2IO6A

Wee1 kinase complexed with inhibitor pd330961
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
279
structure length
252
Chain Sequence
MKSRYTTEFHELEKIGSSVFKCVKRLDGCIYAIKRSKKPSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Wee1-like protein kinase
publication title Synthesis and structure-activity relationships of N-6 substituted analogues of 9-hydroxy-4-phenylpyrrolo[3,4-c]carbazole-1,3(2H,6H)-diones as inhibitors of Wee1 and Chk1 checkpoint kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 252
sequence length 279
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2io6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2io6A01
2YJRA 3D7ZA 1KOBA 1FGIA 5FEDA 1DM2A 2W17A 3QLFA 4UZDA 4NT4A 4PDPA 1ZYSA 4EOPA 1SVEA 4F1TA 2UUEA 1Z57A 3MVHA 5KNJA 5M53A 3ET7A 1SZMA 4PP9A 4GYGA 3LQ5A 5CENA 4EQUA 4RWIA 2VTTA 4MD8E 5AAFA 1REKA 4IMYA 5ICPA 4FUYA 3PY3A 4U0IA 5T3QA 2R3HA 2X7FA 2FO0A 5IA2A 5D12A 5DT3A 4ITJA 2BAKA 4FKGA 1FQ1B 5FTOA 4KBCA 3TZ7A 5GJDA 5BYLA 5C9CA 1PMVA 1PY5A 5HVYA 1QL6A 1OL2A 2JC6A 3MFTA 4KIOA 3FBVA 5EHOA 4HCUA 5FG8A 5J5TA 1IA8A 4IDTA 4ZZOA 3F9NA 3CQWA 3GXLA 4KSQA 3KEXA 3JPVA 5HO8A 1TQPA 4IAZA 3LXKA 3KK8A 3F5GA 5CEKA 3L9LA 2XIRA 2QHMA 4H3BA 4N70A 4M69B 4DGOA 2R7IA 2ITPA 2PUIA 3RAWA 3QZFA 1LEWA 5EYCA 5D41A 4FOBA 4IDVA 4LQMA 4BKZA 2CJMA 1UNHA 3BHVA 2VTSA 3RBWA 5E8XA 4AW2A 3OROA 3A4OX 4Y5QA 4CRSA 5KMLA 3DPKA 3NEWA 2OJFE 2WTWA 3FZ1A 3MH1A 3R30A 4Z7HA 4KBKA 3BLHA 5EQEA 3L8SA 3A7GA 1JPAA 2V22A 2PZIA 3TL8A 3ZO3A 3ODZX 5CU4A 3EMGA 2WQBA 3E92A 5ANKA 5DVRA 2F4JA 3OW3A 4TYEA 3UQGA 4BTKA 4CT2A 3SOAA 4L8MA 2VO7A 1K9AA 3P4KA 4J8NA 3GCUA 4S31A 5AM6A 2C6LA 5C26A 4OTRA 4XLVA 2EXMA 4XG3A 1YQJA 2IVTA 4PRJA 4B6LA 5FBOA 1WCCA 4AE6A 4CT1A 3PA3A 4EUTA 4OTGA 4CTBA 5CQUA 3E87A 3GT8A 5T68A 3HMIA 5JSMA 4BDBA 3ZRMA 4JX7A 4GW8A 4I3ZA 4BKJA 3NAYA 2W1IA 3Q96A 4XG7A 4IAKA 2E9PA 2GNJA 3R1NA 3TUCA 3ZU7A 3BIZA 3E3BX 2WEVA 3DB8A 4GFMA 5AP4A 2X8DA 4U9AA 5IA5A 1JSUA 3T8OA 4YO6A 3CJGA 4KUJA 3O96A 4QPAA 5AV3A 2JBPA 4G5PA 4RIXA 2OXYA 1GIIA 3EJ1A 4UMUA 2O0UA 4C4EA 3CR0A 4B0GA 5LMKC 1O9UA 3DJ7A 4LYNA 4F99A 4LFIA 3QCQA 2W4KA 4O0YA 4RWLA 4ZTHA 2X7GA 3T3UA 2JEDA 4YJTA 5CASA 5CSPA 2XZSA 3NUSA 3GFWA 3PXFA 5JGBA 3BU6A 4GVJA 2W9ZB 5ETAA 5IPJA 2Y9QA 1IR3A 5M09A 3PXKA 5CEIA 3UG2A 1YI6A 3PIXA 4IB0A 2ZYBA 1XQZA 2HWPA 5DMZA 4AOJA 3VUMA 5FD2A 4D0WA 5LCKA 3ROCA 4TYIA 4X3FB 4A4OA 4RPVA 4UWBA 4DH5A 2RFEA 3BHHA 3IONA 1OM1A 4FTCA 5HG5A 3QL8A 4GUBA 3RKBA 5C27A 4P4CA 3AOXA 2PZPA 2C0IA 2HZNA 4FK3A 4PUZA 4CFWA 1YDSE 2C6DA 5M57A 4QP7A 3VS2A 2F7EE 4ZTMA 4DFBA 3H10A 4I5MA 5C4KA 3LM0A 4WT6A 4HCVA 3R00A 5AV1A 4C58A 3KRWA 2XBAA 3F5UA 4F4PA 5E8VA 3ORZA 4ASEA 3FC2A 1OL1A 4L6QA 4KA3A 3PTGA 1Q3DA 2VWIA 1URWA 5GHVA 4RX5A 5H9BA 1FPUA 4ENXA 2VU3A 3DKOA 2P0CA 2O2UA 2R3NA 4ANSA 4GSBA 4QRCA 3U55A 3Q5IA 4C02A 2G2HA 1J7LA 4HGSA 3UMWA 1OZ1A 3UOHA 4FTLA 2CN5A 3LPBA 4OTWA 4AQCA 5K5XA 1PXMA 3HUCA 3QD4A 3UJGA 5AFVA 3QUPA 3E5AA 3TG1A 3C51A 3HL7A 4ZSEA 3R8LA 4OT6A 4BDKA 3DK3A 4W4YA 4C61A 4EOIA 4O22A 4CFXA 2V0DA 2UZUE 2C68A 3EKKA 1CTPE 1UV5A 5BQ0A 4BGGA 4BDDA 4GUEA 3KL8A 3OXTA 4FGBA 3V5LA 5CQWA 5HORA 3QBNA 2F57A 3RWQA 4FSTA 4RIXB 2YWPA 5BUIA 4DLJA 3BYVA 4I1ZA 4FTOA 3DDQA 4TWNA 5HLPA 4C34A 2JKOA 2VTAA 2WTKB 3FKOA 3ZZEA 4DEAA 3OXIA 5CZHA 5E92A 4MH7A 3TEIA 4C33A 1ZOEA 5IDNA 4O7VA 3HX4A 2GTMA 3PPJA 3DZOA 4P5ZA 5F1ZA 1CKJA 5BMMA 5HCXA 4F7SA 4R78A 4BCHA 3WIGA 3GUBA 4GK2A 4AA0A 4IJPA 4WIHA 4YJPA 2HW6A 4O1PA 1Q8TA 3IPHA 2OICA 4M15A 1CSNA 4FV1A 4PV0A 4BCOA 4GK4A 5HQ0A 4PDSA 2GNHA 3VNTA 1BL6A 1YWRA 2VZ6A 1BI7A 3LFAA 5FTQA 4S34A 2YACA 3CD8A 4FEQA 5LWMA 3QHWA 3RPSA 4ZZMA 2XYUA 3H3CA 3O17A 4RJ4A 4TPTA 4I4EA 5ANJA 4N0SA 1PYXA 3W2OA 3UVRA 3ZOSA 4FZ7A 4BCFA 4USEA 4HNFA 2YIRA 5CSHA 4CZUA 3DNEA 3NYXA 5CEOA 2QOBA 2YLEA 4FT9A 2Z7LA 5CXHA 1NXKA 4RT7A 5HE3A 2OK1A 2BHHA 1Q8YA 1H24A 2Y4PA 3D7TB 3DK7A 2R0UA 4MTAA 4GYIA 3NUXA 2VTIA 4ZEGA 3ZFYA 4EJ7A 4PTEA 3I4BA 3EHAA 5L6WL 2C69A 3ULZA 3K2LA 5IQEA 5AJQA 5LXMA 2B9HA 1YWVA 3DLZA 4CFUA 5IQGA 4YTFA 2YCQA 4FSMA 3EN9A 4CQGA 3R83A 4FKWA 3K5UA 4EWQA 4K1BA 4U3ZA 2WQNA 4MX9A 3TXOA 3WZKA 2DS1A 2W05A 4YLJA 4DEHA 4EHGA 5L4QA 5CI6A 4FC0A 4C4IA 3SW4A 3D83A 3DS6A 3SRVB 4FA2A 1H08A 1Z5MA 3E64A 2VTOA 1OKZA 4JG8A 5HU9A 5L2TA 3HAVA 5D1JA 3PJ1A 4RQKA 4UWYA 3AGLA 5FLFA 3C5UA 2AYPA 4CZYB 3QUDA 1KUTA 3CSVA 2YAKA 2BFYA 4RGJA 4GL9A 4PPCA 5EDRA 4EHZA 3TV7A 3SVVA 4BBFA 4PP7A 2YERA 4RJ3A 2IW8A 3VS5A 2V7OA 1TQIA 3BYOA 4QTEA 2VTLA 1GZ8A 4U80A 2RFNA 2XNBA 2YIQA 3K3JA 1M7NA 3D5WA 4G34A 3UOLA 4AXAA 5LVLA 1G8SA 3TTIA 3GU7A 4F63A 4IVBA 1BUHA 1U59A 3W1FA 2QOCA 3DCVA 4FV2A 1Y57A 1EH4A 3HMMA 4LGHA 4E8AA 2WMVA 3E8EA 3ZSGA 4E7WA 5LVPA 3IQ7A 3DV3A 3PYYA 4W9XA 1FVTA 2BRHA 1H4LA 4K8AA 4O7ZA 5AR7A 5J1WA 3VUGA 3AMBA 4N6YA 1MQBA 5GZ8A 3E93A 3S95A 3TDVA 3DT1A 4KAOA 2QHNA 4IM3A 2C1BA 3SC1A 5I9YA 5JN2A 3M42A 3P08A 4G5JA 2UZEA 5CF8A 2C0TA 3LLTA 2PY3A 3I0OA 3KXGA 4RRVA 4BDEA 2CNQA 2Z02A 2Z7RA 2V62A 1NVQA 3PA5A 3RK7A 5C8NA 4FODA 5AV2A 3U4UA 2QLUA 4CCUA 4CKJA 4YJRA 3DJ6A 4BVUA 5D10A 2QO7A 2O63A 3VS7A 1FVRA 2DYLA 2CGXA 4M67A 5KMNA 4K18A 5H8EA 3ULIA 3ZEWA 2R3FA 4NYEA 3H9RA 3FUPA 3MVMA 4XG2A 4RA5A 1J1CA 3GCPA 2PZ5A 5JMSA 4UMRA 1YXXA 3PJCA 1P4FA 2XNPA 3DBEA 2WGJA 3DBFA 2GPHA 4I22A 1ZMWA 4OTFA 4AOTA 3G0FA 5JGAA 4YZDA 1GOLA 1Z9XA 2BTSA 2P33A 4PTCA 3NGAA 4RWJA 3QQGA 3F2RA 1HOWA 2NRYA 2A27A 1FMKA 3C1XA 3HV4A 4XOYA 3U4WA 2X7OA 4IWDA 4G17A 5EYKA 1UVRA 3PUPA 3QRIA 4L44A 4IVDA 2Z7QA 4KWPA 4YZBA 1YXTA 2H6DA 1M14A 2ACXA 3FZOA 4NCTC 2PVLA 1KWPA 5AP0A 3VN9A 2PMNX 5CSWA 5JK3A 3QKLA 4KRCA 5KMMA 1YDTE 3KMUA 4UYAA 3H0YA 3FYJX 4OBPA 2WIPA 3VS1A 5L6OA 4KKEA 3PDTA 3KN6A 3LZBA 3QTIA 5AM7A 4QP9A 3UODA 4EI4A 2XK3A 4RSSA 5AP3A 4EBWA 4I23A 2IVVA 4D2RA 5IU2A 2YABA 4B7TA 4FTKA 4X3FC 2HIWA 2JDOA 3E8CA 4V05A 4BDIA 5AUTA 4H3PA 3CIKA 4U43A 4I0SA 3DGKA 3ATSA 1NA7A 1OUYA 2I0VA 2R3IA 3BQRA 3GBZA 3M2WA 4FT5A 3D4QA 3NDMA 5G6VA 4TYHA 1OIQA 3QLGA 3W2QA 2XBJA 4NKAA 1GIHA 2BIYA 4H36A 4ZSGA 3MPMA 3N4VA 1PW2A 2QOLA 2C3JA 2PVKA 5HTCA 4F0GA 2VX3A 2GQGA 5F9EA 3ZRLA 3WE4A 1OKVA 1VZOA 4FICA 4YSMA 2J2IB 2YM4A 4IWOA 3Q53A 5LVMA 2NPQA 4GIIA 2AC3A 3QTQA 4UEUA 2GNLA 2UW7A 5K9IA 3UTOA 4E5WA 3GNIB 3H9OA 4XEYA 5CX9A 2JAMA 5LMKA 2B0QA 3QGWA 3VJNA 5AR5A 3R9NA 2C6MA 2BRNA 2J5FA 5JKGA 1R78A 3KULB 2B53A 4FI1A 4GFGA 4E6DA 5CAUA 3MESA 4YZCA 3U54A 4JJRA 1UNLA 4BR3A 2ETKA 3FZTA 3WYYA 3FL5A 5AV4A 3MPAA 2XEZA 4M3QA 2CMWA 3RJCA 1PXPA 2W96B 3MBLA 4ZOGA 5HG7A 3V8SA 1Q4LA 3ELJA 5I9VA 1WBTA 5CSVA 5L2WA 1H1QA 4JBQA 3KRLA 4B8LA 2QOQA 5FUTA 1JVPP 3SV0A 2QKWB 3MTLA 3PP0A 4ZY4A 4IWPA 4C59A 4WHZA 4IZAA 3U8WA 4NM7A 2PUPA 4GG7A 4PMTA 4RJ6A 4CMTA 2YCSA 5I9UA 1O6KA 4O7WA 5HO7A 2J6MA 3F3UA 2XS0A 4E20A 3LJ0A 1SVGA 3H4JA 1HCKA 2HAKA 3GVUA 2YHVA 4XV1A 5HNIX 2PE1A 4FYNA 5G1XA 5IUHA 3E88A 5EKOA 4DG3E 4E5BA 3BWFA 4D28A 3WF7A 4FTRA 2P4IA 4I24A 4M97A 4BZDA 4EOJA 2X6DA 2PVJA 4IW0A 3LFQA 4OTPA 4DBXA 5IQFA 2OF2A 3TKHA 5CI7A 3LMHA 1SM2A 2ITVA 4R3CA 5EYDA 3HV7A 3D5UA 1A9UA 1I09A 3OW4A 4XLIA 4QMQA 4QP6A 2WMSA 4NWMA 2Z2WA 3FE3A 4F1MA 2VWWA 4V01A 4DHFA 1QPJA 2BZKB 3DAEA 4D2VA 2WU6A 4O0WA 4YURA 5ANDA 4AW5A 3BGPA 1YOJA 4FL3A 5K0KA 4TT7A 3RPYA 1UKHA 3R8MA 1JSVA 2PPQA 3RP9A 4LOQA 3DKFA 3ORNA 3PVBA 4EUUA 3VBQA 4IC7A 1T45A 4QMZA 4UV0A 2P55A 4FTJA 3WF6A 2XKCA 5DEWA 4JNWA 3F66A 3O7LB 4TYJA 3HEGA 3L9MA 1YHWA 3KGAA 5A3XA 1LPUA 4D5KA 4YO4A 1L8TA 2VWBA 1U4DA 5IA4A 2PWLA 2YITA 2C6IA 4QMYA 1G8AA 4IIRA 4NM3A 3R01A 2XCKA 4DGNA 3ZLSA 4F65A 2JLDA 3IDPA 4CYJA 4EZ5A 3A8XA 2ITXA 4TL0A 2HZ0A 3CE3A 4ITHA 3UZTA 5E8ZA 4F0FA 5JQ5A 2YAAA 2P2IA 3PIYA 4GCJA 3KF7A 2X81A 1YRPA 3II5A 2XEYA 5DI1A 5E90A 4E6CA 3W18A 3HUBA 1JQHA 3GCSA 2A1AB 3BEAA 3KY2A 3OUNB 4EOSA 3O8PA 5CAQA 4XV9A 3FMLA 4TWCA 3WZDA 3ZFMA 1V0BA 3D14A 2XKEA 3PZHA 3O51A 1Y8YA 3CKWA 3MH3A 2P2HA 3ZC5A 5KX8A 2YJSA 5IUIA 3Q60A 3KFAA 4MVFA 4R77A 4OTQA 4QPSA 3NWWA 1O6YA 5GINE 4YGAA 2E9OA 1KV2A 1S9IA 3QX4A 4F9AA 3P79A 3UNZA 4DAWA 2X6EA 4A4LA 5M4UA 4L67A 2R5TA 3QFVA 1B39A 2QR8A 3KA0A 2BDWA 3MPTA 4KIKA 2VNWA 3UQCA 4UN0C 4EYJA 4NFMA 4M0YA 3OCTA 4H1MA 5M4CA 4ZZNA 4W8EA 1M17A 1Q24A 3ORMA 4ZTQA 1H07A 4ZJIA 4E73A 5A46A 4AU8A 1JAMA 2IZRA 3O7LD 5CEMA 3TUDA 5GZ9A 3BRBA 3LLAA 3OXZA 5EDQA 4IX4A 2HXLA 5IQDA 2O5KA 5FP5A 4W4XA 3ZO2A 4CG9A 3REPA 3TZ8A 4BYIA 4BCIA 3V5PA 4ACCA 3NUNA 3FLQA 3ZCLA 5FTGA 3I7BA 3WZEA 4CMOA 1YI3A 2BIKB 4IE9A 5CALA 3JVRA 4FBXA 5KE0A 1J91A 3CTJA 4DITA 4KS7A 5IUGA 3EL7A 1Q8ZA 4TN6A 4TKSA 4IVCA 2WB8A 4H39A 3QYZA 1OKYA 4EQMA 2ONLC 4HNIA 2PVFA 2OI4X 3GENA 3LCSA 3ROYA 1NT2A 3QQUA 2BMCA 2BZHB 4XV3A 5AIRA 4APCA 1V1KA 3A62A 4XRJA 3KK9A 4LRJA 5K3YA 4ARKA 4EHVA 1BI8A 2OLCA 1DAYA 1ZARA 3L9PA 5KUPA 5HO6A 2QOOA 3U9CA 4QMUA 3HYHA 4XOZA 1KE9A 4M69A 4RWKA 1XHAA 3HA6A 4IZ7A 3Q4TA 4LM5A 4YNOA 4G3EA 4C0TA 4EORA 5KMKA 4F9YA 4R1YA 5AAGA 4YZ9A 4ALWA 3NW6A 4HVGA 3KREA 3PLSA 4EZ3A 2GSFA 4U79A 3W2RA 5IISA 3SW7A 4O81A 3QHRA 3GCVA 3OWKA 3NR9A 1H8FA 3QWJA 4IX3A 3T9IA 3VS6A 2ZM4A 4FG9A 4RC3A 4AN9A 4C4FA 5K4JA 3KMMA 5KBRA 2VWZA 4XS2A 3T3VA 2W0JA 4FV0A 5HD4A 1H0WA 3MFRA 3QD0A 5FEEA 5CEPA 2VO3A 3A99A 4QTBA 3Q5ZA 3MFUA 4OTDA 4EHEA 2AUHA 3KRRA 5DH3A 4YU2A 5M4IA 1HCLA 2R9SA 4A9SA 1WBPA 3WBLA 3ERKA 3CC6A 2XF0A 5I9WA 2R3GA 5HE0A 1Q62A 2OIQA 5J9YA 3SG9A 1YKRA 5A4TA 4EC8A 4I94A 4FKJA 5J5SA 2VTRA 3FZPA 5K5NA 2HELA 4GK3A 4IHPA 4D58A 1OIYA 3DY7A 3F3WA 1BLXA 4HPUE 4PTGA 2BPMA 4AZEA 2V55A 4I20A 3Q9XA 4IACA 2OW3A 4P2KA 4WSYA 1JLUE 3AD6A 3EZRA 2CKQA 3HNGA 2IN6A 1RW8A 3COMA 4GU9A 3ZRKA 4FYOA 1XH4A 3CGOA 4DINA 3KRJA 2XKFA 4UMQA 3ZFXA 2UZVA 4NCTA 4DGLC 5KKRC 2W9FB 2HY0A 4FOCA 4S33A 4R5YA 5DE2A 4BTMA 3BCEA 5HHWA 1OIRA 1Q3WA 1ZRZA 1LUFA 1H01A 2JD5A 4KS8A 4DG0E 2QO9A 3OCSA 4R7BA 2BUJA 3KMWA 3F61A 4XH6A 2IW9A 4BDFA 3ZEPA 3F7ZA 5CU6A 3R7YA 2EB2A 4XUFA 4C62A 3NNXA 3BGZA 3NCZA 1OPLA 3N4UA 4KSPA 4X3FA 3E3PA 2XH5A 4YC3A 2OH0E 4JVGA 4CNHA 2C5NA 1PXKA 3FQHA 4FV3A 4X21A 4YC8A 3WF8A 3NIEA 4MNFA 4UX9A 3VO3A 2E2BA 3LFCA 2VN9A 3IK3A 3NVMB 3K54A 1UWHA 4O21A 2F9GA 3NCGA 2JITA 3P7CA 4RQVA 4E4MA 3MW1A 2BRBA 3DZQA 3LJ1A 4U7ZA 4BDGA 3OCBA 3VULA 1YXSA 3Q6UA 3LCDA 2UW6A 3FPMA 1OIUA 4R5SA 4CKRA 5HBJA 2ZB1A 3EFWA 3L8PA 1OVEA 4PDOA 3Q2JA 3HA8A 3PXYA 4WNPA 3DQWA 3W16A 4W4VA 3QKKA 5IEVA 3HZTA 4ASZA 3R1QA 4IBMA 1FMOE 3CPBA 1FINA 4FKOA 5CU3A 4DEEA 2R64A 3FI4A 4HZRA 4ZSJA 5KZIA 3SAYA 4FV7A 4EOMA 1GNGA 2YFXA 2ZDTA 4X2FA 1TVOA 1YXVA 5EFQA 3DKCA 4EK8A 3ODYX 2FUMA 3EQRA 2IPXA 4MBJA 2BKKA 3P78A 4ZXTA 2PU8A 2HYYA 5D7AA 4BICA 4ALUA 3D5VA 4D4SA 2OWBA 2C47A 4LOPA 5EYMA 5FM3A 2FSTX 3Q2MA 1JOWB 5DT0A 4K77A 3VW6A 3KB7A 3PXZA 5HI2A 4OR5A 4IC8A 1PMNA 2HW7A 4YBKA 5IQBA 1W83A 2F7XE 1B6CB 4G1WA 2O3PA 3C7QA 2IWIA 4UMPA 4AT3A 3FJQE 3MIYA 4BGHA 3PSCA 3QQJA 3RNIA 3W55A 4NFNA 4W4WA 2HWOA 4NM0A 3RWPA 2CGVA 5AP5A 2WXVA 3GP0A 4IB1A 3A60A 2UZBA 4H1JA 4USDA 2GTNA 3VF8A 5IEXA 4EK4A 2CPKE 5EHYA 1WBSA 2UW0A 2F7ZE 2QOHA 3I81A 5ANOA 4ZLZA 2UZOA 2CKEA 3VQHA 4OLIA 3NUAA 1XBBA 2H8HA 2VNYA 4GT3A 2ZMDA 2IZSA 3GQIA 4PL5A 5K0XA 5B7VA 4PF4A 1FBNA 3VBYA 1OPJA 2RG6A 4QMPA 4Z55A 3IW4A 4ZLOA 4QQ5A 3QA8A 4BIBA 1P2AA 2C1AA 3O8TA 3UGCA 3VC4A 3U9NA 3UO6A 3SHEA 3LQ8A 3HV6A 1FVVA 2QC6A 2YLFA 3VHKA 4MK0A 5EOBA 4F7NA 4H58A 1APME 3R7EA 3TI1A 2PUNA 2X8EA 4BIEA 2R3QA 4FEUA 2PUUA 2OH4A 3D7TA 1YWNA 3NS9A 4BCPA 4ZSLA 5A6NA 5J9ZA 1WVWA 3AMYA 4FZFB 4KIQA 4UZHA 4WRSA 1XKKA 2BILB 5HU3A 4JG7A 5L3AA 4TWPA 3QALE 4DA5A 5L2IA 1VJYA 2BAQA 4XP3A 4BY9E 4CG8A 3LXPA 4UXLA 5AA8A 4CSVA 4QMTA 4RLKA 5BPYA 4WNOA 3TZ9A 3T9TA 2H96A 2W1FA 5E1EA 4C4JA 2UW9A 5M51A 1JWHA 3BBWA 5A54A 4H05A 3MVLA 4N4SA 4U44A 2X9EA 5I4NA 4MXCA 4RVTA 3HMOA 3D0EA 4Y5HA 1KE6A 5FM2A 3W33A 3PPKA 5I3RA 2VGOA 3MV5A 4NIFB 3KXHA 3SRVA 2I6LA 3WF5A 4TTHB 3ZLWA 4BZNA 4O2ZA 3COIA 3AC5A 4IZYA 4PPBA 4BTFA 5GIOE 1UA2A 1ERKA 4U45A 3PG3A 3SQQA 4QMXA 5LVNA 2RKUA 3W10A 2FYSA 1Y6AA 2XKDA 3AQVA 5E8TA 3UIMA 2GNFA 4U81A 4YP8A 4APPA 2XA4A 2PVYA 3BX5A 3R6XA 2YZLA 4GJ2A 1GY3A 3Q4UA 1R1WA 1F5QA 3LFSA 5TE0A 4BZOA 4CVAA 3A4PA 3FMJA 4ZJJA 1OBDA 4GMYA 4K0YA 4O6EA 1WFCA 3ZM9A 4FK6A 4D0XA 4G2FA 1WBVA 2C3LA 3BHTA 3UE4A 3TNIA 3PWDA 3R7UA 1WBOA 4C4HA 2QO2A 1KE7A 4AG8A 4AACA 3LMGA 5TR6A 2YDKA 4FG8A 5JRSA 2PHKA 1OGUA 1DI9A 3NNVA 4KINA 3RALA 2VRXA 3SA0A 1IEPA 4U40A 3ALNA 3ZUTA 2A4LA 3SXFA 5KMJA 3FI8A 3HV3A 3QGYA 5B2LA 4WUNA 2VTQA 3QQLA 3WOWA 4BC6A 4CQEA 5CANA 1URCA 1H27A 4NH1A 4F9BA 1NVSA 3RCDA 5CU2A 1VEBA 4NJ3A 3BU5A 4IH8A 3TN8A 4RIOA 3IW6A 3R73A 5J8IA 2FSOX 3DTWA 1CMKE 4NSTA 5FQDC 5CF4A 5L8LA 4JRVA 3UO4A 4B9DA 2XNMA 5E7RA 3BZ3A 5KO1A 1SNXA 2NRUA 4G3GA 2O8YA 2ITQA 5F20A 4WSQA 1OL7A 3Q32A 5A14A 3P5KA 4M13A 4FKTA 2GMXA 4FTQA 1XBAA 5FEQA 2V5QA 3E63A 4FKPA 3KXMA 2R7BA 4QT1A 5JFSA 2CGUA 2WMAA 4E1ZA 5KBQA 3AD4A 3VUTA 3CCNA 5EI8A 4CFMA 4V04A 2WHBA 3M1SA 1H00A 3ZSIA 4D4RA 1UWJA 4FV8A 4KB8A 2I1MA 3ZONA 3H0ZA 3A2CA 4OUCA 4A7CA 4F64A 3N51A 5HCZA 1JKKA 2QOKA 1MRVA 3QQFA 4HOKA 4EQCA 4F08A 2WMQA 4QP8A 3QXOA 4C4GA 2G1TA 3KC3A 5KMIA 5EQYA 3QX2A 3LHJA 3KU2A 4MQ2A 4UXQA 3S2PA 4DFLA 4O0RA 5IKWA 2B9JA 2BZIB 3RNYA 5L8KA 3A7HA 4ZTNA 3CY2A 3MA3A 4ZY5A 4F09A 3PLAE 4R1VA 3H30A 4LRKA 4BB4A 4NL0A 4I41A 3LAUA 3FMDA 2W1ZA 4BHNA 3BYMA 2PVHA 5HTBA 2WOTA 4IVAA 5TO8A 4FSRA 1GAGA 4TYGA 5AUYA 4ANOA 2QD9A 3JYAA 4JBVA 1M7QA 2W7XA 4J96A 4K11A 4R6VA 4TNDA 1U54B 4CFFA 4FEXA 1PJKA 2GS6A 4IB3A 1PMEA 1ZMVA 5DRBA 3DNDA 4FKVA 5DYJA 4O7TA 3RK5A 5IQCA 5IG1A 1DAWA 5CVFA 3V8WA 5BVOA 4XBUA 3V3VA 3WE8A 4GT5A 3EYHA 3QTUA 3R8PA 1M2RA 4E6QA 4FL2A 4FKQA 3FXXA 3I6UA 4C3RA 3MYGA 3U87A 2WOUA 1P4OA 2O64A 4XYFA 5HLWA 5FRIA 4DH3A 5KHWA 2WNTA 3DXPA 4O7NA 5DN3A 3BLQA 2NP8A 3MGYA 4YR8A 4JT3A 1PXIA 4F0IA 4BDJA 2B9IA 1J1BA 5E91A 5E8UA 4ERKA 3D15A 3JXWA 3S0OA 4XG4A 2G01A 3MI9A 2O65A 3OBJA 4MNEA 4WNKA 2ITWA 4YJVA 5C03A 3UVQA 4AZFA 3QD3A 2IZUA 4DG2E 2VGPA 4FZDB 4I21A 3FY2A 2ITOA 2GDOA 3HV5A 3C4CA 3LCTA 3KULA 5KCVA 4ZMEA 2PL0A 4C37A 5HIEA 4EH2A 4BDAA 4D1ZA 2ERKA 4RMZA 3SX9A 1RDQE 2F49A 3ETAA 3IDCA 3LJ2A 4YNEA 3I7CA 4QP4A 2JDVA 1GZNA 3MJ1A 4S32A 4W8DA 2X4ZA 4Y83A 5CXZA 3HRFA 3NYOA 4JDHA 4EKKA 1O6LA 3UPZA 4Q2AA 4PWNA 3OWLA 3PG1A 4RVLA 3CP9A 3AD5A 2B7AA 4AOIA 4D5HA 1PYEA 1Q41A 3DK6A 3IDBA 3OP5A 3Q4CA 4NUSA 5BVDA 3PVUA 4HYSA 4J99A 4WG3A 3UIXA 3C50A 3GGFA 2WMXA 3GEQA 3EQBA 3KF4A 5CS6A 4AZSA 1ND4A 2GS2A 4L46A 3H9FA 3I60A 2OJ9A 4R3PA 4A9RA 4DCAA 4BF2A 4D2SA 3EQIA 4C8BA 3QRKA 2VUWA 5M4FA 3EN4A 3G6GA 5ETCA 2VWXA 5M07A 4RBLA 4ANBA 3Q4ZA 3KVWA 4L53A 4AA5A 4FV5A 1YHVA 2ZV7A 4JIKA 4F1OA 3LVPA 4O2PA 2YIWA 3U6JA 5LJJA 1OL6A 1W0XC 3R63A 1W8CA 4UY9A 5CYIA 3ID6C 1OUKA 3ACKA 4I5HA 4Y8DA 4YSJA 4RJ7A 4CGAA 3ZM4A 2WQOA 3ZH8A 1ZYDA 2YA9A 4QTDA 3JUHA 3CS9A 3NUYA 3TCPA 4F6UA 3ITZA 3MA6A 4J95A 2WELA 1KE8A 3DXNA 5AX9A 4MBLA 4MAOA 3CPCA 4ANLA 3QTSA 4ITIA 3NIZA 2LGCA 4GS6A 3QA0A 4QMNA 5J7HA 4U3YA 5LMBA 1OB3A 1GJOA 2OZAB 4G16A 2ERZE 5HNBA 3E62A 4BKYA 3VAPA 4M68A 1UU8A 5HE2A 5FXRA 1H25A 4Z3VA 2W4OA 4I5PA 4RX7A 1XH8A 2JDRA 3R1YA 3G0EA 3MH0A 5CY3A 4BWPA 2YDIA 4FSZA 4RIYB 4ZS4A 2DUVA 4LMNA 5EK7A 3C4XA 4L01A 5CT0A 3R04A 3C9WA 4HGTA 5HICA 2A0CX 3IG7A 5JFXA 2YWVA 3JVSA 4QMWA 3PP1A 3BPRA 4M66A 5EH0A 4U5JA 4P90A 3V04A 4AN3A 4AGUA 4MNEB 4MWIA 4WKQA 5HTIA 2ZM1A 2XM9A 2OJIA 3ZLYA 2XNNA 1LP4A 4LGDA 2JIUA 2XB7A 1OECA 4BI2A 3EOCA 3F69A 4GIHA 2WMUA 3TWJA 5KKRB 5AADA 4UMTA 3IS5A 1OMWA 4L3JA 3JY0A 2E9UA 3BYSA 5ETFA 3UOKA 3DBCA 4IX6A 4LL0A 3R9RA 5CNNA 3UP2A 3G9NA 4QYYA 4ORKA 4IM2A 5B2KA 2BDFA 2E9NA 4DEDA 4RC4A 2OJJA 2BVAA 3OWPA 3HVCA 3EH9A 5IF1A 1CKPA 3FLSA 3LXNA 3QRJA 2W1GA 3DDPA 4QMLA 1T46A 3R71A 4GVAA 3I79A 2FB8A 2WAJA 5AP2A 1WBNA 5CLPA 3FMHA 4L42A 4ONAA 4M0ZA 2W99B 1QPDA 3R1SA 4R7HA 2XNGA 5D9HA 3NPCA 2OIBA 3OY3A 4FVRA 2UVZA 3RZBA 1M52A 4ACHA 4UALA 1J3HA 4PNIA 3CTHA 3UIUA 3PRIA 1JSTA 5J7BA 1Q8WA 4O6LA 5DLSA 4D1SA 3MDYA 1K3AA 5JFVA 3DBDA 3PZEA 5I9ZA 2WTCA 2PMLX 3BYUA 1L3RE 5AA9A 2QVSE 5H2UA 3RINA 2BFXA 4BDHA 4BTJA 4U42A 1YOLA 3RTPA 3QZHA 4ASDA 2PYWA 4M84A 2J0JA 2C3IB 4FGRA 5AMNA 2JAVA 3QYWA 3EYGA 4U41A 1GIJA 4JDKA 4L45A 4CZTA 2P3GX 2CKOA 4FV9A 4CV8A 3FMNA 4J97A 4V0GB 1REJA 5D11A 5CAVA 4BBMA 3OOMA 3DOGA 5K4IA 1GZOA 3GB2A 2J0IA 3BWJA 2OO8X 2UZDA 3TJCA 4I4FA 3OBGA 2C0OA 1WVYA 4E5AX 4IAAA 1W82A 1OKWA 2Q0BA 4D9TA 3Q9WA 5BYYA 3B2TA 3LFDA 3WYXA 3IGOA 4IADA 4E26A 3EIDA 3BQCA 3VF9A 4JI9A 1G3NA 4KIPA 4YUQA 3OFMA 1CDKA 4O0VA 4JXFA 2F2CB 3MY1A 4G3CA 4MXYA 4BHZA 5E1SA 3RAIA 4X2JA 3O71A 4DGMA 3VS3A 3R9DA 3PJ3A 4DTAA 4KABA 3TIZA 4ZAUA 4LV5A 4EKLA 1GZKA 4JDIA 4O84A 3PRFA 1Q61A 2JDTA 4JL9A 4BCKA 4CCBA 5LWNA 5IA0A 4IWQA 3E8NA 4WNMA 5I5ZA 4WO5A 3FQEA 1XH9A 3V01A 3HAMA 1XO2B 2GFCA 4DN5A 3VQUA 4QP1A 5J95A 4CLJA 3NRMA 3MH2A 3VBTA 1RQQA 5J1VA 3EQGA 3LQ3A 4QPMA 3S3IA 3FYKX 4DT9A 3OZ6A 4BI0A 2IVUA 3MJ2A 4AW0A 2UZWE 2WU7A 1WMKA 2G15A 3TNHA 4GT4A 4HVHA 3QQKA 4HVSA 4PMMA 5DPVA 4O7SA 5E8SA 3RMFA 4GKHA 4O7YA 1FGKA 4IQ6A 4XJ0A 4EH4A 3UNKA 3LFNA 5T6KA 1A06A 4OGRA 4I6FA 5DR9A 1AQ1A 4QTAA 3UNJA 4C2WA 4CKIA 1AD5A 3HDMA 1Q5KA 2VWVA 1TKIA 3RCJA 4DEGA 2J50A 1U5RA 4AZVA 2JBOA 3AG9A 3PIZA 3R7GA 3TIYA 3C4WA 1UNGA 5FXSA 3VHEA 3ZMMA 2Y8OA 1Q99A 2WQEA 2CDZA 4JBOA 2VO6A 4JG6A 4Q5HA 3V5JA 3RK9A 1IAHA 4QQTA 3BU3A 4K6ZA 4F70A 4HZSA 3GU5A 3SGCA 4YTCA 5IMXA 1VR2A 4CMUA 2UVYA 4JQEA 2WPAA 1KE5A 1E1VA 4UWCA 3WI6A 4XG6A 4EEVA 2W5AA 4EK5A 2BDJA 4O27B 3OTUA 3EN6A 4LV8A 5AR3A 3SXSA 4I6QA 5EHLA 3FC1X 3EQFA 4FTUA 4EH5A 3QD2B 1OITA 3RM7A 4RVKA 5M08A 4BFMA 4X2GA 3R9OA 2C6EA 3EB0A 2X9FA 3TV4A 1STCE 4XRLA 3KRXA 5ANIA 5HOAA 1BMKA 3DLSA 5JT2A 1MUOA 4FIHA 4DC2A 3PE2A 2QG7A 3NSZA 4ZTSA 3BV3A 4ASXA 4K33A 4AS0A 1IAJA 4LUDA 3IW5A 4G9CA 4IM0A 4GV1A 4K2RA 4UYNA 4XHKB 3FMKA 3R02A 3ZO1A 3I6WA 4AN2A 1R0EA 3OT8A 3L8VA 3W32A 2B52A 4JRNA 4DBNA 2CLXA 3D2KA 3G51A 3OUKA 4RZVA 3EFLA 4X6QC 4D2TA 3LFEA 2I7QA 1DS5A 5FDPA 3EN5A 4FSQA 3ZTXA 2ITUA 3NW5A 3NNUA 2ZVAA 3DFCB 1LEZA 3C0GA 3C5IA 4XMOA 2YN8A 4WG5A 1ZYLA 4O0SA 2X1NA 3DXQA 4RVMA 3ZXTA 5LARA 4Q9ZA 5D7VA 3ALOA 3EWHA 2GS7A 2PTKA 4C2VA 3DBQA 3FDNA 4HCTA 3K3IA 4PPAA 4L7SA 3SDJA 1BYGA 1PHKA 5EI2A 4HVIA 5JRQA 4JIAA 1YXUA 3TDWA 4MWHA 2ITZA 4YJSA 4AWIA 4C38A 3WILA 2EWAA 4S2ZA 2AC5A 2PMOX 1W84A 3NW7A 4TW9A 2XIZA 4MF1A 5HEZA 4D9UA 3UYTA 4GG5A 5I3OA 5IQAA 3P86A 1ZY5A 5H3QA 4A4XA 5CNOA 4EZ7A 4C35A 1P5EA 4PL3A 4BN1A 2QR7A 4BWKA 5CT7A 1I44A 2YCRA 3OC1A 5BVEA 3R22A 3PFQA 2PVRA 4BCGA 3FHRA 4MXZA 3TTJA 4XP2A 3JY9A 4I92A 1ZYJA 3HP2A 3U6IA 4BDCA 5AR2A 4DTKA 4Z16A 1NW1A 3Q9YA 5DA3A 3P7BA 4FIJA 4G3FA 3OHTA 2EB3A 4LUEA 2IW6A 2JFMA 2KTYA 2YCFA 4O91A 4GFOA 3R7VA 2FVDA 4RJ5A 3RAKA 3D2IA 5DNRA 5C4LA 3F7WA 2RGPA 5IA1A 4L3PA 3I1AA 3QTXA 4WBOA 4YJUA 2OXDA 5BVWA 4E4LA 3FLYA 3OEFX 3PY1A 4Y46A 2WTIA 4PMPA 4EH7A 3L9NA 3LCKA 2ZV9A 2C5YA 3LE6A 5A4CA 4WUAA 5AUXA 3R21A 4J7BA 3UIBA 4OAUC 4FV6A 3N9XA 2XJ1A 2RFDA 3D5XA 3U51A 3ZBXA 4O83A 4I93A 2H9VA 3FV8A 3A61A 2ZOQA 3GI3A 2G2IA 2JIVA 2CCHA 4LRMA 4JQ7A 2Y4IB 1Y6BA 3QZIA 4P5QA 3VJOA 2UZLA 3ORXA 4NJDA 4F9WA 3AC1A 2PZRA 4FTMA 4JAJA 3S4QA 1R0PA 2QCSA 3BKBA 1ATPE 4MXAA 3N4TA 3QXPA 4MQ1A 4FKIA 3KQ7A 4Y73A 2JDSA 5EOLA 3OS3A 3OG7A 5CTPA 5TKDA 3G6HA 4EH3A 2I0HA 2OU7A 5B0XA 3LKMA 3EFKA 4O86A 5E8YA 3PVGA 3ZUUA 4C57A 3NYVA 3O8UA 2NO3A 4ACDA 4RIWB 4BCNA 3O23A 5EM7A 5BVNA 5AR4A 3ZDUA 5HZNA 2ZV2A 3RPRA 2PVMA 3B2WA 2RSVA 4HGEA 4FR4A 4USFA 4NIFA 4DF3A 4FVQA 4E6AA 2HK5A 3DJ5A 4J1RA 4GRBA 5DR6A 3F3ZA 4QYHA 1XR1A 3GU8A 4BGQA 5FGKA 5HNGA 4XCUA 4IB5A 2QODA 5HIBA 3TUBA 4E4XA 4FTAA 4AGWA 4HYUA 4U8ZA 2ZV8A 5AAEA 2Z60A 1YDRE 4IANA 4JDJA 4PMSA 4G6OA 2OFVA 4G6NA 4QP2A 3DAJA 2EU9A 3F5XA 4X2KA 4XX9A 1NVRA 2C3KA 5ETIA 5FBNC 3P0MA 4IAFA 3VUKA 5HKMA 4A9UA 4B4LA 4IFCA 1PRYA 2IG7A 3OEZA 4XG9A 1M2PA 3FLNC 4JBPA 1ZLTA 1PKGA 1X8BA 2Y6MA 4GH2A 4EK6A 4R8QA 3LIJA 4RFZA 1H28A 2R3OA 3RPOA 3AC3A 2B4SB 3GC8A 4FZ6A 4QD6A 5DFPA 3OD6X 3FI3A 1ZMUA 4ZS0A 2X4FA 5AR8A 3QKMA 5ACBC 4J52A 5DIAA 4YJNA 3KXXA 3QTWA 3UPXA 2WMRA 5CU0A 3ENHA 4JOAA 3RPVA 2GNIA 2OFUA 4AFJA 2R2PA 3ORIA 2GCDA 3GC9A 4WRGA 3WF9A 5CEQA 4C3PA 3G5DA 3MSSA 3UOJA 3UZRA 3AXWA 4I6BA 2X2KA 4LOOA 4NU1A 5I9XA 4KNBA 1SMHA 3EQPA 3NX8A 4QYEA 5IH5A 4DT8A 4DFZE 5IMEA 2CKPA 3PJ8A 3NNWA 3F2AA 5GZAA 1UKIA 3CLYA 2C5XA 4ZTLA 5BX0A 2WD1A 3R2YA 3ZC6A 1CKIA 5ANEA 4OT5A 5JGDA 2R4BA 3OMVA 2G9XA 2J0MB 2X39A 5HLNA 2W1HA 3C0HA 3ZO4A 4YPDA 3BGQA 2QOFA 3HMPA 3NUPA 3Q6WA 4DGGA 4JR3A 2A2AA 4MKCA 1H26A 1PF8A 4FTNA 5LQFA 1AGWA 2VX1A 2PSQA 4LG4A 1YHSA 2XRWA 4IJ9A 4AUAA 3NAXA 3FLZA 4OAVB 2B54A 2YISA 2E9VA 4ZMFA 4EOQA 4QMMA 3W2PA 1WAKA 1M2QA 4PNKA 3M11A 5C8MA 4FMQA 4HYIA 3TKUA 5A4EA 3ZDIA 3ANQA 3ORPA 4DFYA 4EWHA 1Y91A 2R3LA 3OT3A 4EOKA 3RVGA 3LFFA 2X0GA 1Q97A 4L68A 4YC6A 3ORTA 5AWMA 3FMEA 3FY0A 4GKIA 4EH8A 4JX3A 4QMVA 5EI6A 2LAVA 4BBEA 4L52A 2HXQA 2OF4A 3EQHA 3OF0A 3QC9A 5AP6A 2WTJA 5M06A 2W4JA 2XJ2A 3QF9A 5GJGA 4E3CA 3ZBFA 2ZAZA 1XBCA 3UP7A 2IVSA 5IQHA 3DKGA 3KN5A 3GC7A 4RFMA 2WZJA 1U54A 2Y6OA 3R9HA 3RHXA 3NZ0A 2ETMA 3ANRA 2QONA 3O0GA 4AX8A 4BI1A 4EYMA 5IQIA 4HYHA 4DEBA 4CLIA 1XH5A 4II5A 3QCYA 5FXQA 5AEPA 2JKQA 3OOGA 5GIPE 3G90X 3HGKA 4DFNA 1JNKA 3QCSA 4G3DA 4GEOA 3IO7A 4X2NA 3WZUA 4EJNA 5HCYA 3CGFA 4IFGA 5JZNA 4D2PA 4FT3A 3QC4A 4CRLA 2JKKA 4AE9A 4WBBB 4ENYA 1IASA 2J0KA 4XP0A 1SYKA 4IAIA 4JQ8A 4BL1A 2XNEA 2XUUA 3VUDA 4DH1A 4EONA 4FSNA 3COHA 3GOKA 2WTDA 3R2BA 3CXWA 2GHLA 4Y85A 2BROA 2VWUA 1E1XA 4QQCA 3UZPA 4JR7A 5E9EA 3G2FA 3LOKA 3MWUA 5BVFA 1KV1A 3SOCA 5A9UA 4ZSAA 2I0EA 5L8JA 3GOPA 3JR1A 5EW9A 3SXRA 3VBXA 4FX3A 4HJOA 4RG0A 1KOAA 4FVPA 3ACJA 4B8MA 4I0TA 2RIOA 2GQSA 3F6XA 2ZM3A 3R8VA 3BHUA 4M12A 2R3RA 5KZ0A 4BWXA 5C1QB 5J9LA 3G15A 1MRYA 4CTCA 2FGIA 3MFSA 2CCIA 4R7IA 3VWAA 5EM5A 3ATTA 5HVKA 2ONLA 4J98A 5I0BA 4IX5A 4BRXA 3PXRA 4G9RA 4XNEA 5DG5A 5EM8A 4D2WA 4EL9A 4FSWA 4G6LA 3ZZWA 4QMOA 3VRZA 3EKNA 4OW8A 4QMSA 2XIKA 2Q83A 4O0UA 5HBHA 3UBDA 3FHIA 5ITAA 1R3CA 2WFYA 3GCQA 3Q9ZA 4M14A 1A48A 3Q04A 3AT4A 5JQ8A 2J5EA 4BCQA 4FSYA 4ANNA 3FXZA 4OTIA 4DYMA 4E4NA 1SNUA 3C4ZA 2R3JA 3VIDA 2R0IA 2Y7JA 2OSCA 3HDNA 3CJFA 3QRUA 5AP1A 5GNKA 1PXJA 2ZMCA 3TKIA 2RF9A 2WMBA 1QPCA 5M56A 3S1HA 3QRTA 2PVNA 5EW3A 3TV6A 3FZRA 3LW0A 3BI6A 3OY1A 3IECA 4XV2A 3P23A 4U6RA 4Q5EA 3DFAA 3KVXA 4N6ZA 2J7TA 4NM5A 4JLCA 4NW5A 2VO0A 2J90A 4OBQA 5M55A 2GNGA 3IW8A 4RLLA 3ZLXA 3UVPA 2W1CA 4XG8A 3HP5A 2YEXA 2OZAA 4NKSA 4CEGA 4CFNA 3SG8A 2ITYA 2YM6A 3TZMA 3UMXA 4FT7A 1ZYCA 4AGDA 4DH7A 3MY0A 3RI1A 4DFXE 2XK9A 5A6OA 3OTVA 4AA4A 1R39A 2Y4IC 4FIFA 4MXXA 5EQPA 4TWOA 4FSUA 4FIIA 3AC2A 3W8QA 3VRYA 4RIYA 1E9HA 4L9IA 5CF5A 1PXLA 2XIXA 4A9YA 5DHJA 1BKXA 4K9YA 2BZJA 4FF8A 3VUIA 2VTMA 2OJGA 3DAKA 3NLBA 2F2UA 2C6OA 4O0XA 4L7FA 4X0MA 4ZJVA 4N57A 1W7HA 3AGMA 2XVDA 4P7EA 1FOTA 4IEBA 2W1DA 3DU8A 3PSBA 3QQHA 4PL4A 3AC8A 4M8TA 1VYWA 3MN3A 3COKA 4CYIA 3HECA 5BVKA 3CTQA 3VBVA 1IRKA 3V5QA 3PE1A 4AP7A 4D4YA 3KCFA 4YMJA 2I0YA 2OKRA 4MYGA 1F3MC 5H8BA 5J87A 3PSDA 3WZJA 3F3TA 3KKVA 4FTTA 4MEDA 2G2FA 3I5ZA 5HG9A 3UYSA 1Q8UA 5AV0A 2XYNA 4C7TA 5DRDA 2VAGA 2YIYA 2XIYA 5CZIA 5E8WA 3TM0A 1MQ4A 3FPQA 2IZTA 3MVJA 2PE2A 5TT7A 2GQRA 5H8GA 4I5CA 3TNWA 2UZTA 3F2NA 4HGLA 4TNBA 4L00A 3TACA 3JS2A 1WZYA 4QNYA 5EG3A 4O38A 4AW1A 4AZWA 4MHAA 1NY3A 1H1RA 2X2LA 2CNUA 4OBOA 3HRBA 3QUEA 4H3QA 5DEYA 4NEUA 4EC9A 3QAME 3FKLA 3FZSA 4NK9A 3TNQB 4C36A 3OVVA 2C6KA 4D55A 3VVHA 4YTHA 2X8IA 3FKNA 4NZWB 2XP2A 2HCKA 4YTIA 4EK3A 2UVXA 4FEWA 1ZZ2A 5C8KA 2EVAA 1WVXA 3BE2A 3PJ2A 3V5WA 3ORKA 1ZWSA 5DOSA 1V0PA 4X3JA 4O1OA 4TY1A 3NYNA 4AZTA 2WMWA 5LMAA 4EOLA 3KXZA 4CXAA 3HRCA 2A19B 4PDYA 3UDBA 5EDPA 3LMIA 4YBJA 4O96A 5LOHA 4KBAA 3THBA 2WQMA 1DI8A 3QWKA 5JZJA 3R28A 1OBGA 3NVKI 4YLLA 4LI5A 1QCFA 3HKOA 3P1AA 4D4VA 3FSKA 1P14A 3V51A 3IGGA 4V0GA 3FSFA 3QTRA 4FL1A 4O7LA 4YHJA 4YHFA 4NW6A 2QNJA 2WIHA 3LCOA 3EFJA 2XK4A 5AP7A 5IDPA 3DA6A 4MCVA 4U97A 4WOVA 4A9TA 4LL5A 3C13A 4TRLA 1K2PA 4QQJA 3RZFA 5M44A 1PMUA 3V6RA 1JBPE 1UU9A 3LXLA 3RHKA 3W2SA 3UO5A 4MD9E 2BAJA 5BNJA 3UQFA 3G9LX 3UG1A 3WIKA 4ALVA 3BLRA 2BRGA 4X7QA 3V5TA 1OPKA 3KCKA 4S30A 2FSMX 4X6RA 5IZFA 4M7IA 3R8ZA 3AT2A 3TJDA 3B8QA 2V7AA 3P7AA 2OZOA 1IG1A 1CM8A 2C6TA 1YOMA 2XK6A 3EN7A 3CBLA 3BBTB 5DT4A 5AUZA 2UW8A 4NTSA 5HE1A 2QG5A 3FLWA 5CVGA 3ZSHA 2XJ0A 3G33A 4FTIA 1PKDA 2GU8A 2R3KA 5HX8A 5EM6A 3ZYAA 4ZTRA 4FV4A 2W1EA 3W2CA 3CQEA 4MBIA 2JGZA 2RG5A 1XH6A 4TZRA 5E4HA 5CSXA 2ITNA 2CN8A 3FXWA 4OTHA 3S00A 3R0TA 1XWSA 5FWKK 4FNWA 2YIXA 1TQMA 1OL5A 1PXOA 2C4GA 3WARA 5CWZA 4NTTA 1VYZA 2R3PA 3ORLA 2VTPA 2WKMA 3K5VA 3VS0A 2C30A 4O82A 2ZJWA 2OGVA 3ZUVA 3PVWA 5IH4A 3OCGA 4ANQA 2CLQA 5HD7A 5L2QA 3FMMA 4FNYA 5A4LA 5BUJA 5JH6A 1YI4A 2J51A 3C4EA 5HGIA 1RE8A 3C0IA 5AUVA 3MB6A 4HVDA 4ZIMA 2ESMA 4QO9A 3ZXZA 4F6SA 2BRMA 2BR1A 5AX3A 2QQ7A 3BELA 1F0QA 4XBRA 1ZOHA 4KRDA 2J0LA 3C4FA 2WTKC 3ZS5A 4FIGA 3CQUA 4J71A 4ZLYA 2HZIA 1J7UA 2DQ7X 2OG8A 5J79A 2XCHA 4ANMA 4FKLA 4R3RA 3POOA 4AF3A 4AT4A 3CD3A 2IJMA 1H1SA 3BHYA 4IAYA 4WD5A 3QCXA 4L3LA 5HIDA 2HENA 1UU3A 3PY0A 4CV9A 3EQDA 5KMOA 4AAAA 4PY1A 4Z7GA 4F7LA 1U46A 2XK7A 4TXCA 5C01A 4IXPA 3NMUF 4DH8A 3TT0A 3V8TA 4EBVA 3MY5A 2REIA 1U5QA 2UW5A 3FL4A 3DB6A 4RZWA 1ZZLA 2UW3A 3D94A 2J4ZA 2JKMA 3O2MA 4FKUA 3NUUA 4CD0A 4AGCA 1QPEA 2OXXA 3B8RA 1QMZA 3FWQA 3ENMA 5IA3A 4JAIA 4QTCA 1JKLA 4TYHB 2QLQA 2OIDA 4RFYA 1WBWA 3F82A 3SD0A 3R7OA 4FNZA 3GFEA 2ETRA 3BV2A 5L2SA 5F94A 2C5VA 2WO6A 3RM6A 3DQXA 4A07A 3KXNA 3Q3BA 3FQSA 4YZMA 2FH9A 2XMYA 4LGGA 4E93A 4A06A 1KSWA 2UV2A 3F3VA 4RC2A 4ID7A 1PXNA 4I0RA 3SLSA 4O7RA 3SKCA 4B99A 2J9MA 4DEIA 3A8WA 1RJBA 3CKXA 4I6HA 2B55A 3I0QA 3VUHA 4EOOA 2QURA 2CHLA 3P9JA 2HZ4A 5IEYA 4RJ8A 4ZK5A 3E8DA 4Y72A 2ITTA 3A7IA 4YHTA 5HVJA 1BX6A 2BALA 4QOXA 2BKZA 3IW7A 2QU5A 3EZVA 1XJDA 5L6PA 1V0OA 3Q52A 3QTZA 3TNPC 3IOPA 5EKNA 4BCJA 1LR4A 3AC4A 5JFWA 2OBJA 2EUFB 5KHXA 1ZY4A 2CSNA 2VTNA 2WEIA 4HPTE 4CFVA 4Q9SA 3AMAA 2UW4A 3RGFA 2PK9A 2XM8A 4D1XA 4ACMA 2BCJA 2WTVA 3QZGA 2WMTA 2H34A 5HBEA 4F9CA 1UU7A 4KKHA 2W06A 2HY81 2SRCA 2I40A 2XK8A 1S9JA 2YM8A 3HMNA 4J8MA 4ZP5A 5IH6A 3E7VA 2X2MA 1ZOGA 2YM3A 3PXQA 4MF0A 2RFSA 2DWBA 2VWYA 5JEBA 3CY3A 1MP8A 2UZNA 3FAAA 3EL8A 3IOKA 5AUWA 4IZ5A 4FNXA 4BCMA 2HOGA 3LM5A 2Z7SA 2YM5A 2B1PA 3VS4A 2VTHA 2YZAA 4EH9A 5HESA 3EQCA 4QNAA 1H1PA 5BYZA 2PULA 2W5HA 4YJQA 2KULA 2ZB0A 4G31A 5F4NA 4L43A 4YPSA 4KKGA 4O0TA 5LCJA 1XH7A 2C5OA 2R3MA 4FEVA 5DR2A 4EH6A 3MTFA 1SVHA 4QYGA 1H1WA 5B2MA 3L1SA 4DE4A 1H0VA 4J53A 5ANGA 4FKSA 3FEGA 2EXEA 4FIEA 2VV9A 4KD1A 1MRUA 5LVOA 4FZAB 3MB7A 4GJ3A 5CVHA 2VX0A 3OWJA 3GU6A 3IKAA 5CAPA 2QKRA 3DTCA 2XNOA 3BE9A 3UC4A 5FP6A 5DWRA 4FKRA 4PQNA 4Z9LA 2PMIA 5CAOA 2YM7A 4WG4A 4FG7A 5BUEA 3CEKA 2ZDUA 4QYFA 2CGWA 3A7FA 5DBXA 4DFUA 1JKSA 1JKTA 2FA2A 4FE2A 3PPZA 1G5SA 2FSLX 2JFLA 4ACGA 2Y0AA 4AT5A 4UBAA 1YVJA 2IO6A 5FDXA 3PWYA 3AT3A 2QI8A 1Y8GA 4RIWA 4UB7A 5AIKA 4ZY6A 4BYJA 4HW7A 2QOIA 5F95A 1OI9A 1ZXEA 3FI2A 4RX8A 4F7JA 3L8XA 2PE0A 5A4QA 3UC3A 2EXCX 5GJFA 2GFSA 3R8UA 2PZYA 3GU4A 1W98A 3W8LA 2GHMA 2W5BA 4AFEA 3VW8A 5DGZA 2B9FA 3I5NA 3LFBA 2VD5A 5BMSA 4PX6A 5AUUA 2Q0NA 1YW2A 5HX6A 2BHEA 1B38A 3A7JA 4YLKA 3F5PA 4DLIA 4GU6A 2VTJA 4MXOA 5EW8A 3BEGA 4DCEA 3ZHPC 2JIIA 3F88A 3VBWA 4F6WA 3GQLA 4LMUA 4ERWA 2GHGA 2NNWB 2XRUA 5ACKA 4FUXA 3MS9A 2QU6A 3HLLA 4MD7E 4RA4A 3D9VA 3R7IA 5CF6A 4WA9A 3O50A 1IA9A 2BTRA 4BIDA 5TOZA 1J7IA 1BL7A 3E7OA 4RX9A 4C3FA 4KIKB 3U6HA 4DTBA 2Z8CA 2CNVA 4FT0A 3GC0A 3POZA 3V6SA 3RAHA 1ZAOA 4QP3A 4W9WA 5HG8A 3PA4A 2RL5A 3MIAA 4YJOA 5TF9A 4Y95A 3QU0A 4JS8A 2YDJA 4YZNA
chains in the Genus database with same CATH superfamily
2YJRA 3D7ZA 1KOBA 1FGIA 5FEDA 1DM2A 2W17A 3QLFA 4UZDA 4NT4A 4PDPA 1ZYSA 4EOPA 1SVEA 4F1TA 2UUEA 1Z57A 3MVHA 5KNJA 5M53A 3ET7A 1SZMA 4PP9A 4GYGA 3LQ5A 5CENA 4EQUA 4RWIA 2VTTA 4MD8E 5AAFA 1REKA 4IMYA 5ICPA 2XARA 4FUYA 3PY3A 4U0IA 5T3QA 2R3HA 2X7FA 2FO0A 5IA2A 1W2CA 5D12A 5DT3A 4ITJA 2BAKA 4FKGA 1FQ1B 5FTOA 4KBCA 3TZ7A 5GJDA 5BYLA 5C9CA 1PMVA 1PY5A 5HVYA 1QL6A 1OL2A 2JC6A 3MFTA 4KIOA 3FBVA 5EHOA 4HCUA 5FG8A 5J5TA 1IA8A 4IDTA 4ZZOA 3F9NA 3CQWA 3GXLA 4KSQA 3KEXA 3JPVA 5HO8A 1TQPA 4IAZA 3LXKA 3KK8A 3F5GA 5CEKA 3L9LA 2XIRA 2QHMA 4H3BA 4N70A 4M69B 4DGOA 2R7IA 2ITPA 2PUIA 3RAWA 3QZFA 1LEWA 5EYCA 5D41A 4FOBA 4IDVA 4LQMA 4BKZA 2CJMA 1UNHA 3BHVA 2VTSA 3RBWA 5E8XA 4AW2A 3OROA 3A4OX 4Y5QA 4CRSA 5KMLA 3DPKA 3NEWA 2OJFE 2WTWA 3FZ1A 3MH1A 3R30A 4Z7HA 4KBKA 3BLHA 5EQEA 3L8SA 3A7GA 1JPAA 2V22A 2PZIA 3TL8A 3ZO3A 3ODZX 5CU4A 3EMGA 2WQBA 3E92A 5ANKA 5DVRA 2F4JA 3OW3A 4TYEA 3UQGA 4BTKA 4CT2A 3SOAA 4L8MA 2VO7A 1K9AA 3P4KA 4J8NA 3GCUA 4S31A 5AM6A 2C6LA 5C26A 4OTRA 4XLVA 2EXMA 4XG3A 1YQJA 2IVTA 4PRJA 4B6LA 5FBOA 1WCCA 4AE6A 4CT1A 3PA3A 4EUTA 4OTGA 4CTBA 5CQUA 3E87A 3GT8A 5T68A 3HMIA 5JSMA 3BL7A 4BDBA 3ZRMA 4JX7A 4GW8A 4I3ZA 4BKJA 3NAYA 2W1IA 3Q96A 4XG7A 4IAKA 4BJJB 2E9PA 2GNJA 3R1NA 3TUCA 3ZU7A 3BIZA 3E3BX 2WEVA 3DB8A 4GFMA 5AP4A 2X8DA 4U9AA 5IA5A 1JSUA 3T8OA 4YO6A 3CJGA 4KUJA 3O96A 4QPAA 5AV3A 2JBPA 4G5PA 4RIXA 2OXYA 1GIIA 3EJ1A 4UMUA 2O0UA 4C4EA 3CR0A 4B0GA 5LMKC 1O9UA 3DJ7A 4LYNA 4F99A 4LFIA 3QCQA 2W4KA 4O0YA 4RWLA 4ZTHA 2X7GA 3T3UA 2JEDA 4YJTA 5CASA 5CSPA 2XZSA 3NUSA 3GFWA 3PXFA 5JGBA 3BU6A 4GVJA 2W9ZB 5ETAA 5IPJA 1OGYA 2Y9QA 1IR3A 5M09A 3PXKA 5CEIA 3UG2A 1YI6A 3PIXA 4IB0A 2ZYBA 1XQZA 2HWPA 5DMZA 4AOJA 3VUMA 5FD2A 4D0WA 5LCKA 3ROCA 4TYIA 4X3FB 4A4OA 4RPVA 4UWBA 4DH5A 2RFEA 3BHHA 3IONA 1OM1A 4FTCA 5HG5A 3QL8A 4GUBA 3RKBA 5C27A 4P4CA 3AOXA 2PZPA 2C0IA 2HZNA 4FK3A 4PUZA 4CFWA 1YDSE 2C6DA 5M57A 4QP7A 3VS2A 2F7EE 3O5AA 4ZTMA 4DFBA 3H10A 4I5MA 5C4KA 3LM0A 4WT6A 4HCVA 3R00A 5AV1A 4C58A 3KRWA 2XBAA 3F5UA 4F4PA 5E8VA 3ORZA 4ASEA 3P5JC 3FC2A 1OL1A 4L6QA 4KA3A 3PTGA 1Q3DA 2VWIA 1URWA 5GHVA 4RX5A 3NFGB 5H9BA 1FPUA 4ENXA 2VU3A 3DKOA 2P0CA 2O2UA 2R3NA 4ANSA 4GSBA 4QRCA 3U55A 3Q5IA 4C02A 2G2HA 1J7LA 4HGSA 3UMWA 1OZ1A 3UOHA 4FTLA 2CN5A 3LPBA 4OTWA 4AQCA 5K5XA 1PXMA 3HUCA 3QD4A 3UJGA 5AFVA 3QUPA 3E5AA 3TG1A 3C51A 3HL7A 4ZSEA 3R8LA 4OT6A 4BDKA 3DK3A 4W4YA 4C61A 4EOIA 4O22A 4CFXA 2V0DA 2UZUE 2C68A 3EKKA 1CTPE 1UV5A 5BQ0A 4BGGA 4BDDA 4GUEA 3KL8A 3OXTA 4FGBA 3V5LA 5CQWA 5HORA 3QBNA 2F57A 3RWQA 4DHIB 4FSTA 4RIXB 2YWPA 5BUIA 4DLJA 3BYVA 4I1ZA 4FTOA 3DDQA 4TWNA 5HLPA 4C34A 2JKOA 2VTAA 2WTKB 3FKOA 3ZZEA 4DEAA 3OXIA 5CZHA 5E92A 4MH7A 3TEIA 4C33A 1ZOEA 5IDNA 4O7VA 3HX4A 2GTMA 3PPJA 3DZOA 4P5ZA 5F1ZA 1CKJA 5BMMA 5HCXA 4F7SA 4R78A 4BCHA 3WIGA 3GUBA 4GK2A 4AA0A 4IJPA 4WIHA 4YJPA 2HW6A 4O1PA 1TFFA 1Q8TA 3IPHA 2OICA 4M15A 1CSNA 4FV1A 4PV0A 4BCOA 4GK4A 5HQ0A 4PDSA 2GNHA 3VNTA 1BL6A 1YWRA 2VZ6A 1BI7A 3LFAA 5FTQA 4S34A 2YACA 3CD8A 4FEQA 5LWMA 3QHWA 3RPSA 4ZZMA 2XYUA 3H3CA 3O17A 4RJ4A 4TPTA 4I4EA 5ANJA 4N0SA 1PYXA 3W2OA 3UVRA 3ZOSA 4FZ7A 4BCFA 4USEA 4HNFA 2YIRA 5CSHA 4CZUA 3DNEA 3NYXA 5CEOA 2QOBA 2YLEA 4FT9A 2Z7LA 5CXHA 1NXKA 4RT7A 5HE3A 2OK1A 2BHHA 1Q8YA 1H24A 2Y4PA 3D7TB 3DK7A 2R0UA 4MTAA 4GYIA 3NUXA 2VTIA 4ZEGA 3ZFYA 4EJ7A 4PTEA 3I4BA 3EHAA 5L6WL 2C69A 3ULZA 3K2LA 5IQEA 5AJQA 5LXMA 2B9HA 1YWVA 2X0QA 3DLZA 4CFUA 5IQGA 4YTFA 2YCQA 4FSMA 3EN9A 4CQGA 3R83A 4FKWA 3K5UA 4EWQA 4K1BA 4U3ZA 2WQNA 4MX9A 3TXOA 3WZKA 2DS1A 2W05A 4YLJA 4DEHA 4EHGA 5L4QA 5CI6A 4FC0A 4C4IA 3SW4A 3D83A 3DS6A 3SRVB 4FA2A 1H08A 1Z5MA 3E64A 2VTOA 1OKZA 4JG8A 5HU9A 5L2TA 3HAVA 5D1JA 3PJ1A 4RQKA 4UWYA 3AGLA 5FLFA 3C5UA 2AYPA 4CZYB 3QUDA 1KUTA 3CSVA 2YAKA 2BFYA 4RGJA 4GL9A 4PPCA 5EDRA 4EHZA 3TV7A 3SVVA 4BBFA 4PP7A 2YERA 4RJ3A 2IW8A 3VS5A 2V7OA 1TQIA 3BYOA 2IEWA 4QTEA 2VTLA 1GZ8A 4U80A 2RFNA 2XNBA 2YIQA 3K3JA 1M7NA 3D5WA 4G34A 3UOLA 4AXAA 5LVLA 1G8SA 3TTIA 3GU7A 4F63A 4IVBA 3W0SA 1BUHA 1U59A 3W1FA 2QOCA 3DCVA 4FV2A 1Y57A 1EH4A 3HMMA 4LGHA 4E8AA 2WMVA 3E8EA 1W2DA 3ZSGA 4E7WA 3IQ7A 3DV3A 5LVPA 3PYYA 4W9XA 1FVTA 2BRHA 1H4LA 4K8AA 4O7ZA 5AR7A 5J1WA 3VUGA 3AMBA 4N6YA 1MQBA 5GZ8A 3E93A 3S95A 3TDVA 3DT1A 4KAOA 2QHNA 4IM3A 2C1BA 3SC1A 5I9YA 5JN2A 3M42A 3P08A 4G5JA 2UZEA 5CF8A 2C0TA 3LLTA 2PY3A 3I0OA 3KXGA 4RRVA 4BDEA 2CNQA 2Z02A 2Z7RA 2V62A 1NVQA 3PA5A 3RK7A 5C8NA 4FODA 5AV2A 3U4UA 2QLUA 4CCUA 4CKJA 4YJRA 3DJ6A 4BVUA 5D10A 2QO7A 2O63A 3VS7A 1FVRA 2DYLA 2CGXA 4M67A 5KMNA 4K18A 5H8EA 3ULIA 3ZEWA 2R3FA 4NYEA 3H9RA 3FUPA 3MVMA 4XG2A 4RA5A 1J1CA 3GCPA 2PZ5A 5JMSA 4UMRA 1YXXA 3PJCA 1P4FA 2XNPA 3DBEA 2WGJA 3DBFA 2GPHA 4I22A 1ZMWA 4OTFA 4AOTA 3G0FA 5JGAA 4YZDA 1GOLA 1Z9XA 2BTSA 2P33A 4PTCA 3NGAA 4RWJA 3QQGA 3F2RA 1HOWA 2NRYA 2A27A 1FMKA 3C1XA 3HV4A 4XOYA 3U4WA 2X7OA 4IWDA 4G17A 5EYKA 1UVRA 3PUPA 3QRIA 4L44A 4IVDA 2Z7QA 4KWPA 4YZBA 1YXTA 2H6DA 1M14A 2ACXA 3FZOA 4NCTC 2PVLA 1KWPA 5AP0A 3VN9A 2PMNX 5CSWA 3AKJA 5JK3A 3QKLA 4KRCA 5KMMA 1YDTE 3KMUA 4UYAA 3H0YA 3FYJX 4OBPA 2WIPA 3VS1A 5L6OA 4KKEA 3PDTA 3KN6A 3LZBA 3QTIA 5AM7A 4QP9A 3UODA 4EI4A 2XK3A 4RSSA 5AP3A 4EBWA 4I23A 2IVVA 4D2RA 5IU2A 2YABA 4B7TA 4FTKA 4X3FC 2HIWA 2JDOA 3E8CA 4V05A 3UDZA 4BDIA 5AUTA 4H3PA 3CIKA 4U43A 4I0SA 3DGKA 3ATSA 1NA7A 1OUYA 2I0VA 2R3IA 3BQRA 3GBZA 3M2WA 4FT5A 3D4QA 3NDMA 5G6VA 4TYHA 1OIQA 3QLGA 3W2QA 2XBJA 4NKAA 1GIHA 2BIYA 4H36A 4ZSGA 3MPMA 2X0OA 3N4VA 1PW2A 2QOLA 2C3JA 2PVKA 5HTCA 4F0GA 2VX3A 2GQGA 5F9EA 3ZRLA 3WE4A 1OKVA 1VZOA 4FICA 4YSMA 2J2IB 2YM4A 4IWOA 3Q53A 5LVMA 2NPQA 4GIIA 2AC3A 3QTQA 4UEUA 2GNLA 2UW7A 5K9IA 3UTOA 4E5WA 3GNIB 3H9OA 4XEYA 5CX9A 2JAMA 5LMKA 2B0QA 3QGWA 3VJNA 5AR5A 3R9NA 2C6MA 2BRNA 2J5FA 5JKGA 1R78A 3KULB 2B53A 4FI1A 4GFGA 4E6DA 5CAUA 3MESA 4YZCA 3U54A 4JJRA 1UNLA 3PFYA 4BR3A 2ETKA 3FZTA 3WYYA 3FL5A 5AV4A 3MPAA 2XEZA 4M3QA 2CMWA 3RJCA 1PXPA 2W96B 3MBLA 4ZOGA 5HG7A 3V8SA 1Q4LA 3ELJA 5I9VA 1WBTA 5CSVA 5L2WA 1H1QA 4JBQA 3KRLA 4B8LA 2QOQA 5FUTA 1JVPP 3SV0A 2QKWB 3MTLA 3PP0A 4ZY4A 4IWPA 4C59A 4WHZA 4IZAA 3U8WA 4NM7A 2PUPA 4GG7A 4PMTA 4RJ6A 4CMTA 2YCSA 5I9UA 1O6KA 4O7WA 5HO7A 2J6MA 3F3UA 2XS0A 4E20A 3LJ0A 1SVGA 3H4JA 1HCKA 2HAKA 3GVUA 2YHVA 4XV1A 5HNIX 2PE1A 4FYNA 5G1XA 5IUHA 3E88A 5EKOA 4DG3E 4E5BA 3BWFA 4D28A 3WF7A 4FTRA 2P4IA 4I24A 4M97A 4BZDA 4EOJA 2X6DA 2PVJA 4IW0A 3LFQA 4OTPA 4DBXA 5IQFA 2OF2A 3TKHA 5CI7A 3LMHA 1SM2A 2ITVA 4R3CA 5EYDA 3HV7A 3D5UA 1A9UA 1I09A 3OW4A 4XLIA 4QMQA 4QP6A 2WMSA 4NWMA 2Z2WA 3FE3A 4F1MA 2VWWA 4V01A 1XMLA 4DHFA 1QPJA 2BZKB 3DAEA 4D2VA 2WU6A 4O0WA 4YURA 5ANDA 4AW5A 3BGPA 1YOJA 4FL3A 5K0KA 4TT7A 3RPYA 1UKHA 3R8MA 1JSVA 2PPQA 3RP9A 4LOQA 3DKFA 3ORNA 3PVBA 4EUUA 3VBQA 4IC7A 1T45A 3W0PA 4QMZA 4UV0A 2P55A 4FTJA 3WF6A 2XKCA 5DEWA 4JNWA 3F66A 3O7LB 4TYJA 3HEGA 3L9MA 1YHWA 3KGAA 5A3XA 1LPUA 4O4FA 4D5KA 4YO4A 1L8TA 2VWBA 1U4DA 5IA4A 2PWLA 2YITA 2C6IA 4QMYA 1G8AA 4IIRA 4NM3A 3R01A 2XCKA 4DGNA 3ZLSA 4F65A 2JLDA 3IDPA 4CYJA 4EZ5A 3A8XA 2ITXA 4TL0A 2HZ0A 3CE3A 4ITHA 3UZTA 5E8ZA 4F0FA 5JQ5A 2YAAA 2P2IA 3PIYA 4GCJA 3KF7A 2X81A 1YRPA 3II5A 2XEYA 5DI1A 5E90A 4E6CA 3W18A 3HUBA 1JQHA 3GCSA 2A1AB 3BEAA 3KY2A 3OUNB 4EOSA 3O8PA 5CAQA 4XV9A 3FMLA 4TWCA 3WZDA 3ZFMA 1V0BA 3D14A 2XKEA 3PZHA 3O51A 1Y8YA 3CKWA 3MH3A 2P2HA 3ZC5A 5KX8A 2YJSA 5IUIA 3Q60A 3KFAA 4MVFA 4R77A 4OTQA 4QPSA 3NWWA 1O6YA 5GINE 4YGAA 2E9OA 1KV2A 1S9IA 3QX4A 4F9AA 3P79A 3UNZA 4DAWA 2X6EA 4A4LA 5M4UA 4L67A 2R5TA 3QFVA 1B39A 2QR8A 3KA0A 2BDWA 3MPTA 4KIKA 2VNWA 3UQCA 4UN0C 3UDSA 4EYJA 4NFMA 4M0YA 3OCTA 4H1MA 5M4CA 4ZZNA 4W8EA 1M17A 1Q24A 3ORMA 4ZTQA 1H07A 4ZJIA 4E73A 5A46A 4AU8A 1JAMA 2IZRA 3O7LD 5CEMA 3TUDA 5GZ9A 3BRBA 3LLAA 3OXZA 5EDQA 4IX4A 2HXLA 5IQDA 2O5KA 5FP5A 4W4XA 3ZO2A 4CG9A 3REPA 3TZ8A 4BYIA 4BCIA 3V5PA 4ACCA 3NUNA 3FLQA 3ZCLA 5FTGA 3I7BA 3WZEA 4CMOA 1YI3A 2BIKB 4IE9A 5CALA 3JVRA 4FBXA 5KE0A 1J91A 3CTJA 4DITA 4KS7A 5IUGA 3EL7A 1Q8ZA 4TN6A 4TKSA 4IVCA 2WB8A 4H39A 3QYZA 1OKYA 4EQMA 2ONLC 4HNIA 2PVFA 2OI4X 3GENA 3LCSA 3ROYA 1NT2A 3QQUA 2BMCA 2BZHB 4XV3A 1W2FA 5AIRA 4APCA 1V1KA 3A62A 4XRJA 3KK9A 4LRJA 5K3YA 4ARKA 4EHVA 1BI8A 2OLCA 1DAYA 1ZARA 3L9PA 5KUPA 5HO6A 2QOOA 3U9CA 4QMUA 2XALA 3HYHA 4XOZA 1KE9A 4M69A 4RWKA 1XHAA 3HA6A 4IZ7A 3Q4TA 4LM5A 4YNOA 4G3EA 4C0TA 4EORA 5KMKA 4F9YA 4R1YA 5AAGA 4YZ9A 4ALWA 3NW6A 4HVGA 3KREA 3PLSA 4EZ3A 2GSFA 4U79A 3W2RA 5IISA 3SW7A 4O81A 3QHRA 3GCVA 3OWKA 3NR9A 1H8FA 3QWJA 4IX3A 3T9IA 3VS6A 2ZM4A 4FG9A 4RC3A 4AN9A 4C4FA 5K4JA 3KMMA 5KBRA 2VWZA 4XS2A 3T3VA 2W0JA 4FV0A 5HD4A 1H0WA 3MFRA 3QD0A 5FEEA 5CEPA 2VO3A 3A99A 4QTBA 3Q5ZA 3MFUA 4OTDA 4EHEA 2AUHA 3KRRA 5DH3A 4YU2A 5M4IA 1HCLA 2R9SA 4A9SA 1WBPA 3WBLA 3ERKA 3CC6A 2XF0A 5I9WA 2R3GA 5HE0A 1Q62A 2OIQA 5J9YA 3SG9A 1YKRA 5A4TA 4EC8A 4I94A 4FKJA 5J5SA 2VTRA 3FZPA 5K5NA 2HELA 4GK3A 4IHPA 4D58A 1OIYA 3DY7A 3F3WA 1BLXA 4HPUE 4PTGA 2BPMA 4AZEA 2V55A 4I20A 3Q9XA 4IACA 2OW3A 4P2KA 4WSYA 1JLUE 3AD6A 3EZRA 2CKQA 3HNGA 3VONA 2IN6A 1RW8A 3COMA 4GU9A 3ZRKA 4FYOA 1XH4A 3CGOA 4DINA 3KRJA 2XKFA 4UMQA 3ZFXA 2UZVA 4NCTA 4DGLC 5KKRC 2W9FB 2HY0A 4FOCA 4S33A 4R5YA 5DE2A 4BTMA 3BCEA 5HHWA 1OIRA 1Q3WA 1ZRZA 1LUFA 1H01A 2JD5A 4KS8A 4DG0E 2QO9A 3OCSA 4R7BA 2BUJA 3KMWA 3F61A 4XH6A 2IW9A 4BDFA 3ZEPA 3F7ZA 5CU6A 3R7YA 2EB2A 4XUFA 4C62A 3NNXA 3BGZA 3NCZA 1OPLA 3N4UA 4KSPA 4X3FA 3E3PA 4AAYA 2XH5A 4YC3A 2OH0E 4JVGA 4CNHA 2C5NA 1PXKA 3FQHA 4FV3A 4X21A 4YC8A 3WF8A 3NIEA 4MNFA 4UX9A 3VO3A 2E2BA 3LFCA 2VN9A 3IK3A 3NVMB 3K54A 1UWHA 4O21A 2F9GA 3NCGA 2JITA 3P7CA 4RQVA 4E4MA 3MW1A 2BRBA 3DZQA 3LJ1A 4U7ZA 4BDGA 3OCBA 3VULA 1YXSA 3Q6UA 3LCDA 2UW6A 3FPMA 1OIUA 4R5SA 4CKRA 5HBJA 2ZB1A 3EFWA 3L8PA 1OVEA 4PDOA 3Q2JA 3HA8A 3PXYA 4WNPA 3DQWA 3W16A 4W4VA 3QKKA 5IEVA 3HZTA 4ASZA 3R1QA 4IBMA 1FMOE 3CPBA 1FINA 4FKOA 5CU3A 4DEEA 2R64A 3FI4A 4HZRA 4ZSJA 5KZIA 3SAYA 4FV7A 4EOMA 1GNGA 2YFXA 2ZDTA 4X2FA 1TVOA 1YXVA 5EFQA 3DKCA 4EK8A 3ODYX 2FUMA 3EQRA 2IPXA 4MBJA 2BKKA 3P78A 4ZXTA 2PU8A 2HYYA 5D7AA 4BICA 4ALUA 3D5VA 4D4SA 2OWBA 2C47A 4LOPA 5EYMA 5FM3A 2FSTX 3Q2MA 1JOWB 5DT0A 4K77A 3VW6A 3KB7A 3PXZA 5HI2A 4OR5A 4IC8A 1PMNA 2HW7A 4YBKA 5IQBA 1W83A 2F7XE 1B6CB 4G1WA 2O3PA 3C7QA 2IWIA 4UMPA 4AT3A 3FJQE 3MIYA 4BGHA 3PSCA 3QQJA 3RNIA 3W55A 4NFNA 4W4WA 2HWOA 4NM0A 3RWPA 2CGVA 5AP5A 2WXVA 3GP0A 4IB1A 3A60A 2UZBA 4H1JA 4USDA 2GTNA 3VF8A 5IEXA 4EK4A 2CPKE 5EHYA 1WBSA 2UW0A 2F7ZE 2QOHA 3I81A 5ANOA 4ZLZA 2UZOA 2CKEA 3VQHA 4OLIA 3NUAA 1XBBA 2H8HA 2VNYA 4GT3A 2ZMDA 2IZSA 3GQIA 4PL5A 5K0XA 5B7VA 4PF4A 1FBNA 3VBYA 1OPJA 2RG6A 4QMPA 4Z55A 3IW4A 4ZLOA 4QQ5A 3QA8A 4BIBA 1P2AA 2C1AA 3O8TA 3UGCA 3VC4A 3U9NA 3UO6A 3SHEA 3LQ8A 3HV6A 1FVVA 2QC6A 3TMOA 2YLFA 3VHKA 4MK0A 5EOBA 4F7NA 4H58A 1APME 3R7EA 3TI1A 2PUNA 2X8EA 4BIEA 2R3QA 4FEUA 2PUUA 2OH4A 3D7TA 1YWNA 3NS9A 4BCPA 4ZSLA 5A6NA 4FRFA 5J9ZA 1WVWA 3AMYA 4FZFB 4KIQA 4UZHA 4WRSA 1XKKA 2BILB 5HU3A 4JG7A 5L3AA 4TWPA 3QALE 4DA5A 5L2IA 1VJYA 2BAQA 4XP3A 4BY9E 4CG8A 3LXPA 4UXLA 5AA8A 4CSVA 4QMTA 4RLKA 5BPYA 4WNOA 3TZ9A 3T9TA 2H96A 2W1FA 5E1EA 4C4JA 2UW9A 5M51A 1JWHA 3BBWA 5A54A 4H05A 3MVLA 4N4SA 4U44A 3W0MA 2X9EA 5I4NA 4MXCA 4RVTA 3HMOA 3D0EA 4Y5HA 1KE6A 5FM2A 3W33A 3PPKA 5I3RA 2VGOA 3MV5A 4NIFB 3KXHA 3SRVA 2I6LA 3WF5A 4TTHB 3ZLWA 4BZNA 4O2ZA 3COIA 3AC5A 4IZYA 4PPBA 4BTFA 5GIOE 1UA2A 1ERKA 4U45A 3PG3A 3SQQA 4QMXA 5LVNA 2RKUA 3W10A 2FYSA 1Y6AA 2XKDA 3AQVA 5E8TA 3UIMA 2GNFA 4U81A 4YP8A 4APPA 2XA4A 2PVYA 3BX5A 3R6XA 2YZLA 4GJ2A 1GY3A 3Q4UA 1R1WA 1F5QA 3LFSA 5TE0A 4BZOA 4CVAA 3A4PA 3FMJA 4ZJJA 1OBDA 4GMYA 4K0YA 4O6EA 1WFCA 3ZM9A 4FK6A 4D0XA 4G2FA 1WBVA 2C3LA 3BHTA 3UE4A 3TNIA 3PWDA 3R7UA 1WBOA 4C4HA 2QO2A 1KE7A 4AG8A 4AACA 3LMGA 5TR6A 2YDKA 4FG8A 5JRSA 2PHKA 1OGUA 1DI9A 3NNVA 4KINA 3RALA 4LDTA 2VRXA 3SA0A 1IEPA 4U40A 3ALNA 3ZUTA 2A4LA 3SXFA 5KMJA 3FI8A 3HV3A 3QGYA 5B2LA 4WUNA 2VTQA 3QQLA 3WOWA 4BC6A 4CQEA 5CANA 1URCA 1H27A 4NH1A 4F9BA 4DDIA 1NVSA 3RCDA 5CU2A 1VEBA 4NJ3A 3BU5A 4IH8A 3TN8A 4RIOA 3IW6A 3R73A 5J8IA 2FSOX 3DTWA 1CMKE 4NSTA 5FQDC 5CF4A 5L8LA 4JRVA 3UO4A 4B9DA 2XNMA 5E7RA 3BZ3A 5KO1A 1SNXA 2NRUA 4G3GA 2O8YA 2ITQA 5F20A 4WSQA 1OL7A 3Q32A 5A14A 3P5KA 4M13A 4FKTA 2GMXA 4FTQA 1XBAA 5FEQA 2V5QA 3E63A 4FKPA 3KXMA 2R7BA 4QT1A 5JFSA 2CGUA 2WMAA 4E1ZA 5KBQA 3AD4A 3VUTA 3CCNA 5EI8A 4CFMA 4V04A 2WHBA 3M1SA 1H00A 3ZSIA 4D4RA 4AQKA 1UWJA 4FV8A 4KB8A 2I1MA 3ZONA 3H0ZA 3A2CA 4OUCA 4A7CA 4F64A 3N51A 5HCZA 1JKKA 2QOKA 1MRVA 3QQFA 4HOKA 4EQCA 4F08A 2WMQA 4QP8A 3QXOA 4C4GA 2G1TA 3KC3A 4O4EA 5KMIA 5EQYA 3QX2A 3LHJA 3KU2A 4MQ2A 4UXQA 3S2PA 4DFLA 4O0RA 5IKWA 2B9JA 2BZIB 3RNYA 5L8KA 3A7HA 4ZTNA 3CY2A 3MA3A 4ZY5A 4F09A 3PLAE 4R1VA 3H30A 4LRKA 4BB4A 4NL0A 4I41A 3LAUA 3FMDA 2W1ZA 4BHNA 3BYMA 2PVHA 5HTBA 2WOTA 4IVAA 5TO8A 4FSRA 1GAGA 4TYGA 5AUYA 4ANOA 2QD9A 3JYAA 4JBVA 1M7QA 2W7XA 4J96A 4K11A 4R6VA 4TNDA 1U54B 4CFFA 4FEXA 1PJKA 2GS6A 4IB3A 1PMEA 1ZMVA 5DRBA 3DNDA 4FKVA 5DYJA 4O7TA 3RK5A 5IQCA 5IG1A 1DAWA 5CVFA 3V8WA 5BVOA 4XBUA 3V3VA 3WE8A 4GT5A 3EYHA 3QTUA 3R8PA 1M2RA 4E6QA 3BL9A 4FL2A 1G8KA 4FKQA 3FXXA 3I6UA 4C3RA 3MYGA 3U87A 2WOUA 1P4OA 2O64A 4XYFA 5HLWA 5FRIA 4DH3A 5KHWA 2WNTA 3DXPA 4O7NA 5DN3A 3BLQA 2NP8A 3MGYA 4YR8A 4JT3A 1PXIA 4F0IA 4BDJA 2B9IA 1J1BA 5E91A 5E8UA 4ERKA 3D15A 3JXWA 3S0OA 4XG4A 2G01A 3MI9A 2O65A 3OBJA 4MNEA 4WNKA 2ITWA 4YJVA 5C03A 3UVQA 4AZFA 3QD3A 2IZUA 4DG2E 2VGPA 4FZDB 4I21A 3FY2A 2ITOA 2GDOA 3HV5A 3C4CA 3LCTA 3KULA 5KCVA 4ZMEA 2PL0A 4C37A 5HIEA 4EH2A 4BDAA 4D1ZA 2ERKA 4RMZA 3SX9A 1RDQE 2F49A 3ETAA 3IDCA 3LJ2A 4YNEA 3KIOC 3I7CA 4QP4A 2JDVA 1GZNA 3MJ1A 4S32A 4W8DA 2X4ZA 4Y83A 5CXZA 3HRFA 3NYOA 4JDHA 4EKKA 1O6LA 3UPZA 4Q2AA 4PWNA 3OWLA 3PG1A 4RVLA 3TYKA 3CP9A 3AD5A 2B7AA 4AOIA 4D5HA 1PYEA 1Q41A 3DK6A 3IDBA 3OP5A 3Q4CA 4NUSA 5BVDA 3PVUA 4HYSA 4J99A 4WG3A 3UIXA 2NYAA 3C50A 3GGFA 2WMXA 3GEQA 3EQBA 3KF4A 5CS6A 4AZSA 1ND4A 2GS2A 4L46A 3H9FA 3I60A 2OJ9A 4R3PA 4A9RA 4DCAA 4BF2A 4D2SA 3EQIA 4C8BA