BI7A 2HXLA 3EL8A 3FXXA 4W9XA 3LQ8A 5KMMA 3KVXA 5HTIA 1KE7A 3BX5A 2HW7A 2W0JA 3ZUVA 3TUBA 3Q4CA 4FTCA 3PIXA 3M42A 2OGVA 4RIYB 2YWVA 4J7BA 2WGJA 4U6RA 4GYGA 5KMKA 2VO0A 4NJDA 5CWZA 5HZNA 2NPQA 4AWIA 3COKA 3HDNA 2WTIA 4BBFA 4ZAUA 3RM7A 3MVMA 3D94A 4YNOA 5AUTA 3FI8A 3HECA 4JDIA 4JR3A 4O7TA 3O17A 1ZXEA 2XCKA 1E9HA 3I4BA 5FEEA 4XMOA 4DG2E 4K33A 5CX9A 3SX9A 4USFA 1SNXA 5J7BA 3LKMA 1PXMA 3ZC6A 1UKHA 5LVNA 1MQBA 4MXOA 3TKUA 2BHHA 4DEDA 2O5KA 1IA9A 2HZNA 2OW3A 3G90X 4ALVA 2PTKA 4GT5A 3CS9A 3CY3A 3QD0A 5HD4A 2BROA 4BGGA 4FV9A 3CY2A 2C0OA 1DM2A 2G2FA 3OY3A 4R78A 3GC9A 4U8ZA 2W1DA 2WOTA 3TZ9A 5CAQA 4MQ1A 1B38A 1UU7A 4YZMA 4K2RA 3ORZA 4DFLA 2YIYA 4BCOA 3WF6A 5K5NA 2Q0NA 1OVEA 2VD5A 2EUFB 2G9XA 2CGVA 4YZNA 3LXPA 2WHBA 5KBRA 1OIUA 1Q8ZA 2W5HA 1LEZA 1PMVA 1OPJA 2GNJA 4U81A 2FH9A 2RSVA 4GT3A 1XH9A 2YIWA 1UNGA 3SXSA 3BV3A 3ZBFA 5LCKA 1GJOA 5TO8A 3BKBA 4EYMA 3NSZA 3DBQA 4C4EA 4CV9A 4W8DA 4IIRA 1MUOA 4PL3A 3F2AA 4YHTA 5I9ZA 4BI0A 2ESMA 5DWRA 2BZIB 5HGIA 4FEUA 4AU8A 1YXTA 4RWLA 4KABA 3LIJA 3SG9A 3PVWA 3MFUA 4UXQA 4MXZA 4ZZOA 4V05A 3R9NA 2NO3A 2B9IA 2HZ0A 4FKLA 3FPQA 3RMFA 3TL8A 3P5KA 3MY1A 4X2FA 4XYFA 1CM8A 4FF8A 2J4ZA 4C37A 4O2PA 1NVRA 2PVMA 4JXFA 3BU5A 4DH8A 4H1MA 4KNBA 5IPJA 4DTBA 3DAKA 3EWHA 5AV3A 5IKWA 3QLGA 3T9TA 2Z7RA 5IDPA 3QQKA 4OTRA 3HRBA 4D4YA 3KN6A 4FT0A 3TCPA 5HBJA 3IW4A 2C5NA 2YJRA 2E9VA 3AG9A 3QHWA 4TN6A 4DTKA 4G5PA 4XV1A 1T45A 3VUDA 3BCEA 4CYJA 2Z60A 3HAMA 3ZCLA 3Q6UA 2XCHA 1QPEA 4L42A 3RK7A 3K54A 4QP3A 5LQFA 3OMVA 4IB0A 4EZ3A 4RSSA 2CN5A 4IAYA 2W06A 1ZY4A 3F88A 2R3PA 1Q99A 3SXFA 4BWXA 4G3EA 5IG1A 3FV8A 2XEZA 1YXSA 4FKVA 3JXWA 4CKRA 4MNFA 3GCUA 5CVFA 3S2PA 3VBYA 4YMJA 3E64A 4E6QA 3ZZEA 3TDVA 4BCMA 5IQDA 3AC5A 4FTMA 2YEXA 2G2IA 4XLVA 1YDTE 4IM0A 4GEOA 4K18A 3QA8A 3DB6A 1I09A 3PXQA 4I41A 4PDOA 4L44A 3KF7A 5CYIA 1XHAA 5DT0A 2JDVA 4HYHA 2ZVAA 1GZNA 1OL2A 4GFMA 3F9NA 2B4SB 3F82A 3ET7A 3SGCA 4BDIA 5C4LA 3QTRA 2G15A 3KQ7A 4UZHA 3UOLA 3H30A 1Y8GA 1YWNA 2VX0A 2BALA 2B9HA 1LP4A 4YUQA 2WU6A 4M66A 4CFXA 3S4QA 2OSCA 3T3VA 3KB7A 3U4UA 2VTHA 2QKWB 4XH6A 4FIFA 5IA4A 2JDOA 2UV2A 2WO6A 3PVUA 3RZFA
chains in the Genus database with same CATH superfamily
1ZAOA 3QD2B 4IVDA 4A06A 2X9EA 3LVPA 4IB3A 4C3PA 2RFNA 1DAWA 3R1YA 4BWPA 2NYAA 2QVSE 3AC3A 5JFXA 4C33A 2RIOA 2QC6A 3JY9A 2W4JA 5AX9A 3P7CA 4JG6A 1BUHA 4PDPA 4I23A 4HVHA 3VBTA 3SC1A 3DTWA 3VWAA 1V0BA 5HVJA 2ZV9A 4HPTE 2XNOA 4KSPA 5ANGA 4UMRA 3QTZA 3UZTA 3NMUF 3KIOC 3NVKI 1GIHA 2C4GA 1NVSA 3LM5A 2FYSA 2FA2A 4U43A 3A7FA 3E88A 4GG7A 4XUFA 4I94A 4E93A 4XOYA 2GPHA 2UW9A 5HKMA 5HNGA 2GCDA 3IQ7A 5TF9A 4E7WA 2F7EE 3E93A 2HCKA 3UYSA 5KMNA 3R21A 3QZIA 4B9DA 3A8XA 5FDXA 3DGKA 3OXTA 4ASZA 2PU8A 2VTQA 1ATPE 2J6MA 4FTKA 5IMEA 2IG7A 1OL5A 2PMIA 3IW6A 2HZIA 3ALNA 1OECA 4N0SA 3OCTA 4JG7A 4F9YA 2WQOA 4O6LA 2BDFA 4J96A 4O7VA 3DKCA 4QPAA 4A9TA 4EH4A 4IX3A 4BKYA 3FMMA 2VWUA 3R6XA 3G15A 2XRWA 2EWAA 4IX5A 3KCFA 5CU4A 5KHWA 1YHSA 4YJOA 3ZLSA 3ZLXA 4DN5A 5AIRA 2XJ2A 5CS6A 3UZRA 4XLIA 3TACA 2YITA 5BUIA 2W9ZB 3DAEA 3FWQA 2X1NA 3EYHA 2ERKA 4V0GA 4YZDA 2OFUA 4YJNA 3UGCA 5GIOE 1ZZLA 5J9YA 3TNQB 3GUBA 4P90A 2OJFE 4D5KA 3NYVA 1Y57A 3DQXA 5H2UA 4S2ZA 4EOKA 4MYGA 2GS7A 4NJ3A 2PVJA 2R9SA 2FSMX 2R0IA 3LCTA 4EBVA 2XRUA 4TRLA 4Y83A 4JG8A 2IF8A 4HGSA 3S0OA 2VWZA 4FT7A 5AX3A 5BYZA 2C0IA 5E1SA 1BLXA 4DHFA 3QTSA 1Q4LA 2WOUA 4RX9A 3DTCA 4YZBA 3FL5A 3QUPA 4HVGA 3R04A 5IH5A 5CI7A 3AOXA 3JYAA 2EXEA 4GU9A 4W8EA 3U6IA 4I6HA 1PMUA 1YHVA 4NIFB 2X2KA 2VGOA 1UA2A 5IA0A 2VGPA 4BRXA 4K11A 3VBQA 3NYNA 4AQKA 2O8YA 2GS2A 4IAZA 3B2WA 1SVEA 1REJA 3Q9XA 4RJ4A 1H1SA 3NFFB 4EJ7A 2BRHA 4LMUA 4WT6A 5DPVA 5DFPA 4C8BA 4NT4A 2EVAA 4FOBA 4HZRA 5CVGA 4UX9A 4QP1A 3E5AA 5EM8A 2PZRA 5L4QA 5KMOA 2YDJA 4L8MA 4FT5A 3ZMMA 4CD0A 5HQ0A 2JDRA 3TNIA 4WUAA 4BCPA 1PXJA 4QP7A 3OW3A 3DXQA 4FTLA 3DLSA 4J97A 5DT4A 4EORA 4I92A 5CEOA 2CNQA 4J71A 5FP5A 4CRSA 5CF8A 3G0FA 3P23A 2VO6A 4Q9ZA 3PA5A 2UW3A 4MH7A 4ZTSA 3V5WA 3FEGA 3IDBA 1K2PA 2BIKB 5CXHA 2GQGA 3ROCA 5LMBA 1F3MC 1HOWA 5GZ9A 4L7FA 3MFRA 4ASDA 3AGMA 2C68A 3QXOA 3GGFA 1ND4A 3QGWA 4AX8A 1XH8A 3BWJA 4FV4A 2YM4A 2UZDA 3EFKA 3VHEA 5CEKA 3PLAE 3MFSA 4AGDA 4IWOA 3FKOA 3VW6A 3ID6C 5FP6A 1R0EA 3IS5A 4WKQA 4I3ZA 5IA1A 3HV5A 2BZHB 4QQCA 4CQGA 2QR7A 3DB8A 4MQ2A 3DLZA 1WBPA 3KULA 5BNJA 2YLFA 1ZWSA 2JKMA 4O0SA 4JBVA 5JRQA 4OUCA 2OZAA 3NUPA 2J0IA 3U87A 3FMJA 3G51A 4QYEA 1I44A 2QCSA 2XIYA 2IW6A 3W18A 4BDHA 4O0WA 4EH9A 3MV5A 3R8MA 4BDFA 2C1AA 4TTHB 1OKWA 1UVRA 4LRKA 4WNMA 3PY1A 3EIDA 4KAOA 4U41A 3RP9A 4FIHA 3WZJA 2YCSA 3F5PA 3LW0A 3R01A 1JPAA 4ZEGA 3E92A 2WMUA 5HIDA 4DGLC 1J3HA 4A4OA 4AFEA 5I9VA 5FEDA 5AV2A 1OL6A 3BGZA 2BAKA 5M4FA 4YBJA 1M7NA 2VNWA 3NNXA 2A1AB 5E8WA 2WMSA 2VRXA 1Z9XA 3VONA 3V04A 5L8LA 2Z8CA 1KSWA 2ITYA 4YBKA 4FVRA 5GINE 4D1SA 1JSTA 4UYNA 2Q83A 4IB1A 4MF0A 2W99B 2VO3A 3D5UA 1VJYA 3MSSA 4OTHA 4QP9A 3RAIA 4BWKA 3V5QA 3OXZA 3BGQA 3ZH8A 1YXXA 3BHUA 2UW5A 3UNJA 3PA3A 5AP7A 3ATSA 3LFAA 3AMAA 3E8CA 1W8CA 2F57A 4KRDA 4RQKA 3B8QA 4B8MA 4BCJA 4PPAA 5EDRA 4Y46A 2BVAA 2XNPA 4WNPA 5EYCA 3U6HA 2PPQA 3PXKA 4IBMA 2BDWA 5FRIA 3P5JC 5IQEA 5GIPE 3CGFA 2C3KA 2YM3A 4GRBA 3ZSIA 4NL0A 3RPSA 2PZ5A 4UZDA 4M13A 5AV1A 1JSVA 3GCVA 3P9JA 3QRKA 5HBHA 3BHYA 3HMOA 3GBZA 1PXLA 4FTOA 4M68A 1FGKA 4DEAA 2J5FA 3R7EA 3R8ZA 3DV3A 3DZOA 3U9NA 4TL0A 3EQGA 4QYYA 3H9RA 1BL6A 4ZS0A 5AAEA 2YABA 3DBDA 3PY3A 4QTCA 4O6EA 1BYGA 1UU3A 5CSXA 3Q4TA 5AP6A 1SZMA 3TMOA 4JLCA 3ENHA 4FKTA 3ZSHA 4TYHA 5JRSA 3V5LA 4A9SA 3LLAA 5JK3A 3B2TA 2UZNA 3LCSA 4IDVA 4QP2A 5M55A 4R1VA 3PUPA 5EHOA 5BVKA 3F3TA 3GCPA 5DRDA 4D2VA 3D83A 5M4CA 2OK1A 4FKIA 2J7TA 3C4WA 4M14A 1M17A 2IWIA 4DCEA 1NVQA 1X8BA 2W7XA 4FMQA 5ETFA 4K8AA 4FKOA 2JAVA 2JC6A 2W4OA 3FMLA 2P2IA 3QRTA 5ANEA 3ZO3A 4F65A 2ZFYA 4FGRA 5IQBA 2GNIA 4ONAA 3EHAA 2C30A 3VQHA 4EUUA 1YVJA 3ENMA 3QYZA 4O82A 5BYYA 4D1XA 1UWHA 4EOPA 3KA0A 5KBQA 3W8LA 5C8MA 4BBMA 3VULA 2QURA 4CKJA 3KN5A 2IZTA 1ZMUA 4M0YA 1XKKA 4P2KA 3ML1A 1QCFA 1ZOEA 4BYJA 5DOSA 3ZO1A 2XEYA 4MKCA 1OBGA 2XB7A 2XH5A 3FI4A 2OFVA 4YZ9A 3W0NA 4TWPA 5T6KA 3W0MA 5HHWA 1SM2A 3CTQA 2Y9QA 3G6GA 3PJ1A 4BZOA 2O3PA 4IH8A 4BB4A 4F7LA 4DF3A 3C0IA 4NWMA 1GOLA 3QCYA 4ZP5A 2WTVA 5JFSA 3D5VA 5J95A 4RIYA 4RMZA 4QTBA 5K4IA 1M14A 5IH6A 2KTYA 4L01A 4WD5A 5D11A 3RPVA 3PDTA 4C3FA 1B39A 2WTCA 4JQ7A 4ORKA 5A4EA 4BZNA 4DT8A 3Q5IA 4GFGA 1R1WA 2I0HA 4CT2A 5HX8A 3UC3A 4QYHA 1JKLA 5EYKA 3T9IA 5DEYA 5ICPA 2GFSA 2YDKA 2CSNA 5KZ0A 3RGFA 4C3RA 5CSVA 3C13A 2VTSA 4C35A 5IMXA 4PTEA 2BR1A 5HLPA 3NWWA 4BDKA 4Z16A 1PJKA 1QL6A 2WQBA 3HA6A 3VS2A 3GFWA 3UPXA 2ITXA 5J5SA 5KNJA 1FVTA 1YRPA 3G33A 2J0KA 3OW4A 4MWIA 4QMOA 4D2PA 4YJSA 2YHVA 3TI1A 2JDTA 4JX7A 4F6UA 4F7NA 4ZMEA 3H10A 3TEIA 4FZ6A 5K9IA 4IMYA 1FVRA 4O0RA 4C57A 5CAOA 1Q8TA 5DRBA 3CQUA 2AEGA 2WMVA 4UY9A 1PHKA 3AC2A 2RG5A 3W2PA 4EH6A 4CZYB 3EN7A 5AP2A 4DEGA 1GNGA 3O8UA 2XK3A 4ENYA 1A9UA 4RA4A 2UW4A 4OT5A 4XCUA 1IEPA 4JR7A 3LJ1A 3MS9A 4FV7A 3CTHA 4Y5HA 4ZLYA 4QTEA 5BV3A 3Q5ZA 4ERWA 3C9WA 3NGAA 5K0XA 3R02A 1KWPA 4XNEA 2DWBA 3LQ5A 4J99A 4LOQA 4EK4A 2W17A 2XMYA 3GNIB 5CQWA 4CXAA 2XNMA 4RC2A 2C6OA 3RBWA 3OVVA 3WF7A 3PSDA 5A4LA 5HO8A 3EN6A 1FMOE 5LVPA 3G5DA 2YIRA 4F6WA 4MWHA 2PMOX 4ZOGA 4FUYA 2QHMA 3EFLA 3HDMA 4O0YA 3VBXA 5BVWA 3WI6A 1WBOA 1TQMA 4BIDA 3EJ1A 2I6LA 3R1QA 2VTOA 4E20A 3O96A 3E8EA 3V3VA 5B2MA 1WBSA 5IZFA 3BEGA 4DFXE 5AIKA 3UDBA 5EDPA 3NEWA 5KUPA 3FLQA 5A4TA 1TVOA 4RJ3A 1XJDA 4ANLA 5EG3A 2CNUA 2ITTA 5DBXA 4H3PA 4CFMA 4AT3A 3D4QA 3W1FA 3ZLYA 4BTKA 1IRKA 5HVKA 5CEQA 3EYGA 4N6YA 4JIAA 4AOJA 4NTSA 3KU2A 5E8VA 4I5MA 4D58A 2H34A 3BBWA 4EK3A 2UW8A 3UO5A 2G01A 2CKPA 3ZTXA 4HNIA 4C61A 5J5TA 3C5IA 2HOGA 3VUKA 3RZBA 1U5QA 3NNUA 4RWKA 2R3MA 2YN8A 3RCJA 3OWLA 4N6ZA 5EQEA 4F9AA 3TTIA 1XBCA 1SYKA 2B1PA 2XIRA 3A62A 5HG5A 4JI9A 4XG7A 4X3JA 3VHKA 3LE6A 4DITA 5L3AA 3QYWA 1J7LA 4D5HA 4FTTA 4QMMA 1YOMA 1YWVA 3LCDA 2X8IA 5I9WA 4AA4A 5HESA 4AZTA 3Q9WA 3W2CA 3WF8A 5TE0A 4J1RA 3GU4A 3ERKA 1XMMA 4FI1A 2ITWA 2YAAA 3F5UA 3LM0A 5HOAA 3QFVA 3R2YA 3FZ1A 4PRJA 2VWBA 4M69B 4FZAB 4P7EA 4TYEA 3EQBA 3H4JA 3UDZA 5C26A 3SDJA 3GU5A 4UWYA 3E7VA 4MNEA 2FO0A 5AP5A 1JKTA 4L68A 4RVKA 4KIKB 2ZB1A 3EMGA 2C6EA 4YSJA 5E4HA 2ITVA 3FLSA 4U0IA 1NXKA 2VTNA 3JY0A 4BI2A 3RTPA 1CTPE 3IW5A 4IFGA 2OF4A 1Y8YA 4FT3A 3DBCA 1Y6AA 3NVMB 5ETCA 3O2MA 5HCYA 4EWQA 5DYJA 4AA0A 4DLJA 3PRFA 3IGGA 4EOSA 1ERKA 4I5HA 1GIJA 3EQFA 4QNAA 4W4WA 1FQ1B 3VF9A 2NP8A 3ORKA 3BV2A 1H26A 4YC8A 4RLKA 4Y95A 1KE6A 4QMZA 4A9YA 5FXRA 3A7IA 4R7BA 1Y6BA 5C1QB 3OTVA 1FGIA 4L00A 1Q8WA 3NUUA 4AXAA 5TKDA 4RX7A 1Q8UA 2PVHA 3D2IA 4TZRA 1AQ1A 4GJ3A 4DAWA 5IEVA 4I20A 4GFOA 3AD5A 4YHJA 4CNHA 3BEAA 2G2HA 3QBNA 4KBAA 3NUXA 3COHA 4RIXB 4RZWA 4EHEA 4TYHB 3ZUUA 4ZY5A 4EOLA 4IZ5A 5E92A 1OB3A 4FNYA 3WZUA 3EN4A 1DI8A 4X2NA 3SLSA 2FSLX 5M44A 5FM2A 3MH0A 4JOAA 4G6OA 2OI4X 2VWYA 3R1SA 3JUHA 4FSQA 3TUDA 5FTQA 1FOTA 3D7ZA 5KMIA 1WVYA 2OG8A 3DS6A 1BX6A 2UW0A 4FTRA 3DJ7A 2X6DA 1WBWA 3PY0A 4QD6A 4CKIA 1G8KA 5HU3A 3BE2A 1YI3A 5DE2A 4CMUA 4LGDA 1H01A 2Y8OA 4Y85A 4BCKA 4BY9E 1DAYA 4LI5A 1R0PA 4RFMA 5ANOA 4OTWA 4BN1A 2XNEA 3E7OA 4FV3A 2A2AA 4JL9A 5F94A 3HV3A 2REIA 2P55A 2I40A 3R28A 5HG9A 5I9XA 3A7GA 4JBQA 3QF9A 4NIFA 3HL7A 3I81A 4LL0A 4FTQA 1ZYJA 3CE3A 3LAUA 3MPTA 3VS6A 5GJFA 4PPBA 2C5VA 4F4PA 4ZSLA 4O7RA 4DGNA 3W55A 2OZOA 4AAYA 3AKJA 4L52A 2VTAA 5AADA 5DT3A 1PW2A 4R5YA 2UZOA 4BCIA 4DGGA 1UU9A 5ETIA 2XALA 1UU8A 2WNTA 3EQCA 4BFMA 4E3CA 4IZ7A 4BDAA 3MIAA 4S31A 4F1OA 2Q0BA 3KVWA 2XP2A 3C4ZA 4YSMA 4JMQA 4L3PA 4DFBA 1MQ4A 2VX1A 5J9LA 3W0OA 4O83A 2HAKA 1A06A 2JD5A 2DQ7X 4DH5A 3ZFXA 5I9YA 5LWMA 4BIBA 1F0QA 3CQEA 4JJRA 3DK7A 3NR9A 4Q2AA 2VV9A 3FMNA 3ZLWA 5J9ZA 2BDJA 2X7FA 3AC4A 3V01A 4HW7A 3EKKA 3MJ1A 5DGZA 5EHYA 4D9UA 1YXVA 2WMXA 3MH1A 3QTXA 2YIXA 2X2MA 2QR8A 5ANKA 2E2BA 4YPSA 4CLIA 2X7GA 3DKGA 3FLZA 3FSFA 5HIBA 1HCLA 4AZSA 3UQFA 3BWFA 4I4EA 4E6DA 3FLNC 3TTJA 2OIBA 1LUFA 4GSBA 3PXYA 3TM0A 2PVLA 5C01A 1T46A 4F9BA 2XAMA 4EWHA 4CMTA 3Q52A 4WNOA 2IZUA 4Q5EA 3ANQA 4XX9A 4G3FA 3V5PA 3VUIA 3QQHA 4DCAA 4NCTC 4QMWA 3UIXA 5E8YA 4WO5A 5JQ8A 2YZLA 4BCGA 3DFAA 3OS3A 3EOCA 3IOPA 3KGAA 2PYWA 3QQLA 5T3QA 4L67A 3D5XA 4JRVA 1WAKA 3DT1A 3PJ2A 4BBEA 2WPAA 3KXGA 3PSCA 4O2ZA 4C0TA 2X0PA 3EQHA 3I0OA 5HCXA 3QX2A 3UP7A 3NUNA 5HG8A 5HD7A 4R77A 2PUIA 4WG5A 2HENA 4MVFA 4AE6A 3PXZA 3WZEA 3KXMA 3LXNA 3OEZA 3BLQA 3HRCA 4RT7A 3ODZX 4GKHA 2BFYA 2QOBA 4O4CA 4RA5A 2QO2A 4I0RA 4ANNA 1J1CA 3LMIA 3QKKA 5CZHA 3PE1A 5A4QA 4Z55A 1BKXA 3CC6A 4X2GA 1B6CB 3CBLA 4FSZA 3NLBA 2A98A 3HAVA 4ACMA 3KMUA 4FX3A 3WBLA 2WTWA 2ITZA 4D0WA 4ITIA 5M4IA 3FHIA 3GEQA 3IK3A 4G5JA 3VBWA 5LVOA 3BPRA 5LMAA 3LQ3A 1XH6A 4UEUA 4CMOA 3AKKA 1G3NA 2GS6A 5L8KA 2R7BA 2V5QA 3R00A 4CFFA 1M2RA 1XWSA 4E5AX 5H8BA 2W1CA 2JBPA 4FG8A 4O1PA 5DMZA 4MCVA 3L9PA 4HYUA 1M2PA 2H6DA 3RPRA 3COMA 4FNXA 1UKIA 5CNNA 1OGYA 5HLNA 1OKZA 4GV1A 2YWPA 4NW5A 4PY1A 2X4ZA 5DIAA 3KREA 4O84A 2AUHA 3HRFA 3QZFA 2CCIA 1ZY5A 3F7WA 4ITJA 4O0XA 4FV8A 4PWNA 2PK9A 2VTIA 1GIIA 3KK9A 1F5QA 4Z9LA 1Q41A 4DEHA 3UODA 4EQCA 2P33A 4G16A 3IW7A 5AR7A 3HA8A 1LPUA 4IZAA 3HP5A 2F2UA 3QKMA 4AT5A 2XJ1A 4HGLA 4OR5A 4C4JA 4FSUA 5EQPA 3CIKA 3FXWA 1OIYA 3GT8A 3PG3A 1JWHA 3MVHA 4YTHA 5KE0A 4AQCA 2XYUA 2QOHA 3OFMA 1PRYA 2GTMA 2O2UA 3FMKA 4MNEB 3EQIA 4U97A 2X8DA 3QTQA 4RJ7A 4U40A 2BRMA 4DHZA 3VF8A 4GK4A 3MESA 3O0GA 4LOPA 4RJ8A 4LUEA 4ZSEA 2R3QA 4XP0A 2CLXA 2VZ6A 3R7GA 1U59A 3RI1A 3VN9A 3CJFA 5E8ZA 4ACCA 1WVWA 2PE1A 2QOKA 2XS0A 4PNKA 3ROYA 5CU0A 4AN9A 3R0TA 4L43A 3DY7A 4FKWA 4WHZA 4NKAA 2WTKC 2XKFA 4BTJA 3VO3A 3MH3A 2F2CB 1RJBA 2C6KA 3FI3A 2J90A 5FQDC 3E3PA 4EZ7A 3TNPC 4M7IA 5K5XA 3C1XA 3VS3A 3IONA 4UYAA 4RJ6A 2XK8A 4JIKA 3I79A 5D12A 5EI6A 1U5RA 4J53A 1CKIA 4DTAA 3QRIA 4JVGA 2W1GA 4O22A 4I24A 1ZMWA 2OJJA 4CFUA 4BR3A 2GNGA 3DXNA 5EM5A 4H3BA 3LJ2A 4YJRA 3O8PA 4AE9A 2CKQA 4GMYA 3IKAA 5M07A 2ITOA 4K77A 4BF2A 3MJ2A 2J5EA 2PZPA 4AW1A 3NW5A 4DHIB 4U7ZA 2YDIA 3EQDA 1PF8A 3K5UA 3MN3A 4FSTA 4O4FA 4XV2A 3WZDA 5EOBA 3GVUA 1U54B 3RK9A 3ZO2A 3DK3A 5BVDA 5IUHA 4ZSJA 4FK3A 2BKKA 3SD0A 4FL3A 2OXDA 3R83A 5HG7A 1W84A 1FMKA 1WBVA 4JRNA 4C7TA 3FBVA 4F7JA 1W98A 2EXCX 2CLQA 4L46A 4O4BB 3VS0A 3HV6A 4U80A 3CP9A 5FWKK 2IW9A 5BUJA 4S34A 1UWJA 4L53A 4LDTA 3F2NA 2XNBA 3GCSA 4LQMA 4BCNA 4EH5A 4KIQA 4OBQA 4UBAA 2B53A 2XYNA 4C4HA 3P7AA 5CF5A 3SW7A 4NM0A 4ANMA 2QLQA 5IQCA 2VWXA 4FT9A 3LFBA 4E4NA 1YW2A 3QQJA 4ZSGA 5L2QA 4R3PA 4X3FB 4E8AA 3KEXA 4M84A 4XG3A 3L8PA 3FYKX 3C4EA 4RGJA 4FEXA 2LGCA 3HYHA 4GUBA 4F63A 3QRJA 4UV0A 4IWPA 5C9CA 4LG4A 3WZKA 2OIDA 3L9LA 5CTPA 3RINA 5H8EA 3HZTA 1Q97A 2UZLA 2VTPA 4RIWB 4S32A 1FVVA 3DPKA 1JBPE 3PZEA 2QHNA 2ITPA 3AGLA 3JVSA 3A60A 4PMTA 2B54A 3VQUA 4OTPA 3LOKA 4WSYA 1TQIA 2ZMCA 4ZZNA 4O0VA 4ZTLA 4FODA 5AUVA 1XR1A 3R63A 4N70A 3VJOA 4A9RA 5L2IA 1PKDA 2R5TA 4XP3A 3NNWA 3F3ZA 4RX5A 3QC9A 3Q6WA 4JDJA 2O65A 2X9FA 5EW9A 3BBTB 4XEYA 4YLJA 4HNFA 3POOA 4EKKA 3CR0A 1U46A 3ITZA 3OUNB 4IWDA 4FTJA 5CY3A 3AMBA 3FL4A 3K5VA 4IW0A 4GK2A 4FVPA 1YI6A 4LGHA 4YTFA 3QC4A 5JT2A 3ZDIA 4AZVA 2VX3A 3L8SA 4FZFB 4A7CA 3PFYA 4O7WA 5JFVA 3PJ3A 1OKYA 1CKPA 4LFIA 3KMMA 4FTIA 5JFWA 5IQFA 5ANJA 5J8IA 1H4LA 3GENA 2X0QA 2CDZA 1YWRA 2XIKA 3CD3A 4JNWA 5B0XA 3VS7A 3VUGA 2WAJA 4CG9A 3D14A 2CN8A 3QRUA 2Z2WA 5TR6A 3F3VA 4S30A 2P4IA 3WARA 4DLIA 2EB2A 4QOXA 4FEWA 1Q5KA 3FQSA 5I4NA 3VRZA 2VUWA 4ANQA 2HWPA 2R2PA 4G2FA 4MK0A 3FHRA 2BHEA 4ZZMA 3KL8A 4CFVA 4F99A 5I5ZA 2XANA 3HVCA 3Q53A 3QD4A 3OWPA 3TIYA 4DH1A 4D0XA 5JMSA 3TT0A 2IZSA 5H8GA 4AGWA 2XM8A 1NW1A 1O6YA 3H9OA 2XZSA 2A4LA 3RK5A 1W83A 2I0EA 3HKOA 3DCVA 3FPMA 1BMKA 2R64A 3R22A 4CCUA 4ZLOA 5IU2A 3W2RA 4AW2A 3QQUA 3O8TA 3PIZA 5FD2A 5CZIA 3ATTA 2JKOA 4ANSA 3LPBA 4AW5A 3EL7A 1WZYA 2PMLX 2ZDUA 3QAME 4EC9A 1H25A 2P2HA 4YO4A 1W2DA 5AWMA 4DT9A 1YQJA 2OJIA 3GXLA 4C38A 5JSMA 1G8AA 4OLIA 3UJGA 2PUPA 4N4SA 4A4LA 4N57A 3VS1A 2R3FA 1RW8A 2GDOA 2R3JA 1OI9A 5JZJA 4E6CA 4B8LA 4USDA 4M69A 3UVQA 4XBUA 3VUMA 4DFNA 2XAOA 1ZARA 4YURA 2YAKA 3LCKA 4GK3A 4KIKA 2QOQA 3VUTA 3HX4A 3OCBA 3HUCA 3CCNA 2C6DA 4PDYA 1JKSA 4W9WA 4XG4A 3UO4A 4OBPA 4BTFA 5AUWA 2XBAA 3ZZWA 2EU9A 5HIEA 4U45A 3Q2JA 2IVVA 1SVHA 2E9OA 2QU6A 3DNDA 5M08A 4NYEA 2YIQA 3UMXA 3REPA 2C6LA 2BPMA 5J1VA 5J7HA 3ZFYA 5IQGA 4EZ5A 5CXZA 1NA7A 4F6SA 2VWIA 1XBAA 4IDTA 4DH7A 3ORPA 4IWQA 5F9EA 3DK6A 3NUSA 3ZS5A 3UIMA 2WTKB 4ERKA 2BKZA 5A6NA 1RE8A 4IC8A 4Y8DA 5FBOA 1M7QA 3W16A 3NZ0A 3PVGA 3LFFA 4JBPA 2UZWE 4NKSA 2NNWB 3DDPA 4PL4A 5I0BA 3AKLA 5A3XA 3ORTA 4FV5A 1REKA 1ZZ2A 4PDSA 4D2TA 2XK4A 2YCFA 4TXCA 4WNKA 3KRLA 3RAHA 2HY0A 5CF4A 4RIXA 4FYNA 4GIHA 3G0EA 2ITNA 2WKMA 4O7NA 4F0FA 3I1AA 2XUUA 3R8VA 4BCFA 4MXXA 3PP0A 3BYOA 2QD9A 1NY3A 3M1SA 3MYGA 2RKUA 4USEA 3TIZA 2BTSA 1VLRA 1K3AA 3NUAA 3U55A 2OJ9A 4FIEA 4PL5A 4DA5A 3LZBA 3QTWA 4OTQA 3OWJA 4E5WA 3DKOA 2BZJA 3D7TB 3PIYA 5M09A 4MX9A 5IA3A 5BVFA 4R7IA 4FGBA 3OBJA 4EOOA 3T8OA 2H8HA 4Q5HA 5CVHA 2OKRA 1JVPP 3BHTA 1XH4A 2VTMA 1PMEA 2XM9A 2JGZA 3OT3A 4I5PA 4IACA 5EH0A 5C8KA 3GFEA 3ZRKA 5AR3A 3ZSGA 2PMNX 3QXPA 4NTTA 4G3CA 5CF6A 4PX6A 4HVDA 2ZOQA 5FUTA 4FSRA 3IOKA 5DN3A 3O23A 2ZJWA 4IC7A 4NSTA 4IVCA 4KINA 4CVAA 2CPKE 3AC8A 3SQQA 4ZSAA 2YA9A 5EHLA 4BGHA 3FMDA 3W8QA 4CTBA 4GKIA 5EFQA 5J1WA 2IVTA 4F0IA 2E9NA 3QCQA 3UQGA 4WOVA 3MB7A 4XJ0A 4ALWA 4BHNA 1YOLA 3KXNA 3QHRA 4FKSA 4MF1A 4MBIA 1STCE 3E8DA 4JBOA 3RWPA 4AAAA 4AGUA 4AN2A 5M51A 2WFYA 3CKWA 4TPTA 4BIEA 4KSQA 4EUTA 4RZVA 5ANIA 4AA5A 2PHKA 4ZJVA 3MW1A 3UE4A 1ZMVA 5EYMA 1UV5A 2XK7A 2IN6A 3NAXA 3HGKA 3RPOA 2PZIA 4LM5A 5DI1A 4CRLA 4EHGA 2BRNA 4H58A 5KCVA 4CFWA 5E7RA 3MA6A 4TYGA 5HE3A 2WQMA 3D2KA 3HMPA 3UOJA 4KIPA 2X0OA 4RRVA 3TXOA 4U42A 2C69A 3WILA 1YDSE 2C6MA 4FKJA 1XO2B 3A4PA 3CXWA 2ZDTA 3AD6A 3A8WA 3LFEA 4IJ9A 4QYFA 3F3WA 1H0VA 3D9VA 3FC1X 2YLEA 3GC0A 4GL9A 2A0CX 4B0GA 5ITAA 1MRYA 3F6XA 4EYJA 5M06A 4DHJA 4XG8A 1M52A 1W2FA 3VS4A 4QMXA 4Y73A 5EM6A 2YERA 2FUMA 4XRJA 1QPJA 4X0MA 4M97A 1V0OA 4AW0A 3BZ3A 4UWCA 5AA9A 3CKXA 3KC3A 3P1AA 4F64A 4QMLA 5L2SA 3U51A 3BGPA 3WYYA 1JLUE 4FTNA 5L2TA 5AA8A 1Q3DA 5EI8A 4DBNA 2WD1A 4PUZA 1BL7A 2QG7A 3ETAA 2C5OA 4QQJA 5E91A 2BTRA 3MDYA 4IXPA 2WQEA 1WBTA 4IADA 1SMHA