2IO6A

Wee1 kinase complexed with inhibitor pd330961
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
279
structure length
252
Chain Sequence
MKSRYTTEFHELEKIGSSVFKCVKRLDGCIYAIKRSKKPSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wee1-like protein kinase
publication title Synthesis and structure-activity relationships of N-6 substituted analogues of 9-hydroxy-4-phenylpyrrolo[3,4-c]carbazole-1,3(2H,6H)-diones as inhibitors of Wee1 and Chk1 checkpoint kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 252
sequence length 279
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2io6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2io6A01
1CDKA 2Y8OA 4KIOA 3R73A 4W4WA 2WMVA 2CCIA 5DEYA 3R8UA 2HZ4A 5M4IA 4AOJA 2HCKA 4FKWA 5DR9A 2ZMDA 1UWJA 2XB7A 1V0PA 2C6OA 5LWNA 5KMLA 4TYGA 3IO7A 4CKJA 1U5QA 3MIYA 3R1SA 4IZAA 2YJSA 3PA3A 3TKHA 4U79A 2QLQA 3PUPA 4BHNA 2WTKC 4M12A 5ICPA 2CGUA 4JOAA 1Z57A 4FZFB 2W06A 5CZIA 5TO8A 3LCTA 3W2QA 4GKHA 4TWOA 4DG0E 4L46A 5CQWA 4ALVA 4CYJA 5HLPA 3AC1A 3TIZA 1J7LA 2I0VA 4HZSA 4A06A 1ATPE 2B9JA 4FNWA 3VC4A 3RVGA 4PDYA 5F1ZA 3EQCA 3KULB 4PTCA 3CE3A 4J71A 3PP0A 4DC2A 4ZLZA 2YM4A 3BBTB 3POZA 2WEIA 5K0XA 2BR1A 1O6KA 4C3FA 4I5PA 4NUSA 2WO6A 3SXFA 4TL0A 2VTPA 3D4QA 4A9TA 3G0FA 4DGMA 4QTEA 2ITTA 4C4FA 2NP8A 3BBWA 3I5NA 3Q32A 2E9NA 4M69A 2LAVA 3UO4A 4FV1A 4CXAA 5FM2A 2BDWA 3POOA 2HWPA 2E9OA 2IN6A 5AAFA 4ASZA 4L6QA 2JIVA 4CCUA 4CYIA 3K3IA 4QO9A 3C9WA 5L2SA 4FEXA 2XMYA 4EHEA 4IAYA 3UTOA 3PLAE 1PXPA 3QQJA 3DBFA 4I5CA 4AW1A 2QOBA 4D55A 1OB3A 2PVRA 4C4GA 3KRWA 4V05A 2GQSA 5IF1A 3PG1A 2B53A 2QOHA 3KXZA 3LMGA 2C5YA 4D2TA 3QCYA 1IA9A 2CLQA 4CNHA 4O84A 3BU3A 3W2PA 3Q52A 2CGXA 4LGDA 5IQFA 5JRSA 2XEZA 1ZYLA 3IQ7A 4Q9ZA 4J95A 4UY9A 2GS2A 2Y4PA 4ASDA 5KZIA 3VN9A 1OPJA 5AR5A 4FTCA 3RKBA 5HTCA 3N4UA 4G5PA 4GFGA 3PG3A 2W9FB 2P4IA 4ZK5A 3QTRA 3ZUUA 5L3AA 5CWZA 3C0IA 4O82A 5CANA 3R1QA 3DB8A 4TPTA 3TUBA 3B2WA 2GTNA 3FZPA 1XJDA 4BR3A 2ESMA 2UW0A 3ORNA 4PPAA 3UIUA 5LWMA 2REIA 4YJTA 2J50A 2P0CA 2BALA 5HBEA 4HYIA 5EM5A 3OCSA 3OHTA 5D41A 3OTUA 4FTLA 5IQHA 4PPCA 3CQUA 4EYJA 5D1JA 5IUIA 4QMWA 5E8TA 4YTIA 5KNJA 2C6LA 1Q3DA 2R3OA 4XLVA 4MD7E 4CKIA 3BGPA 2VNYA 4P7EA 5C03A 2J2IB 4D4SA 2ITUA 4C37A 4C3RA 4YC3A 5EI6A 2ITZA 4J7BA 4F7JA 3R2BA 4GVAA 2ACXA 5JKGA 1XBBA 3MY1A 1UKIA 2UZWE 5AP7A 3QFVA 2HZIA 3RAKA 3KREA 5E8WA 5LVLA 3RPSA 1MUOA 4IM3A 4W4YA 4Y73A 2BFYA 4G31A 3W16A 4C38A 4CFMA 4FTIA 5AMNA 4EC8A 3GGFA 3ZDUA 1RDQE 3JS2A 4XBRA 4HGLA 3OBGA 4JG8A 2JGZA 3K5VA 3QAME 2UZUE 1ZY4A 2A4LA 3L8PA 1KE8A 3P7AA 4AZTA 4QP6A 5BVEA 4BI2A 1WBOA 5TF9A 1S9JA 3QKKA 4YLKA 4HPTE 4XP2A 3QYWA 4X2JA 4YJRA 4YO4A 2YZAA 3T9TA 4E4NA 2W1EA 3DKOA 3MI9A 4BB4A 4DCEA 1M17A 4TWPA 4ERKA 4M0ZA 1FINA 5CT7A 2IZTA 4MXAA 4FK6A 3K2LA 3VF8A 4K0YA 2LGCA 2WTIA 3PPKA 3R9NA 4YPSA 4P5QA 4YJOA 2VX3A 2ZV2A 3H3CA 5HBHA 3QTUA 3ZLXA 4GIHA 3M42A 3BYSA 5J8IA 2VO7A 3FE3A 3R9HA 4D4YA 3MVJA 4RFYA 4BWPA 4K77A 3W8QA 5IQDA 4WO5A 3PPZA 4Z3VA 3AD4A 3EN7A 4KKEA 4IDVA 5C4KA 2CKOA 3D5VA 1OPLA 4MWIA 5LVOA 5EDRA 3FEGA 3QCXA 1GAGA 4FOBA 3CKWA 4CG8A 5H2UA 2RF9A 1M7QA 2BRGA 2UVXA 4OW8A 4AG8A 2ITPA 4HJOA 3A4PA 2UZEA 3NUPA 4G2FA 4L7FA 3ZSHA 2IG7A 3LOKA 3KF7A 1URCA 3BKBA 4FIJA 4RT7A 1LEWA 1RJBA 3CQWA 4X3FB 2YLEA 4ZTLA 3VBVA 2QONA 4G17A 4JAJA 5CASA 3QZGA 4K9YA 5FGKA 2DWBA 3IK3A 4FTAA 5DN3A 5M09A 3W55A 4BBFA 4C62A 4BI1A 2CN5A 3A2CA 4LV8A 4M0YA 4M68A 1MRUA 3VUKA 3I0OA 1OKWA 4IFGA 4I1ZA 2YM5A 3PIYA 2WMRA 4E5AX 3OWPA 5J79A 3MW1A 4A4LA 3C5IA 3V5JA 3VS4A 3COIA 4G9RA 4F7SA 5HVYA 2BAQA 3WZDA 3PXYA 4ZTSA 5H9BA 3VIDA 2B0QA 4I93A 4GK2A 4UYNA 3COMA 4RFMA 2XK3A 5F20A 4YNEA 3R7VA 5HLWA 3MTFA 3I6UA 2VWWA 3KL8A 3QXPA 4FTRA 4AT3A 1VJYA 4UZDA 2JDRA 4RMZA 3TKIA 4FL2A 2X8DA 5BVWA 4DAWA 5CEQA 2JKOA 4O83A 4EHZA 2YDKA 3W2RA 5EW9A 1SVGA 2I1MA 4RA5A 2XKEA 3DZOA 4HGSA 3ORMA 2PYWA 4X3JA 3MWUA 4G1WA 4NZWB 2QI8A 4EH5A 1FVRA 3MN3A 5K4JA 5EOBA 2QO2A 4X0MA 5IDPA 3P23A 4RJ6A 4ZZMA 3Q4ZA 2AC5A 4ANOA 4PX6A 4V04A 5AA9A 3ANRA 2Z02A 3QTSA 2VTNA 4KRCA 2VTRA 3DBQA 5ETAA 4HVIA 4X21A 1NY3A 1YXSA 2Z60A 5BVOA 3VQUA 5JFSA 4IAKA 4FZ7A 4Y83A 1BL7A 2P33A 3IGOA 1CM8A 3IW6A 4P90A 5FBOA 2IWIA 3E5AA 3FV8A 4LOOA 3MTLA 3D7ZA 4NJDA 4ZY6A 4ONAA 4QP4A 2QCSA 4CFXA 1PXOA 1H01A 3RALA 4EH9A 5KKRC 4HCTA 4PTGA 5CSWA 1JPAA 3TZ9A 1ZOGA 4BRXA 3OXTA 3R2YA 1PYEA 2ITXA 3V5WA 4DFNA 3C51A 4AW0A 3CGFA 1V0OA 1LEZA 4D5KA 5IA3A 5G1XA 4FSWA 3U51A 3VUMA 3ZEWA 3IDPA 4GL9A 1LR4A 2OICA 3CPCA 2XJ1A 5CVGA 5FLFA 4FV7A 3V8WA 5CEMA 5C8KA 3O7LB 4MD8E 4WUNA 3A7JA 1OZ1A 4L3JA 3BELA 2EWAA 2OXDA 1UNLA 3E88A 4FTMA 4JBVA 2YCSA 5FXQA 3OP5A 3ZEPA 3D14A 3WZUA 4UALA 4BIEA 4F08A 5LMKC 3VW8A 3ORLA 5FUTA 2QR7A 4E8AA 1Y6BA 3DNEA 4ACHA 3Q4TA 3NLBA 4GFOA 5CXHA 2B9HA 2HXLA 2GQGA 2PVKA 3FMHA 3KU2A 3O50A 2G2HA 4JJRA 3CJGA 4RIXA 5FEEA 3OFMA 3KY2A 3KK8A 5GJGA 3MY5A 2C3IB 3LMHA 4X6QC 3QKLA 4NIFA 5AV3A 3SHEA 1YVJA 3MH2A 4RJ4A 1Z9XA 4GT5A 1M2PA 3QD4A 4ZP5A 4MWHA 2PVHA 2XK8A 4LI5A 5B0XA 3F61A 4OLIA 3WARA 4EH4A 4IWPA 3KF4A 4RC4A 4MK0A 2FB8A 3H9RA 3IG7A 3P79A 4FNXA 5ANEA 3PTGA 3RAHA 4AT4A 2OFUA 4MEDA 3ALNA 1J3HA 3OW4A 4Q9SA 3VW6A 4TY1A 1J1CA 2XNPA 4ZTQA 4Z7HA 3TN8A 3HRFA 5HKMA 1UNGA 4PMMA 4YBKA 4FKSA 4B4LA 3NYNA 5FXSA 4R5SA 3BYUA 2WTCA 2XYUA 3RNIA 1CKIA 4FA2A 4K11A 5EDPA 4YZBA 2GSFA 3R1YA 3Q2MA 5TT7A 4ASEA 5CAQA 2WKMA 3HP5A 3AC3A 3PZHA 3OWJA 4RWLA 3HUBA 5EYKA 3UP2A 4DYMA 1RQQA 1UVRA 2RFNA 4FSMA 4WNMA 1P5EA 1M52A 5HCXA 2C6KA 5AA8A 3HAVA 3L9MA 4BWKA 1YWRA 4IBMA 1OVEA 4TKSA 2BHEA 3F9NA 4I0SA 4YHTA 3DJ7A 5J1WA 4JRNA 2CNVA 2WELA 3L8SA 4QQ5A 3L8XA 3AMAA 5M44A 1R1WA 5KBQA 4IANA 5I9YA 4O7VA 2KULA 1ZAOA 3EQBA 4YURA 4HYSA 2VU3A 3Q5IA 5A4CA 2GPHA 1OITA 4E5BA 3NVMB 4ZEGA 4C61A 3BRBA 4M84A 3KEXA 4X2FA 4E7WA 3GBZA 3DBDA 4PPBA 1XH6A 4MX9A 1ZYJA 4R7HA 3P08A 4F0FA 4FNYA 4FEVA 3R7YA 3NYXA 4JBQA 5DT4A 4B99A 4CFWA 2VGOA 1PJKA 1YXXA 1H1RA 4O86A 5HG8A 3BU5A 2X1NA 2R5TA 1SVEA 3SOAA 3CBLA 1MQ4A 3C4FA 4D9TA 5JGBA 4EZ3A 5HVJA 4DEBA 1TKIA 4L67A 1XH8A 4LMNA 1HCLA 2FO0A 2Y4IB 3AG9A 2JDSA 1PKGA 3VAPA 2Q0BA 2X8IA 3PJCA 4A9YA 4AZVA 4USEA 3DV3A 2PHKA 2FSOX 1JSUA 3DKCA 3OCTA 3UMWA 3OS3A 4ZLYA 1KV2A 2O0UA 3AXWA 2XK6A 4RVMA 2BILB 5ANJA 2XEYA 4S2ZA 2PVYA 5CTPA 5CEIA 4UMPA 1WBSA 1F3MC 3AGMA 2G2FA 5L2TA 3GT8A 3PDTA 3ROCA 1A06A 3PIXA 5D10A 4YC6A 2P55A 4RBLA 2JITA 4U8ZA 3G9NA 5CAVA 1J7IA 3K3JA 4BICA 4XEYA 4A4OA 5B7VA 3QWKA 1CTPE 4XV3A 1QCFA 2VNWA 3VS3A 1YHWA 5DR6A 3ZBXA 4CRLA 3F66A 4I22A 4AW5A 1IAHA 4FKQA 2C5OA 5L2IA 1Q8ZA 4EHVA 3CSVA 2HW7A 2GHLA 2R3HA 2X2KA 2J90A 1FQ1B 4G16A 2WTDA 4BTJA 4AP7A 2E9VA 2C69A 4R3CA 4I0TA 3AMBA 3BLQA 1XBCA 4RX9A 2XNBA 5HHWA 3V6SA 2XKFA 2PU8A 5LMKA 3ZBFA 1Q4LA 4XHKB 2JBPA 3ZRKA 3PY1A 4ALUA 3LIJA 4DCAA 4XG4A 3ZOSA 1ZYCA 1PMUA 3NUYA 5AEPA 3HNGA 3PA5A 4CMTA 4N57A 4MBJA 4R1YA 3KK9A 2IW6A 2OFVA 2J4ZA 3HRBA 3O2MA 3TJCA 5HTBA 2HOGA 3D7TB 3DXNA 2OO8X 4EORA 5C8NA 1Q41A 4U41A 4YZCA 3OY1A 3PE2A 3NX8A 3CY2A 3GC8A 4AACA 1NW1A 3ID6C 1Q24A 2NNWB 4RIYB 4EH2A 4CSVA 3BHHA 3QZIA 1J7UA 3UZRA 4EUUA 2WU6A 4D2PA 4QMPA 2Y9QA 3R7GA 2ETKA 3QXOA 4FTNA 4GMYA 4NSTA 1FGIA 4AA4A 1P14A 3S95A 4GK4A 1YOMA 3SOCA 3SG9A 2GFSA 1FPUA 5CXZA 2YACA 2R3KA 4EKKA 3SLSA 3NVKI 4RG0A 4QMUA 5JT2A 1XKKA 2A0CX 1SZMA 3FAAA 3MFTA 3TNHA 2IVTA 3G6HA 3RM7A 4BI0A 5AR3A 5AR7A 4CQGA 2RFEA 2QNJA 2RSVA 3JPVA 2QC6A 4OT6A 3ZXTA 5BNJA 4TT7A 3EFKA 4EOLA 2NRYA 3ZTXA 3DS6A 1UV5A 4EK6A 3NNUA 4I5MA 4PL5A 5CSVA 5TE0A 4FV8A 2XCKA 1CKJA 2VX1A 5FTQA 1M7NA 4G3FA 4QTAA 4B6LA 4EL9A 3KRJA 1BLXA 4TWNA 1G8AA 1HCKA 4TYIA 5D12A 3RNYA 4YZDA 4RC2A 1WZYA 3W33A 3ZSGA 3LVPA 1OIUA 4X2NA 4QOXA 4ZTMA 5C26A 4O7ZA 3QALE 4O27B 2BCJA 3HLLA 3BHYA 3ZUTA 1QPJA 4WBBB 3VBQA 1S9IA 4F7NA 4L8MA 1NA7A 4EZ5A 3OW3A 4F6UA 4MD9E 3CTJA 4YNOA 3C4ZA 3WE8A 1OL2A 5AV4A 2W1IA 2WQOA 2YA9A 3ZFYA 3FKOA 3KXXA 4IH8A 4M15A 1B6CB 2ITNA 3ENHA 3ORIA 3U4WA 1IAJA 4N0SA 3CTHA 4W8EA 3EL7A 4DFYA 3BU6A 4BKZA 2C47A 3GU6A 4PY1A 2IVUA 2OK1A 3FI4A 1KE7A 2BZJA 2YIYA 4FIIA 5I5ZA 3ULIA 4IWQA 4WBOA 3MS9A 4ZIMA 4J99A 3CR0A 4ZMFA 2EB2A 3BYOA 4GVJA 3VF9A 2ITVA 1URWA 5C4LA 4AE9A 4AX8A 3DK6A 4I24A 5FD2A 1YDRE 1MRYA 3LXNA 3F2RA 5AP6A 3VS6A 4U44A 4IADA 3HMMA 2R3FA 3DAKA 4BZDA 3HRCA 4BDHA 1ZZLA 2C6IA 1YI6A 4EH3A 4KIKA 4TYEA 3F5GA 1E9HA 4YO6A 4BZOA 3JXWA 4M69B 5EYDA 2GS7A 3IDCA 4F9AA 4R3RA 5AJQA 2OW3A 5ACBC 3MH0A 2QU6A 3A4OX 5J7BA 4DEAA 5AV1A 2UW6A 3NW7A 4ID7A 5HNGA 5HE1A 3ZSIA 1Q61A 3ZM9A 4DITA 1AD5A 4JDKA 4NW5A 3OF0A 4F63A 3MB7A 2QO7A 2O65A 3DB6A 3GU5A 4I4EA 4GT4A 4Q2AA 3A7FA 5ANGA 3NDMA 5CU0A 3U4UA 4USFA 5AUZA 3NUXA 4BGQA 4BBMA 2XNEA 3UE4A 5DWRA 3BX5A 3I79A 3FMMA 5E8UA 1J91A 4YHFA 3WILA 3NUSA 4C8BA 2YHVA 3UG1A 4ANBA 5T3QA 3UNZA 4IMYA 3A60A 3WF5A 4KSQA 4GEOA 2JFMA 4Q5HA 2HAKA 3ZUVA 4DGOA 3O0GA 2YLFA 5JMSA 3PVBA 4LG4A 3CGOA 3V5QA 5M56A 3QTQA 1CMKE 4O91A 1WBTA 3JYAA 4C2WA 2DYLA 3BPRA 5G6VA 3Q4UA 2BKKA 4YJNA 5DFPA 4DEDA 2WU7A 2PUNA 2PZRA 2QOLA 3GB2A 4V0GA 5AUWA 4OGRA 2R3QA 4B8LA 3EZVA 2X7OA 3R8LA 3RPRA 4XG6A 5EKNA 5LQFA 2IPXA 4EOMA 5GINE 4G3GA 1GZOA 5FXRA 2VWXA 4R6VA 3GOPA 5LMAA 2BMCA 2QG7A 5AP5A 2F57A 5A9UA 5BQ0A 4EK3A 3QTZA 5CI6A 3CTQA 3VJNA 5ACKA 2PZIA 3TZMA 3GCUA 3IW8A 2GNFA 3C1XA 1XH7A 2F7ZE 4BDGA 3QHRA 4I21A 3VBXA 4FSZA 2RKUA 2ZYBA 4FTTA 3VHKA 5A6OA 2PULA 2UZTA 2VWUA 5CEOA 1JKKA 2XNGA 5F95A 2J5EA 1JSVA 3Q9WA 3AT2A 3UIBA 5CNNA 4RJ5A 3SX9A 1ZMVA 4JX3A 4AN3A 4BFMA 5IG1A 1M2QA 3BWJA 3F2NA 5A4LA 5DE2A 4QMQA 3JVSA 3Q9XA 4TYHB 4U9AA 5EQYA 1BI8A 2W96B 5KMKA 3SKCA 4FKJA 4IZ7A 2P2HA 5IUGA 3ZLWA 2XNMA 3BV2A 4G3DA 3TIYA 4DEIA 4EWQA 1WVXA 1H08A 2VTIA 2J0JA 3R30A 5CNOA 3ZO3A 2F7XE 4GSBA 2I0YA 4BVUA 2ZB1A 3UOLA 2RG6A 2YFXA 3TZ7A 5JN2A 1R3CA 3KXMA 4U42A 4USDA 4J8NA 3F3TA 5AAEA 3V8SA 1F0QA 1P2AA 1IEPA 4GJ3A 4BGHA 4TWCA 4JR3A 2CKEA 2VWIA 3LJ2A 3UO5A 3LFDA 3FYKX 4JL9A 2R4BA 4GRBA 3CEKA 5J9ZA 1ZXEA 2XIKA 4D1ZA 1JLUE 1Q3WA 2W4KA 4F9YA 2P2IA 4QPAA 4D28A 5E8YA 4M66A 4QQCA 4YJQA 4MQ2A 4O0WA 3A7GA 5HICA 3UO6A 4IVDA 3LQ3A 4NYEA 2OZAA 2WTKB 3PVGA 3R71A 5CX9A 4GU6A 3ZS5A 2XM8A 4QMVA 2DS1A 5IEXA 3RPOA 3QQHA 4ZTRA 4UMQA 3W2CA 4B7TA 5M53A 3Q2JA 3TNQB 5EH0A 2DUVA 4FVQA 3N51A 4YZ9A 4NCTC 4HVDA 3UIXA 3SRVA 4UBAA 3DPKA 4DBNA 3LHJA 4PTEA 2XCHA 3SW4A 4YMJA 2A2AA 1VEBA 2PUUA 3RINA 4O7TA 1Y91A 2WMQA 4YBJA 4WNKA 4S32A 3TUDA 4K33A 4BZNA 2GNIA 3RTPA 1YOLA 3A8XA 2BROA 5HOAA 4E93A 4IX3A 4FSRA 4CZTA 2I7QA 3HV6A 4HGTA 5HX8A 3HMIA 3MPAA 1TQIA 2OF2A 4GU9A 4W4XA 3REPA 1XBAA 4FKRA 4FKPA 3LCOA 3COHA 4DH3A 2B9IA 3LAUA 3F5UA 4G34A 3QZFA 4H3QA 4YP8A 3OXIA 2X9FA 4E4XA 3KMWA 5KO1A 3E8CA 4LQMA 4RSSA 2IW9A 2RG5A 3ULZA 3QD0A 5FEDA 1W82A 5AX3A 3AMYA 3OD6X 4PP7A 3GENA 1PXKA 2GNJA 2VRXA 3BGQA 4J98A 4BCFA 5I9UA 4JBOA 4Z9LA 4DH8A 4JG6A 5H3QA 3NSZA 2QD9A 4M13A 4YTHA 4LGHA 3UIMA 3ZLSA 5CALA 4FEWA 3ZO4A 4AWIA 5FG8A 4OT5A 4WG5A 4D4VA 3C7QA 3LQ8A 4FSTA 5KMJA 4L52A 5CAOA 3DFCB 4M14A 2C5VA 4L44A 4GK3A 3FHRA 3LFEA 1OM1A 2I0HA 3ZCLA 2R9SA 2NRUA 3ZXZA 3DU8A 3IECA 4F9CA 4Z55A 3K54A 3GCSA 5GZ8A 2WIPA 4IVCA 1NVRA 4AZWA 2YIWA 3RI1A 2R3MA 2J0KA 2B52A 2PZPA 2WMSA 2CLXA 3PJ2A 3RAWA 4ZZOA 1OL7A 2ZM4A 4Y95A 3DY7A 2WMTA 1OKZA 3TT0A 4BHZA 1GOLA 3FI3A 3FY0A 3UNJA 5A4EA 2XP2A 1OPKA 4HCUA 2ETRA 5FDPA 1LPUA 2OIQA 2XNNA 4KABA 5HO6A 1FMOE 4PV0A 2OJFE 3TZ8A 1IRKA 3BHUA 3F5PA 1W98A 4O6LA 4EOIA 4QMNA 4FZDB 2C6DA 1YXUA 4FT9A 3COKA 4Q5EA 1ZMWA 2Z2WA 3SXSA 4AU8A 5IEVA 2GCDA 5FWKK 3FMKA 3ZHPC 5B2MA 4Z7GA 2OXXA 4DLJA 4AGCA 2JDVA 1FVTA 2J0MB 1KOBA 3C5UA 3PE1A 3MYGA 3ZO1A 4YLJA 4JRVA 4O7RA 3GI3A 3CKXA 4L3LA 2R0UA 2JDTA 5D9HA 3I5ZA 4GUBA 4IZ5A 3GU4A 1P4OA 3FPQA 5L2QA 3RZFA 5CF4A 5CVFA 2OU7A 4OUCA 3EH9A 1K2PA 5AUXA 4YSJA 3GU7A 1A48A 3KC3A 4K18A 4AF3A 4RIXB 4AZSA 4H1JA 1GY3A 2B4SB 4LUEA 4C36A 4G6NA 4NIFB 4G6OA 3QC4A 3TV7A 1A9UA 5IA1A 5BUIA 4I6QA 5HG7A 3RP9A 2C3LA 4J8MA 1H4LA 4AGDA 3A61A 5E1EA 2HZNA 1ZOEA 3S2PA 5AR4A 3Q04A 1F5QA 4IM2A 4MNFA 4OTPA 4PDPA 4U80A 2GMXA 2YAKA 2ZM3A 3HX4A 3QQUA 3F3WA 4CMUA 4JDJA 5M07A 3R28A 1WVYA 4O7SA 3MVMA 1GJOA 3T3VA 2YN8A 4YTCA 4GG7A 4K8AA 2YWVA 5CLPA 2I0EA 1PXMA 1DI8A 3QRKA 1PXLA 3U9NA 3O71A 5E8SA 1ZLTA 3A62A 5CAUA 1SMHA 4XS2A 4BYIA 2V0DA 3EB0A 3OUNB 1R0EA 2OWBA 5LVPA 4IX5A 4NKAA 3O7LD 4KIPA 1BUHA 3PY0A 3BV3A 4NCTA 2R2PA 3HDMA 4QYHA 3KCFA 3QTWA 5IMXA 1OIRA 3HEGA 3UOJA 2FVDA 3Q6WA 3QUPA 2BRMA 3U55A 1FMKA 3P4KA 5LJJA 4WOVA 3EN4A 4ORKA 4RX7A 4DEHA 3PRFA 4ACCA 3I60A 4G5JA 3GFWA 5FTGA 4FTJA 1JAMA 5BVFA 3IS5A 2VWVA 2OH0E 2R3PA 2W1ZA 2CDZA 2Y6OA 3FMEA 3PWYA 4QPMA 5AP0A 4D9UA 1XO2B 3KB7A 1Y6AA 3SA0A 5BVDA 3HECA 5EQPA 1IA8A 1WBWA 4JI9A 3HV7A 3ATSA 1HOWA 1XWSA 4NK9A 3P1AA 4TYJA 2OI4X 3SDJA 2VWYA 4UYAA 4FT5A 2WAJA 3F82A 3FHIA 3TKUA 2UW5A 4UMRA 5EHOA 4WSYA 2V55A 4XP0A 4O0XA 1JKTA 4Y5QA 5AIKA 1JKSA 3DLZA 2J0LA 4FC0A 1JNKA 4G3EA 1VYZA 4IXPA 2JIIA 1LP4A 5CU2A 4NM3A 5BVNA 4G6LA 3VS5A 4MCVA 2C5XA 4FVPA 3FZOA 4ZS0A 3P7BA 4EQUA 2VTMA 2X2MA 2XBAA 4KS7A 4FG9A 4EOKA 1YWVA 2EXMA 3PXFA 4LRJA 2XKDA 2W1DA 5FQDC 3R8PA 3U8WA 1ZYSA 3QZHA 4UMTA 5AUVA 2WD1A 3RK5A 4ZZNA 5IUHA 4E5WA 4EJ7A 1YHSA 4KSPA 3MVLA 3RMFA 3RCJA 1GZKA 1SNXA 3KCKA 4AGUA 3FZSA 4MHAA 4RFZA 5KKRB 5DLSA 2VV9A 4EK5A 2YIQA 4JXFA 4MNEA 5EK7A 4D1XA 4DBXA 2C3JA 2BFXA 4FK3A 3VQHA 4NW6A 3VULA 2RGPA 1PMVA 4FT7A 4MAOA 1WBPA 3LLAA 2XS0A 4QP8A 3LCSA 4FEUA 4DE4A 3E63A 2Y7JA 4QMTA 4BDKA 1W8CA 4EYMA 4IWOA 1IASA 1WCCA 1UWHA 2EU9A 2VTSA 3FL5A 4R5YA 3RJCA 4CT1A 3OTVA 4DEEA 4IVAA 5BPYA 3LFFA 3V5PA 4EEVA 1YXVA 2JAVA 3VUHA 4U3YA 3WF8A 3D5UA 3EKKA 3MB6A 3C0HA 4XX9A 4OTQA 3EQGA 4HNIA 4RJ3A 3RPVA 3V6RA 2WIHA 4UWCA 4QP1A 3W2OA 4RVKA 5IQGA 4FNZA 2HXQA 2FH9A 4FYOA 5KHWA 2PTKA 3EJ1A 3S3IA 4DH5A 4PL4A 4NM7A 3T8OA 2YJRA 3TV4A 5JEBA 4JBPA 4ZAUA 4CFNA 5CSHA 3U54A 5EW8A 3AC8A 2OH4A 3DZQA 3MVHA 4LL5A 3UBDA 2XA4A 1ZWSA 2NPQA 2OBJA 4O96A 3ORKA 4D0WA 5TOZA 3U6IA 3R7EA 2BZIB 3JUHA 3ZRMA 3DDQA 3CD8A 5H8GA 3TJDA 1KOAA 1I44A 4I23A 5EI8A 4F1MA 2J5FA 4RQKA 3G2FA 1BMKA 3A99A 2VGPA 3KN6A 4H3PA 4XG8A 4K6ZA 5K5NA 4A9RA 1B39A 4AE6A 4KBCA 4KA3A 3CQEA 5BX0A 2XM9A 3NS9A 2XJ0A 4IFCA 5AM6A 5IPJA 2PVFA 3DQXA 4PDOA 5CYIA 3RPYA 2W4JA 4QMOA 4KS8A 4UX9A 2X39A 5IQCA 4AZEA 3PXZA 2G2IA 3NYVA 3FPMA 4PF4A 4RJ8A 4C4EA 3ETAA 3NW5A 5KMNA 5AFVA 2H96A 1PXJA 2J0IA 3L1SA 5LCKA 3ZMMA 5HG5A 1R0PA 3QX4A 2IZRA 3ACJA 2XZSA 5EM6A 5A54A 5GZAA 1SNUA 2CNQA 3UDBA 2X6EA 1JBPE 4ENXA 3FXWA 3EFWA 4WKQA 2XH5A 5EFQA 3VBWA 2GHGA 3ZLYA 2ZDTA 4I5HA 4ASXA 4OR5A 3NRMA 4IQ6A 3H0YA 2PE1A 4RC3A 1Q8YA 4WD5A 2FA2A 5KMOA 4U5JA 5LARA 3HMPA 5HCYA 4O0YA 4IHPA 3FZTA 2QOQA 4JIKA 5M4CA 4W4VA 1YI4A 3FMDA 2WTWA 3RBWA 2BDFA 2R3NA 2V7OA 3V5TA 3IW4A 3Q6UA 4WRSA 4XH6A 4FTKA 5DT0A 2JKMA 1P4FA 3NNXA 4J97A 3T3UA 1PW2A 4AN9A 1W84A 5HEZA 5EKOA 4L00A 5CSPA 5IQBA 4J53A 3EOCA 4HVGA 3GCQA 2PMLX 3N9XA 3LJ0A 4L68A 4BWXA 3QRUA 4APCA 3LW0A 3NR9A 5KZ0A 1CSNA 2WZJA 4CLJA 4XV2A 4APPA 4CTBA 4A07A 1L3RE 4NTSA 3OUKA 2B55A 4F6WA 2R3RA 4FUXA 2WMWA 5J5SA 3EYHA 4C4IA 2E9PA 3RK7A 4O2ZA 3BQRA 5DYJA 4F70A 3ORZA 4DFLA 2QURA 5C1QB 3MESA 4D4RA 4QQJA 2J6MA 4HW7A 4OBQA 1ZZ2A 4X2GA 3QLGA 4F0GA 2IVSA 3KMMA 2VZ6A 2PMOX 3OWKA 3TNPC 3TXOA 4FSQA 2WMXA 4H36A 4XOYA 3TI1A 1H07A 2GQRA 3MJ1A 4FUYA 4FICA 4XG7A 3VVHA 4WUAA 4KIKB 3WIKA 4DTAA 2GTMA 3N4TA 1PHKA 1UU8A 2HK5A 5HIEA 3RM6A 4AW2A 3B8QA 3LXKA 5GZ9A 5I3RA 4QMYA 2W1FA 4IX4A 3R9RA 3DCVA 2C3KA 4L01A 5E8VA 4C34A 2X81A 2QKWB 4F7LA 3R7UA 3UYTA 3D5XA 4ZSLA 2V5QA 4I41A 5CENA 3CIKA 2JKKA 3P0MA 4EUTA 5DNRA 3LE6A 4WHZA 2ONLC 3EZRA 3NCGA 3GNIB 3IOPA 3OOGA 4IAAA 3ZC6A 3QD2B 4FV6A 4O1PA 5AUUA 3OWLA 3O8PA 4ZTNA 4RA4A 3ATTA 3GFEA 4OTRA 2BTSA 4PNKA 3PXKA 2Z7LA 5CAPA 3OEZA 3DXQA 2PMIA 4BDIA 2H34A 2E9UA 4ZJVA 4R8QA 3PJ1A 4OBPA 5CQUA 3MA3A 5IA4A 5JGAA 1H25A 3VRZA 1ZY5A 4IDTA 2V22A 4C35A 1JOWB 5HIBA 2QVSE 4MKCA 1FOTA 4O7LA 4YHJA 4CRSA 3THBA 1KUTA 5CU3A 5FBNC 3FXZA 2YWPA 4QYEA 1OGUA 3PRIA 2BIYA 3C4XA 4V0GB 4DG2E 2GHMA 3TG1A 3R01A 1PF8A 2W0JA 4NM0A 1PMEA 4L53A 2WHBA 4RGJA 4XG9A 4XJ0A 2VTOA 3DDPA 3EN9A 4R1VA 5GJDA 4DGLC 3Q4CA 2JKQA 2JEDA 3ENMA 1XQZA 2IZUA 2PY3A 1ZOHA 2JLDA 3E8DA 4ANLA 4ZSGA 4K1BA 4I94A 2YIRA 4AZFA 1G8SA 3A8WA 3Q5ZA 5ITAA 3QTIA 5DIAA 5DRDA 2VN9A 5HG9A 3ZRLA 3SVVA 2VTTA 2OLCA 4IJ9A 2X8EA 3K5UA 2W5HA 2X0GA 3A7IA 3PP1A 3KN5A 4QD6A 4F9BA 5FP5A 3I6WA 1O9UA 3LCDA 4KBAA 3LFQA 5B2KA 1JKLA 4FV2A 5J5TA 4AT5A 2VX0A 4E73A 4NEUA 4H1MA 3P7CA 2VTQA 5EYCA 1GIHA 3R21A 5CF6A 4IAIA 4YJUA 2WB8A 5EM8A 3KA0A 4FBXA 5IMEA 3S00A 3R22A 5HU3A 2BAJA 4NL0A 4LFIA 1U59A 3RGFA 4JDHA 5JFXA 3QF9A 4KKHA 2H9VA 3FMLA 4L9IA 5FRIA 3E87A 1G3NA 4DT9A 3CC6A 4QYGA 5C27A 4B9DA 4UN0C 4XP3A 2WPAA 2UUEA 5IDNA 4HYHA 1XR1A 4WNOA 4GS6A 4NH1A 1PXNA 3I7CA 1PY5A 3EQIA 3BHTA 2ZOQA 1OL1A 2PE2A 2QR8A 4I3ZA 4PQNA 4W8DA 4C58A 4Z16A 2W4OA 4XNEA 3VWAA 3GC7A 5H8EA 5JQ5A 3UQCA 2HW6A 3PZEA 2UZVA 1PMNA 3OBJA 3WYYA 3SG8A 1UU7A 2JBOA 2WNTA 3FJQE 2V62A 4EZ7A 3IONA 3MIAA 4CGAA 5M08A 5E91A 2BTRA 2Z7QA 3FKLA 4IVBA 4JX7A 4KNBA 3Q3BA 4B0GA 5A14A 2JC6A 2W1GA 3OY3A 4BDBA 4O7WA 2QU5A 2EVAA 4X2KA 4BGGA 4I0RA 2BUJA 2OZAB 3L9LA 3GCPA 3MGYA 3OCGA 2Z7RA 3AOXA 4R77A 3D94A 1B38A 1H26A 2PL0A 2XNOA 3E62A 4GFMA 4TN6A 4FX3A 1UU9A 5LXMA 3LQ5A 3PSBA 2CCHA 3FQEA 4QMMA 3D9VA 3ZH8A 3G90X 3EL8A 3PVUA 2R3GA 3VO3A 4C4JA 2GNHA 4EBWA 3ODYX 1OMWA 5ANOA 2O5KA 3SRVB 3NW6A 3PFQA 3MPMA 5K3YA 3ZFXA 3VRYA 1PXIA 1WVWA 3NIZA 4AA5A 4GIIA 4LUDA 5IH5A 3EHAA 3SD0A 4E6AA 3E8NA 2ITQA 5E9EA 3GUBA 2YCRA 4PMPA 3CLYA 4I4FA 3D2IA 5LCJA 1SM2A 2UW3A 3FLSA 4LV5A 4RX8A 3D15A 4JG7A 5L6OA 3F7WA 4FV0A 4CFFA 5IQEA 3S4QA 3PWDA 5HCZA 3KVXA 1H0WA 3PSCA 4FF8A 3TCPA 5IU2A 5L6WL 3H0ZA 1W7HA 4PMSA 3FLYA 4F9WA 3FUPA 5BYYA 4PL3A 2OJ9A 3R9DA 3DAJA 3L9NA 5ETIA 5AUYA 1ND4A 2Z7SA 5LVNA 4J96A 3OT3A 3UGCA 4M8TA 2PVJA 5AAGA 2ETMA 2ONLA 3FY2A 3ACKA 4AAAA 2RFSA 3E3BX 2GFCA 3DNDA 3MFSA 2VTJA 3NPCA 4O0UA 5DR2A 2B7AA 2W7XA 4X6RA 3M1SA 3LFNA 4FTOA 2BRHA 3DTWA 3FBVA 5C9CA 3W1FA 2ZAZA 5AM7A 3UQFA 2OJGA 4KD1A 2RIOA 4Y72A 5AIRA 4GCJA 3MFUA 3C4WA 3I81A 3WF7A 4O1OA 4JDIA 4E26A 2WQBA 4W9XA 5EHYA 4V01A 1VR2A 1NVSA 3BI6A 3QQFA 3BWFA 1KWPA 3UJGA 3MA6A 4BF2A 3JR1A 3SW7A 2CKQA 3H4JA 4AFJA 3NMUF 3QRIA 3H9OA 1ZMUA 3EQDA 4IB1A 4LYNA 4XBUA 5IA5A 3RWQA 3UMXA 4GT3A 3UVPA 3EKNA 4ZSAA 3FI2A 1OL5A 3KFAA 4UEUA 2QOIA 3QRTA 2X9EA 2VD5A 4IAZA 4C57A 3R7OA 1PKDA 5H8BA 2WTJA 5DHJA 3VBYA 2PUPA 4I20A 3OEFX 3HMOA 3NNVA 5AUTA 4D2VA 1G5SA 2XRWA 2YAAA 3NAYA 1U54A 1BI7A 3PJ8A 5L6PA 4HZRA 1YKRA 2HENA 4ANSA 4FG7A 4YLLA 4QMLA 4C4HA 1QMZA 3HP2A 4BTMA 3TUCA 5F4NA 2XVDA 5K5XA 3JVRA 5A4QA 3OZ6A 5IH6A 2R3LA 3WYXA 3HV5A 3FLQA 2SRCA 5IKWA 3G33A 4BDEA 2YCQA 1V0BA 1YXTA 4BCMA 5HE3A 4NFNA 3ZYAA 4FIFA 3DLSA 5CU6A 4U7ZA 2F9GA 5EQEA 2WOUA 3FLNC 4CZYB 3LFAA 4ZSEA 4ANMA 3UNKA 3Q60A 2OJJA 2OIBA 4BCIA 1R39A 2ERKA 4JS8A 4WG4A 5D7AA 1O6YA 3HAMA 1WMKA 1RW8A 2EB3A 2H8HA 4L42A 5CF5A 5EM7A 4FE2A 2CPKE 3AQVA 3ZZEA 1Y8GA 1OUYA 4CTCA 1GNGA 3IDBA 2BIKB 2F7EE 3PJ3A 4YU2A 2B54A 4IB5A 4PRJA 5DPVA 4OTGA 5HE0A 4HOKA 4YGAA 2E2BA 5E7RA 1XH9A 4HYUA 4D0XA 4MXCA 2XK9A 5I3OA 1H8FA 3WF6A 2OKRA 3E64A 4ACMA 2OZOA 2C1AA 3UQGA 1JWHA 4YTFA 3HV3A 1YW2A 1E1XA 2OIDA 5DEWA 2NO3A 4RIWA 1OUKA 4FGBA 3BGZA 3QYZA 4DH7A 5CEPA 3NAXA 5JQ8A 2UZLA 4QMXA 5JH6A 3O23A 3GC0A 2QHMA 3G0EA 4FZ6A 2JAMA 2AUHA 5KHXA 2YDIA 3KRLA 3KXGA 4XCUA 4U40A 2AC3A 4S30A 4FEQA 3W10A 3QCSA 4TW9A 3GOKA 2QODA 3WE4A 1KV1A 5FTOA 5ANIA 2C30A 3TWJA 4A4XA 1MP8A 4BKJA 4F6SA 3SGCA 1X8BA 5KX8A 2YM6A 3IKAA 2C6TA 5HGIA 4H39A 4IACA 4QP3A 4YZMA 5KUPA 3L8VA 2UW8A 3R83A 1TQMA 2C0TA 2W1CA 2BKZA 3LFCA 3GEQA 2QLUA 3CP9A 4E6QA 3UC4A 3FQHA 3F3VA 3DK3A 2PUIA 3FLZA 3F3UA 2G15A 3P5KA 2WQMA 2FSTX 4RIOA 3HA8A 4GG5A 3AC4A 3NCZA 1JQHA 3TEIA 3QU0A 5EYMA 4F1TA 4WRGA 3E3PA 2W1HA 1AGWA 5KMMA 3LXLA 3HVCA 3I0QA 3E7OA 3IOKA 1Y57A 4BCQA 2ZB0A 3EWHA 4EQCA 3Q9ZA 2P3GX 2OGVA 5E8XA 3W32A 5L4QA 3WOWA 3RK9A 1YRPA 1JSTA 4FSYA 3F69A 1QPDA 4FI1A 3QQGA 3QHWA 5IH4A 3R63A 4N70A 1M14A 2UZBA 4QP2A 4I6HA 5CY3A 4ZLOA 4EH7A 2PPQA 4HCVA 2IVVA 3BHVA 4OTWA 3R8ZA 3ORXA 5DH3A 2PK9A 2QG5A 4YJPA 4RWJA 3HYHA 5AP2A 4O38A 1Q8UA 3EQHA 4AQCA 5LMBA 2ITYA 2XRUA 3Q96A 5EG3A 3HKOA 2Y0AA 3FSFA 4A9SA 1NVQA 1TQPA 3I4BA 1IR3A 1STCE 5AP1A 1KE9A 4QYYA 5DOSA 4F99A 2CHLA 3NEWA 4OTDA 2HZ0A 4DLIA 4O0SA 3WBLA 2PZYA 3CXWA 4FV4A 4ITJA 5FM3A 4DEGA 4EJNA 1R78A 4XLIA 3ET7A 4KUJA 2UVZA 4DTKA 2QHNA 4EOSA 1RE8A 1Z5MA 3NUUA 4FKVA 2WTVA 2J7TA 3QWJA 1JVPP 2BAKA 4TYHA 2B9FA 1J1BA 2O64A 3EMGA 2V7AA 4II5A 4MXXA 4XYFA 3V04A 2WQEA 5LOHA 2ZV9A 3DKFA 4LM5A 4MNEB 4JQ8A 4AUAA 2QKRA 2F2UA 3GXLA 4W9WA 5IEYA 5DI1A 1UKHA 3PVWA 4RQVA 2YDJA 5M4UA 4KIQA 1Y8YA 3LKMA 4X7QA 4EK8A 4X3FC 1WBNA 2W5AA 5HE2A 2ZM1A 4TNDA 4E4MA 5F9EA 5HVKA 4FOCA 4M67A 3TNIA 2CSNA 4FIEA 4MXZA 4CT2A 2XIXA 1H1QA 4DFBA 2WMUA 4MTAA 2O8YA 1PYXA 2HWOA 3AD6A 3KULA 4UXQA 4FVRA 4NTTA 4XV1A 1BL6A 5HQ0A 1SYKA 2QOKA 5EI2A 4GH2A 5CT0A 3R0TA 4EOPA 4RX5A 4YR8A 4ZY5A 4DN5A 4ZS4A 2EXCX 4C33A 2BPMA 2UZDA 4EOJA 4AS0A 3TDWA 5AV0A 1DM2A 3LXPA 4IC8A 3VHEA 4N4SA 3WZJA 2CGWA 5L8JA 4BDFA 2C68A 2R3JA 2X6DA 2GU8A 4FG8A 3OVVA 4BYJA 1REJA 3F5XA 2YISA 3P86A 3SXRA 4XV9A 5A46A 2ERZE 2UZOA 2XF0A 1H1WA 3A7HA 1H0VA 4BDCA 1CKPA 2F49A 3NNWA 4JIAA 3CS9A 5AX9A 4BCKA 4QQTA 5GJFA 2AYPA 1DI9A 4U81A 3NUAA 2YZLA 2ZV8A 3D83A 3SQQA 4BDAA 1H28A 2PSQA 2YEXA 3DA6A 1IG1A 4FKLA 5DVRA 5AWMA 4JNWA 3JY9A 2PZ5A 1Q99A 3QUEA 2GS6A 3PLSA 4RWKA 3DGKA 4YUQA 3WIGA 4DH1A 2ITWA 5ETCA 4ZXTA 5C01A 3RHKA 4RVTA 4FYNA 4LOQA 2XK4A 2XBJA 2F4JA 4Y5HA 4BCOA 2X2LA 4IM0A 3PY3A 5BMMA 3GQIA 5L8KA 4O22A 3R8VA 3KGAA 4C02A 3MV5A 3LMIA 2C0OA 4QNYA 2CMWA 5DT3A 5HI2A 3O96A 2IZSA 3EIDA 3RZBA 4O2PA 2ZJWA 1KE5A 4LL0A 4L3PA 1T46A 4FIHA 4DT8A 3I7BA 3GC9A 2J9MA 1WFCA 4IJPA 3GP0A 4D58A 5HESA 3F3ZA 2BZKB 3M11A 5GIOE 4C2VA 3DFAA 3ZM4A 1BYGA 3D5WA 5FEQA 1V1KA 4BDDA 4EWHA 5IQAA 2WXVA 4AOTA 4YJVA 2CKPA 3U6JA 3DBCA 4TZRA 2R0IA 3V3VA 3ZC5A 2YERA 3LM0A 5M55A 5JSMA 3FC1X 3CCNA 3OT8A 5BVKA 5D11A 3SC1A 2PMNX 2YITA 1EH4A 1OL6A 4IW0A 4QYFA 4R7IA 4DG3E 5CSXA 3LZBA 4MXYA 2HELA 4WT6A 3VJOA 2BDJA 4U3ZA 4OAVB 2JFLA 3QUDA 3FWQA 4BTFA 4PUZA 5HNBA 5J87A 5L2WA 4F4PA 2UW7A 1M2RA 5ETFA 2VTHA 4C3PA 4PWNA 3TV6A 4UMUA 2QO9A 1OECA 1OBDA 3R00A 5HX6A 3G6GA 4RZVA 3PYYA 3RWPA 4CVAA 3UODA 3VUGA 3F6XA 4DGGA 5AP3A 4BIBA 5K4IA 4J52A 4KAOA 5L8LA 4FTQA 1W83A 5D7VA 4ZJIA 4E3CA 4PDSA 2CNUA 3UPZA 4A7CA 1GZ8A 4R78A 5GHVA 4QP7A 4XRLA 4JVGA 3PSDA 2YCFA 3EYGA 2OSCA 1APME 3DKGA 2JIUA 3DJ6A 4YC8A 5TR6A 3R04A 4RRVA 1FGKA 4XMOA 2FSMX 4ZTHA 4UB7A 3Q53A 2UVYA 4ITHA 3NYOA 1DS5A 3UVQA 3ORPA 3R02A 3AT4A 4MF0A 4EH8A 3DTCA 2UV2A 4FZAB 3QQLA 3AT3A 5AADA 3GCVA 3ERKA 3GU8A 5A3XA 4F09A 3RCDA 1UNHA 3KMUA 3QD3A 3TL8A 3DOGA 3MSSA 2VTLA 4DINA 3OC1A 4PNIA 2PWLA 5ANKA 5A6NA 2VAGA 4WG3A 4IB0A 3BLHA 3LPBA 4CCBA 5HTIA 4LRKA 5AV2A 2GNLA 3KVWA 4X3FA 4GKIA 2R7IA 2VTAA 4Y8DA 4O81A 3U9CA 5HU9A 4OAUC 4HPUE 4GV1A 3W2SA 4B8MA 4U6RA 4PP9A 4XG2A 1DAYA 2XKCA 3FDNA 3S0OA 3UZTA 1TVOA 4KKGA 5I4NA 4DA5A 3PIZA 2CN8A 4MYGA 3NIEA 4GYIA 5AR2A 5FP6A 4YJSA 3ITZA 4ZJJA 4ACGA 4EOQA 2C1BA 2VO0A 4UWYA 4L45A 2HYYA 2PE0A 4AXAA 2GDOA 4CFUA 4EONA 3DXPA 2XIZA 2UW4A 1AQ1A 3H30A 2ZV7A 3DJ5A 3P78A 4LGGA 3TNWA 4F1OA 4E1ZA 3KRRA 4BCPA 3R9OA 3UP7A 4P2KA 3UOKA 5IQIA 3LM5A 5DBXA 3MH1A 4FL1A 3BCEA 4EKLA 5M51A 3ZO2A 2Q83A 3IGGA 5E8ZA 4FKIA 4AA0A 3DT1A 5KE0A 3PXQA 3QGYA 3Q9YA 4BCJA 4DGNA 3E92A 4ANQA 4E6DA 5J9YA 3EFLA 4IWDA 4FKUA 5GIPE 1XH5A 4RWIA 3AGLA 4OTHA 2OF4A 4E4LA 4G3CA 4ITIA 5JGDA 3M2WA 4N6YA 1Q8WA 1NXKA 5K0KA 4FV3A 5JZJA 3FSKA 2R64A 5E90A 3HV4A 3LCKA 4QMZA 2W99B 3QKMA 1H24A 2VUWA 4U43A 3I1AA 3TM0A 2QQ7A 4NU1A 4NKSA 4WIHA 4NFMA 4ACDA 3UOHA 4S34A 4EQMA 2KTYA 2A27A 3BEGA 3KRXA 3ZZWA 5FDXA 4BIDA 5J1VA 1GIIA 4ALWA 2Y4IC 3FMNA 4YSMA 4P5ZA 2F2CB 3UZPA 1WBVA 3AD5A 2C6EA 4MVFA 4TNBA 2O3PA 4JR7A 4YZNA 3ZONA 1K9AA 2VWBA 2BRBA 2FUMA 4GJ2A 3BEAA 4MXOA 3OCBA 3VS1A 4DFUA 4ZSJA 2WOTA 4BDJA 2R3IA 2X4ZA 3V51A 4CG9A 5JK3A 4IEBA 1H1PA 3HMNA 4O7YA 5GNKA 3PXRA 3O8TA 2JDOA 4RZWA 3QC9A 4MBLA 4XRJA 1KSWA 3TTIA 3C0GA 3VS2A 5C8MA 3ZU7A 2PVMA 5LVMA 4E20A 3DBEA 3NGAA 4CV9A 4EC9A 3D2KA 4Y85A 2H6DA 2PVLA 2XYNA 4FKTA 5AP4A 1GIJA 4CV8A 2CGVA 1OKYA 5KMIA 4O7NA 1U4DA 5EW3A 4IE9A 3LLTA 4YPDA 2VO6A 1H00A 1Q62A 2O2UA 3FYJX 5IZFA 4UZHA 4XUFA 3R1NA 1Q8TA 2ITOA 3O51A 3OXZA 4E6CA 1ERKA 2WFYA 4M3QA 4UV0A 4Y46A 2PVNA 3R7IA 2OG8A 3NUNA 4FT3A 4IB3A 2FGIA 4RLLA 4HVHA 1OBGA 4D5HA 4LOPA 5I9VA 3S1HA 4D2SA 3ZDIA 1YDSE 3EN5A 2Y6MA 4JAIA 5B2LA 3IPHA 5HZNA 3BYMA 3BLRA 4IZYA 4TTHB 4C59A 3ALOA 1UA2A 2X7FA 1QPEA 3BE2A 1WAKA 2YM8A 4BC6A 5I0BA 4OTFA 3EQPA 3OROA 1MQBA 4RLKA 4BL1A 3UG2A 3NZ0A 5T68A 3R6XA 5CU4A 4EBVA 3C4CA 3VUTA 3KQ7A 4O6EA 5KCVA 3W18A 3MH3A 5E4HA 4ZMEA 1W0XC 3B2TA 5M57A 4RPVA 3EN6A 3N4VA 3QRJA 2ZMCA 4QNAA 3HGKA 4IC7A 3QA0A 5HORA 4ENYA 4CMOA 2QOFA 1NT2A 4R7BA 4GW8A 5JRQA 3FC2A 4FR4A 2RL5A 2C5NA 3MJ2A 5DGZA 2QOOA 4KWPA 4O0RA 1SVHA 4HNFA 3ROYA 5HBJA 4WSQA 4KINA 4WA9A 5CS6A 4XG3A 2HY0A 4H05A 3C13A 2ZVAA 1VZOA 3SAYA 2A1AB 3FMJA 1UU3A 3TDVA 5EHLA 3WF9A 3FKNA 3VS7A 2C0IA 5J9LA 3MDYA 3MBLA 3QGWA 4BCGA 4EI4A 4BTKA 4LRMA 5A4TA 3OOMA 1REKA 1MRVA 3II5A 4I92A 5DRBA 3GVUA 4BY9E 3G51A 3O17A 3VS0A 4FKOA 1T45A 2Q0NA 2WGJA 1OIYA 2O63A 3RHXA 5HD4A 3F2AA 3CPBA 4CLIA 2XJ2A 2XK7A 2IW8A 2W17A 3VUDA 4N6ZA 2CJMA 3V01A 3FLWA 3UVRA 1K3AA 1BX6A 4GUEA 4CZUA 5BYLA 4DTBA 2BVAA 2DQ7X 2RFDA 2UZNA 4JQ7A 4EH6A 4TRLA 4CD0A 4HGEA 5CVHA 5HLNA 3WZEA 2J51A 4RVLA 5AR8A 4EOOA 3GQLA 1ZARA 4FIGA 4UXLA 2EUFB 3HL7A 3ORTA 4L7SA 3DAEA 3V8TA 3G5DA 4PMTA 2YM3A 5E1SA 5E92A 3U87A 3CD3A 4EK4A 3LFBA 1FVVA 3C50A 4FSNA 4ERWA 3WI6A 2XUUA 1U54B 3VBTA 3F88A 4U0IA 4BCHA 2A19B 3BE9A 4OBOA 4C0TA 4F0IA 3E8EA 5J95A 2BZHB 4AFEA 2FYSA 4H58A 5IISA 5JFWA 3HUCA 2W05A 4RJ7A 3FI8A 4QP9A 5BYZA 3WZKA 3QA8A 4DFXE 5BUJA 4FSUA 3U6HA 2HIWA 3FXXA 3PPJA 4QMSA 3SV0A 3HDNA 5CEKA 5CF8A 3DK7A 4TXCA 1YHVA 4AGWA 4G9CA 3W8LA 4ANNA 5DMZA 4F65A 5F94A 5I9WA 3H10A 5ANDA 4CEGA 5T6KA 2EXEA 1BKXA 1O6LA 2I40A 3E7VA 4FV9A 4O21A 4A9UA 2OXYA 2XIRA 5BMSA 3UPXA 3CY3A 4I6BA 1OI9A 3EQRA 4CKRA 1U46A 3FZRA 2G01A 2IO6A 2X7GA 3OG7A 5EDQA 4D2RA 4MF1A 3QBNA 4OTIA 4XOZA 4BKYA 3QCQA 2ZDUA 1YI3A 2UW9A 2YIXA 3JY0A 3QTXA 4NM5A 3BQCA 3QLFA 4NJ3A 1OKVA 4O0VA 4WNPA 5DA3A 1YDTE 3NWWA 2QOCA 4QT1A 5DG5A 5JZNA 2VO3A 4U45A 1QPCA 5CI7A 4BBEA 3E93A 4D1SA 4ZY4A 4FMQA 3H9FA 4KB8A 3IW5A 4DHFA 1ZYDA 4IIRA 4P4CA 1VYWA 4ZOGA 3QL8A 5CZHA 2R7BA 5EOLA 2BRNA 4FKGA 5KBRA 4IX6A 4QTDA 2W5BA 3EFJA 3FL4A 4RIWB 5TKDA 4FV5A 3RAIA 2FSLX 4DF3A 3QQKA 1LUFA 2C4GA 3TTJA 1QL6A 3R8MA 5I9ZA 4HVSA 5HNIX 5BUEA 1H1SA 3BZ3A 4R3PA 1PRYA 2YM7A 1YQJA 1E1VA 3MPTA 4NT4A 3G15A 1ZRZA 5M06A 1XH4A 3PA4A 3QX2A 4JT3A 4ARKA 3KXHA 4NWMA 3OMVA 1H27A 4GYGA 4CQEA 4QTCA 3P9JA 4U97A 4FT0A 1KE6A 5HD7A 4UWBA 4MQ1A 4AN2A 2YABA 5HO7A 2WQNA 1L8TA 4F64A 5HIDA 3EQFA 2WMBA 3FQSA 5I9XA 1U5RA 3LJ1A 1Q97A 4K2RA 3VNTA 4BCNA 4KRDA 3UC3A 2HY81 3B8RA 3D7TA 3KKVA 2C6MA 4KBKA 4FTUA 2G1TA 1FBNA 5K9IA 4S31A 3VUIA 2VWZA 4MH7A 3ODZX 4FL3A 4QRCA 1YOJA 2X4FA 4FODA 4I6FA 3T9IA 4O0TA 3F7ZA 3UYSA 2WMAA 3LFSA 4AOIA 4EHGA 1Q5KA 4QTBA 4RIYA 3CJFA 3DQWA 1OIQA 5IA2A 5M4FA 3BIZA 3G9LX 2IJMA 4IAFA 4JQEA 3TACA 2OJIA 3ELJA 3MY0A 4QPSA 5HO8A 3O8UA 3IW7A 3AC5A 1I09A 2B1PA 4DFZE 1XHAA 3D0EA 4MBIA 5JFVA 4FGRA 3L9PA 4CFVA 4M97A 3V5LA 2JD5A 2WEVA 2XIYA 4LMUA 4J1RA 1YWNA 4M7IA 3MFRA 3ANQA 2BHHA 2W9ZB 4H3BA 2G9XA 2Z8CA 4JLCA 1DAWA 4L43A 3HZTA 4D2WA 3AC2A 4BN1A 4C7TA 1GZNA 3C4EA 4S33A 3HA6A 2GNGA 5J7HA 3FZ1A 3KXNA 5IA0A 3ZFMA 3BYVA 2I6LA
chains in the Genus database with same CATH superfamily
1CDKA 2Y8OA 4KIOA 3R73A 4W4WA 2WMVA 2CCIA 5DEYA 3R8UA 2HZ4A 5M4IA 4AOJA 2HCKA 4FKWA 5DR9A 2ZMDA 1UWJA 2XB7A 1V0PA 2C6OA 5LWNA 5KMLA 4TYGA 3IO7A 3UDZA 4CKJA 1U5QA 3MIYA 3R1SA 4IZAA 2YJSA 3PA3A 3TKHA 4U79A 2QLQA 3PUPA 4BHNA 2WTKC 4M12A 5ICPA 2CGUA 4JOAA 1Z57A 4FZFB 2W06A 5CZIA 5TO8A 3LCTA 3W2QA 4GKHA 4AXCA 4TWOA 4DG0E 4L46A 5CQWA 4ALVA 4CYJA 5HLPA 3AC1A 3TIZA 1J7LA 2I0VA 4HZSA 4A06A 1ATPE 2B9JA 4FNWA 3VC4A 3RVGA 4PDYA 5F1ZA 3EQCA 3KULB 4PTCA 3CE3A 4J71A 3PP0A 4DC2A 4ZLZA 2YM4A 3BBTB 3POZA 2WEIA 5K0XA 2BR1A 1O6KA 4C3FA 4I5PA 4NUSA 2WO6A 3SXFA 4TL0A 2VTPA 3D4QA 4A9TA 3G0FA 4DGMA 4QTEA 2ITTA 4C4FA 2NP8A 3BBWA 3I5NA 3Q32A 2E9NA 4M69A 2LAVA 3UO4A 4FV1A 4CXAA 5FM2A 2BDWA 3POOA 2HWPA 2E9OA 2IN6A 5AAFA 4ASZA 4L6QA 2JIVA 4CCUA 4CYIA 3K3IA 4QO9A 3C9WA 5L2SA 4FEXA 2XMYA 4EHEA 4IAYA 3UTOA 3PLAE 1PXPA 3QQJA 3DBFA 4I5CA 4AW1A 2QOBA 4D55A 1OB3A 2PVRA 4C4GA 3KRWA 4V05A 2GQSA 5IF1A 3PG1A 2B53A 2QOHA 3KXZA 3LMGA 2C5YA 4D2TA 3QCYA 1IA9A 2CLQA 4CNHA 4O84A 3BU3A 3W2PA 3Q52A 2CGXA 4LGDA 5IQFA 5JRSA 2XEZA 1ZYLA 2X0PA 3IQ7A 4Q9ZA 4J95A 4UY9A 2GS2A 2Y4PA 4ASDA 5KZIA 3VN9A 1OPJA 5AR5A 4FTCA 3RKBA 5HTCA 3BL7A 4G5PA 4GFGA 4O4DA 3PG3A 3N4UA 2W9FB 2P4IA 4ZK5A 3QTRA 3ZUUA 5L3AA 5CWZA 3C0IA 4JMQA 4O82A 5CANA 3R1QA 3DB8A 4TPTA 3TUBA 3B2WA 2GTNA 3FZPA 1XJDA 3NFGB 4BR3A 2ESMA 2UW0A 3ORNA 4PPAA 3UIUA 5LWMA 2REIA 4YJTA 2J50A 2P0CA 2BALA 5HBEA 4HYIA 5EM5A 3OCSA 3OHTA 5D41A 3OTUA 4FTLA 5IQHA 4PPCA 3CQUA 4EYJA 5D1JA 5IUIA 4QMWA 5E8TA 4YTIA 5KNJA 2C6LA 1Q3DA 2R3OA 4XLVA 4MD7E 4CKIA 3BGPA 2VNYA 4P7EA 5C03A 2J2IB 4D4SA 2ITUA 4C37A 4C3RA 4YC3A 5EI6A 2ITZA 4J7BA 4F7JA 3R2BA 4GVAA 2ACXA 5JKGA 1XBBA 3MY1A 1UKIA 2UZWE 5AP7A 3QFVA 2HZIA 3RAKA 3KREA 5E8WA 5LVLA 3RPSA 1MUOA 4IM3A 4W4YA 4Y73A 2BFYA 4G31A 3W16A 4C38A 4CFMA 4FTIA 5AMNA 4EC8A 3GGFA 3ZDUA 1RDQE 3JS2A 4XBRA 4HGLA 3OBGA 4JG8A 2JGZA 3K5VA 3QAME 2UZUE 1ZY4A 2A4LA 3L8PA 1KE8A 3P7AA 4AZTA 4QP6A 5BVEA 4BI2A 1WBOA 5TF9A 1S9JA 3QKKA 4YLKA 2XAOA 4HPTE 4XP2A 3QYWA 4X2JA 4YJRA 4YO4A 2YZAA 3T9TA 4E4NA 2W1EA 3DKOA 3MI9A 4BB4A 4DCEA 1M17A 4TWPA 4ERKA 4M0ZA 1FINA 5CT7A 2IZTA 4MXAA 4FK6A 3K2LA 3VF8A 4K0YA 2LGCA 2WTIA 3PPKA 3R9NA 4YPSA 4QDVA 4P5QA 4YJOA 2VX3A 2ZV2A 3H3CA 5HBHA 3QTUA 3ZLXA 4GIHA 3M42A 3BYSA 5J8IA 2VO7A 3FE3A 3R9HA 4D4YA 3MVJA 4RFYA 4BWPA 4K77A 3W8QA 5IQDA 4WO5A 3PPZA 4Z3VA 3AD4A 3EN7A 4KKEA 4IDVA 5C4KA 2CKOA 3D5VA 1OPLA 4MWIA 5LVOA 5EDRA 3FEGA 3QCXA 1GAGA 4FOBA 3CKWA 4CG8A 2A98A 5H2UA 2RF9A 3UDTA 1M7QA 2BRGA 2UVXA 4OW8A 4AG8A 2ITPA 4HJOA 3A4PA 2UZEA 3NUPA 4G2FA 4L7FA 3ZSHA 2IG7A 4LDTA 3LOKA 3KF7A 1URCA 3BKBA 4FIJA 4RT7A 1LEWA 1RJBA 3CQWA 4X3FB 2YLEA 4ZTLA 3VBVA 2QONA 4G17A 4JAJA 5CASA 3W0SA 3QZGA 4K9YA 5FGKA 2DWBA 3IK3A 4FTAA 5DN3A 5M09A 3W55A 4BBFA 4C62A 4BI1A 2CN5A 3A2CA 4LV8A 4M0YA 4M68A 1MRUA 3VUKA 3I0OA 1OKWA 4IFGA 4I1ZA 2YM5A 3PIYA 2WMRA 4E5AX 3OWPA 2IEWA 5J79A 3MW1A 4A4LA 3C5IA 3V5JA 3VS4A 3COIA 4G9RA 4F7SA 5HVYA 2BAQA 3WZDA 3PXYA 4ZTSA 5H9BA 4AQKA 3VIDA 2B0QA 4I93A 4GK2A 4UYNA 3COMA 4RFMA 2XK3A 5F20A 4YNEA 3R7VA 5HLWA 3MTFA 3I6UA 2VWWA 3KL8A 3QXPA 4FTRA 4AT3A 1VJYA 4UZDA 2JDRA 4RMZA 3TKIA 4FL2A 2X8DA 5BVWA 4DAWA 5CEQA 2JKOA 4O83A 4EHZA 2YDKA 3W2RA 5EW9A 1SVGA 2I1MA 4RA5A 2XKEA 3DZOA 4HGSA 3ORMA 2PYWA 4X3JA 3MWUA 4G1WA 4NZWB 2QI8A 4EH5A 1FVRA 3MN3A 5K4JA 5EOBA 2QO2A 4X0MA 5IDPA 3PUFC 3P23A 4RJ6A 4ZZMA 3Q4ZA 2AC5A 4ANOA 4PX6A 4V04A 5AA9A 3ANRA 2Z02A 3QTSA 2VTNA 4KRCA 2VTRA 3DBQA 5ETAA 4HVIA 4X21A 1NY3A 1YXSA 2Z60A 5BVOA 3VQUA 5JFSA 4IAKA 4FZ7A 4Y83A 1BL7A 2P33A 3IGOA 1CM8A 3IW6A 4P90A 5FBOA 2IWIA 3E5AA 3FV8A 4LOOA 3MTLA 3D7ZA 4NJDA 4ZY6A 4ONAA 4QP4A 2ZFYA 3NFFB 2QCSA 4CFXA 1PXOA 1H01A 3RALA 4EH9A 5KKRC 4HCTA 4PTGA 5CSWA 1JPAA 3TZ9A 1ZOGA 4BRXA 3OXTA 3R2YA 1PYEA 2ITXA 3V5WA 4DFNA 3C51A 4AW0A 3CGFA 1V0OA 1LEZA 4D5KA 5IA3A 5G1XA 4FSWA 3U51A 3VUMA 3ZEWA 3IDPA 4GL9A 1LR4A 2OICA 3CPCA 2XJ1A 5CVGA 5FLFA 4FV7A 3V8WA 5CEMA 5C8KA 3O7LB 4MD8E 4WUNA 3A7JA 1OZ1A 4L3JA 3BELA 2EWAA 2OXDA 1UNLA 3E88A 4FTMA 4JBVA 2YCSA 5FXQA 3OP5A 3ZEPA 3D14A 3WZUA 4UALA 4BIEA 4F08A 5LMKC 3VW8A 3ORLA 4DHZA 5FUTA 3W0QA 2QR7A 4E8AA 1Y6BA 3DNEA 4ACHA 3Q4TA 3NLBA 4GFOA 5CXHA 2B9HA 2HXLA 2GQGA 2PVKA 3FMHA 3KU2A 3O50A 2G2HA 4JJRA 3CJGA 4RIXA 5FEEA 3OFMA 3KY2A 3KK8A 5GJGA 3MY5A 2C3IB 3LMHA 4X6QC 3QKLA 4NIFA 5AV3A 3SHEA 1YVJA 3MH2A 4RJ4A 1Z9XA 4GT5A 1M2PA 3QD4A 4ZP5A 4MWHA 2PVHA 2XK8A 4LI5A 5B0XA 3F61A 4OLIA 3WARA 5BV3A 4EH4A 4IWPA 3KF4A 4RC4A 4MK0A 2FB8A 3H9RA 3IG7A 3P79A 4FNXA 5ANEA 3PTGA 3RAHA 4AT4A 2OFUA 4MEDA 3ALNA 1J3HA 3OW4A 4Q9SA 3VW6A 4TY1A 1J1CA 2XNPA 4ZTQA 4Z7HA 3TN8A 3HRFA 5HKMA 1UNGA 4PMMA 4YBKA 4FKSA 4B4LA 3NYNA 5FXSA 4R5SA 3BYUA 2WTCA 2XYUA 3RNIA 1CKIA 4FA2A 4K11A 5EDPA 4YZBA 2GSFA 3R1YA 3Q2MA 5TT7A 4ASEA 5CAQA 2WKMA 3HP5A 3AC3A 3PZHA 3OWJA 4RWLA 3HUBA 5EYKA 3UP2A 4DYMA 1RQQA 1UVRA 2RFNA 4FSMA 4WNMA 1P5EA 1M52A 5HCXA 2C6KA 5AA8A 3HAVA 3L9MA 4BWKA 1YWRA 4IBMA 1OVEA 4TKSA 2BHEA 3F9NA 4I0SA 4YHTA 3DJ7A 5J1WA 4JRNA 2CNVA 2XAMA 2WELA 3L8SA 4QQ5A 3L8XA 3AMAA 5M44A 1R1WA 5KBQA 4IANA 5I9YA 4O7VA 2KULA 1ZAOA 3EQBA 4YURA 4HYSA 2VU3A 3Q5IA 5A4CA 2GPHA 1OITA 4E5BA 3NVMB 4ZEGA 4C61A 3BRBA 4M84A 3KEXA 4X2FA 4E7WA 3GBZA 3DBDA 4PPBA 1XH6A 4MX9A 1ZYJA 4R7HA 3P08A 4F0FA 4FNYA 4FEVA 3R7YA 3NYXA 4JBQA 5DT4A 4B99A 4CFWA 2VGOA 1PJKA 1YXXA 1H1RA 4O86A 5HG8A 3BU5A 2X1NA 2R5TA 1SVEA 1ST0A 3SOAA 3CBLA 1MQ4A 3C4FA 4D9TA 5JGBA 4EZ3A 5HVJA 4DEBA 1TKIA 4L67A 1XH8A 4LMNA 1HCLA 2FO0A 2Y4IB 3AG9A 2JDSA 1PKGA 3VAPA 2Q0BA 2X8IA 3PJCA 4A9YA 4AZVA 4USEA 3DV3A 2PHKA 2FSOX 1JSUA 3DKCA 3OCTA 3UMWA 3OS3A 4ZLYA 1KV2A 2O0UA 3AXWA 2XK6A 4RVMA 2BILB 5ANJA 2XEYA 4S2ZA 2PVYA 5CTPA 5CEIA 3UDSA 4UMPA 1WBSA 1F3MC 3AGMA 2G2FA 5L2TA 3GT8A 3PDTA 3ROCA 1A06A 3PIXA 5D10A 4YC6A 2P55A 4RBLA 2JITA 4U8ZA 3G9NA 5CAVA 1J7IA 3K3JA 4BICA 4XEYA 4A4OA 5B7VA 3QWKA 1CTPE 4XV3A 1QCFA 2VNWA 3VS3A 1YHWA 5DR6A 3ZBXA 4CRLA 3F66A 4I22A 4AW5A 1IAHA 4FKQA 2C5OA 5L2IA 1Q8ZA 4EHVA 3CSVA 2HW7A 2GHLA 1W2DA 2R3HA 2X2KA 2J90A 1FQ1B 4G16A 2WTDA 4BTJA 4AP7A 2E9VA 2C69A 4R3CA 4I0TA 3AMBA 3BLQA 1XBCA 4RX9A 2XNBA 5HHWA 3V6SA 2XKFA 2PU8A 5LMKA 3ZBFA 1Q4LA 4XHKB 2JBPA 3ZRKA 3PY1A 4ALUA 3LIJA 4DCAA 4XG4A 3ZOSA 1ZYCA 1PMUA 3NUYA 5AEPA 3HNGA 3PA5A 3AKKA 4CMTA 4N57A 4MBJA 4R1YA 3KK9A 2IW6A 2OFVA 2J4ZA 3HRBA 3O2MA 3TJCA 5HTBA 2HOGA 3D7TB 3DXNA 2OO8X 4EORA 5C8NA 1Q41A 4U41A 4YZCA 3OY1A 3W0RA 3PE2A 3NX8A 4DDIA 3CY2A 3GC8A 4AACA 1NW1A 3ID6C 1Q24A 2NNWB 4RIYB 4EH2A 4CSVA 3BHHA 3QZIA 1J7UA 3PFYA 3UZRA 4EUUA 2WU6A 4D2PA 4QMPA 2Y9QA 3R7GA 2ETKA 3QXOA 4FTNA 4GMYA 4NSTA 1FGIA 4AA4A 1P14A 3S95A 4GK4A 1YOMA 3SOCA 3SG9A 2GFSA 1FPUA 5CXZA 2YACA 2R3KA 4EKKA 3SLSA 3NVKI 4RG0A 4QMUA 5JT2A 1XKKA 2A0CX 1SZMA 3FAAA 3MFTA 3TNHA 2IVTA 3G6HA 3RM7A 4BI0A 5AR3A 5AR7A 4CQGA 2RFEA 2QNJA 2RSVA 3JPVA 2QC6A 4OT6A 3ZXTA 5BNJA 4TT7A 3EFKA 4EOLA 2NRYA 3ZTXA 3DS6A 1UV5A 4EK6A 3NNUA 4I5MA 4PL5A 5CSVA 5TE0A 4FV8A 2XCKA 1CKJA 2VX1A 5FTQA 1M7NA 4G3FA 4QTAA 4B6LA 4EL9A 3KRJA 1BLXA 4TWNA 1G8AA 1HCKA 4TYIA 5D12A 3RNYA 3BLAA 4YZDA 4RC2A 1WZYA 3W33A 3ZSGA 3LVPA 1OIUA 4X2NA 4QOXA 4ZTMA 5C26A 4O7ZA 3QALE 4O27B 2BCJA 3HLLA 3BHYA 3ZUTA 1QPJA 4WBBB 3VBQA 1S9IA 4F7NA 4L8MA 1NA7A 4EZ5A 3OW3A 4F6UA 4MD9E 3CTJA 4YNOA 3C4ZA 3WE8A 1OL2A 5AV4A 2W1IA 2WQOA 2YA9A 3ZFYA 3BL9A 3FKOA 3KXXA 4IH8A 4M15A 1B6CB 2ITNA 3ENHA 3ORIA 3U4WA 1IAJA 4N0SA 3CTHA 4W8EA 3EL7A 4DFYA 3BU6A 4BKZA 2C47A 3GU6A 4PY1A 2IVUA 2OK1A 3FI4A 1KE7A 2BZJA 2YIYA 4FIIA 5I5ZA 3ULIA 4IWQA 4WBOA 3MS9A 4ZIMA 4J99A 3CR0A 4ZMFA 2EB2A 3BYOA 4GVJA 3VF9A 2ITVA 1URWA 4BJJA 5C4LA 4AE9A 4AX8A 3DK6A 4I24A 5FD2A 1YDRE 3W0OA 1MRYA 3LXNA 3F2RA 5AP6A 3VS6A 4U44A 4IADA 3HMMA 2R3FA 3DAKA 4BZDA 3HRCA 4BDHA 1ZZLA 2C6IA 1YI6A 4EH3A 4KIKA 4TYEA 3F5GA 1E9HA 4YO6A 4BZOA 3JXWA 4M69B 5EYDA 2GS7A 3IDCA 4F9AA 4R3RA 5AJQA 2OW3A 5ACBC 3MH0A 2QU6A 3A4OX 5J7BA 4DEAA 5AV1A 2UW6A 3NW7A 4ID7A 5HNGA 5HE1A 3ZSIA 1Q61A 3ZM9A 4DITA 1AD5A 4JDKA 4NW5A 3OF0A 4F63A 3MB7A 2QO7A 2O65A 3DB6A 3GU5A 4I4EA 4GT4A 4Q2AA 3A7FA 5ANGA 3NDMA 5CU0A 3U4UA 4USFA 5AUZA 3NUXA 4BGQA 4BBMA 2XNEA 3UE4A 5DWRA 3BX5A 3I79A 3FMMA 5E8UA 1J91A 4YHFA 3WILA 3NUSA 4C8BA 2YHVA 3UG1A 4ANBA 4F78A 5T3QA 3UNZA 4IMYA 3A60A 3WF5A 4KSQA 4GEOA 2JFMA 4Q5HA 2HAKA 3ZUVA 4DGOA 3O0GA 2YLFA 5JMSA 3PVBA 4LG4A 3CGOA 3V5QA 5M56A 3QTQA 1CMKE 4O91A 1WBTA 3JYAA 4C2WA 2DYLA 3BPRA 5G6VA 3Q4UA 2BKKA 4YJNA 5DFPA 4DEDA 2WU7A 2PUNA 2PZRA 2QOLA 3GB2A 4V0GA 5AUWA 4OGRA 2R3QA 4B8LA 3EZVA 2X7OA 3R8LA 3RPRA 4XG6A 5EKNA 5LQFA 2IPXA 4EOMA 5GINE 4G3GA 1GZOA 5FXRA 2VWXA 4R6VA 3GOPA 5LMAA 2BMCA 2QG7A 5AP5A 2F57A 5A9UA 5BQ0A 4EK3A 3QTZA 5CI6A 3CTQA 4O4CA 3VJNA 5ACKA 2PZIA 3TZMA 3GCUA 3IW8A 2GNFA 3C1XA 1XH7A 2F7ZE 4BDGA 3QHRA 4I21A 3VBXA 4FSZA 2RKUA 2ZYBA 4FTTA 3VHKA 5A6OA 2PULA 2UZTA 2VWUA 5CEOA 1JKKA 2XNGA 5F95A 2J5EA 1JSVA 3Q9WA 4QDEA 3AT2A 3UIBA 5CNNA 4RJ5A 3SX9A 1ZMVA 4JX3A 4AN3A 4BFMA 5IG1A 1M2QA 3BWJA 3F2NA 5A4LA 5DE2A 4QMQA 3JVSA 3Q9XA 4TYHB 4U9AA 5EQYA 1BI8A 2W96B 5KMKA 3SKCA 4FKJA 4IZ7A 2P2HA 5IUGA 3ZLWA 2XNMA 3BV2A 4G3DA 3TIYA 4DEIA 4EWQA 1WVXA 1H08A 2VTIA 2J0JA 3R30A 5CNOA 3ZO3A 2F7XE 4GSBA 2I0YA 4BVUA 2ZB1A 3UOLA 2RG6A 2YFXA 3TZ7A 5JN2A 1R3CA 3KXMA 4U42A 4USDA 4J8NA 3F3TA 5AAEA 3V8SA 1F0QA 1P2AA 1IEPA 4GJ3A 4BGHA 4TWCA 4JR3A 2CKEA 2VWIA 3LJ2A 3UO5A 3LFDA 3FYKX 4JL9A 2R4BA 4GRBA 3CEKA 5J9ZA 1ZXEA 2XIKA 4D1ZA 1JLUE 1Q3WA 2W4KA 4F9YA 2P2IA 4QPAA 4D28A 5E8YA 4M66A 4QQCA 4YJQA 4MQ2A 4O0WA 3A7GA 5HICA 3UO6A 4IVDA 3LQ3A 4NYEA 2OZAA 2WTKB 3PVGA 3R71A 5CX9A 4GU6A 1OGYA 3ZS5A 2XM8A 4QMVA 2DS1A 5IEXA 3RPOA 3QQHA 4ZTRA 4UMQA 3W2CA 4B7TA 5M53A 3Q2JA 3TNQB 5EH0A 2DUVA 4FVQA 3N51A 4YZ9A 4NCTC 4HVDA 3UIXA 3SRVA 4UBAA 3DPKA 4DBNA 3LHJA 4PTEA 2XCHA 3SW4A 4YMJA 2A2AA 1VEBA 2PUUA 3RINA 4O7TA 1Y91A 2WMQA 4YBJA 4WNKA 4S32A 3TUDA 4K33A 4BZNA 2GNIA 3RTPA 1YOLA 3A8XA 2BROA 5HOAA 4E93A 4IX3A 4FSRA 4CZTA 2I7QA 3HV6A 4HGTA 2XANA 5HX8A 3HMIA 3MPAA 1TQIA 2OF2A 4GU9A 4W4XA 3REPA 1XBAA 4FKRA 4FKPA 3LCOA 3COHA 4DH3A 2B9IA 3LAUA 3F5UA 4G34A 3QZFA 4H3QA 4YP8A 3OXIA 2X9FA 4E4XA 3KMWA 5KO1A 3E8CA 4LQMA 4RSSA 2IW9A 2RG5A 3ULZA 3QD0A 5FEDA 1W82A 1VLRA 5AX3A 3AMYA 3OD6X 4PP7A 3GENA 1PXKA 2GNJA 2VRXA 3BGQA 4J98A 4BCFA 5I9UA 4JBOA 4Z9LA 4DH8A 4JG6A 5H3QA 3NSZA 2QD9A 4M13A 4YTHA 4LGHA 3UIMA 3ZLSA 5CALA 4FEWA 3ZO4A 4AWIA 5FG8A 4OT5A 4WG5A 4D4VA 3C7QA 3LQ8A 4FSTA 5KMJA 4L52A 5CAOA 3DFCB 4M14A 2C5VA 4L44A 4GK3A 3FHRA 3LFEA 1OM1A 2I0HA 3ZCLA 2R9SA 2NRUA 3ZXZA 3DU8A 3IECA 4F9CA 4Z55A 3K54A 3GCSA 5GZ8A 2WIPA 4IVCA 1NVRA 4AZWA 2YIWA 3RI1A 2R3MA 2J0KA 2B52A 2PZPA 2WMSA 2CLXA 3PJ2A 3RAWA 4ZZOA 1OL7A 2ZM4A 4Y95A 3DY7A 2WMTA 1OKZA 3TT0A 4BHZA 1GOLA 3FI3A 3FY0A 3UNJA 5A4EA 2XP2A 1OPKA 4HCUA 2ETRA 4O4BB 1LPUA 2OIQA 2XNNA 4KABA 5HO6A 1FMOE 4PV0A 2OJFE 3TZ8A 1IRKA 3BHUA 3F5PA 1W98A 4O6LA 4EOIA 4QMNA 4FZDB 2C6DA 1YXUA 4FT9A 3COKA 4Q5EA 1ZMWA 2Z2WA 3SXSA 4AU8A 5IEVA 2GCDA 5FWKK 3FMKA 3ZHPC 5B2MA 4Z7GA 2OXXA 4DLJA 4AGCA 2JDVA 1FVTA 2J0MB 1KOBA 3C5UA 3PE1A 3MYGA 3ZO1A 4YLJA 4JRVA 4O7RA 3GI3A 3CKXA 4L3LA 2R0UA 2JDTA 5D9HA 3I5ZA 4GUBA 4IZ5A 3GU4A 1P4OA 3FPQA 5L2QA 3RZFA 5CF4A 5CVFA 2OU7A 4OUCA 3EH9A 1K2PA 5AUXA 4YSJA 3GU7A 1A48A 3KC3A 4K18A 4AF3A 4RIXB 4AZSA 4H1JA 1GY3A 2B4SB 4LUEA 4C36A 4G6NA 4NIFB 4G6OA 3QC4A 3TV7A 1A9UA 5IA1A 5BUIA 4I6QA 5HG7A 3RP9A 2C3LA 4J8MA 1H4LA 4AGDA 3A61A 5E1EA 2HZNA 1ZOEA 3S2PA 4O4EA 3Q04A 1F5QA 4IM2A 4MNFA 4OTPA 4PDPA 4U80A 2GMXA 2YAKA 2ZM3A 3HX4A 3QQUA 3F3WA 4CMUA 4JDJA 5M07A 3R28A 1WVYA 4O7SA 3MVMA 1GJOA 3T3VA 2YN8A 4YTCA 4GG7A 4K8AA 2YWVA 5CLPA 2I0EA 1PXMA 1DI8A 3QRKA 1PXLA 3U9NA 3O71A 5E8SA 1ZLTA 3A62A 5CAUA 1SMHA 4XS2A 4BYIA 2V0DA 3EB0A 3OUNB 3AKJA 1R0EA 2OWBA 5LVPA 4IX5A 4NKAA 3O7LD 4KIPA 1BUHA 3PY0A 3BV3A 4NCTA 2R2PA 3HDMA 4QYHA 3KCFA 3QTWA 5IMXA 1OIRA 3HEGA 3UOJA 2FVDA 3Q6WA 3QUPA 2BRMA 3U55A 1FMKA 3P4KA 5LJJA 4WOVA 3EN4A 4ORKA 4RX7A 4DEHA 3PRFA 4ACCA 3I60A 4G5JA 3GFWA 5FTGA 4FTJA 1JAMA 5BVFA 3IS5A 2VWVA 2OH0E 2R3PA 2W1ZA 2CDZA 2Y6OA 3FMEA 3PWYA 4QPMA 5AP0A 4D9UA 1XO2B 3KB7A 1Y6AA 3SA0A 5BVDA 3HECA 5EQPA 1IA8A 1WBWA 4JI9A 3HV7A 3ATSA 1HOWA 1XWSA 4NK9A 3P1AA 4TYJA 2OI4X 3SDJA 2VWYA 4O4FA 4UYAA 4FT5A 2WAJA 3F82A 3FHIA 3TKUA 2UW5A 4UMRA 5EHOA 4WSYA 2V55A 4XP0A 4O0XA 1JKTA 4Y5QA 5AIKA 1JKSA 3DLZA 2J0LA 4FC0A 1JNKA 4G3EA 1VYZA 4IXPA 2JIIA 1LP4A 5CU2A 4NM3A 5BVNA 4G6LA 3VS5A 4MCVA 2C5XA 4FVPA 3FZOA 4ZS0A 3P7BA 4EQUA 2VTMA 2X2MA 2XBAA 4KS7A 4FG9A 4EOKA 1YWVA 2EXMA 3PXFA 4LRJA 2XKDA 2W1DA 5FQDC 3R8PA 3U8WA 1ZYSA 3QZHA 4UMTA 5AUVA 2WD1A 3RK5A 4ZZNA 5IUHA 4E5WA 4EJ7A 1YHSA 4KSPA 3MVLA 3RMFA 3RCJA 1GZKA 1SNXA 3KCKA 4AGUA 3FZSA 4MHAA 4RFZA 5KKRB 5DLSA 2VV9A 4EK5A 2YIQA 4JXFA 4MNEA 5EK7A 4D1XA 4DBXA 2C3JA 2BFXA 4FK3A 3VQHA 4NW6A 3VULA 2RGPA 1PMVA 4FT7A 4MAOA 1WBPA 3LLAA 2XS0A 4QP8A 3LCSA 4FEUA 4DE4A 3E63A 2Y7JA 4QMTA 4BDKA 1W8CA 4EYMA 4IWOA 1IASA 1WCCA 1UWHA 2EU9A 2VTSA 3FL5A 4R5YA 3RJCA 4CT1A 3OTVA 4DEEA 4IVAA 5BPYA 3LFFA 3V5PA 4EEVA 1YXVA 2JAVA 3VUHA 4U3YA 3WF8A 3D5UA 3EKKA 3MB6A 3C0HA 4XX9A 4OTQA 3EQGA 4HNIA 4RJ3A 3RPVA 3V6RA 2WIHA 4UWCA 4QP1A 3W2OA 4RVKA 5IQGA 4FNZA 2HXQA 2FH9A 4FYOA 5KHWA 2PTKA 3EJ1A 3S3IA 4DH5A 4PL4A 4NM7A 3T8OA 2YJRA 3TV4A 5JEBA 4JBPA 4ZAUA 4CFNA 5CSHA 3U54A 5EW8A 3AC8A 2OH4A 3DZQA 3MVHA 4LL5A 3UBDA 2XA4A 1ZWSA 2NPQA 2OBJA 4O96A 3ORKA 4D0WA 5TOZA 3U6IA 3R7EA 2BZIB 3JUHA 3ZRMA 3DDQA 3CD8A 5H8GA 3TJDA 1KOAA 1I44A 4I23A 5EI8A 4F1MA 2J5FA 4RQKA 3G2FA 1BMKA 3A99A 2VGPA 3KN6A 4H3PA 4XG8A 4K6ZA 5K5NA 4A9RA 1B39A 4AE6A 4KBCA 4KA3A 3CQEA 5BX0A 2XM9A 3NS9A 2XJ0A 4IFCA 5AM6A 5IPJA 2PVFA 3DQXA 4PDOA 5CYIA 3RPYA 2W4JA 4QMOA 4KS8A 4UX9A 2X39A 5IQCA 4AZEA 3PXZA 2G2IA 3NYVA 3FPMA 4PF4A 4RJ8A 4C4EA 4MUQA 3ETAA 3NW5A 5KMNA 5AFVA 2H96A 1PXJA 2J0IA 3L1SA 1W2FA 5LCKA 3ZMMA 5HG5A 1R0PA 3QX4A 2IZRA 3ACJA 2XZSA 5EM6A 5A54A 5GZAA 1SNUA 2CNQA 3UDBA 2X6EA 1JBPE 4ENXA 3FXWA 3EFWA 4WKQA 2XH5A 5EFQA 3VBWA 2GHGA 3ZLYA 2ZDTA