2IO6A

Wee1 kinase complexed with inhibitor pd330961
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
279
structure length
252
Chain Sequence
MKSRYTTEFHELEKIGSSVFKCVKRLDGCIYAIKRSKKPSVDEQNALREVYAHAVLGQHSHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISENYRIMSYFKEAELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISKVMFKIGDLGHVTRISSPQVEEGDSRFLANEVLQENYTHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLPRIPQVLSQEFTELLKVMIHPDPERRPSAMALVKHSVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Wee1-like protein kinase
publication title Synthesis and structure-activity relationships of N-6 substituted analogues of 9-hydroxy-4-phenylpyrrolo[3,4-c]carbazole-1,3(2H,6H)-diones as inhibitors of Wee1 and Chk1 checkpoint kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 252
sequence length 279
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2006-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2io6A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2io6A01
1OL1A 2BZJA 4QPMA 4F0IA 1OZ1A 2E9NA 4U79A 3E7VA 1JVPP 4ACHA 4TYGA 1IA8A 3V3VA 5EYCA 2YZLA 2EVAA 4PDPA 4UALA 2QG7A 1R78A 4ID7A 3UPXA 3KK8A 4A9UA 4ZAUA 4O6EA 1H0VA 2R0UA 3JUHA 3Q4UA 3QUEA 4FV9A 2H34A 3S95A 4BGQA 2V7AA 4FZ6A 2R4BA 3CD8A 3QXPA 3NUAA 4DTKA 1H27A 4X21A 3K5UA 1ZY5A 3QYZA 4UN0C 4IAZA 2WMQA 3OXTA 2P2IA 4JBVA 5TE0A 5AR5A 2JBPA 2J90A 3R6XA 3NUPA 3IQ7A 1KWPA 3PJCA 3TDVA 3L8SA 1P2AA 3FUPA 4M68A 5C1QB 5IMXA 3IECA 5DHJA 3HRBA 3G51A 3LM5A 3HLLA 3O8TA 4ZEGA 4D0WA 4H05A 4L3JA 2OZAA 4IDTA 2PYWA 5CASA 2ZVAA 3HRCA 2HCKA 3MFUA 3ULZA 3IPHA 3QQUA 1Y6BA 4V04A 4E6CA 2PUPA 2BPMA 2PVKA 4ZMFA 2WTKB 2EXEA 2VO3A 4GL9A 5A6OA 3KA0A 4J52A 3FXZA 3GUBA 3MJ2A 3VS3A 4RWJA 3PIZA 2Q0BA 4CQGA 4JS8A 4XNEA 1UKIA 5IA4A 3AMBA 1WBSA 3TUDA 3BGPA 1M52A 2WPAA 5BVOA 1FGIA 2PVRA 4HPTE 2YDKA 3GNIB 4GFOA 5J1WA 3BBTB 2HENA 2XKCA 1OKYA 1XH6A 2W06A 5EYKA 5ETCA 4DH5A 3CY2A 5IU2A 4CG9A 3EFLA 4BCPA 3OBJA 4BCNA 2JDTA 4NK9A 2XJ2A 3MS9A 3R0TA 5M4CA 3MIYA 5CF4A 4XV2A 3EOCA 5HNIX 3HYHA 3A62A 3QTRA 3VW8A 4E4NA 2X39A 3DXQA 3C13A 5AUXA 1JWHA 4FSUA 4BDDA 3BU6A 4QP8A 3VW6A 2PMNX 3OW4A 1OB3A 2HY0A 5JZNA 3JR1A 4ITJA 3OT3A 2QODA 1QL6A 4A9RA 1DAYA 4CRLA 4GFGA 3MSSA 1SNXA 1PXMA 5CEIA 3DJ6A 3F66A 2ONLC 4KBKA 3V01A 2W1HA 4M66A 4XBRA 2HZIA 2XVDA 5HO6A 5HVJA 4BDEA 5JKGA 3GC9A 1Q61A 1KOBA 4CT2A 3JPVA 4FK3A 2JFMA 4RA4A 4X3JA 3KMUA 2VTRA 2C1BA 5TT7A 3TJCA 1OPLA 4XHKB 5DEYA 4D4RA 3BCEA 4NTSA 4CGAA 2WQOA 4Y72A 3LM0A 4FNXA 5BMMA 3Q6UA 4TRLA 1YWRA 3O7LB 4G5PA 3RWPA 2YCRA 4AACA 4I92A 4AOIA 5JGAA 5DIAA 3UVQA 2WXVA 4GKIA 4FA2A 4EH4A 4XV1A 3FMKA 5BQ0A 4G17A 5GIPE 5FXRA 5FP6A 3MDYA 4WO5A 3UTOA 3Q4TA 3PIXA 2OH0E 2PVYA 5EQPA 1GJOA 1H01A 2GCDA 1Q8ZA 4M8TA 4QRCA 4QTBA 3R7YA 3O96A 3E62A 2J6MA 4J96A 4E5WA 1OPKA 4ZY4A 5LMKA 3RPSA 2IJMA 5BVDA 4QMQA 3VUHA 4AN2A 4MBIA 4C33A 1JKTA 1WBTA 5KBQA 2Y0AA 2XKDA 2VTAA 2OF2A 3VRZA 2J0IA 2C68A 4LGDA 1MQ4A 5CALA 4FIJA 3ORIA 3N9XA 3BE2A 3VAPA 3ZO4A 3ZM4A 3GOKA 1KE5A 1DI9A 5EFQA 3TDWA 2W1GA 2H8HA 4GU9A 4UY9A 1P4FA 5GHVA 3I6WA 2F57A 3UIUA 3LHJA 4YMJA 3W1FA 2R3OA 4RX9A 4JG8A 3RAWA 3CPBA 3ZUUA 4J97A 4M3QA 4NM7A 3PJ3A 3W18A 1TVOA 1QPJA 5C9CA 4AW5A 2W5HA 4CFFA 4O0YA 4E73A 3I0QA 4D5HA 3C9WA 2UZVA 3GCUA 3U54A 4IFCA 1M7QA 4H1JA 2EXCX 5DT3A 1I44A 5IQDA 1ZY4A 4RX7A 3VUTA 4AG8A 3DKFA 4CMTA 2B9IA 3NYNA 4QMSA 1Y6AA 1SVGA 3O51A 4JBOA 4NH1A 4TW9A 4PDSA 5H9BA 3T9IA 4AA0A 5KBRA 5J1VA 2PU8A 4L43A 3NNVA 3KN5A 1U54B 2VTOA 5HQ0A 4FSTA 3WYXA 2UW3A 3HV7A 5I9UA 5FP5A 1ZOGA 5C8KA 4FKTA 3IOKA 2XNEA 4JBQA 3ALOA 4I0SA 4NZWB 2UV2A 4WIHA 2V62A 4FG7A 4KABA 5AV4A 1PMEA 2YN8A 1GNGA 3CY3A 3F7ZA 2WTWA 3DJ5A 2J0KA 5IUGA 4ZY5A 1OBDA 2GS2A 3V5LA 3D94A 4IC7A 2F2CB 3P79A 1BX6A 1YW2A 4BC6A 4R1VA 5CQUA 2JLDA 2OJFE 2JKKA 3LFCA 4D9UA 2OICA 1OL7A 3IGOA 3MBLA 3LXLA 4EK3A 4WSQA 3ZSIA 3FC2A 4E4XA 2WMBA 4LUEA 2ETMA 4GYIA 4FYNA 3ZFMA 4IB0A 5DGZA 2C6DA 4KBAA 2GNLA 4O86A 5CVFA 3ZZWA 3CIKA 1A06A 2QOFA 2BAQA 4B6LA 3LFNA 4NYEA 4FV1A 5IQBA 4OTFA 3IW7A 4JBPA 2BR1A 4EK6A 1E1VA 1ZZ2A 4B0GA 1PMUA 4TT7A 1BYGA 3NYXA 2PMOX 3ORMA 3R7GA 5CYIA 3E8EA 4JLCA 5JK3A 1FGKA 4QPSA 2CKOA 3POOA 3HV4A 3SVVA 2RFNA 4KD1A 3ZLYA 2PHKA 4ZP5A 5D7AA 2VTIA 4YNEA 4ZLOA 3QU0A 4IWOA 3F5PA 3BE9A 4YZBA 2VWVA 3DZQA 4JG7A 4MD8E 3EFKA 3PVWA 5F94A 3AG9A 5CSVA 3UDBA 2XJ0A 5CI6A 3RALA 4IM2A 5GJDA 4BDIA 5LMKC 3GU6A 2FVDA 1FMKA 2WTKC 4O7NA 2WU7A 4M0YA 3ZM9A 4FKPA 4D28A 5KMNA 4E26A 3ZRLA 4QP6A 3JVSA 3RHKA 3LIJA 4DBNA 5JFXA 4L8MA 4ZS4A 4IADA 3V5WA 4TPTA 3FLNC 4ZSLA 3SLSA 2FSOX 4RJ7A 4PL4A 4C4GA 2PWLA 1M2QA 4R77A 4NW6A 4UWBA 4GG5A 4KS8A 2VWBA 4FSQA 4BY9E 4FKGA 4B4LA 2IO6A 3JY9A 1Y91A 2I0YA 4WG4A 4X2JA 3UQGA 2BKKA 2WGJA 2UW9A 2OJ9A 2I0HA 4C4EA 1YOJA 4U9AA 2HZ4A 3ZDIA 4EKKA 5M57A 3R8UA 3VBVA 5FLFA 4DGGA 3VS4A 4QYYA 5HCYA 2WTCA 3ORTA 3U55A 5HTBA 3GCPA 3BU5A 1XBCA 2W96B 4GFMA 4XG8A 5HGIA 4FZFB 2UUEA 4HZSA 3FV8A 4TNDA 3DB6A 5BVWA 2UZOA 3U87A 5BX0A 4LI5A 1BLXA 3FPMA 3O8UA 3O8PA 1Z9XA 2YZAA 4EZ7A 3OC1A 5I3OA 3W2OA 2RF9A 3N51A 3WF5A 2FGIA 4JIAA 1K2PA 4QMMA 4M67A 3R2BA 5IQEA 2PVMA 4ENYA 3EQPA 3WF6A 4L6QA 4TXCA 4F6SA 4M97A 3QRIA 2PTKA 4MF0A 3SXFA 3VF8A 5ICPA 4FEUA 2XIYA 4F7SA 3BHHA 3FYKX 3QLGA 4HGSA 5HVYA 4D2VA 5IH6A 1JKKA 2PZIA 3QWJA 3ID6C 4AZSA 1O9UA 3FJQE 3WE8A 3LFQA 3LJ0A 4IVAA 3AC4A 2QOKA 4AW0A 2W4OA 5AUWA 4YO6A 3U6IA 3C1XA 3L8PA 4FK6A 3ZCLA 3JS2A 4G9RA 4HGTA 2B0QA 4FOBA 5EW3A 3FPQA 2C5NA 5CF5A 3RZFA 2QU6A 2UZNA 2R7IA 3MH2A 3SDJA 5HLNA 3VQHA 4FV5A 5HNGA 4WNKA 2YM6A 4L00A 4W4XA 2FUMA 3TACA 5FWKK 3BBWA 4E7WA 3GT8A 1VYWA 4IHPA 4QP4A 4XG2A 3VS2A 4CNHA 1ZXEA 1B39A 3AGLA 3WBLA 1WBVA 4IQ6A 4GVAA 4JX3A 4RJ5A 1ZYLA 2R3FA 5BVNA 3SD0A 2XM8A 1CMKE 1PXNA 3F3TA 4IJPA 4U0IA 4WNMA 5HICA 4I5CA 3ZBFA 4ACDA 4UWCA 4XUFA 4TNBA 3AOXA 4XP0A 3RNIA 3WARA 1ZMVA 3MH0A 4O7LA 1G5SA 3A4PA 4KKEA 3LZBA 2NP8A 4DINA 1NVSA 3MPMA 5DLSA 5F1ZA 4YZ9A 3QTUA 4IX6A 5KO1A 4ZZOA 2JAVA 4YSMA 4O7ZA 4F99A 4IACA 4Z3VA 4XOZA 3EN4A 5EDPA 4EK8A 3L8VA 3PIYA 3MVHA 1J7UA 1PMNA 3GB2A 3QZGA 2PSQA 3P08A 3U4UA 2CGXA 1WCCA 3FYJX 5FRIA 5IQIA 4YPDA 4YJNA 3UJGA 1PYEA 4UMRA 3OXIA 4A4OA 3FAAA 4AW2A 3ZLSA 3U6HA 3CC6A 4ITIA 3P9JA 4QMOA 1H28A 2I0VA 4II5A 2BIKB 4N6ZA 4ANSA 5L2WA 1ZYJA 4E6QA 4K6ZA 4I4FA 3OBGA 4K2RA 5H2UA 3RM6A 2O8YA 3HZTA 3ZUTA 4G34A 2WMRA 2J0LA 1SZMA 2V7OA 1PXLA 3MN3A 3RK9A 1IA9A 4O0UA 4RIOA 2BFYA 4ZSGA 2VGOA 5M56A 4AE6A 3FKNA 2FB8A 2YABA 5AP4A 4C4FA 3TM0A 4KIKB 5AADA 2HXQA 1IR3A 1LUFA 4JRVA 5ANGA 2O65A 3UOLA 3ZSHA 4EYJA 4F1MA 4EC9A 3DPKA 2HZNA 4H58A 3F88A 2UZWE 4HYUA 1H1RA 2I7QA 3HAVA 3HEGA 3LQ3A 3CR0A 4MYGA 4NJDA 2VGPA 4R6VA 4A7CA 3M42A 5FDPA 4ANNA 3G2FA 3GQIA 1BL6A 3C0GA 5AR2A 4G3GA 3HKOA 5IH4A 3IG7A 4M69B 4CVAA 4U80A 1Q62A 2C6LA 2GNFA 4FT9A 2QOHA 4C0TA 4PY1A 1Z5MA 2PPQA 3CCNA 3ZC6A 2CNVA 3PVUA 5ANIA 3FY0A 3OVVA 5K5XA 3FMEA 4Q2AA 4B7TA 5L6WL 1V0BA 1XQZA 2BZKB 4RG0A 2NRYA 3FZRA 4NEUA 5J87A 4D4VA 2F49A 4CXAA 1NVQA 2XYNA 3QAME 5TR6A 2I0EA 2VTQA 3ZLWA 2CKEA 3UYTA 1BI7A 3G6GA 4YZCA 5L3AA 2J7TA 1Q8UA 2WMVA 4FSMA 4IAIA 4L9IA 3KCKA 4IBMA 3G33A 4KINA 3ZU7A 1UNHA 3QF9A 4WUNA 1JOWB 2QKRA 2GFSA 3KMMA 3E88A 5FEEA 4D5KA 3TUCA 4HYIA 5E8SA 5KMKA 4NTTA 2J0JA 2OXDA 3MH1A 4DH7A 4YBKA 2BRGA 4BGGA 2UW6A 4CFWA 3ENHA 4XP3A 2ERKA 2QVSE 3LCDA 3ZYAA 2YIRA 3QRKA 1XJDA 5HIBA 5M06A 2JIVA 2WQBA 5H8GA 1ZMWA 3QA0A 3V51A 4IW0A 4XS2A 4P4CA 4ACMA 3L9PA 3HVCA 3BV2A 4FTJA 3THBA 4YJPA 2NPQA 5AX3A 3ZFXA 4PP9A 2R3KA 4K0YA 2HXLA 2WIPA 3R9DA 5CU3A 4B8LA 5CXHA 5TF9A 2RSVA 5L8KA 5LJJA 4LV8A 1GZOA 4NSTA 3IW6A 3NPCA 5EI6A 4BWPA 4HPUE 4KIKA 5HG7A 4DCEA 5L4QA 1APME 4O0VA 2CNUA 5DE2A 3ORKA 5DBXA 2C3IB 4YJQA 4H3QA 2XM9A 3SGCA 5J7BA 3DAJA 3V5TA 3ROCA 1ZOHA 3DQXA 3FHIA 4PRJA 4BCJA 1W84A 4M69A 1AQ1A 4GT3A 3VUDA 4Y95A 4TWCA 1OMWA 4UYAA 3UIMA 4OAUC 3S00A 4HGLA 2C6TA 2CMWA 4S32A 3FQEA 3AXWA 5HCZA 1Q97A 2C5YA 4OTHA 4GU6A 4FYOA 4H3BA 3NVMB 4DT8A 5EM6A 4FSRA 4USDA 2WTIA 3BLQA 3M2WA 2YDJA 5CTPA 4BDFA 4H39A 2UZTA 2QOBA 5CU2A 1UU9A 5IA5A 4XG6A 5C4KA 4RWLA 3R8MA 2PVLA 5EHOA 2OIQA 1O6YA 3OWLA 2P4IA 4EOMA 3ORZA 1JQHA 3MPTA 3ANRA 3ZS5A 3QTZA 2GNJA 2VD5A 3VBWA 2X2KA 4IAKA 4DLIA 3GFEA 3M11A 4DFXE 3LFBA 2ZYBA 3MYGA 3PFQA 4GIIA 2WMSA 4JVGA 4RVLA 4BGHA 3MY5A 4IM3A 1F5QA 4FKIA 1OUKA 2FH9A 1H07A 4E5BA 3TJDA 5LVNA 4KUJA 1YI6A 4TYHA 3R7VA 4AFJA 1JSUA 5LVOA 1PY5A 3C4CA 3FL5A 4UWYA 5A4QA 4FEVA 5EQEA 5AX9A 3VHKA 3MW1A 2IZUA 3RAKA 3S2PA 3MB6A 4F9BA 3LKMA 5EI2A 2R3LA 3Q9YA 3SRVB 1LPUA 4W8DA 4F7JA 3FQHA 5LVMA 4N57A 3LW0A 2BZHB 3C50A 1T45A 1WBOA 2XRWA 4BCHA 2XKEA 4JXFA 4O1OA 3LCKA 4A9YA 3TV7A 4JAJA 4S30A 4EOQA 5HORA 3N4TA 3QLFA 4YTFA 4FODA 3UMXA 2UZDA 1L3RE 4CMUA 4ZJVA 4Q5HA 3ZEWA 5HKMA 5CNNA 1U46A 3D7TA 1YWVA 3GVUA 4FV4A 2YIYA 4QTDA 5E8UA 4YGAA 3KC3A 2WQNA 4UBAA 3FE3A 2RFSA 4Z55A 2WTVA 5IEYA 1J7IA 2IZTA 4MXZA 2CKQA 2BVAA 4QQ5A 2E9VA 3N4UA 4Y83A 3ITZA 5DR9A 3PJ1A 4X2GA 4F09A 2XNOA 4ONAA 4XX9A 3AD5A 3C5IA 3OW3A 4YZDA 5DRBA 4BCKA 3H0YA 4QTEA 5IQGA 1WAKA 5GIOE 3QYWA 1FVTA 2GHGA 4PF4A 3BGZA 4AGCA 4YTCA 4WD5A 1WMKA 3DLZA 4GKHA 4ZTSA 4ALVA 3NNWA 4AGUA 1U4DA 4GT5A 3LMIA 2C3KA 2Y9QA 4BDGA 4ZTNA 5KMLA 3GC7A 3D5XA 5FEDA 2YM5A 3W10A 4IANA 3A8XA 4RMZA 2WNTA 1XKKA 2WTJA 4QQTA 2ITVA 4CLJA 3PG3A 3DAEA 3UBDA 1J1BA 1MQBA 3D15A 3QTXA 4CLIA 1UKHA 4ANQA 5D12A 5J9YA 3KMWA 4Y85A 4DN5A 3DGKA 3UOKA 2BUJA 4CCBA 3MV5A 5JH6A 3UNZA 2PZ5A 2RIOA 4FEQA 4TWPA 4K33A 4L52A 4I20A 2ONLA 2CN5A 4RQKA 4A4XA 3WZDA 1YHSA 3KEXA 3SRVA 3P23A 2JDRA 5AP5A 4C4JA 1Q8WA 4EWHA 2YIWA 4I0RA 3R30A 1I09A 1JSTA 1ZLTA 4U6RA 3HDNA 3WYYA 3S0OA 3ZRMA 1IG1A 3SG9A 3ZC5A 4ACGA 3V6RA 1HCKA 3EWHA 2F9GA 2CHLA 3EL8A 2QG5A 2Y4IB 1CKPA 3OROA 4CSVA 3F82A 2EU9A 4FIIA 4GCJA 4NFNA 3TV6A 4C58A 2G15A 4CZYB 4D2SA 3LFAA 4FEXA 2WMXA 4CKRA 4RFYA 2ETRA 4QMVA 4C2WA 1W7HA 4RA5A 3KFAA 1KSWA 3RK5A 4I93A 2X6EA 5ANOA 3DFCB 3WOWA 1STCE 2B4SB 3DKCA 5EYMA 4GSBA 3RPVA 4U45A 5FUTA 1YXXA 2YDIA 5A54A 1S9IA 4FTQA 4ASZA 4G31A 3A8WA 4PL5A 4I1ZA 3NIZA 2C30A 3PDTA 4O82A 4D0XA 2BROA 2OG8A 3UYSA 2FSTX 4ASXA 4YJVA 2GU8A 2QO2A 4E3CA 3FLYA 4RWIA 3VS0A 3HUCA 3A7FA 5H8BA 5HD4A 2PE1A 3F5UA 4QNAA 5FGKA 3QBNA 3BYVA 4IFGA 4N6YA 4DG3E 2IZRA 2ZM4A 4X3FB 4EHVA 3UPZA 4I5HA 4G3DA 4IAYA 5AAFA 4LOPA 4AZEA 3HV3A 4FTAA 5EM8A 4JX7A 3R28A 4I94A 3FI8A 5HU3A 4FKUA 3QTIA 2BHEA 4NCTA 4O21A 5TO8A 3Q9XA 3WZEA 3KF7A 5JQ5A 3FC1X 2Y6OA 2C5VA 3MFRA 3F6XA 3QC4A 3G0EA 4AT5A 4O0WA 5IF1A 5IQAA 3UC4A 2B53A 4BI2A 4A4LA 4C02A 4FKWA 5E1EA 2PL0A 4LQMA 1IRKA 3D9VA 4OTIA 2GS7A 2RL5A 3FBVA 4WSYA 3AT3A 5AM6A 2YWPA 5FTOA 4FSYA 5HBJA 1UU3A 4L3PA 4YTHA 4HVIA 3B2TA 5HTCA 5JT2A 3HL7A 3NGAA 4UV0A 4F9WA 4O7RA 1SYKA 4JIKA 3T3UA 3NVKI 4ZXTA 2HZ0A 3CQEA 5M4IA 3RK7A 4L7SA 2C0IA 3T9TA 4I22A 5AIKA 4BTMA 3O0GA 5GJFA 5CEQA 4I6BA 5CVGA 3FWQA 4OTDA 4EJ7A 2ZV2A 5CANA 3OHTA 2C5OA 2C6KA 2YM4A 5B0XA 4EOKA 5L2TA 3G9NA 2RGPA 5HLWA 4FIFA 4LOOA 2C6OA 2PUNA 4O7VA 4USEA 3K2LA 2NO3A 2BTRA 3A7JA 4GRBA 2V5QA 3C4EA 2DQ7X 4FTMA 4O0TA 4PQNA 2QKWB 2O0UA 3RVGA 4M7IA 2J2IB 4FTKA 1MRVA 4PDYA 5FTQA 2SRCA 2W5AA 4FICA 3IW4A 3KK9A 2GSFA 2O64A 4QPAA 5FDXA 4XEYA 1ZOEA 4MK0A 2IG7A 2QOQA 3IGGA 3LLAA 2P33A 3LMGA 4L46A 2YERA 1Y8GA 2VTNA 1H25A 1BI8A 4FUYA 3LOKA 4IEBA 3W2CA 4F9YA 3REPA 2E9OA 4X3FA 3I5NA 2VN9A 2OKRA 3RPOA 3DOGA 5LMAA 1BL7A 3ZEPA 1OKVA 1R1WA 3R21A 2A0CX 4BDAA 4ZTMA 2PE2A 4QYFA 4DFZE 4IX3A 4KIQA 4GIHA 3VVHA 1KE9A 4EYMA 5E8TA 2R3MA 2R5TA 4ZS0A 5LCJA 4EOIA 2PY3A 4C38A 2P2HA 2OH4A 4DFLA 3NCZA 1KE7A 4GT4A 2YJRA 2JDVA 4QOXA 1G3NA 2B9FA 3KU2A 4O2PA 3AGMA 2VWXA 4O81A 4BBEA 2CSNA 3I0OA 3BZ3A 3DY7A 3IK3A 4FTCA 2HW7A 4AQCA 2R9SA 5DVRA 2DYLA 4FTLA 4LMUA 3VUKA 4AFEA 3UZTA 3M1SA 3UIXA 3HUBA 4ARKA 2E9UA 2VU3A 3EN7A 3NIEA 1H8FA 1CM8A 5AUUA 3OY3A 4APPA 4CD0A 5HI2A 4V01A 3DBDA 3H9OA 4YLLA 2X0GA 3GU4A 1OPJA 4I24A 3E64A 3JY0A 4KAOA 3O2MA 5I9VA 3FQSA 3QCSA 3SAYA 3HMIA 3PYYA 3TNIA 2QO7A 3POZA 3R1YA 4KKHA 4RJ4A 4NCTC 3C51A 3PZHA 3ZXTA 1JBPE 3BIZA 1YOLA 3G0FA 3QQJA 2JC6A 4LL5A 3PE1A 4FV0A 1PKDA 3FZ1A 3CS9A 3ACJA 4FOCA 4BR3A 3HA8A 4FV8A 2KULA 4BHNA 2Y4IC 2VV9A 4MTAA 3CQWA 3ZO1A 4EH8A 5BNJA 3VQUA 5ITAA 3O71A 5CENA 3CBLA 3I81A 3C4XA 4V0GB 4FV3A 5DG5A 4AXAA 5AEPA 1QPEA 3EMGA 4BDCA 1R3CA 1PXOA 1U5QA 3G90X 4EC8A 3EH9A 4ZTHA 3N4VA 4YLJA 4F64A 2W17A 4NM5A 4U44A 4BBFA 4FIEA 2YFXA 3BYUA 2Z7QA 3RTPA 4RFMA 3QZFA 1PXPA 2OJJA 2UW5A 1PHKA 4OGRA 3RPRA 4APCA 5KMIA 3EFWA 4FT7A 2VWIA 1IASA 3OOMA 3QKMA 5CY3A 4DGOA 2XCHA 1JKLA 3AMAA 3E3BX 3QUDA 4QP3A 5IPJA 5D10A 5LOHA 3R73A 3QC9A 4GYGA 5M51A 4IAFA 3E87A 5KZIA 3CD3A 3DJ7A 3QA8A 4MX9A 2AUHA 4QNYA 3CSVA 2AC5A 4Q9SA 3OTUA 2KTYA 3DKOA 4KIPA 2XK6A 5IUIA 2X4ZA 4DG2E 3F2RA 4NL0A 2VAGA 5AR8A 3CTJA 4QP7A 4GVJA 1IEPA 2C47A 2XIXA 2XK3A 4JQEA 5FM3A 4YHTA 5A4CA 4X3FC 3D2IA 1ZRZA 4ZZMA 3S3IA 3VBYA 5B2LA 5HO7A 4YNOA 4TYIA 3MH3A 3VIDA 3W32A 4TKSA 3R1NA 2QOIA 3GC0A 4L3LA 2R3HA 3OG7A 4AT3A 4U43A 2HYYA 1L8TA 1U54A 5EG3A 3R7UA 2Q83A 3BELA 2RG5A 4WG3A 3SQQA 3R9HA 4KRDA 4D58A 4ZLZA 3NUUA 5A3XA 3HDMA 3U9NA 4S33A 4BDJA 1GOLA 4XRLA 2QONA 4XH6A 4EONA 4I21A 2WEVA 2BAKA 4GG7A 1Y8YA 2VTJA 1GIJA 2X1NA 4JDIA 4L68A 4O1PA 4PWNA 4KSPA 3RWQA 3S4QA 4QMZA 5D9HA 4FNWA 3EL7A 3QHRA 4G5JA 4G1WA 3P7AA 3OCGA 1DAWA 4V0GA 3RCJA 4D1XA 2JKMA 3PPZA 3QZHA 3TTJA 4EOLA 5BMSA 4DEDA 4MWIA 4FV6A 2AC3A 5AP6A 4FTUA 4BB4A 4U42A 4CFMA 3AC3A 3EYHA 1YXSA 3F3ZA 4CTBA 4QP9A 5BUEA 3MFTA 3O23A 4OBOA 4FZDB 1OECA 4FVPA 3AC2A 3MVMA 1W8CA 2XUUA 5E91A 3UZRA 5AA9A 4JDJA 3ANQA 5LMBA 5E8YA 4MXOA 3R7OA 1SVEA 2JIUA 4QO9A 3VF9A 3B2WA 4AGDA 4FT5A 5CT7A 2BHHA 4FEWA 4QYEA 4ZK5A 4BDHA 3Q6WA 2C3JA 4L44A 2ZV8A 3DU8A 2XBAA 3LXNA 4I23A 3UZPA 4K18A 1O6KA 2J50A 4BZNA 4FTRA 3PPJA 4CCUA 2WIHA 4U7ZA 4W9XA 3TV4A 1YQJA 3A60A 4UMTA 5F9EA 1ZYDA 5CSHA 4AS0A 4O0RA 3QGYA 3MY1A 3BI6A 4MCVA 4EK5A 4A07A 4WBBB 5AUTA 3MESA 5IQHA 3UGCA 4D1ZA 3CJGA 1WBPA 2VNWA 2Y6MA 4F1OA 5HNBA 3LFEA 4GK3A 4ZSJA 1WBWA 4PMPA 1UNGA 3E3PA 5AIRA 2ZOQA 4FBXA 4OBQA 3VNTA 2ZB0A 1Q3DA 3ZBXA 3LFDA 1VJYA 1OI9A 1OVEA 1TQMA 1VEBA 2F7ZE 4WT6A 5FEQA 4DGNA 2ITUA 3H10A 3EJ1A 5HEZA 2JFLA 1GZNA 2VTTA 3LE6A 2BIYA 2F7XE 2XNBA 5DI1A 1SVHA 1B38A 2R2PA 4ZMEA 5ANKA 3FZTA 4RJ8A 1HCLA 2JAMA 4JJRA 4ORKA 4AZFA 2Z2WA 4WBOA 3F7WA 4O22A 2QQ7A 4O96A 5IA2A 5H3QA 5GJGA 3NNUA 4BL1A 4BF2A 4OAVB 4NFMA 4OLIA 4E8AA 5IZFA 4WHZA 4RX8A 5CS6A 4DH3A 5ACBC 4HVDA 5BYYA 3F5XA 1CSNA 3MI9A 5CX9A 5HO8A 4EHZA 2G01A 4N4SA 5J9ZA 3E8CA 1YKRA 1M7NA 2NRUA 2QOLA 2XNPA 2Z7SA 3D5UA 3LQ5A 5FBNC 2GDOA 4DA5A 5M07A 3LXPA 3HAMA 1FMOE 2ITOA 4GUEA 3VWAA 5CSWA 4FR4A 4BTFA 3NW5A 3E63A 1YXVA 3TZ7A 2R3RA 4NIFB 5KX8A 4HZRA 4FI1A 4Y5HA 4DYMA 3CTHA 3L9MA 4JAIA 4Y8DA 3QTQA 4ACCA 3HV6A 4BTJA 4EORA 5EH0A 2FA2A 2UZUE 4FIGA 4F9CA 2B55A 5E8XA 3WE4A 2OO8X 2DUVA 4BIDA 4F0GA 5JGBA 5CI7A 2OU7A 2OFVA 4KB8A 4DEAA 5A4EA 2ITZA 3NR9A 5I9YA 5L2QA 3R83A 1CKIA 4BCMA 3NUSA 3UQCA 3VUIA 3G6HA 2CCIA 1KE8A 5EI8A 4YTIA 3TNHA 3WI6A 5AP7A 2OFUA 3EKNA 1AD5A 3KF4A 4S2ZA 3MY0A 2YAAA 4ASDA 5IDPA 3U6JA 2UW7A 2HWPA 4CG8A 2XIZA 3R8VA 1UWJA 4YC8A 3F3UA 1A9UA 2CLQA 3RGFA 4AAAA 3AQVA 4C2VA 2X2LA 3O7LD 4FX3A 2Z8CA 2HIWA 4FKQA 4H36A 4MEDA 4CT1A 5IA0A 5I9ZA 3R8PA 4K9YA 1OM1A 2BDWA 3OCSA 3CLYA 4QMLA 3L1SA 5EM5A 3R8LA 4LM5A 3LJ1A 3PXRA 3DTWA 2H96A 2X7GA 3P1AA 2DWBA 2FO0A 3K54A 4BKJA 4EBVA 2JKQA 4XCUA 1F3MC 4HW7A 2PVJA 2ZJWA 3OWPA 5F4NA 4UZHA 5DWRA 5K3YA 3BHYA 4A06A 2JDOA 3GGFA 4BYIA 4F9AA 2X8DA 5FBOA 5A4TA 1UV5A 2VZ6A 3ATTA 4FNZA 2RFEA 4QP2A 3NCGA 5CSPA 4XYFA 5TOZA 1BKXA 5AP2A 3NW6A 3OEZA 4QMXA 2Y4PA 3A99A 3D7ZA 1CTPE 5CEKA 4RIYB 4XP2A 3OD6X 4EOSA 5HIEA 1R39A 2YM7A 4RFZA 4JL9A 5EM7A 1G8AA 5E92A 4GW8A 4JQ7A 2QLUA 2X8EA 3EQGA 3OF0A 5C01A 4FV2A 4Q5EA 3TTIA 1K9AA 2ITTA 4AWIA 1IAHA 5T3QA 3R22A 2C69A 3PXYA 3PRFA 5E8WA 3GBZA 2ETKA 2R3GA 2WD1A 4EH2A 3Q96A 4MD9E 1XH8A 3IDPA 2YM3A 4MXCA 3CP9A 3UQFA 2H9VA 2W1IA 5BVEA 3VBTA 3FZSA 5CU6A 3UG1A 2VTMA 1URWA 4F65A 5KHXA 5A14A 3BEGA 4OTWA 5E8VA 3E7OA 3LCOA 4U5JA 2ZM1A 3HV5A 4BYJA 4IMYA 4PMTA 4X2KA 5LCKA 4BDBA 3AC1A 4ERWA 5DEWA 3R9RA 3E8DA 2X7OA 3LQ8A 1ZAOA 4IWPA 5E90A 3FI4A 3KXGA 3OWKA 2BRBA 2WEIA 3EFJA 4KSQA 4RIXB 3WZJA 4BWKA 3WIGA 2XK8A 4GMYA 5HD7A 2ITNA 2QOOA 1H1QA 3NSZA 4QT1A 2W1FA 4BWXA 2E9PA 2I6LA 1BMKA 2GFCA 2ITQA 3QRUA 4AX8A 5BVFA 5DOSA 4TYEA 4IB5A 3OWJA 4RIWB 1RE8A 3GCQA 3ET7A 4RVTA 3Q2JA 2PUUA 4NKSA 2UW4A 3FMLA 5HX6A 2ITWA 3U4WA 2GPHA 4DG0E 4OTPA 4YJOA 2A27A 3COIA 2OXYA 5HVKA 2IW8A 4YURA 4DLJA 3QALE 3TKIA 4CTCA 4AP7A 1XH7A 1XBBA 5J7HA 2X2MA 5JFSA 3ZUVA 1QPDA 1H1PA 2ITXA 4C4IA 4EH3A 1UA2A 2GHLA 2XZSA 3MTFA 5IKWA 4D2TA 4O7YA 5KZ0A 4RJ6A 2PVNA 4J71A 5IDNA 5JGDA 1QPCA 3C4FA 3KKVA 5AP1A 1QCFA 2GNIA 2UW8A 2YISA 3DLSA 4IVBA 4CFUA 4EH7A 4YP8A 2YIQA 4FKRA 5ANEA 4LOQA 4RWKA 3WF7A 4O84A 3DBEA 5CU4A 4AA4A 1CDKA 1KV2A 1W98A 4FKJA 2PUIA 3A7IA 4K77A 2F2UA 3Q2MA 5HE1A 5EOBA 3MA3A 3CTQA 2WO6A 5DN3A 2PZRA 4HNFA 5AV3A 3QGWA 5C27A 1ZYCA 2CJMA 4I0TA 5IQFA 2VX0A 5EKOA 3ACKA 2VTSA 4IIRA 3NDMA 4CYIA 4PNKA 4AZWA 4EK4A 3C5UA 5F95A 4C61A 4IVCA 3VS6A 3KVWA 3BPRA 4OTQA 4PTCA 4MXAA 2YCFA 3IOPA 4TN6A 2JD5A 1VYZA 5K0KA 2UZEA 2W1CA 4UX9A 4NJ3A 5HESA 1Y57A 4FNYA 5AUVA 1OIYA 5DFPA 2A1AB 2PULA 2W99B 5DYJA 1MP8A 5L8JA 3EQIA 3A4OX 3BU3A 2GQRA 3NX8A 3R01A 4IB3A 4M14A 3ELJA 4FT0A 5LARA 4IAAA 2XP2A 2R3PA 4JR3A 5AP3A 3WIKA 5A4LA 5A6NA 3H9RA 2ZV9A 3DBQA 3ZLXA 4YPSA 3EHAA 4NUSA 4XG4A 4MQ1A 3FY2A 1JNKA 5EW8A 3SKCA 3CJFA 2CPKE 4FZAB 3G15A 2OXXA 4BI0A 4JG6A 2PMLX 4FL1A 5GZ9A 1ERKA 5AR3A 1YHWA 1OGUA 2XS0A 4PTGA 1U5RA 3VBQA 4J95A 5JSMA 3MTLA 3BQCA 3LVPA 3NAXA 3SV0A 2X4FA 4ZSAA 5B7VA 3FHRA 3RPYA 3EQBA 5I3RA 2X7FA 4QTAA 5DMZA 1MRYA 2EXMA 4X6QC 3B8QA 4EWQA 4C4HA 5IMEA 1PXJA 2XEZA 3IO7A 2OZOA 3TT0A 3W16A 4FF8A 2WMTA 4BICA 5CEPA 4IZ7A 2XNGA 4I6HA 3RCDA 5JQ8A 3OMVA 4OW8A 4IZAA 3QCQA 3CKWA 3VULA 5J95A 1WVYA 3PP0A 4ALWA 3FEGA 3PA4A 3BWJA 3ZO3A 3TNWA 4BZOA 4F70A 3CGOA 1ZYSA 3NRMA 1FOTA 3OUKA 3UVPA 5AJQA 1XWSA 3W2SA 4BCGA 3UP7A 3PSBA 4CYJA 4D2WA 4UMUA 3ZFYA 4O38A 5CLPA 1W82A 4LV5A 5EW9A 1NT2A 3QHWA 4FL2A 4ITHA 3NAYA 5FXSA 5AWMA 3ROYA 4D9TA 4E20A 1FVRA 5AFVA 3FMMA 1Q8YA 4L67A 1DI8A 3UOHA 1M2PA 4EI4A 3F3WA 2XK9A 3DZOA 4MQ2A 4EL9A 3LMHA 3IW5A 3F5GA 1PXKA 1LEWA 2WU6A 4HCTA 4PMSA 4DGMA 4IZYA 3AD6A 1Q4LA 3GQLA 1ZMUA 4X2FA 2IWIA 5HU9A 2WMWA 5L2SA 1UNLA 4ANMA 5CNOA 3FDNA 4QP1A 4QQJA 4FG9A 2Z02A 3HMMA 4FSWA 4UXLA 4XG7A 3E92A 5KMOA 1K3AA 4O7TA 3UMWA 4CV9A 2YJSA 4G6OA 4PMMA 3TL8A 3R7EA 4IH8A 5JRQA 1IAJA 1O6LA 2HK5A 4LGGA 5AR4A 5B2MA 4FG8A 4QMYA 5ETIA 3A2CA 2HELA 4MVFA 2H6DA 4LFIA 3QX2A 3NLBA 3MIAA 3NMUF 4K11A 3RM7A 4XJ0A 3DXPA 3DT1A 4ZJIA 4BFMA 4L7FA 4C8BA 4NT4A 4R3CA 2J5EA 4V05A 3DQWA 3I60A 2XH5A 5L6OA 4IC8A 3W33A 4O7SA 1SM2A 2E2BA 2OSCA 2QNJA 4DH8A 5L6PA 4XOYA 4J53A 4C36A 4ZOGA 5EDRA 2GQSA 1PXIA 5CSXA 5J5SA 3NWWA 4LRJA 4PV0A 4OT6A 5JFVA 4UB7A 3U9CA 3ZSGA 5M44A 3TG1A 1YI4A 3P7BA 3KREA 1OKWA 4USFA 1S9JA 4QMWA 4O0SA 5LXMA 2I1MA 2J9MA 1GZKA 2J5FA 4R5YA 4UEUA 4W9WA 1TKIA 5CXZA 4S31A 3NZ0A 3GU8A 4YZMA 4NKAA 3QKLA 2CNQA 1PJKA 4FSZA 5LQFA 3KVXA 3UG2A 5E9EA 3L8XA 2PZYA 2REIA 4MXXA 5I5ZA 3BQRA 4U40A 4JDKA 2FSLX 4MAOA 2WAJA 1WVXA 2XK4A 3GU7A 2YCQA 3Q52A 2R3QA 1JSVA 4DEBA 4AF3A 4FUXA 3FLSA 4DTBA 3L9NA 4C62A 5HG5A 2WHBA 1H08A 4OBPA 2BRNA 4D2PA 3SW7A 2AYPA 2R3JA 4D4YA 2ITPA 1XO2B 3CEKA 3GEQA 3JVRA 4KNBA 4Q9ZA 4E1ZA 4CEGA 3LCSA 2CLXA 4U81A 4DFBA 3FXWA 2EB3A 2PE0A 2VX1A 3KRRA 3NYOA 3PPKA 3PWDA 5IQCA 4JRNA 2YACA 2BDFA 2G9XA 3KXZA 5DNRA 2F7EE 3FI2A 4E93A 3F61A 4PPBA 4LGHA 5EYDA 4CQEA 3LCTA 4I41A 3QTWA 4PUZA 4U41A 4ZJJA 4J99A 4JDHA 4BRXA 3ZXZA 4EH6A 1DS5A 2QC6A 2CGVA 5C8MA 4CZTA 4QD6A 1KOAA 4BVUA 3F2AA 5CT0A 3AC8A 3DK6A 4EOJA 3C4WA 4ASEA 3JXWA 2ZMCA 4IB1A 1VZOA 3I4BA 5KMMA 1PYXA 1W0XC 2W9FB 2UVYA 4E6DA 1WZYA 4LMNA 3FL4A 2WQMA 5K4IA 3TUBA 3TKHA 3PXQA 4I4EA 4RZWA 4F7NA 3BHTA 3BYOA 3HP2A 3PXKA 4W4WA 2BRMA 2X9EA 3PWYA 3PY0A 1OKZA 2C0TA 3R00A 4C3PA 2R3NA 4O27B 4NW5A 4IDVA 3OY1A 4RC2A 3FLZA 4LYNA 4OR5A 4U3YA 5JRSA 3ATSA 2Q0NA 1OITA 4NWMA 3QQGA 3SC1A 4MHAA 5LWMA 2XBJA 4W4VA 1YWNA 1W83A 3IDCA 3PY1A 4ZSEA 4DFNA 3S1HA 2WMAA 3FI3A 3PG1A 5J9LA 4HCVA 1YOMA 4YJUA 4D55A 1VR2A 2HWOA 3ZRKA 4HCUA 4MWHA 5J8IA 5CEMA 2WELA 3ORXA 4AZVA 2JIIA 1JLUE 3ORLA 3EKKA 4X7QA 1XHAA 3EB0A 4G3EA 4IM0A 4BKZA 4UXQA 5C8NA 4R5SA 3H4JA 4R7BA 4YC6A 4YUQA 4YR8A 3R1SA 4EOOA 4ZY6A 3ETAA 3P4KA 1WVWA 5H8EA 3SX9A 2BAJA 3UO4A 3ZOSA 1EH4A 4HYSA 2YEXA 2W1DA 4CZUA 2QOCA 4PX6A 4EZ5A 4MBLA 3G5DA 5LVPA 2BILB 4GJ2A 1M14A 2QD9A 3Q4CA 2ZM3A 4HVHA 4JR7A 4I5MA 5C03A 4RVMA 2LAVA 5A9UA 5BYZA 2ZDTA 3RP9A 4BCFA 2C3LA 5F20A 4MD7E 2YM8A 2F4JA 3DCVA 3KRLA 3KRWA 5CEOA 4FZ7A 5TKDA 4F08A 3NUYA 3QFVA 4H1MA 4FL3A 3IONA 3Q4ZA 3WZKA 1MRUA 4J8NA 4EQCA 2C6MA 2YA9A 3C7QA 4AOTA 3Q53A 2ZB1A 3R8ZA 3KXMA 5AA8A 4O83A 5IG1A 1CKJA 3JYAA 3QD3A 5ACKA 3TEIA 3TNQB 1G8SA 5EKNA 2R7BA 4EQMA 2C5XA 3COHA 1PRYA 1A48A 3PP1A 3UNKA 4XLIA 3UIBA 4BCIA 2C6IA 1E9HA 3BLRA 3ODZX 4MNFA 4DEEA 4G9CA 4BTKA 4IZ5A 4AUAA 4KBCA 5GNKA 3QD0A 5D7VA 1FINA 2CDZA 3UO6A 3IDBA 3SXSA 4B8MA 5K9IA 3CQUA 3I1AA 3TNPC 1REKA 3RBWA 5ETFA 4CRSA 3TN8A 2OBJA 3Q32A 2VRXA 2XYUA 3BYSA 4GEOA 3TXOA 4RRVA 2OGVA 3RAHA 3ODYX 3SOCA 1YDSE 3I5ZA 3U8WA 3UVRA 4GH2A 4XMOA 2V0DA 3W8QA 1P14A 3IKAA 3EN6A 2BKZA 3LFFA 3E8NA 2C6EA 1UWHA 3CKXA 5I9WA 3SXRA 2Y7JA 4QMNA 2XRUA 3KULB 5J5TA 2IVSA 3C0HA 5KE0A 2XKFA 4R1YA 4Z16A 2VWWA 4O91A 5AV2A 2WFYA 4BDKA 4KRCA 3PY3A 3VO3A 3P78A 2QO9A 2Z60A 4DFUA 4EQUA 4U97A 4NM0A 3QQFA 2OIBA 3FLQA 5T68A 4BCOA 3VJOA 4DEGA 4YSJA 3QL8A 4M0ZA 2VTPA 3KCFA 3GI3A 5EHYA 2ZMDA 5L8LA 3LAUA 4I6FA 3QKKA 2GMXA 4PP7A 1Q8TA 5HIDA 2ESMA 4CFXA 3ORPA 5HCXA 4JOAA 3VN9A 3EZVA 3HX4A 4D1SA 2O2UA 2YIXA 3KY2A 3O17A 3W8LA 4ALUA 3ZH8A 4Z7HA 3PLSA 5IEXA 4YBJA 5LVLA 2WTDA 3P86A 4H3PA 2IVVA 4LUDA 4OTGA 4EKLA 4EJNA 5E7RA 2RG6A 3HGKA 4UYNA 2JEDA 5AUYA 1OL2A 3V5JA 2XCKA 3RKBA 3PE2A 4MXYA 3KXXA 4YHJA 3LJ2A 4A9SA 4Z7GA 4DF3A 3I7CA 3GOPA 3QQKA 3FKOA 3ULIA 3PZEA 2B1PA 5M53A 3PSDA 1PKGA 2WKMA 4DCAA 3FSKA 2W5BA 5HE2A 2XIRA 1E1XA 3KB7A 2OJIA 1YDTE 4L45A 4ZZNA 2OI4X 3LPBA 4ZIMA 5K0XA 2W05A 4RQVA 4WRGA 3FLWA 3ZHPC 5HZNA 2P55A 1H26A 2W4KA 1OL6A 4FKLA 4FMQA 3UC3A 2XK7A 4GUBA 4NM3A 4F63A 1GY3A 3DBCA 3EQDA 4Z9LA 4YU2A 2V55A 1H24A 1HOWA 3DA6A 3KULA 3EQCA 5ETAA 5M4UA 2YLEA 4FVQA 4EOPA 1YDRE 2G1TA 2X8IA 4BHZA 3Q5IA 1PMVA 4Y5QA 5HE3A 2C1AA 3CPCA 2P0CA 4G6LA 4IE9A 4U8ZA 3TKUA 4C34A 4CMOA 4IWDA 4BBMA 5JMSA 4OUCA 1NA7A 3PUPA 4DBXA 3DKGA 1JPAA 1OL5A 5AV0A 3FZPA 5A46A 5AP0A 2R0IA 4ZTLA 3L9LA 3NYVA 5FTGA 3HECA 2BDJA 2J4ZA 1RQQA 3CXWA 2BZIB 2UZLA 1X8BA 2V22A 4KWPA 3U51A 3RHXA 1PW2A 4F7LA 2GS6A 2X9FA 3K5VA 2VNYA 2JKOA 1FVVA 3PVBA 4TWOA 3F69A 4G16A 4PNIA 1F0QA 4B99A 1J91A 1LEZA 4S34A 1OUYA 4XLVA 1OIRA 4F6UA 4I6QA 4P5ZA 4W8EA 3R7IA 3R9OA 4D4SA 1R0PA 4G6NA 3FZOA 4JI9A 2IPXA 1JAMA 3NUNA 2QHNA 2YHVA 3GP0A 4IX4A 2PVHA 3HA6A 3F2NA 4QTCA 1LR4A 4RC3A 5M4FA 4G3CA 5J79A 3FKLA 3NS9A 4EUUA 4MBJA 3OZ6A 4J7BA 3UOJA 3QWKA 4E5AX 4HNIA 4AT4A 4DAWA 4CKIA 3IW8A 2CGWA 4J8MA 2OF4A 4HGEA 3EN5A 3EN9A 3OCTA 2HW6A 3QTSA 5KNJA 1XR1A 3QCYA 1ZARA 4L53A 3VUMA 4JQ8A 3D14A 4KIOA 3RNYA 3DDQA 3QX4A 3V8TA 3Q9ZA 2EB2A 4DTAA 1J3HA 2Z7RA 3DB8A 5HHWA 3VC4A 3I6UA 5BUJA 2ERZE 5AMNA 4AOJA 1YRPA 2XNMA 1DM2A 3P0MA 4WA9A 1XBAA 3ZO2A 2I40A 3DDPA 4OT5A 5AUZA 3W55A 4C37A 5AV1A 5B2KA 3BV3A 3KXNA 3QXOA 4KA3A 4QQCA 4EBWA 2XEYA 4R7HA 3EQRA 4XV9A 4RGJA 4JNWA 3DV3A 3G9LX 3GXLA 4FSNA 4MKCA 4MNEB 2PMIA 3V04A 3DNEA 3T3VA 3T8OA 3PXZA 2UVZA 2XA4A 5BYLA 4WG5A 4YJSA 4DEIA 4QYHA 3Q04A 3R71A 1Q5KA 4FIHA 5DR2A 5G1XA 4R3RA 4TWNA 3ORNA 5CU0A 1R0EA 3OFMA 4F0FA 3FMHA 4WNOA 2IVUA 2QLQA 4M15A 4C3FA 3HMPA 4F4PA 4FVRA 3TWJA 1YXUA 3W2PA 3EQFA 2YITA 3D2KA 3OT8A 3KGAA 2XJ1A 4HJOA 2XMYA 1KV1A 1Q99A 2HAKA 3MGYA 5DT4A 5EK7A 5AAEA 5M08A 2C4GA 2Z7LA 1ATPE 1XH9A 3OXZA 3TIZA 3UO5A 4X0MA 3OOGA 4Y73A 1SMHA 4PDOA 3Q60A 3KL8A 3Q3BA 3E93A 1RJBA 5C4LA 5HBHA 4DC2A 3W2RA 2HOGA 2J0MB 1OIQA 2G2IA 5HG8A 1V0OA 3E5AA 4M84A 4AW1A 5CAUA 1GIIA 5LWNA 4C3RA 3R2YA 5CF6A 2RFDA 2GTNA 2IZSA 3DTCA 3RAIA 3VS1A 3RMFA 4FGRA 2WOUA 4KS7A 5GINE 3TZ8A 3COKA 3PA3A 3AT4A 4FKSA 4GJ3A 4XG3A 5IEVA 4U3ZA 3GC8A 3NUXA 5CAOA 2WOTA 2IN6A 4YJTA 5I0BA 4ZTRA 2RKUA 3TCPA 4XRJA 1UVRA 2UVXA 4AZTA 4DT9A 3A7HA 3RI1A 3WF8A 3KQ7A 3W2QA 4ZTQA 3QQLA 1H1WA 3H0ZA 4MF1A 4NIFA 1V1KA 4WKQA 2O5KA 5FXQA 3D5VA 2XB7A 3R04A 1ND4A 2GNHA 2NNWB 1YXTA 1B6CB 3OUNB 3DK3A 3QRJA 2JITA 4RLKA 4DEHA 1GZ8A 2IW9A 2WMUA 4QYGA 1TQIA 3RJCA 2LGCA 4ENXA 3OEFX 4FKOA 1ZWSA 2R3IA 4MNEA 1Q3WA 3Q9WA 1ZZLA 2VX3A 3HP5A 4BZDA 2OK1A 4R7IA 1AGWA 1T46A 3KN6A 4TTHB 2VWYA 2CGUA 2CCHA 4CFNA 4K1BA 4ANOA 1XH5A 3FMJA 4R3PA 3UNJA 4FKVA 5HOAA 4Y46A 2YLFA 4RX5A 3CGFA 3HMNA 4PPAA 4DITA 5FG8A 3NNXA 1M2RA 1NXKA 5CWZA 1OIUA 2VO6A 3CE3A 1SNUA 3BHUA 5DH3A 3TZMA 5KKRB 1UU7A 3K3JA 3PRIA 3F3VA 4YZNA 3QUPA 1GAGA 1Q41A 3HMOA 4YHFA 5HX8A 4WNPA 4AGWA 2YCSA 2XIKA 1GIHA 3AMYA 5GZAA 3D5WA 3A61A 3LLTA 3QD4A 3BRBA 1JKSA 1URCA 4IJ9A 4DFYA 4LL0A 5JEBA 4E4LA 3PXFA 2X6DA 1WBNA 1OBGA 1Z57A 2P3GX 3PJ2A 5CVHA 2XF0A 4HYHA 5FD2A 3R9NA 3ZDUA 4CV8A 4EHEA 4LRMA 3OP5A 5KUPA 4JT3A 5EQYA 4AN9A 3DS6A 5KHWA 4RLLA 4TYHB 3VS5A 3QZIA 4IXPA 5E1SA 5ANDA 4YO4A 4HOKA 4K8AA 2CN8A 3HRFA 2OIDA 5AAGA 4RIYA 2QU5A 2JBOA 5DA3A 3R1QA 1J1CA 2WZJA 2G2HA 4GK4A 3V8SA 4XBUA 4FC0A 2A4LA 3AD4A 3O50A 2OW3A 2A2AA 3UE4A 3C0IA 2W9ZB 3B8RA 3II5A 2JGZA 4J98A 4KKGA 4BKYA 4FTIA 4DE4A 5EDQA 4QMTA 1KUTA 4N70A 3OTVA 2UW0A 3MJ1A 4IWQA 4RVKA 5D11A 3SOAA 3ZMMA 4LRKA 5I4NA 1H4LA 3C4ZA 2BALA 3DBFA 4X6RA 4XG9A 3WILA 5KCVA 4I3ZA 2PZPA 4B9DA 4GK2A 4EH9A 3D7TB 4UZDA 4DH1A 4A9TA 4D2RA 3PLAE 5ANJA 4R8QA 3MPAA 1LP4A 4FV7A 5E8ZA 4EHGA 3ZTXA 1KE6A 5BPYA 5IISA 3FMNA 2ZV7A 4FE2A 4X2NA 3V5QA 1V0PA 2UZBA 1TQPA 3GFWA 3F9NA 5DPVA 4EZ3A 2EUFB 3HNGA 3TZ9A 3QD2B 4F6WA 3QCXA 5GZ8A 4DHFA 2O63A 2ZAZA 2GTMA 3NW7A 4DGLC 4YJRA 5IH5A 1Q24A 2QHMA 2VO7A 3IS5A 1RW8A 4I5PA 1M17A 4RIXA 5HE0A 4EUTA 4RC4A 2BRHA 2BCJA 3KRJA 4M13A 5CF8A 4EEVA 3RINA 3VS7A 4P7EA 2BFXA 3BGQA 3SG8A 1U59A 2GHMA 2QURA 2W1ZA 2B7AA 4OTRA 3V8WA 2ITYA 5HLPA 3VRYA 2EWAA 2FYSA 2VTHA 5M55A 3K3IA 4FGBA 3ZONA 4RIWA 4XV3A 5T6KA 5BUIA 3SA0A 5D41A 5DR6A 4FT3A 3LXKA 2FSMX 2GQGA 1NVRA 3BEAA 5AR7A 3D83A 4RBLA 3WZUA 3MVJA 4L01A 2Y8OA 5D1JA 2HY81 4PTEA 3MVLA 4PPCA 4ERKA 3GENA 5CAVA 3R02A 2ZDUA 5JZJA 1H0WA 3I7BA 4FTTA 4QMPA 2PK9A 3EQHA 3GCVA 3VJNA 4ANLA 2O3PA 4C57A 4LG4A 5HTIA 2CKPA 3ZZEA 3D4QA 5CQWA 4RJ3A 5M09A 5C26A 5CAPA 3P5KA 3KXHA 5EOLA 2VUWA 3BHVA 2OJGA 2OWBA 3TIYA 4TZRA 3QRTA 5HG9A 1YHVA 1WFCA 5FM2A 4YLKA 3RZBA 4F1TA 2QR8A 4MH7A 2IVTA 3FXXA 3ALNA 2WQEA 5IA1A 3DNDA 5FQDC 2VWZA 5BVKA 4WUAA 1P4OA 5K4JA 1FPUA 4BIEA 5E4HA 2PVFA 2IW6A 4L42A 3DAKA 4AU8A 3BX5A 3BLHA 3Q5ZA 3TI1A 1NW1A 3PVGA 4UMQA 1H1SA 3NEWA 2VTLA 2GNGA 3H9FA 1H00A 3ERKA 1MUOA 3UP2A 3MFSA 4E6AA 5AM7A 4QMUA 1BUHA 4P2KA 1YVJA 1J7LA 3VHEA 1YI3A 2QI8A 3KRXA 3PSCA 3DFAA 5EHLA 2DS1A 4M12A 4W4YA 3SHEA 4TY1A 4O7WA 5DRDA 4N0SA 3OCBA 3GU5A 4RPVA 4R78A 1QMZA 2ACXA 2W4JA 3EIDA 3UODA 3MA6A 4FTOA 4O2ZA 4NU1A 4AE9A 4TL0A 4P5QA 4C59A 5JN2A 4CKJA 4BCQA 4GV1A 2WB8A 1P5EA 5CZHA 1XH4A 3PJ8A 2YWVA 3BYMA 2B52A 4IX5A 3V5PA 4C7TA 4AN3A 4RSSA 1FBNA 3A7GA 1PF8A 3PA5A 2G2FA 4J1RA 3AT2A 5IA3A 3R63A 5KMJA 1REJA 3AC5A 2OZAB 3MB7A 5CZIA 3I79A 3MWUA 2X81A 4BN1A 4E4MA 5IUHA 1NY3A 1UU8A 2J51A 2R64A 2VO0A 2W0JA 2XNNA 3D0EA 3SW4A 5HBEA 3DXNA 4BIBA 4HVSA 5CAQA 2OLCA 3EYGA 5K5NA 4RT7A 5DT0A 3V6SA 4TYJA 3EZRA 3H3CA 3OS3A 4WOVA 4UMPA 5KKRC 4PL3A 4FTNA 2QR7A 3DK7A 4G2FA 4GS6A 2B9HA 4ZLYA 3GCSA 5I9XA 4AA5A 4ANBA 4C35A 4RZVA 3FSFA 3ENMA 3P7CA 2BTSA 4WRSA 3VBXA 5L2IA 2W1EA 4CFVA 3H30A 3QQHA 3VUGA 2A19B 2B54A 2W7XA 4P90A 5JFWA 4IVDA 4YC3A 5G6VA 3LFSA 1FQ1B 2BMCA 4EH5A 4O0XA 2JDSA 4BI1A 2B9JA 4G3FA 3WF9A 3BKBA 4O6LA 3PTGA 2YAKA 3COMA 2C0OA 3BWFA 4HVGA 1RDQE 2QCSA 2VWUA 3FMDA
chains in the Genus database with same CATH superfamily
1OL1A 2BZJA 4QPMA 4F0IA 1OZ1A 2E9NA 4U79A 3E7VA 1JVPP 4ACHA 4TYGA 1IA8A 3V3VA 5EYCA 2YZLA 2EVAA 4PDPA 4UALA 2QG7A 1R78A 4ID7A 3UPXA 3KK8A 4A9UA 4ZAUA 4O6EA 1H0VA 2R0UA 3JUHA 3Q4UA 3QUEA 4FV9A 2H34A 3S95A 4BGQA 2V7AA 4FZ6A 2R4BA 3CD8A 3QXPA 3NUAA 4DTKA 1H27A 4X21A 3K5UA 1ZY5A 3QYZA 4UN0C 4IAZA 2WMQA 3OXTA 2P2IA 4JBVA 5TE0A 5AR5A 2JBPA 2J90A 3R6XA 3NUPA 3IQ7A 1KWPA 3PJCA 3TDVA 3L8SA 1P2AA 3FUPA 4M68A 5C1QB 5IMXA 3IECA 5DHJA 3HRBA 3G51A 3LM5A 3HLLA 3O8TA 4ZEGA 4D0WA 4H05A 4L3JA 2OZAA 4IDTA 2PYWA 5CASA 2ZVAA 3HRCA 2HCKA 3MFUA 3ULZA 3IPHA 3QQUA 1Y6BA 4V04A 4E6CA 2PUPA 2BPMA 2PVKA 4I6LA 2WTKB 4ZMFA 2EXEA 2VO3A 4GL9A 5A6OA 3KA0A 4J52A 3FXZA 3GUBA 3MJ2A 3VS3A 4RWJA 3PIZA 2Q0BA 4CQGA 4JS8A 4XNEA 1UKIA 5IA4A 3AMBA 1WBSA 3TUDA 3BGPA 1M52A 2WPAA 5BVOA 1FGIA 2PVRA 4HPTE 2YDKA 3GNIB 4GFOA 5J1WA 3BBTB 2HENA 2XKCA 1OKYA 1XH6A 2W06A 5EYKA 5ETCA 4DH5A 3CY2A 5IU2A 4CG9A 3EFLA 4BCPA 3OBJA 4BCNA 2JDTA 4NK9A 2XJ2A 3MS9A 3R0TA 5M4CA 3MIYA 5CF4A 4XV2A 3EOCA 5HNIX 3HYHA 3A62A 3QTRA 3VW8A 4E4NA 2X39A 3DXQA 3C13A 5AUXA 1JWHA 4FSUA 4BDDA 3BU6A 4QP8A 3VW6A 2PMNX 3OW4A 4DHIB 1OB3A 2HY0A 5JZNA 3JR1A 4ITJA 3OT3A 4MUQA 2QODA 1QL6A 4A9RA 1DAYA 4CRLA 4GFGA 3MSSA 1SNXA 1PXMA 5CEIA 3DJ6A 3F66A 2ONLC 4KBKA 3V01A 2W1HA 4M66A 4XBRA 2HZIA 2XVDA 5HO6A 5HVJA 4BDEA 5JKGA 3GC9A 1Q61A 1KOBA 2IEWA 4CT2A 3JPVA 4FK3A 2JFMA 4RA4A 4X3JA 3KMUA 2VTRA 2C1BA 5TT7A 3TJCA 1OPLA 4XHKB 5DEYA 4D4RA 3BCEA 4NTSA 4CGAA 2WQOA 4Y72A 3LM0A 4FNXA 5BMMA 3Q6UA 4TRLA 1YWRA 3O7LB 4G5PA 3RWPA 2YCRA 4AACA 4I92A 4AOIA 5JGAA 5DIAA 3UVQA 2WXVA 4GKIA 4FA2A 4EH4A 4XV1A 3FMKA 5BQ0A 4G17A 5GIPE 5FXRA 5FP6A 3MDYA 4WO5A 3UTOA 3Q4TA 3PIXA 2OH0E 2PVYA 5EQPA 1GJOA 1H01A 2GCDA 1Q8ZA 4M8TA 4QRCA 4QTBA 3R7YA 3O96A 3E62A 2J6MA 4J96A 4E5WA 1OPKA 4ZY4A 5LMKA 3RPSA 2IJMA 5BVDA 4QMQA 3VUHA 4AN2A 4MBIA 4C33A 1JKTA 1WBTA 5KBQA 2Y0AA 2XKDA 2VTAA 2OF2A 3VRZA 2J0IA 3NFFB 2C68A 4LGDA 1MQ4A 5CALA 4FIJA 3ORIA 3N9XA 3BE2A 3VAPA 3ZO4A 3ZM4A 3GOKA 1KE5A 1DI9A 5EFQA 3TDWA 2W1GA 2H8HA 4GU9A 4UY9A 1P4FA 5GHVA 3I6WA 2F57A 3UIUA 3LHJA 4YMJA 3W1FA 2R3OA 4RX9A 4JG8A 3RAWA 3CPBA 3ZUUA 4J97A 4M3QA 4NM7A 3PJ3A 3W18A 1TVOA 1QPJA 5C9CA 4AW5A 2W5HA 4CFFA 4O0YA 4E73A 3I0QA 4D5HA 3C9WA 2UZVA 3GCUA 3U54A 4IFCA 1M7QA 4H1JA 2EXCX 5DT3A 1I44A 5IQDA 1ZY4A 4RX7A 3VUTA 4AG8A 3DKFA 4CMTA 2B9IA 3NYNA 4QMSA 1Y6AA 1SVGA 3O51A 4JBOA 4NH1A 4TW9A 4PDSA 5H9BA 3T9IA 4AA0A 5KBRA 5J1VA 2PU8A 4L43A 3NNVA 3KN5A 1U54B 2VTOA 5HQ0A 4FSTA 3WYXA 2UW3A 3HV7A 5I9UA 5FP5A 1ZOGA 5C8KA 4FKTA 3IOKA 2XNEA 4JBQA 3ALOA 4I0SA 4NZWB 2UV2A 4WIHA 2V62A 4FG7A 4KABA 5AV4A 1PMEA 2YN8A 1GNGA 3CY3A 3F7ZA 2WTWA 3DJ5A 2J0KA 5IUGA 4ZY5A 1OBDA 2GS2A 3V5LA 3D94A 4IC7A 2F2CB 3P79A 1BX6A 1YW2A 4BC6A 4R1VA 5CQUA 2JLDA 2OJFE 2JKKA 3LFCA 4D9UA 2OICA 1OL7A 3IGOA 3MBLA 3LXLA 4EK3A 4WSQA 3ZSIA 3FC2A 4E4XA 2WMBA 4LUEA 2ETMA 4GYIA 1XMMA 4FYNA 3ZFMA 4IB0A 5DGZA 2C6DA 4KBAA 2GNLA 4O86A 5CVFA 3ZZWA 3CIKA 1A06A 2QOFA 2BAQA 4B6LA 3LFNA 4NYEA 4FV1A 5IQBA 4OTFA 3IW7A 4JBPA 2BR1A 4EK6A 1E1VA 1ZZ2A 4B0GA 1PMUA 4TT7A 1BYGA 3NYXA 2PMOX 3ORMA 3R7GA 5CYIA 3E8EA 4JLCA 5JK3A 1FGKA 4QPSA 2CKOA 3POOA 3HV4A 3SVVA 2RFNA 4KD1A 3ZLYA 2PHKA 4ZP5A 5D7AA 2VTIA 2IF8A 4YNEA 4ZLOA 3QU0A 4IWOA 3F5PA 3BE9A 4YZBA 2VWVA 3DZQA 4JG7A 4MD8E 3EFKA 3PVWA 5F94A 3AG9A 5CSVA 3UDBA 2XJ0A 5CI6A 3RALA 4IM2A 5GJDA 4BDIA 5LMKC 3GU6A 2FVDA 1FMKA 2WTKC 4O7NA 2WU7A 4M0YA 3ZM9A 4FKPA 4D28A 5KMNA 4E26A 3ZRLA 4QP6A 3JVSA 3RHKA 3LIJA 4DBNA 5JFXA 4L8MA 4ZS4A 4IADA 3V5WA 4TPTA 3U51A 3FLNC 4ZSLA 3SLSA 2FSOX 4RJ7A 4PL4A 4C4GA 2PWLA 1M2QA 4R77A 4NW6A 4UWBA 4GG5A 4KS8A 2VWBA 4FSQA 4BY9E 4FKGA 4B4LA 2IO6A 3JY9A 3O5AA 1Y91A 2I0YA 4WG4A 4X2JA 3UQGA 2BKKA 2WGJA 2UW9A 2OJ9A 2I0HA 4C4EA 1YOJA 4U9AA 2HZ4A 3ZDIA 4EKKA 5M57A 3R8UA 3VBVA 5FLFA 4DGGA 3VS4A 4QYYA 5HCYA 2WTCA 3ORTA 3U55A 5HTBA 3GCPA 3BU5A 1XBCA 4FRFA 2W96B 4GFMA 4XG8A 5HGIA 4FZFB 2UUEA 4HZSA 3FV8A 4TNDA 3DB6A 5BVWA 2UZOA 3U87A 5BX0A 4LI5A 1BLXA 3FPMA 3O8UA 3O8PA 1Z9XA 2YZAA 4EZ7A 3OC1A 5I3OA 3W2OA 2RF9A 3N51A 3WF5A 2FGIA 4JIAA 1K2PA 4QMMA 4M67A 3R2BA 5IQEA 2PVMA 4ENYA 3EQPA 3WF6A 2XANA 4L6QA 4TXCA 4F6SA 4M97A 3QRIA 2PTKA 4MF0A 3SXFA 3VF8A 5ICPA 4FEUA 2XIYA 4F7SA 3BHHA 3FYKX 3QLGA 4HGSA 5HVYA 4D2VA 5IH6A 1JKKA 2PZIA 3QWJA 3ID6C 4AZSA 1O9UA 3FJQE 3WE8A 3LFQA 3LJ0A 4IVAA 3AC4A 2QOKA 4AW0A 2W4OA 5AUWA 4YO6A 3U6IA 3C1XA 3L8PA 4FK6A 3ZCLA 3JS2A 4G9RA 4HGTA 2B0QA 4FOBA 5EW3A 3FPQA 2C5NA 5CF5A 3RZFA 2QU6A 2UZNA 2R7IA 3MH2A 3SDJA 5HLNA 3VQHA 4FV5A 5HNGA 4WNKA 2YM6A 4L00A 4W4XA 2FUMA 3TACA 5FWKK 3BBWA 4E7WA 3GT8A 1VYWA 4IHPA 4QP4A 4XG2A 3VS2A 4CNHA 1ZXEA 1B39A 3AGLA 3WBLA 1WBVA 4IQ6A 4GVAA 4JX3A 4RJ5A 1ZYLA 2R3FA 5BVNA 3SD0A 2XM8A 1CMKE 1PXNA 3F3TA 4IJPA 4U0IA 4WNMA 5HICA 4I5CA 3ZBFA 4ACDA 4UWCA 4XUFA 4TNBA 3AOXA 4XP0A 3RNIA 3WARA 4QEBA 1ZMVA 3MH0A 4O7LA 1G5SA 3A4PA 4KKEA 3LZBA 2NP8A 3P5JC 4DINA 1NVSA 3MPMA 5DLSA 5F1ZA 4YZ9A 3QTUA 4IX6A 5KO1A 4ZZOA 2JAVA 4YSMA 4O7ZA 4F99A 4IACA 4Z3VA 4XOZA 3EN4A 5EDPA 4EK8A 3L8VA 3PIYA 3MVHA 1J7UA 1PMNA 3GB2A 3QZGA 2PSQA 3P08A 3U4UA 2CGXA 1WCCA 3FYJX 5FRIA 5IQIA 4YPDA 4YJNA 3UJGA 1PYEA 4UMRA 3OXIA 4A4OA 3FAAA 4AW2A 3ZLSA 3U6HA 3CC6A 4ITIA 3P9JA 4QMOA 1H28A 2I0VA 4II5A 2BIKB 4N6ZA 4ANSA 5L2WA 1ZYJA 4E6QA 4K6ZA 4I4FA 3OBGA 4K2RA 5H2UA 3RM6A 2O8YA 3HZTA 3ZUTA 4G34A 4AXEA 2WMRA 2J0LA 1SZMA 2V7OA 1PXLA 3MN3A 3RK9A 1IA9A 4O0UA 4RIOA 2BFYA 4ZSGA 2VGOA 5M56A 4AE6A 3FKNA 2FB8A 2YABA 5AP4A 4C4FA 3TM0A 4KIKB 5AADA 2HXQA 1IR3A 1LUFA 4JRVA 5ANGA 2O65A 3UOLA 3ZSHA 4EYJA 4F1MA 4EC9A 3DPKA 2HZNA 4H58A 3F88A 2UZWE 4HYUA 1H1RA 2I7QA 3HAVA 3HEGA 3LQ3A 3CR0A 4MYGA 4NJDA 2VGPA 4R6VA 4A7CA 3M42A 5FDPA 4ANNA 3G2FA 3GQIA 1BL6A 2A98A 3C0GA 4G3GA 3HKOA 5AR2A 5IH4A 3IG7A 4M69B 4CVAA 4U80A 1Q62A 2C6LA 2GNFA 4FT9A 2QOHA 4C0TA 4PY1A 1Z5MA 2PPQA 3W0PA 3CCNA 3ZC6A 2CNVA 3PVUA 5ANIA 3FY0A 3OVVA 5K5XA 3FMEA 4Q2AA 4B7TA 5L6WL 1V0BA 1XQZA 2BZKB 4RG0A 2NRYA 3FZRA 4NEUA 3W0QA 5J87A 4D4VA 2F49A 4CXAA 1NVQA 2XYNA 3QAME 5TR6A 2I0EA 2VTQA 3ZLWA 2CKEA 3UYTA 1BI7A 3G6GA 4YZCA 5L3AA 2J7TA 1Q8UA 2WMVA 4FSMA 4IAIA 4L9IA 3KCKA 4IBMA 3G33A 4KINA 3ZU7A 1UNHA 3QF9A 4WUNA 1JOWB 2QKRA 2GFSA 3KMMA 3E88A 5FEEA 4D5KA 3TUCA 4HYIA 5E8SA 5KMKA 4NTTA 2J0JA 2OXDA 3MH1A 4DH7A 4YBKA 2BRGA 4BGGA 2UW6A 4CFWA 3ENHA 4XP3A 2ERKA 2QVSE 3LCDA 3ZYAA 2YIRA 3QRKA 1XJDA 5HIBA 4LDTA 2JIVA 2WQBA 5M06A 5H8GA 1ZMWA 3QA0A 3V51A 4IW0A 4XS2A 4P4CA 4ACMA 3L9PA 3HVCA 3BV2A 4FTJA 3THBA 4YJPA 2NPQA 5AX3A 3ZFXA 4PP9A 2R3KA 4K0YA 2HXLA 2WIPA 3R9DA 5CU3A 4B8LA 5CXHA 5TF9A 2RSVA 5L8KA 5LJJA 4LV8A 1GZOA 4NSTA 3IW6A 3NPCA 5EI6A 4BWPA 4HPUE 4KIKA 5HG7A 4DCEA 5L4QA 1APME 4O0VA 2CNUA 5DE2A 3ORKA 5DBXA 2C3IB 4YJQA 4H3QA 2XM9A 3SGCA 5J7BA 3DAJA 3V5TA 3ROCA 1ZOHA 3DQXA 3FHIA 4PRJA 4BCJA 1W84A 4M69A 1AQ1A 4GT3A 3VUDA 4Y95A 4TWCA 1OMWA 4UYAA 3UIMA 4OAUC 3S00A 4HGLA 2C6TA 2CMWA 4S32A 3FQEA 3AXWA 5HCZA 1Q97A 2C5YA 4OTHA 4GU6A 4FYOA 4H3BA 3NVMB 4DT8A 5EM6A 4FSRA 4USDA 3TYKA 2WTIA 3BLQA 3M2WA 2YDJA 5CTPA 4BDFA 4H39A 2UZTA 2QOBA 5CU2A 1UU9A 5IA5A 4XG6A 5C4KA 4RWLA 3R8MA 2PVLA 5EHOA 2OIQA 1O6YA 3OWLA 2P4IA 4EOMA 3ORZA 1JQHA 3MPTA 3ANRA 3ZS5A 3QTZA 2GNJA 2VD5A 3VBWA 2X2KA 4IAKA 4DLIA 3W0RA 3GFEA 3M11A 4DFXE 3LFBA 2ZYBA 3MYGA 3PFQA 4GIIA 2WMSA 4JVGA 4RVLA 4BGHA 3MY5A 4IM3A 1F5QA 4FKIA 1OUKA 2FH9A 1H07A 4E5BA 3TJDA 5LVNA 4KUJA 1YI6A 4TYHA 3R7VA 4AFJA 1JSUA 5LVOA 1PY5A 3C4CA 3FL5A 4UWYA 5A4QA 4FEVA 5EQEA 5AX9A 3VHKA 3MW1A 3UDSA 2IZUA 3RAKA 3S2PA 3MB6A 4F9BA 3LKMA 5EI2A 2R3LA 3Q9YA 3SRVB 1LPUA 4W8DA 4F7JA 3FQHA 5LVMA 4N57A 3LW0A 2BZHB 3C50A 1T45A 1WBOA 2XRWA 4BCHA 2XKEA 4JXFA 4O1OA 3LCKA 4A9YA 3TV7A 4JAJA 4S30A 4EOQA 5HORA 3N4TA 3QLFA 4YTFA 4FODA 3UMXA 2UZDA 1L3RE 4CMUA 4ZJVA 4Q5HA 3ZEWA 5HKMA 5CNNA 1U46A 3D7TA 1YWVA 3GVUA 4FV4A 2YIYA 4QTDA 5E8UA 4YGAA 3KC3A 2WQNA 4UBAA 3FE3A 2RFSA 4Z55A 2WTVA 5IEYA 1J7IA 2IZTA 4MXZA 2CKQA 2BVAA 4QQ5A 2E9VA 3N4UA 4Y83A 3ITZA 5DR9A 3PJ1A 4X2GA 4F09A 2XNOA 4ONAA 4XX9A 3AD5A 3C5IA 3OW3A 4YZDA 5DRBA 4BCKA 3H0YA 4QTEA 5IQGA 1WAKA 5GIOE 3QYWA 1FVTA 2GHGA 4PF4A 3BGZA 4AGCA 4YTCA 4WD5A 1WMKA 3DLZA 4GKHA 4ZTSA 4ALVA 3NNWA 4AGUA 1U4DA 4GT5A 3LMIA 2C3KA 2Y9QA 4BDGA 4ZTNA 5KMLA 3GC7A 3D5XA 5FEDA 2YM5A 3W10A 4IANA 3A8XA 4RMZA 2WNTA 1XKKA 2WTJA 4QQTA 2ITVA 4CLJA 3PG3A 3DAEA 3UBDA 1J1BA 1MQBA 3D15A 3QTXA 4CLIA 1UKHA 4ANQA 5D12A 5J9YA 3KMWA 4Y85A 4DN5A 3DGKA 3UOKA 2BUJA 4CCBA 3MV5A 5JH6A 3UNZA 2PZ5A 2RIOA 4FEQA 4TWPA 1G8KA 4K33A 4L52A 4I20A 2ONLA 2CN5A 4RQKA 4A4XA 3WZDA 1YHSA 3KEXA 3SRVA 3P23A 2JDRA 5AP5A 4C4JA 1Q8WA 4EWHA 2YIWA 4I0RA 3R30A 1I09A 1JSTA 1ZLTA 4U6RA 3HDNA 3WYYA 3S0OA 3ZRMA 1IG1A 3SG9A 3ZC5A 4ACGA 3V6RA 1HCKA 3EWHA 2F9GA 2CHLA 3EL8A 2QG5A 2Y4IB 1CKPA 3OROA 4CSVA 3F82A 2EU9A 4FIIA 4GCJA 4NFNA 3TV6A 4C58A 2G15A 4CZYB 4D2SA 3LFAA 4FEXA 2WMXA 4CKRA 4RFYA 2ETRA 4QMVA 4C2WA 1W7HA 4RA5A 3KFAA 1KSWA 3RK5A 4DDGA 4I93A 2X6EA 5ANOA 3DFCB 3WOWA 1STCE 2B4SB 3DKCA 5EYMA 4GSBA 3RPVA 4U45A 5FUTA 1YXXA 2YDIA 5A54A 1S9IA 4FTQA 4ASZA 4G31A 3A8WA 4PL5A 4I1ZA 3NIZA 2C30A 3PDTA 4O82A 4D0XA 2BROA 2OG8A 3UYSA 2FSTX 4ASXA 4YJVA 2GU8A 2QO2A 4E3CA 3FLYA 4RWIA 3VS0A 4BJJA 3HUCA 3A7FA 5H8BA 5HD4A 2PE1A 3F5UA 4QNAA 5FGKA 3QBNA 3BYVA 4IFGA 4N6YA 4DG3E 2IZRA 2ZM4A 4X3FB 4EHVA 3UPZA 4I5HA 4G3DA 4IAYA 5AAFA 4LOPA 4AZEA 3HV3A 4FTAA 5EM8A 4JX7A 3R28A 4I94A 3FI8A 5HU3A 4FKUA 3QTIA 2BHEA 4NCTA 4O21A 5TO8A 3Q9XA 3WZEA 3KF7A 5JQ5A 3FC1X 2Y6OA 2C5VA 3MFRA 3F6XA 3QC4A 3G0EA 4AT5A 4O0WA 5IF1A 5IQAA 3UC4A 2B53A 4BI2A 4A4LA 4C02A 4FKWA 5E1EA 2PL0A 4LQMA 4DHZA 1IRKA 3D9VA 4OTIA 2GS7A 2RL5A 3FBVA 4WSYA 3AT3A 5AM6A 2YWPA 5FTOA 4FSYA 5HBJA 1UU3A 4L3PA 4YTHA 4HVIA 3B2TA 5HTCA 5JT2A 3HL7A 3NGAA 4UV0A 4F9WA 4O7RA 1SYKA 4JIKA 3T3UA 3NVKI 4ZXTA 2HZ0A 3CQEA 5M4IA 3RK7A 4L7SA 2C0IA 3T9TA 4I22A 5AIKA 4BTMA 3O0GA 5GJFA 5CEQA 4I6BA 5CVGA 3FWQA 4OTDA 4EJ7A 2ZV2A 5CANA 3OHTA 2C5OA 2C6KA 2YM4A 5B0XA 4EOKA 5L2TA 3G9NA 2RGPA 5HLWA 4DDIA 4FIFA 4LOOA 2C6OA 2PUNA 4O7VA 4USEA 3K2LA 2NO3A 2BTRA 3A7JA 4GRBA 2V5QA 3C4EA 2DQ7X 4FTMA 4O0TA 4PQNA 2QKWB 4FJVA 2O0UA 3RVGA 4M7IA 2J2IB 4FTKA 1MRVA 4PDYA 5FTQA 2SRCA 2W5AA 4FICA 3IW4A 2X0OA 3KK9A 2GSFA 2O64A 4QPAA 5FDXA 4XEYA 1ZOEA 4MK0A 2IG7A 2QOQA 3IGGA 3LLAA 2P33A 3LMGA 4L46A 1TZDA 2YERA 1Y8GA 2VTNA 1H25A 1BI8A 4FUYA 3LOKA 4IEBA 3W2CA 4F9YA 3REPA 2E9OA 4X3FA 3I5NA 2VN9A 2OKRA 3RPOA 3DOGA 5LMAA 1BL7A 3ZEPA 2XAMA 1OKVA 1R1WA 3R21A 2A0CX 4BDAA 4ZTMA 1TFFA 2PE2A 4QYFA 4DFZE 4IX3A 4KIQA 4GIHA 3VVHA 1KE9A 4EYMA 5E8TA 2R3MA 2R5TA 4ZS0A 5LCJA 4EOIA 2PY3A 4C38A 2P2HA 2OH4A 4DFLA 3NCZA 1KE7A 4GT4A 2YJRA 2JDVA 4QOXA 1G3NA 2B9FA 3KU2A 4O2PA 3AGMA 2VWXA 4O81A 4BBEA 2CSNA 3I0OA 3BZ3A 3DY7A 3IK3A 4FTCA 2HW7A 4AQCA 2R9SA 5DVRA 2DYLA 4FTLA 3ML1A 4LMUA 3VUKA 4AFEA 3UZTA 3M1SA 3UIXA 3HUBA 4ARKA 2E9UA 2VU3A 3EN7A 3NIEA 1H8FA 1CM8A 5AUUA 3OY3A 4APPA 4CD0A 5HI2A 4V01A 3DBDA 3H9OA 4YLLA 2X0GA 3GU4A 1OPJA 4I24A 3E64A 3JY0A 4KAOA 3O2MA 2ZFYA 5I9VA 3FQSA 3QCSA 3SAYA 3HMIA 3PYYA 3TNIA 2QO7A 3POZA 3R1YA 4KKHA 4RJ4A 4NCTC 3C51A 3PZHA 3ZXTA 1JBPE 3BIZA 1YOLA 3G0FA 3QQJA 2JC6A 4LL5A 3PE1A 2AQXA 4FV0A 1PKDA 3FZ1A 3CS9A 3ACJA 4FOCA 4BR3A 3HA8A 4FV8A 2KULA 4BHNA 2Y4IC 2VV9A 4MTAA 3CQWA 3ZO1A 4EH8A 5BNJA 3VQUA 5ITAA 3O71A 5CENA 3CBLA 3I81A 3C4XA 4V0GB 4FV3A 5DG5A 4AXAA 5AEPA 1QPEA 3EMGA 4BDCA 1R3CA 1PXOA 1U5QA 3G90X 4EC8A 3EH9A 4ZTHA 3N4VA 4YLJA 4F64A 2W17A 4NM5A 4U44A 4BBFA 4FIEA 2YFXA 3BYUA 2Z7QA 3RTPA 4RFMA 3QZFA 1PXPA 2OJJA 2UW5A 1PHKA 4OGRA 3RPRA 4APCA 5KMIA 3EFWA 4FT7A 2VWIA 1IASA 3OOMA 3QKMA 5CY3A 4DGOA 2XCHA 1JKLA 3AMAA 3E3BX 3QUDA 4QP3A 5IPJA 5D10A 5LOHA 3R73A 3QC9A 4GYGA 5M51A 4IAFA 3E87A 5KZIA 3CD3A 3DJ7A 3QA8A 4MX9A 2AUHA 4QNYA 3CSVA 2AC5A 4Q9SA 3OTUA 2KTYA 3DKOA 4KIPA 2XK6A 1W2FA 5IUIA 2X4ZA 4DG2E 3F2RA 4NL0A 2VAGA 5AR8A 3CTJA 4QP7A 4GVJA 1IEPA 2C47A 2XIXA 2XK3A 4JQEA 5FM3A 3PUFC 4YHTA 5A4CA 4X3FC 3D2IA 1ZRZA 4ZZMA 3S3IA 3VBYA 5B2LA 5HO7A 4YNOA 4TYIA 3MH3A 3VIDA 3W32A 4TKSA 3R1NA 2QOIA 3GC0A 4L3LA 2R3HA 3OG7A 4AT3A 4U43A 2HYYA 1L8TA 1U54A 5EG3A 3R7UA 2Q83A 3BELA 2RG5A 4WG3A 3SQQA 3R9HA 4KRDA 4D58A 4ZLZA 3NUUA 5A3XA 3HDMA 3U9NA 4S33A 4BDJA 1GOLA 4XRLA 2QONA 4XH6A 4EONA 4I21A 2WEVA 2BAKA 4GG7A 1Y8YA 2VTJA 1GIJA 2X1NA 4JDIA 4L68A 4O1PA 4PWNA 4KSPA 3RWQA 3BLAA 3S4QA 4QMZA 4JMQA 5D9HA 4FNWA 3EL7A 3QHRA 4G5JA 4G1WA 3P7AA 3OCGA 1DAWA 4V0GA 3RCJA 4D1XA 3W0NA 2JKMA 3PPZA 3QZHA 3TTJA 4EOLA 5BMSA 4DEDA 4MWIA 4FV6A 2AC3A 5AP6A 4FTUA 4BB4A 4U42A 4CFMA 3AC3A 3EYHA 1YXSA 3F3ZA 4CTBA 4QP9A 5BUEA 3MFTA 3O23A 4OBOA 5BV3A 4FZDB 1OECA 4FVPA 3AC2A 3MVMA 1W8CA 2XUUA 5E91A 3UZRA 5AA9A 4JDJA 3ANQA 5LMBA 5E8YA 4MXOA 3R7OA 1SVEA 2JIUA 4QO9A 3VF9A 3B2WA 4AGDA 4FT5A 5CT7A 2BHHA 4FEWA 4QYEA 4ZK5A 4BDHA 3Q6WA 2C3JA 4L44A 2ZV8A 3DU8A 2XBAA 3LXNA 4I23A 3UZPA 4K18A 1O6KA 2J50A 4BZNA 4FTRA 3PPJA 4CCUA 2WIHA 4U7ZA 4W9XA 3TV4A 1YQJA 3A60A 4UMTA 5F9EA 1ZYDA 5CSHA 4AS0A 4O0RA 3QGYA 3MY1A 3BI6A 4MCVA 4EK5A 4A07A 4WBBB 5AUTA 3MESA 5IQHA 3UGCA 4D1ZA 3W0SA 3CJGA 1WBPA 2VNWA 2Y6MA 4F1OA 5HNBA 3LFEA 4GK3A 4ZSJA 1WBWA 4PMPA 1UNGA 3E3PA 5AIRA 2ZOQA 4FBXA 4OBQA 3VNTA 2ZB0A 1Q3DA 3ZBXA 3LFDA 1VJYA 1OI9A 1OVEA 1TQMA 1VEBA 2F7ZE 4WT6A 5FEQA 4DGNA 2ITUA 3H10A 3EJ1A 5HEZA 2JFLA 1GZNA 2VTTA 3LE6A 2BIYA 2F7XE 2XNBA 5DI1A 1SVHA 1B38A 2R2PA 4ZMEA 5ANKA 3FZTA 4RJ8A 1HCLA 2JAMA 4JJRA 4ORKA 4AZFA 2Z2WA 4WBOA 3F7WA 4O22A 2QQ7A 4O96A 5IA2A 5H3QA 5GJGA 3NNUA 4BL1A 4BF2A 4OAVB 4NFMA 4OLIA 4E8AA 5IZFA 4WHZA 4RX8A 5CS6A 4DH3A 5ACBC 4HVDA 5BYYA 3F5XA 1CSNA 3MI9A 5CX9A 5HO8A 4EHZA 2G01A 4N4SA 5J9ZA 3E8CA 1YKRA 1M7NA 2NRUA 2QOLA 2XNPA 2Z7SA 3D5UA 3LQ5A 5FBNC 2GDOA 4AQKA 4DA5A 5M07A 3LXPA 3HAMA 1FMOE 2ITOA 4GUEA 3VWAA 5CSWA 4FR4A 4BTFA 3NW5A 3E63A 1YXVA 3TZ7A 2R3RA 4NIFB 5KX8A 4HZRA 4FI1A 4Y5HA 4DYMA 3CTHA 3L9MA 4JAIA 4Y8DA 3QTQA 4ACCA 3HV6A 4BTJA 4EORA 3BL9A 5EH0A 2FA2A 2UZUE 1XMLA 4FIGA 4F9CA 2B55A 5E8XA 3WE4A 2OO8X 2DUVA 4BIDA