2V7AA

Crystal structure of the t315i abl mutant in complex with the inhibitor pha-739358
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
270
structure length
269
Chain Sequence
DKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIIIEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
publication title Crystal Structure of the T315I Abl Mutant in Complex with the Aurora Kinases Inhibitor Pha-739358.
pubmed doi rcsb
source organism Homo sapiens
total genus 81
structure length 269
sequence length 270
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2v7aA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2v7aA01
4HJOA 4GT4A 4DG2E 3QTQA 4EKKA 1G8SA 4QMTA 3IW7A 3CY2A 2YFXA 5FP6A 1SNUA 2QKRA 4QP1A 4AW0A 5HKMA 1JSVA 4FZAB 3BYMA 4BZDA 3F3VA 3FLNC 4ARKA 4BN1A 5EKNA 3ORZA 2Y6OA 3OROA 5EI2A 4UMPA 5E9EA 3FI4A 4K2RA 3PWYA 4EWQA 2PE1A 4DLJA 3U9NA 4IWOA 4PDPA 3UZPA 4TKSA 3SOAA 3BGQA 5IEXA 1OBGA 2V0DA 3RINA 3U6HA 4MX9A 4TYHB 1CKIA 4FNXA 2W5HA 4X3FB 1SVHA 5IUHA 3RI1A 5L8LA 1P4FA 3SG8A 3D5VA 4FGBA 5DH3A 2BRGA 4DITA 3Q5IA 5HVYA 2CKEA 3NX8A 3NYOA 3QL8A 4AZWA 1OB3A 1Q5KA 2E9UA 2B54A 2W5BA 2CHLA 3R8MA 2AYPA 4ZS0A 2ZV2A 3V5PA 4FV7A 3DB8A 4JIAA 4OTRA 5B2MA 4BR3A 4QYFA 3W16A 3WIGA 3MIAA 2C0TA 1JAMA 4MXZA 4R7HA 2JDRA 3RAIA 1I09A 3GFEA 4KRDA 5AP7A 2YM6A 1PHKA 3PVWA 2HW6A 2UV2A 4KINA 3W2CA 2C6OA 3KU2A 4JQEA 3RWQA 4ACDA 4HW7A 1ND4A 1XH7A 3U4WA 3KULA 4RWIA 4NKAA 3HRCA 4KBCA 4HGSA 1Q62A 3F2AA 3TXOA 4BTJA 1H1WA 2DWBA 3NUSA 3SGCA 2FO0A 4F7LA 2C47A 4U9AA 1YDTE 4DEEA 4ZTRA 3FAAA 4E5AX 2GNHA 4I6BA 4YJPA 4FF8A 3R63A 2GNJA 1T46A 5J8IA 4WG3A 1PXMA 4NJ3A 2IZUA 5AM6A 4XV3A 2DS1A 3MIYA 2OSCA 2ITXA 4J95A 4GL9A 4DGOA 1Q4LA 3IGOA 3MWUA 2XCKA 3PJCA 5ANJA 4E26A 5I0BA 3GC7A 5CX9A 4Q9ZA 4D4SA 3ALOA 4I0SA 3EWHA 1YVJA 1OPLA 2ITQA 2OIDA 5DI1A 4RVLA 3C1XA 3TKUA 2WTKB 2F2UA 1PKDA 1OL2A 1PRYA 5DLSA 2DUVA 2H96A 2WO6A 5I9WA 3TUBA 4QRCA 4QYEA 3QFVA 4OTHA 2EVAA 1K2PA 4E4MA 2C6LA 3AMYA 3Q6WA 3QZIA 1UKIA 5CF5A 4MXOA 2PUNA 5C1QB 5EOLA 2X8EA 4B6LA 4PX6A 4X2FA 4XG2A 4BICA 3F82A 3MVHA 4GU6A 1LEWA 2BRBA 1UV5A 3LAUA 4D2SA 3RK9A 4YTFA 1H1SA 1HCKA 4H3QA 3UC3A 4D0WA 4O7SA 2XEZA 4H1MA 4EONA 4FTTA 4RLLA 5IA5A 2GHMA 2XH5A 3DAEA 4JAJA 4KS8A 5EH0A 3CTHA 1J7UA 3NRMA 1W98A 1GIIA 2IVSA 4KNBA 4G5PA 2GMXA 4IFCA 2PZYA 3OFMA 4A9YA 5BPYA 3RPOA 3NAXA 1LUFA 5ANOA 1JSTA 1MUOA 2OIQA 3KCKA 2VWUA 1J7IA 3CQWA 3JY9A 4M0ZA 3C4EA 4QPAA 5FM2A 5M53A 1JVPP 3DTWA 3KVWA 5BVNA 3WZEA 2ITPA 3NYVA 1S9JA 2GNFA 3TG1A 5C26A 5D11A 5K5XA 4BCFA 4HGTA 4RX8A 4WIHA 4KIQA 4S31A 5DHJA 2ZMDA 2WQEA 5HBJA 2ZDTA 3EQBA 3ZO2A 2W4KA 3CIKA 1ERKA 1YXXA 4CZUA 4E8AA 2PYWA 2GNIA 2WTIA 4RJ5A 5HBEA 4GFOA 3R6XA 2B53A 4U6RA 5AIRA 2R3JA 5AV2A 2Y4IB 4XCUA 2JBOA 3LFSA 1H28A 4V0GA 4C2VA 4AZFA 4Q9SA 4CG8A 4FKPA 4RFMA 5LVLA 3FQEA 4I4EA 4TYEA 5TOZA 5LMAA 4EH4A 4TTHB 2BMCA 3RBWA 4AOIA 3V6RA 3F3TA 2HZNA 3MJ1A 4G5JA 5LVMA 3FKOA 3ZLYA 1Q99A 2YJSA 3ZZWA 3H3CA 4PMTA 5A9UA 2UVZA 2LAVA 5AR3A 1PXIA 3KF4A 5EW3A 4LQMA 3MFUA 1OVEA 1YXUA 3MFRA 3OTUA 2R3RA 5BYLA 3W18A 5ANDA 4JJRA 2HWPA 1R1WA 2QOOA 3BQRA 5EDRA 5AR8A 2WZJA 3MJ2A 4QMLA 4CTBA 4EOKA 2EWAA 1J1BA 2BAKA 2PHKA 3EN6A 5BUIA 4V01A 3CQEA 2JKKA 5M57A 1JKSA 3OEFX 3P86A 4YP8A 2HCKA 2OJGA 3DKOA 1W7HA 3GOKA 3M2WA 4ACGA 4BI2A 2HY0A 4MYGA 4QNYA 4DGMA 2J50A 3Q96A 4A4OA 3P7BA 2VX3A 3PRFA 2VTNA 3K5VA 3DFAA 3GU8A 4YHJA 5L3AA 3LQ8A 2P2HA 5I9XA 4NYEA 4YBJA 4ZXTA 4I21A 1VYZA 5IQIA 4NT4A 4USEA 5FXQA 5HICA 3T3VA 4ZTLA 1GOLA 2X4FA 3F3UA 3F5XA 3LLTA 4RRVA 1GJOA 2W1ZA 2WD1A 3KRRA 3WZUA 4EOOA 4G6OA 2W1GA 3GI3A 5TT7A 1PXLA 2JKQA 3CC6A 1U46A 2ITYA 4WHZA 1Y6AA 5HZNA 2C5NA 3BYOA 3HMNA 4L3JA 4PP7A 5M06A 3MFTA 3RM7A 4YUQA 1WBVA 5DRDA 3VBVA 3UQGA 4DN5A 4LRJA 3CEKA 1U54A 3R7YA 3U8WA 4CKRA 5K9IA 4EWHA 2C6EA 3AT4A 3QD0A 3TEIA 4K18A 3R1NA 5CEPA 3MBLA 2PZIA 4QYGA 2OK1A 3IOKA 4TZRA 4E4XA 3NMUF 3QUPA 4BCIA 3GU5A 3F9NA 2UZVA 4KSQA 4CLJA 1PXOA 5LXMA 3FMKA 4IX3A 1XH9A 3AC3A 3NNUA 3Q9ZA 3P4KA 1F0QA 4R8QA 3C9WA 5DPVA 4DGGA 2Q83A 4WRSA 5IQAA 2AC5A 1UWHA 3UIXA 5JZNA 3QQJA 4FTMA 3NUXA 3U6JA 2BUJA 3VVHA 4XG7A 1OPKA 2UZUE 4D58A 4Z7GA 5KBRA 5KMOA 3TDWA 1IEPA 2CJMA 2VU3A 5BVWA 3O8PA 3Q53A 3A99A 5FBOA 4YURA 2WMSA 3G5DA 4D2VA 3BGZA 3TTIA 3DY7A 3A60A 3Q4UA 4FZDB 4ASZA 4PDYA 4RX7A 5ANEA 5E7RA 3ZDIA 4O0XA 4XRJA 4J1RA 4XH6A 4XNEA 3P23A 2Z7LA 5EHLA 1H08A 2ZM1A 3CTQA 2JITA 2UW0A 3C5UA 4DINA 2VO3A 5JT2A 4HYUA 4EUUA 4BTMA 4CMUA 3COMA 5KUPA 5AADA 2XYNA 2X7FA 4L3PA 3UNKA 4L43A 4FNZA 4HYHA 5CEIA 2P3GX 3TJDA 2UVXA 5D7AA 2IW6A 5EDPA 3KMWA 2QLQA 4M69A 1YOMA 5EW8A 2C5VA 3SRVA 4C33A 4O0SA 3IECA 5L4QA 4DA5A 4GRBA 1P2AA 5CY3A 3CD3A 1QL6A 2WMAA 3LXPA 1MRVA 3F3WA 5FTOA 2X8DA 1J7LA 4QMMA 3NR9A 1KOBA 4D2TA 1BUHA 3C4FA 4IM3A 2XVDA 5LVPA 2VWWA 3VJOA 3VUHA 3D7TA 3ZXZA 1IRKA 2I6LA 2X2MA 4LI5A 3DBEA 3UIBA 2CNVA 2ERKA 3SLSA 4IZ7A 3AMBA 2Z7RA 1WBSA 4GFMA 4ZEGA 2XBJA 3TM0A 5LJJA 2RFEA 1SM2A 2JAVA 4LGGA 2QG5A 3ZSIA 3DKGA 4TYGA 3NDMA 4E6CA 2VWXA 3S00A 4CYJA 2X39A 5IQEA 3FI3A 4KIKB 3VBWA 5A4EA 3ZBXA 3KMMA 2YM8A 1GZ8A 4CQGA 5HTBA 4ZZOA 5C8NA 2ETMA 4NFMA 4ITHA 5JKGA 3JR1A 3EQDA 2P33A 3QCQA 2YWVA 4BB4A 4MHAA 4YJUA 5HOAA 4LV8A 3CCNA 3PIZA 4FTJA 2R7IA 3WF9A 4O0YA 4CMOA 1JKLA 2HZ0A 2PL0A 4TT7A 4EK5A 5IQFA 5CQWA 3QC4A 2R3PA 5CSVA 3ZEWA 3W2OA 3BLHA 4LG4A 4D4YA 1SMHA 2RIOA 3QCYA 4UMUA 4F63A 4JX7A 4F9BA 4FIHA 3AD5A 5HNIX 2WB8A 3NW6A 2YAAA 3PZHA 3TV7A 4BDCA 4YC6A 2FSTX 5KMNA 3QKMA 3M1SA 2GQSA 2UW9A 4NCTA 3A8XA 4HNFA 3SDJA 1OL6A 3R7EA 5CAOA 2HZIA 4AE9A 4BGGA 2FGIA 3NIZA 5JN2A 5B2LA 2RKUA 2CCHA 3LFBA 1E1VA 2C5XA 4U5JA 4BY9E 4ZAUA 2R5TA 4ZTHA 1PF8A 3PXYA 4JG7A 1ZYLA 4QMZA 2VTOA 4JRVA 2XNEA 3GCQA 3L9MA 3KVXA 2OF2A 1FGKA 5BX0A 4ZY6A 3AT3A 3VUGA 3LCTA 4ZTNA 1KE6A 4ENXA 2YCFA 3LFQA 5JRSA 3LFFA 3OW4A 2J0IA 3FMNA 4PDOA 2YJRA 5BVOA 4EOLA 2WMBA 3C0IA 4FKGA 3IG7A 1YDSE 3LXKA 3ZTXA 2X8IA 5L2TA 3OVVA 4ZSEA 1E9HA 1YKRA 3BX5A 1WZYA 3H0ZA 3DDQA 1XH5A 1ZYDA 1FVTA 4ZJVA 2YCQA 2B9JA 3GT8A 4OTFA 4OTIA 3D9VA 4EZ5A 2UZBA 3NUAA 3COKA 1ZLTA 4ZY4A 3EFJA 4NCTC 5AP0A 2OJIA 4TN6A 4RIYB 3MH2A 4O7ZA 4OAVB 1VJYA 2ZV9A 2C1AA 5IUIA 4Y46A 4U81A 2GTNA 3QRJA 1SYKA 3JVRA 4JOAA 4S30A 3MH3A 5CVHA 2XK9A 4I93A 4F6WA 5M09A 1VYWA 3A4OX 4CV9A 4XLIA 4WO5A 3A7JA 2XB7A 5JGDA 1P4OA 4QQJA 4C4FA 2QOIA 4R77A 4S34A 2WMTA 3FZTA 3MS9A 4FV3A 5IDNA 3FC1X 4D1SA 3EJ1A 4IWQA 3P7CA 4D0XA 5M07A 4GK2A 3Q6UA 1KSWA 2CLXA 4HGLA 3O8UA 3EN4A 5DE2A 3IONA 2JDOA 4EQUA 3HZTA 3OT8A 4TYIA 4FTOA 4HCUA 5D12A 3DLZA 2R3FA 3G33A 4QP9A 3THBA 3ZZEA 2VX1A 4PPBA 3VRZA 3G0EA 3D0EA 4XV1A 3B8RA 1W84A 2PE2A 4CFXA 4U7ZA 3GNIB 2JFLA 4L68A 4HZRA 2VTSA 4O7TA 3U54A 3LIJA 3FZPA 4GG5A 1DM2A 4I6FA 3VN9A 2XCHA 4EH3A 4ZY5A 4R1YA 3SOCA 3L9PA 1BL7A 1OL7A 3TNIA 2XBAA 3G0FA 3ZS5A 4R3PA 1UU8A 5LOHA 4G6NA 2W1EA 3A61A 3ATTA 4N6ZA 4FBXA 2NRYA 3DBFA 3RALA 4G31A 5J95A 1M17A 5IEVA 2JIVA 3V6SA 4KBAA 4R7BA 4IBMA 3NVMB 2HZ4A 4B7TA 3PYYA 4IB0A 5CTPA 2J0KA 4AG8A 3UOJA 1IAHA 3V3VA 4YNOA 1TVOA 3HDNA 3BHUA 2HIWA 4YJOA 1VZOA 4LL5A 4UWCA 2HENA 2VV9A 3TIYA 2PUPA 4ITIA 3R9HA 4GU9A 2XEYA 4QTDA 3OHTA 3EKKA 1IR3A 1O6YA 4FZ6A 4V04A 5KMLA 3IW6A 2GFSA 5AV1A 3ZHPC 3NGAA 3Q04A 4YJTA 4D28A 3L9NA 1DI9A 3WIKA 5BYYA 1ZYJA 1ZYSA 2PVJA 2RGPA 5JFSA 4QOXA 4KB8A 5FUTA 2QR8A 5AP1A 4FL1A 2X6EA 4JI9A 4YTHA 3TNQB 4YMJA 4DH5A 4MNEB 3BV2A 2ACXA 4C57A 3NYXA 3VO3A 2V7OA 4I5PA 4JBPA 4I23A 4X7QA 3NAYA 5HX6A 4IAYA 3QC9A 3DS6A 1REKA 2WMRA 3Q9WA 3OEZA 4TYJA 4BDFA 2VWBA 2UZEA 3ZRKA 2JEDA 2WGJA 3ANQA 3MY5A 2BDWA 3UYSA 5JQ5A 4HVSA 2J2IB 4FA2A 5C8KA 3LCOA 5BVDA 2G9XA 4JX3A 4HVGA 2OJJA 2UZNA 4C2WA 2PVHA 5IF1A 5BVEA 3W2PA 2VWYA 3UNZA 4E1ZA 4NJDA 3ZCLA 4RWLA 4KSPA 4CZTA 4G9CA 2FUMA 3FQSA 4IZYA 4CKIA 4CNHA 2QOHA 3GU7A 5CXZA 4D9TA 2VGPA 4GCJA 4PY1A 3ZO4A 2R3QA 4I20A 3D2KA 1ZRZA 1XKKA 3DT1A 4I0TA 4DFXE 5H8EA 4FT5A 4R7IA 4PL5A 4BRXA 4FX3A 4K1BA 2ONLC 5CF6A 1OITA 2YDJA 4NM5A 2YIRA 3NSZA 3PXRA 4YPSA 1OECA 5EM5A 1YHWA 2WQMA 3QALE 3SD0A 5IMXA 1Q97A 2VRXA 4IH8A 1GY3A 4BDJA 4KKHA 4F6UA 4I3ZA 3UOHA 3OMVA 3PG1A 2OZAA 4GK3A 3GEQA 2YEXA 4W9WA 3LM5A 2KULA 4OGRA 3D7ZA 5KHXA 5L6PA 4LGHA 2W17A 5DYJA 4Y5HA 3OWLA 3RAWA 3ENMA 2OG8A 3EMGA 4FV5A 3QHRA 3DJ6A 4OTDA 3C4XA 4FT3A 2VTQA 3NYNA 4RJ3A 1LR4A 4ANSA 5DR9A 3FL5A 3ELJA 4EH8A 3V5QA 2JDVA 3OOGA 1Q24A 3UO4A 2XKDA 4O6LA 2J4ZA 1W83A 2C69A 4FVRA 4QMVA 4XG9A 3LM0A 4UN0C 3HRFA 4IAKA 3Q3BA 4AOJA 1LPUA 4JDKA 2Z7SA 5HCXA 2PVLA 4DFNA 1GAGA 3AG9A 3IW4A 3BRBA 4NTTA 2O5KA 5HCYA 3W8QA 4EOSA 4FE2A 3MB6A 5K4JA 1PMVA 4F08A 3LMHA 4G2FA 3CJFA 1O9UA 4IZAA 3DAJA 4NL0A 4EEVA 4CFFA 3GP0A 1OGUA 4FT7A 4NW6A 3VWAA 1JOWB 2P55A 4ACHA 2XKCA 5A14A 3U4UA 1BKXA 4EH9A 2P4IA 5HVKA 3OCTA 4RBLA 4OLIA 4HGEA 2UZOA 3HA8A 4JDHA 3LMGA 4IMYA 4FGRA 1PXKA 1FMKA 4MVFA 1MRYA 2XNBA 3JVSA 3VJNA 4LUDA 2C5OA 1JPAA 2OWBA 3I60A 4QNAA 5M4FA 4BF2A 3EKNA 4MF0A 4C4EA 4DTKA 1PMEA 2YZAA 3R7GA 3F3ZA 2NRUA 1Q8ZA 4FL2A 3I5ZA 2ZYBA 2VO6A 1H07A 3PRIA 4JBQA 4X3JA 2PULA 3PY3A 3S95A 1PKGA 5CLPA 3QX4A 4XV2A 4RIXA 4FTAA 2QG7A 3ODZX 4RZVA 3V5TA 3ZO1A 1H8FA 2PY3A 3RJCA 3CE3A 4BKJA 2E2BA 3GGFA 2R4BA 5IG1A 2G2HA 3KREA 4O82A 4P5QA 4F9CA 4M68A 4Q5EA 2XNMA 1E1XA 4C3FA 1G3NA 2IPXA 4U43A 4RIWB 3FHIA 3M42A 4QP7A 5K5NA 5HE2A 3E87A 2AC3A 3RTPA 2YZLA 5CSHA 1OL1A 1UVRA 4KD1A 4FUXA 3KULB 3NUUA 2IVTA 2Y9QA 3FLQA 3PE2A 3QD3A 4PPAA 4UEUA 1YWRA 2UW3A 5CZHA 4AF3A 1H27A 2PUIA 3DBQA 2O2UA 5FXRA 2EB2A 2CDZA 1J3HA 3GC9A 2OF4A 2UVYA 4HPUE 4EOPA 4MXCA 2YCRA 2RSVA 4XS2A 3PSCA 4ACMA 2G01A 4OR5A 4NWMA 1V1KA 5I9ZA 3UZRA 5M51A 4AW5A 2GQRA 2VTTA 4AGUA 5DFPA 3HL7A 2R7BA 3FZSA 2VN9A 3N4TA 2CNQA 3ZMMA 5HEZA 1Z57A 4C37A 1H26A 4FSQA 4RPVA 2WXVA 2W0JA 2BZHB 4ZK5A 4O7WA 3AT2A 3NW7A 3CJGA 5FP5A 3C50A 3AC4A 5AEPA 4QP4A 2BRMA 2YM7A 1P14A 4I22A 3I7CA 4IACA 4S33A 5E91A 2CGXA 4V05A 4DBNA 2XA4A 3UMWA 4RJ7A 4XOYA 3KXMA 1WFCA 1QPCA 4G17A 5HQ0A 3UOKA 1Y6BA 4P2KA 4YNEA 5DIAA 4U8ZA 5CAPA 3VUKA 3C7QA 3PUPA 4FC0A 2R3NA 2WMUA 4TWPA 5HIEA 3FMLA 3IKAA 5ANKA 3F7WA 4MXXA 5FDXA 3R00A 3BKBA 1IA9A 5BNJA 4DLIA 4BL1A 3TWJA 4XRLA 3QWJA 5D10A 3H9OA 3DNEA 2YABA 2BROA 1ZOGA 4YHFA 1I44A 2JIUA 3LQ3A 2B7AA 1M52A 5E4HA 3QLGA 1Q61A 3TIZA 2B9IA 2BHEA 4AQCA 1OKVA 4YZDA 2RFNA 3IK3A 4QTAA 3HV6A 1UNHA 2OIBA 2R3IA 3DQXA 4IJ9A 3BU6A 4CFUA 3A2CA 2IVVA 2ETKA 1J91A 1H0WA 3DZQA 4F9WA 4YU2A 1XBBA 4GT3A 2BVAA 4MXYA 1Q8WA 3Q4ZA 4L3LA 2PVMA 4PP9A 4QO9A 4V0GB 1T45A 3A7HA 4R78A 1KWPA 4P90A 4FKWA 1SNXA 3OW3A 5IQBA 5IH4A 4ZMFA 3OXTA 2YLEA 2W9FB 4HCTA 1M2RA 4M7IA 5GHVA 4I0RA 2V5QA 4C3PA 5IEYA 1PMUA 1YDRE 1BMKA 4JDJA 4IWPA 2J7TA 1Q41A 4K77A 4WRGA 3RK7A 3VW8A 3ZU7A 3W33A 3FPQA 4U44A 1JSUA 2FA2A 3PLAE 3VQHA 3L8VA 3VS7A 4CSVA 4W4YA 4QMQA 3F5PA 3HAVA 4L8MA 4XBRA 3NLBA 4WNPA 3SXRA 5C9CA 5IISA 3CTJA 1A48A 3H9RA 4PNKA 4FSWA 4EK8A 3KA0A 3PJ2A 4P5ZA 4PV0A 5L2SA 2Y7JA 3WF5A 1H4LA 1QPEA 3P7AA 4LUEA 4TPTA 4EK6A 4ZLYA 5HI2A 4MD9E 3ZLSA 5HIDA 4JG8A 2C3JA 4ANNA 1BLXA 5AAGA 5DT3A 5IZFA 1Y8YA 1Z5MA 2QI8A 5ACBC 4EHZA 1M7NA 1TQMA 4TW9A 4CCBA 2G2IA 1XJDA 3EN5A 1OKWA 4FG7A 5GZ9A 3VS4A 5J9LA 1YOJA 2R3MA 4C35A 3ZC5A 4KABA 1BI7A 3BYSA 4J99A 5EYKA 5EYCA 5DEYA 3S2PA 4AZSA 4M15A 4BDDA 2ITUA 2WELA 3KRLA 1GZOA 1PXNA 4I6QA 5I3OA 4U45A 1B6CB 2ZV7A 3GXLA 3DTCA 3E3PA 4C02A 4J98A 2RL5A 3FUPA 5IH5A 4FMQA 1FINA 2XKEA 5DR2A 5FG8A 3DDPA 2W9ZB 3HV3A 3K3JA 3QUDA 5L2QA 3BLRA 2YM3A 3LE6A 4GMYA 3D5XA 4XG8A 5HO8A 5CAQA 2ETRA 5HX8A 2XNOA 2W4JA 2VTIA 1R0PA 2PSQA 3DJ5A 3WBLA 2RFSA 1QMZA 3QRTA 1U54B 3DB6A 5A6NA 4F6SA 3OD6X 2VZ6A 5KMKA 1XBCA 1YHSA 3SX9A 2C0OA 3SW4A 5FM3A 3KB7A 3AD4A 2XRWA 3RWPA 3BHTA 4XEYA 5IA4A 5C4KA 5EOBA 2YA9A 3V8SA 3VS0A 5M4UA 2IZRA 4A7CA 4ASXA 3PA5A 3DPKA 4FTQA 4AA5A 3R8PA 4E20A 4F70A 5LCKA 4RT7A 4A4XA 4I41A 2YHVA 4BBMA 4BVUA 1PJKA 5DT4A 5CU3A 3RAHA 3VUTA 1APME 4FKLA 4IB1A 4QQ5A 4ZIMA 2EB3A 3WYYA 3PPJA 4FEWA 2QOBA 1SVGA 2XS0A 4WBOA 3WARA 2BDJA 4ZTSA 3HMPA 5K3YA 3BIZA 2PVKA 4DCEA 4I92A 5AUVA 4BDAA 4D9UA 1KE9A 3EFKA 3NEWA 4XX9A 3EQFA 4U0IA 4AW1A 3SVVA 3OXZA 4ZMEA 4K11A 4OTQA 4XG3A 1HCLA 3POOA 4D55A 3EL8A 2IG7A 2CN5A 4I6HA 2Q0BA 3F69A 4O91A 4AOTA 3VBQA 2QOCA 5KKRB 5KMJA 4EQCA 4F7JA 3SXFA 1CKJA 3EOCA 4BDGA 5FTGA 4M69B 4FYOA 2FSMX 3SRVB 5TO8A 4RVMA 3PA3A 4KAOA 3PLSA 3F5GA 1WBWA 5KO1A 4BCPA 4AUAA 1H00A 3BHYA 4M67A 3GQIA 3TKIA 5CALA 4YO4A 1Q8UA 4DFYA 5CSXA 2B4SB 3KCFA 3W2QA 3D7TB 3HECA 3WF7A 3JYAA 1K3AA 5EFQA 1A9UA 1OIUA 2W06A 3H9FA 1WAKA 4IANA 5AM7A 3AC8A 3TNHA 4CEGA 4FKUA 5HTIA 1U5QA 2CPKE 2I0HA 4M97A 4IHPA 1TQPA 3SAYA 3FE3A 5EHOA 4C61A 3MY0A 1L3RE 4GT5A 4WUNA 4AA0A 3UO6A 4AGCA 1Y91A 1ZY5A 5EDQA 2C4GA 4FSRA 2B0QA 2GFCA 1XR1A 3IPHA 5KZ0A 4X6QC 3C4CA 5LARA 5CEOA 4FSZA 3TTJA 5GJGA 3RP9A 3D14A 5IU2A 3NZ0A 3CPBA 3Q4TA 1H01A 4EHVA 3RPRA 2XYUA 5AP2A 4Y72A 5EKOA 4UY9A 1IA8A 3R8UA 3UZTA 4O1OA 1XHAA 2X6DA 3QLFA 4FSTA 3PP0A 4EBWA 4XG4A 2YAKA 5E90A 2UW7A 3D5WA 3VBYA 3JPVA 4RVTA 3AQVA 3ACJA 3KL8A 4PUZA 3HDMA 4WBBB 3NS9A 3EQRA 5J1WA 3PXZA 2J0JA 3HV4A 2VWIA 1FPUA 2BRHA 4FG8A 4ZSGA 3R01A 4DFBA 4OTPA 3C0GA 3BWFA 3SW7A 2CKOA 2HY81 4JS8A 4NSTA 5LVNA 5CU6A 3NW5A 1RE8A 2JDSA 1YI6A 4FV0A 5AA9A 3KF7A 5TR6A 2LGCA 4MNFA 3TV4A 4QP6A 3ID6C 4H3BA 5J5TA 3PVBA 2WU7A 3PSDA 4O7VA 3GU4A 4Y95A 4LOOA 4MD7E 2H8HA 2X4ZA 2CGVA 3AGMA 4RA5A 3RPYA 2VTAA 3MY1A 3UG2A 1UNGA 4EJNA 4EOJA 3O51A 3S0OA 4JR7A 3F66A 4FT0A 3RZFA 3ZOSA 3F6XA 2W1FA 4BYIA 4J71A 3KK8A 3RZBA 4IX6A 3IOPA 4FIJA 3PJ1A 3OC1A 4II5A 4E6AA 4Q5HA 4QMOA 4DE4A 2ESMA 4YTCA 5AAEA 3ZONA 2YIYA 5J9ZA 2QQ7A 4ZLOA 4F7NA 3FI2A 3HGKA 3NUYA 4FEQA 4G34A 5CQUA 2B9FA 4B8MA 5IMEA 1DI8A 3OY3A 2Y4IC 4R1VA 5CSWA 2BTRA 5AIKA 4DEIA 4W4WA 3VUIA 1CDKA 4LMNA 5D9HA 1QPJA 4N4SA 4WNOA 4C36A 4IFGA 5M4CA 1NW1A 4MBJA 2F2CB 3FY2A 3NNWA 4NIFA 4JQ7A 4JL9A 3ZSGA 4O2PA 1QPDA 5LWNA 4IQ6A 3O17A 4CFWA 3UVPA 4BDBA 3F2NA 4XP3A 4EL9A 4MD8E 5BUJA 4X6RA 2FB8A 5JFVA 5D1JA 2W5AA 3DA6A 1R3CA 2XIXA 4QPMA 4IC7A 4AN2A 5A46A 3HP2A 3LCSA 3NNXA 2QVSE 3Q4CA 3PY1A 3QQFA 1TKIA 2JAMA 3R28A 4FKJA 4U3ZA 3ZFMA 5EM7A 5BUEA 3K5UA 3BBTB 3DNDA 4FZ7A 3SC1A 5CF4A 2Z7QA 3R30A 4M14A 5EYMA 4FKRA 3QD4A 5A4QA 4WG5A 5DOSA 4D4RA 4EZ7A 2BRNA 4O83A 3R1SA 3B8QA 4OBPA 2XF0A 3DK7A 5AP6A 4LOQA 4X2GA 5JK3A 3RCJA 3A7GA 4YGAA 4UXLA 4S2ZA 4RC2A 2XNPA 5LMBA 5ETAA 1GIHA 2UZTA 3R7VA 3QTSA 2B55A 2VTPA 4EBVA 2A0CX 2QNJA 1XH6A 2JD5A 5BVKA 4UWYA 3BHHA 5EG3A 4YLJA 2QLUA 3ORPA 4RFYA 5I5ZA 4NTSA 3HV7A 3JS2A 3CD8A 4BIBA 2C6IA 4ID7A 2Y6MA 3O50A 5G6VA 2F9GA 3ORXA 4ZZNA 1JLUE 5B7VA 3U87A 4KBKA 3VQUA 2RF9A 3AMAA 4PRJA 1CTPE 4IM0A 4IVBA 4JBVA 2VO0A 4EK4A 2REIA 2XRUA 3HA6A 4PPCA 3QA0A 4M0YA 4FOBA 3PE1A 3DQWA 4GJ3A 4FVPA 4MAOA 3TNPC 3UTOA 4CGAA 3LHJA 5CAVA 3QWKA 3ERKA 4D2PA 2JLDA 1XBAA 2ZV8A 3KKVA 3QRUA 4FIFA 2X7OA 5DRBA 5AUZA 5BMMA 4E4NA 2VTHA 2PVFA 5J7HA 3MVJA 4AGDA 5LVOA 3FMEA 3AC2A 4DH7A 2FYSA 3ZC6A 4UV0A 1FQ1B 4FK6A 1EH4A 3OS3A 5JSMA 3LQ5A 3W8LA 3MN3A 4IB5A 4RGJA 5GIOE 3DOGA 1M2QA 2QO7A 2WMWA 3A4PA 3D83A 3ZUTA 3E63A 4GUEA 3FL4A 3I0QA 4E7WA 5AP3A 2BIKB 4U97A 5DBXA 2O63A 4LMUA 4G3FA 4ZSLA 2QU6A 4J8NA 3FMDA 3UPXA 3D94A 5B0XA 3F2RA 2I40A 3G15A 1RQQA 4FZFB 3FMMA 4ZJIA 4A9UA 4R3CA 1JKTA 4BYJA 5EQYA 1SVEA 3FDNA 3ZFXA 4AXAA 4NUSA 3OT3A 5CS6A 2IZTA 4GFGA 3UIUA 5T6KA 4BGQA 3KXXA 3EFWA 4DEBA 4EOQA 5HIBA 3SA0A 4JXFA 4CTCA 3W55A 2CNUA 3KRJA 4Y8DA 4MK0A 3ZSHA 4L44A 3CP9A 5DR6A 2XK4A 2WTDA 3DXNA 4KIKA 2E9VA 4RJ6A 5H3QA 2RG5A 5A3XA 5C8MA 3ZFYA 1BL6A 3O7LB 4L6QA 5CEKA 3TL8A 3LOKA 3C13A 4IVDA 2CKPA 1IASA 2OH4A 3RK5A 3Q9XA 4JRNA 3A8WA 2X2LA 4YZBA 5E8VA 3AXWA 4EYMA 4ZSJA 5IKWA 3CKXA 3V51A 1W0XC 2XIZA 5LWMA 4PNIA 3K2LA 3TV6A 3R04A 3PIYA 2KTYA 4AWIA 3LKMA 2BZIB 3ORTA 3LJ0A 4YSJA 3R02A 3TJCA 4RJ4A 1UU9A 3KC3A 2YIWA 3Q32A 5AV0A 4A9TA 1UU7A 2XJ1A 3LLAA 2WIPA 3RKBA 4W4XA 5GZ8A 4OBOA 2FSLX 2ITOA 3OOMA 2IZSA 4QQTA 2OXXA 3P0MA 4NZWB 4YJVA 3UBDA 1R39A 3GQLA 4BDIA 2PVYA 1YOLA 4AW2A 3KN5A 4C4HA 1UU3A 3CBLA 3QYZA 4YC8A 2HAKA 3CGOA 2CLQA 2J0MB 2PMNX 3P5KA 4UB7A 4ALVA 4GH2A 1PMNA 3R7OA 4C0TA 4MQ1A 4YLLA 2WEVA 5HG7A 4DEGA 1RW8A 3MTFA 3S3IA 4HVDA 2XUUA 4UXQA 2W1CA 3IW8A 5HBHA 2GNLA 2PZPA 3A7IA 4F64A 2WMQA 3G6GA 3KRXA 5M56A 5FEDA 3PPKA 4U80A 1NA7A 2WTVA 3KXGA 4PL4A 4EK3A 4FTNA 3ZUUA 4J53A 2ONLA 3CS9A 3ITZA 4IB3A 4RG0A 4WSQA 4JBOA 3RPSA 3I1AA 4FKIA 3FZOA 5AR7A 2BAJA 1CMKE 5FWKK 3DBDA 1KE7A 1ZAOA 3GFWA 4HVIA 4L00A 2WU6A 4BKYA 5JH6A 2JC6A 4RQKA 4CRSA 4DAWA 1ZZLA 1R0EA 3BELA 4RIYA 5CWZA 4E6QA 3BLQA 3MPAA 4L9IA 4DC2A 3E93A 3WZDA 4EH7A 3QTRA 4R3RA 3DKCA 4BHZA 3VUMA 4AACA 2UZWE 2X2KA 5J87A 4BDKA 4BTKA 4FKQA 2F49A 4C59A 1JWHA 2RG6A 4GSBA 4AT5A 4DH1A 5CEMA 2ITTA 5I9VA 3WZKA 4UALA 5AWMA 4ASEA 2GHLA 5KX8A 3VC4A 4A9RA 2E9NA 3KRWA 3UODA 4FEVA 2GPHA 4RQVA 3W1FA 5CVFA 3MB7A 4EH6A 5EI6A 2UW6A 4F9YA 5HU3A 3K3IA 3TUDA 2ZDUA 4RIXB 5JZJA 5HG5A 3MH1A 4YJQA 1PY5A 4TWCA 1KV2A 3QTXA 4QTBA 4DEDA 4F65A 5AUXA 1J1CA 1M14A 3CLYA 5CT7A 4K33A 4XUFA 4Y85A 4Y5QA 4G3CA 5AAFA 4ENYA 2VTMA 4PWNA 1LP4A 3O71A 3R9OA 3BQCA 4FKOA 5HORA 2EXEA 2VAGA 4L46A 4FL3A 3QKKA 4H36A 4RC4A 3TZ9A 3P9JA 4QMSA 1PW2A 3QAME 1STCE 3QBNA 3TZ8A 3TDVA 1GZKA 3R1QA 2XNGA 4R5SA 3TKHA 5BQ0A 5I4NA 4U40A 5JFWA 4YPDA 5HNGA 2YM4A 5CI6A 3QZHA 2ZJWA 3GCSA 3OTVA 5CENA 4RVKA 4CVAA 1XO2B 1O6LA 1OM1A 1FOTA 2CCIA 2BFYA 3ORNA 4FTUA 5E8TA 3FMJA 3KXHA 4HOKA 3PPZA 1Y8GA 3HRBA 3CR0A 4AE6A 4BCGA 1P5EA 3QTZA 4QP2A 4AX8A 2HWOA 4O2ZA 4F0IA 5FDPA 2GCDA 3D15A 2R9SA 2GQGA 2ITNA 1NVRA 3BV3A 4FV9A 4YR8A 2F57A 4HNIA 4CT1A 3EYHA 2YN8A 2NO3A 2X1NA 4LYNA 3ODYX 3QQUA 4IAAA 4GKIA 2QO9A 4D5KA 1O6KA 4O27B 3D2IA 1BYGA 1OBDA 3R2BA 3N9XA 4I5HA 4C58A 3QUEA 3VF8A 3VAPA 2EU9A 2QOLA 1KE8A 5D41A 4XYFA 4MTAA 5E1SA 3E7OA 4C3RA 4CFNA 3NVKI 4X2JA 3FC2A 4AN3A 3MTLA 3Q60A 5ETIA 3ZM4A 4EYJA 2QCSA 1YI4A 1XWSA 2UW5A 4FI1A 3VW6A 4D2WA 3MFSA 4G3GA 3UVQA 3AGLA 3VS5A 2W1DA 4D5HA 5E8XA 2QOFA 5CYIA 2OLCA 1ZOEA 2Z60A 4DTAA 3RNIA 4FNWA 4WSYA 2BHHA 3ETAA 5M55A 2SRCA 2GDOA 4XP2A 5E92A 4ZS4A 4O0TA 4FVQA 4RWJA 1KV1A 4I4FA 4K0YA 4BDHA 3ROCA 1YQJA 3ZUVA 2OJFE 3COIA 3QZGA 4OAUC 3DLSA 5F1ZA 5I3RA 2CMWA 1YRPA 2QU5A 3B2WA 2OXYA 4NM3A 2WQNA 3OG7A 2H6DA 3QXOA 4QMWA 1FVVA 3B2TA 3HKOA 2PMOX 4JLCA 4AS0A 2HK5A 3U9CA 2J6MA 3QGYA 2BZKB 3DKFA 2O65A 4O0VA 4AT4A 3G6HA 4FIIA 1JBPE 2A1AB 4L52A 4M66A 5DVRA 2E9PA 3TZMA 4AT3A 4LRMA 4DFZE 4IX4A 2BPMA 4CXAA 1JKKA 3H10A 3TI1A 3MDYA 4DFLA 1W8CA 3V8WA 2J9MA 3KXZA 3S4QA 1YI3A 3CGFA 4MBIA 3EQIA 3UGCA 4DG3E 2C6KA 1OKYA 3MH0A 5J1VA 4BDEA 4MWHA 3HLLA 3O8TA 3ZXTA 5HLPA 5AA8A 4CFMA 2PMIA 4FT9A 4BCMA 3R7UA 2ZM4A 3LFAA 1WBOA 3QGWA 4RX5A 3ACKA 1TQIA 2R3LA 3I7BA 1QCFA 3ALNA 4CYIA 2OZOA 4EJ7A 4FV8A 4P7EA 2YDIA 5IH6A 4ORKA 2VTJA 2UZDA 1ZY4A 3DXPA 3HAMA 5IQGA 3VHEA 2JBPA 3V04A 3VS2A 3KQ7A 3FMHA 2H34A 5AP4A 2IN6A 1M2PA 2QD9A 2J51A 2OJ9A 3E64A 4MXAA 1WVXA 5LCJA 2YERA 1W82A 1YWNA 2A19B 4AZEA 5TF9A 4BFMA 3EH9A 4QMNA 4O81A 3QA8A 4GJ2A 4B9DA 2C6TA 4IVAA 4A07A 2DYLA 4F1TA 1CM8A 1Q3DA 2WQOA 2FSOX 4GVJA 4BCHA 2G2FA 2XZSA 1NVSA 3UDBA 5CEQA 3V5LA 3GU6A 4WUAA 4DCAA 5E8ZA 3F7ZA 4BZNA 4C34A 4BIDA 3E8DA 3LFNA 4IC8A 3QRKA 4AAAA 1MP8A 5C27A 1FMOE 5TE0A 1YW2A 2I0YA 2W05A 3QKLA 2YLFA 3W2SA 3G2FA 1CSNA 3E7VA 4RLKA 5AV3A 3RAKA 3NUNA 2J90A 2X9EA 4QMUA 1ATPE 2VGOA 3NNVA 5BMSA 2HXLA 4XP0A 2OI4X 4NW5A 5F20A 3GOPA 2JKMA 1OPJA 4ZOGA 3RVGA 5FQDC 4PTCA 2UW8A 5M44A 4N57A 3QQKA 2HXQA 4DGNA 2W1HA 4JQ8A 4KIOA 3R8LA 3MPMA 3PXKA 2PVRA 4WD5A 5A6OA 3EZVA 3DCVA 2YDKA 1OI9A 4BZOA 5HGIA 3DK6A 5DT0A 4B0GA 5IPJA 3HMOA 3EL7A 5F95A 2PE0A 4UMQA 3QQHA 4G3EA 1MQ4A 3G51A 3RGFA 4RIWA 2GS6A 1NY3A 3MGYA 4GYIA 4QT1A 4FIEA 1OIQA 2X81A 4NH1A 2C30A 4IZ5A 4AGWA 1OIYA 3OWJA 2R0IA 5CVGA 5GIPE 4PMMA 2GHGA 2B9HA 2YCSA 3M11A 4O6EA 4X0MA 3I0OA 4EI4A 4F99A 3U6IA 3H30A 2YIQA 2F7XE 2HOGA 2A27A 3WE4A 2QHMA 1WBPA 4I5MA 2PZRA 4OTGA 4EC8A 2F4JA 3KK9A 4OW8A 5KMIA 3MPTA 1NXKA 3VUDA 3BCEA 4BIEA 4M3QA 3L9LA 4ANBA 1VEBA 4H39A 5DA3A 4FTRA 4FYNA 2WNTA 3F61A 4BWKA 3GC0A 3I4BA 2A2AA 4E3CA 3MYGA 4EC9A 2C3IB 4GEOA 4C4JA 3NWWA 1U59A 4APPA 2X7GA 3FZRA 1XH8A 3Q5ZA 4NM0A 1XH4A 2A4LA 2OKRA 2QOKA 3OUKA 4DBXA 4MH7A 1OMWA 1MQBA 4PTEA 3VBTA 3E5AA 3ORKA 3IW5A 1UA2A 5B2KA 3UQCA 3U55A 3WZJA 2V62A 4L67A 1BI8A 5H2UA 3LJ2A 2WPAA 2OFVA 4CCUA 3EYGA 3OBJA 3V5JA 3ZM9A 3SV0A 4AU8A 4TYHA 3BI6A 3IDCA 3UQFA 4X3FA 1Q8YA 1ZARA 4Z3VA 4MQ2A 4QYHA 3N4UA 2I0VA 3E3BX 4YSMA 2HW7A 2OGVA 4XMOA 3VS3A 5H8GA 4AP7A 4MEDA 3LVPA 4ANQA 2EXMA 3O96A 4FTKA 5IA1A 4I5CA 2BKZA 3WF6A 4IXPA 5CSPA 5HE3A 2FVDA 3TCPA 1GZNA 5M08A 4BI1A 1IAJA 5AUTA 3R0TA 2ZAZA 3PY0A 4DTBA 1RJBA 3FKNA 3UP2A 2QHNA 3KGAA 1RDQE 3P08A 2PK9A 2QOQA 4FIGA 4CFVA 3AC5A 5G1XA 2ZB0A 3RHXA 5EYDA 3V5WA 3VRYA 2YISA 3ZEPA 4YZNA 2B52A 4BBEA 2BDFA 2R3KA 3DV3A 4OT6A 4K8AA 4Z7HA 3FLWA 3FSFA 3FJQE 2YWPA 4USDA 4YZCA 2C0IA 3PFQA 5AUYA 5HLNA 1ZMVA 4X3FC 3TT0A 1UWJA 2EUFB 5KZIA 4BCQA 4KUJA 3Q9YA 4L42A 3GCUA 2X9FA 3WE8A 2EXCX 4DEHA 3FSKA 5CI7A 4F1MA 3PXFA 4O96A 3ATSA 3GENA 3DU8A 3QU0A 3LCKA 1H25A 4F1OA 4J96A 2OBJA 3BHVA 3HUCA 4UZDA 5L6WL 1NT2A 2OICA 4ZJJA 3HUBA 2IW8A 2BFXA 5IA0A 2WAJA 2YITA 4TL0A 3FHRA 4Z9LA 1UKHA 4M12A 3QZFA 3FEGA 3GCPA 2Y0AA 2WQBA 3HNGA 2OH0E 5AUWA 1BX6A 5CXHA 3IS5A 3SQQA 3LFCA 2UUEA 3WILA 3ORMA 4ZSAA 2C1BA 2W7XA 3HMIA 5A4CA 3HX4A 4CD0A 4ERWA 3GUBA 2E9OA 2WTJA 3QF9A 3II5A 4G1WA 4MCVA 4CV8A 2J0LA 4C62A 1G5SA 2AUHA 3DGKA 3FXWA 3SKCA 4FV4A 3I5NA 5IQDA 2HELA 4G3DA 2PWLA 4HYSA 5FLFA 3C0HA 5AMNA 4ANMA 3RNYA 4QYYA 3CQUA 4KS7A 2CSNA 3O23A 5CNNA 1ZMUA 5FD2A 4IX5A 1G8AA 2XJ0A 4C4GA 4KIPA 4W8DA 3TNWA 3LCDA 4F4PA 3EN9A 4UMRA 4YC3A 1B38A 5AUUA 5ICPA 1Q8TA 3PZEA 2B1PA 3FLYA 3KN6A 4RJ8A 4CQEA 3I81A 4NIFB 5ETCA 4G9RA 4LGDA 2CGWA 4A9SA 3FKLA 2WTKC 4RFZA 4BWPA 4BCNA 5IQHA 4NEUA 2WEIA 5DGZA 3ZH8A 3DXQA 3PVGA 3VS6A 2W4OA 2O64A 3T8OA 1ZXEA 5HTCA 4Y83A 3A7FA 2G15A 3JXWA 5ANGA 5AX9A 3ZBFA 2ZB1A 3NCGA 4HPTE 5CASA 5JGAA 3HP5A 1OZ1A 2BIYA 4NFNA 4CKJA 1OL5A 3F5UA 1R78A 4WNKA 5AP5A 4FEXA 3CY3A 2Z8CA 1H24A 3BPRA 3IO7A 5KHWA 4XHKB 5EI8A 3QX2A 3T9IA 4NM7A 5E8SA 3R21A 4IM2A 4P4CA 4O7YA 4W9XA 3VULA 4FV2A 5M4IA 5IQCA 4D4VA 1FVRA 2PZ5A 4LV5A 3UE4A 1Y57A 1YXSA 5CT0A 4USFA 5EHYA 2VWZA 3R8ZA 2IVUA 4JAIA 3OBGA 3QYWA 2WTCA 5L2IA 4H1JA 4IAIA 3UC4A 3E62A 2JDTA 1U4DA 2WMXA 1ZWSA 5ETFA 1Z9XA 3T3UA 2I1MA 4FTLA 4PF4A 4PMSA 5HG9A 2VNWA 1H1RA 1GNGA 1REJA 1VR2A 3G90X 4LOPA 5ACKA 1AGWA 4BCOA 4CT2A 3RCDA 4OUCA 5I9UA 3BE9A 5T68A 3W32A 5F94A 4FR4A 3QRIA 4E93A 2GSFA 5FEQA 5DG5A 4O86A 4EOMA 3BBWA 3FPMA 1ZMWA 3JY0A 2BTSA 1MRUA 5FEEA 3G9LX 5E1EA 2ERZE 4YJRA 4EUTA 2VX0A 3R2YA 4IJPA 1B39A 1CKPA 3FLZA 1AQ1A 2WMVA 2XMYA 3BWJA 4QPSA 4W8EA 4BI0A 2Y4PA 3BE2A 3BU5A 2HYYA 4O22A 2ZOQA 3UO5A 3REPA 4GK4A 3OWKA 4RZWA 2BALA 3FBVA 4YJNA 2JGZA 3OCBA 5GNKA 2GTMA 4GKHA 5C01A 3QD2B 3IQ7A 3VBXA 4A06A 3ZYAA 4KWPA 1H0VA 3O0GA 4GIHA 2R0UA 3UIMA 2C68A 4U79A 3DFCB 4K6ZA 2VD5A 3GCVA 2PUUA 4FICA 3O7LD 2ITWA 4G16A 2C6DA 5DN3A 4DH8A 2WFYA 4I24A 2V22A 1KE5A 3ZRLA 5KNJA 1A06A 4GG7A 4L01A 4FSNA 3G9NA 2IO6A 4LFIA 3R22A 4K9YA 4L7FA 2ZM3A 2ZVAA 4TWOA 4D1ZA 4ANOA 5KE0A 5I9YA 5KKRC 4FTIA 4Y73A 4QD6A 1FBNA 2NP8A 3NIEA 4IWDA 5H9BA 3FQHA 1V0BA 4YJSA 5HO6A 4C8BA 5A4TA 1WBTA 5L6OA 3BEGA 3OZ6A 4MWIA 2C5YA 4UYNA 5HCZA 3VF9A 1DAYA 1DS5A 2VTLA 5F9EA 3VS1A 2OU7A 3HVCA 2YACA 4DT8A 4ACCA 5LQFA 4H05A 5FBNC 3OXIA 4GW8A 3NPCA 4QMPA 3C4ZA 4EORA 3UPZA 3L1SA 2JIIA 3R83A 5TKDA 3LJ1A 3C51A 2WKMA 5HG8A 5HO7A 2Y8OA 3UP7A 4YZMA 3HV5A 4E6DA 4FV1A 3E8CA 3E88A 2VTRA 4XJ0A 1XQZA 4PL3A 5IA2A 3Q2MA 2VUWA 5FXSA 3W2RA 3QQGA 1FGIA 3LXNA 3BEAA 2Z02A 1H1QA 3BYUA 4J97A 4XOZA 5K0KA 3IGGA 4E5WA 5HE1A 3MSSA 3MVLA 5JRQA 3RPVA 2QURA 2PU8A 4C7TA 3AD6A 3NUPA 4M84A 3QXPA 3GBZA 4IIRA 1Q3WA 1SZMA 2XK6A 3QTIA 4G6LA 4ASDA 2X0GA 2J5EA 4FG9A 4RIOA 5KCVA 2XK8A 3KEXA 4FUYA 4RSSA 4TWNA 2XK3A 3T9TA 3GC8A 5HESA 3ULZA 2NPQA 2GNGA 4DYMA 4M8TA 4QMYA 4BKZA 4QP3A 4X21A 2FH9A 4CG9A 5JQ8A 4O21A 2OXDA 4GS6A 5HE0A 3GVUA 4OTWA 3TUCA 1HOWA 3R8VA 1YHVA 4EH2A 2PPQA 4AZTA 3DAKA 4FSMA 3LFEA 2V55A 3OF0A 5L8JA 4U3YA 5K4IA 3S1HA 4UX9A 4XLVA 4B8LA 2W1IA 3PWDA 2H9VA 5L8KA 3DJ7A 4L53A 3KY2A 2Q0NA 3CPCA 4BC6A 3OP5A 3R9NA 5HNBA 3PJ3A 2BCJA 4DT9A 3MA6A 4IW0A 1IG1A 3DZOA 1OIRA 4TNDA 4ZZMA 4DEAA 1OKZA 4WA9A 1V0PA 1WBNA 4JG6A 1URWA 3R9DA 3UNJA 3MESA 5BYZA 4ZLZA 4O7NA 3UYTA 2P0CA 2XIYA 2F7ZE 3GB2A 1F3MC 4KA3A 4M13A 4FK3A 4QTCA 4DG0E 2BKKA 4WKQA 3MA3A 4KKGA 4O0RA 3OY1A 4EQMA 3FI8A 3A62A 3H0YA 3BGPA 3O2MA 4ZTMA 4DH3A 5HVJA 3AC1A 4XG6A 5D7VA 4RC3A 2W96B 1DAWA 4O0UA 5EK7A 2XIRA 2G1TA 3BZ3A 5FTQA 4JVGA 4AFEA 2R2PA 3FV8A 4U42A 5K0XA 4DHFA 4BTFA 5J5SA 3D4QA 1F5QA 1U5RA 2C3LA 2J5FA 4QP8A 3EZRA 3FZ1A 3OCSA 4CRLA 4N0SA 4YHTA 5A54A 2JFMA 3HMMA 3NCZA 3R1YA 4FSUA 4O1PA 1JQHA 4NU1A 2R64A 4YBKA 3P79A 4FKTA 4DF3A 3P78A 3CKWA 3R7IA 1LEZA 3ANRA 1WVYA 2ZMCA 2QC6A 3FYKX 3LFDA 4H58A 4JT3A 4L7SA 4TRLA 2OZAB 4FEUA 2C3KA 5AR5A 5KMMA 4IDTA 4AN9A 5HLWA 4RMZA 3I6UA 3C4WA 5CANA 2P2IA 5GZAA 3OUNB 2W99B 4DGLC 4XBUA 4O7LA 4C38A 1X8BA 3EQHA 4JDIA 4EHGA 3MV5A 3MVMA 2CN8A 3RM6A 4F7SA 3V8TA 3QQLA 3UVRA 3C5IA 4N6YA 3ORIA 3DK3A 4JIKA 4BWXA 5JFXA 4O38A 4F0FA 2ITZA 2OFUA 5EM6A 5DEWA 2CGUA 3N51A 3VNTA 2WIHA 5IDPA 3ULIA 2WTWA 4CLIA 5A4LA 1ZOHA 2BZJA 1AD5A 4FTCA 4D2RA 2VNYA 4O0WA 4EOIA 4Z55A 4ZTQA 5GJDA 3ROYA 2QONA 2QKWB 3UMXA 2I7QA 3R71A 4S32A 4RX9A 3FXXA 3PG3A 1S9IA 4GV1A 3EIDA 4OBQA 4ANLA 5AV4A 1PYEA 4WG4A 3ENHA 4D1XA 1WCCA 3ORLA 3L8XA 3L8SA 2R3GA 2VWVA 4FKVA 4GUBA 1OUKA 1YXTA 2QR7A 4UMTA 2XP2A 4IVCA 5AJQA 4GVAA 1PXPA 4IAZA 4KKEA 2QO2A 2BR1A 4Z16A 4YLKA 2IW9A 4GYGA 1ZZ2A 5T3QA 4AFJA 3EHAA 1L8TA 4A4LA 5CU0A 2WOTA 4F0GA 1WMKA 2CKQA 5FGKA 4E5BA 4BCJA 3IDBA 2PMLX 3OCGA 2YIXA 4UZHA 4WT6A 4XV9A 4LM5A 5CU4A 5EQPA 3RHKA 4RWKA 5ANIA 5DMZA 5JGBA 4B4LA 4YO6A 3R9RA 3EFLA 3SXSA 3EQGA 1PYXA 3POZA 1URCA 4I94A 4ALWA 5FRIA 4DFUA 4BBFA 3FYJX 4AZVA 3BYVA 3WOWA 3I6WA 3PTGA 3EB0A 3TACA 3FLSA 4C4IA 2WOUA 5IA3A 4EHEA 4Q2AA 5H8BA 5J9YA 3CXWA 3KXNA 4R5YA 3AOXA 4N70A 3LW0A 4OT5A 4RA4A 1NVQA 3SG9A 5CZIA 4AA4A 4X2NA 1YXVA 4MBLA 3WYXA 3VIDA 4FODA 2GS7A 2IWIA 3IDPA 5C03A 2XNNA 2JKOA 3D5UA 3EQCA 2GU8A 3I79A 4NK9A 3E8NA 4UYAA 5HU9A 3LZBA 4ALUA 3L8PA 4QMXA 2XK7A 3MW1A 4FV6A 3ZO3A 2NNWB 5AFVA 4UWBA 3QTWA 4HZSA 3PJ8A 3PA4A 4YZ9A 2V7AA 4J8MA 3UOLA 4PDSA 5IUGA 2O8YA 3VHKA 2IJMA 2OO8X 2R3OA 4FOCA 1YWVA 3KFAA 4E73A 3V01A 3ZDUA 4MF1A 3P1AA 3KMUA 4KRCA 5LMKA 3ET7A 4I1ZA 4IEBA 1M7QA 4F09A 2I0EA 2Z2WA 3QCXA 4IADA 3H4JA 3PDTA 2GS2A 2XIKA 2XJ2A 4X2KA 5EQEA 3BU3A 3PXQA 1KUTA 3PIXA 4MNEA 2O3PA 5CAUA 4CZYB 2DQ7X 1H1PA 1ZYCA 4H3PA 4HCVA 4JNWA 4NKSA 4QQCA 4GIIA 3TN8A 3UG1A 4IDVA 3ZLWA 3ZRMA 2BAQA 3F88A 2VO7A 4QTEA 5DWRA 5GINE 4MKCA 4O7RA 5C4LA 4PMPA 4E4LA 5JMSA 4EH5A 5EW9A 2WHBA 3DBCA 3HEGA 3LMIA 5BVFA 3PVUA 4EZ3A 2PTKA 2ITVA 2RFDA 3U51A 5CNOA 3UJGA 2XM8A 3N4VA 3LXLA 3PP1A 4IAFA 3FXZA 4ONAA 2UZLA 4FSYA 1WVWA 3E8EA 2PVNA 4CMTA 4U41A 3E92A 4LRKA 4LL0A 5E8WA 5CF8A 5HHWA 5LMKC 5L2WA 5JEBA 3QCSA 5DNRA 2UW4A 5E8UA 4WOVA 4UBAA 3PSBA 3EN7A 3EQPA 5GJFA 4BCKA 3OWPA 1UNLA 1K9AA 4BGHA 2F7EE 1PXJA 3FWQA 3Q2JA 4PTGA 3Q52A 4EKLA 2XKFA 1V0OA 3SHEA 5AR4A 4YTIA 2R3HA 4IE9A 3TZ7A 4ITJA 3WF8A 4PQNA 5AR2A 5AX3A 4ERKA 4F9AA 1GIJA 3K54A 5J7BA 5CU2A 4HYIA 4R6VA 4WNMA 4HVHA 4TY1A 2BILB 3QHWA 5KBQA 2OW3A 3JUHA 4JR3A 3ZLXA 4O84A 3LPBA 3HYHA 2O0UA 2C6MA 2XM9A 4FNYA 5HD4A 4FKSA 5F4NA 4TNBA 5HD7A 1OUYA 4J7BA 3FY0A 5E8YA 4ZP5A 3R73A 3RMFA 2QODA 4TXCA 4W4VA 1KOAA 3COHA 3WI6A 5EM8A 5J79A 3W10A 3CSVA 2YM5A 4BHNA 4APCA 3QTUA 5ITAA 4J52A 3MI9A 1JNKA 4B99A 4L45A
chains in the Genus database with same CATH superfamily
4HJOA 4GT4A 4DG2E 3QTQA 4EKKA 1G8SA 4QMTA 3IW7A 3CY2A 2YFXA 5FP6A 1SNUA 2QKRA 4QP1A 4AW0A 5HKMA 4DHIB 1JSVA 4FZAB 3BYMA 4BZDA 3F3VA 3FLNC 4ARKA 4BN1A 5EKNA 3ORZA 2Y6OA 3OROA 5EI2A 4UMPA 5E9EA 3FI4A 4K2RA 3PWYA 4EWQA 2PE1A 4DLJA 3U9NA 4IWOA 4PDPA 3UZPA 4TKSA 3SOAA 3BGQA 5IEXA 1OBGA 2V0DA 3RINA 3U6HA 4MX9A 4TYHB 1CKIA 4FNXA 2W5HA 4X3FB 1SVHA 5IUHA 3RI1A 5L8LA 1P4FA 3SG8A 3D5VA 4FGBA 5DH3A 2BRGA 4DITA 3Q5IA 5HVYA 2CKEA 3NX8A 3NYOA 3QL8A 4AZWA 1OB3A 1Q5KA 2E9UA 2B54A 2W5BA 2CHLA 3R8MA 2AYPA 4ZS0A 2ZV2A 3V5PA 4FV7A 3DB8A 4JIAA 4OTRA 5B2MA 4BR3A 4QYFA 3W16A 3WIGA 3MIAA 2C0TA 3W0SA 1JAMA 4MXZA 4R7HA 2JDRA 3RAIA 1I09A 3GFEA 4KRDA 5AP7A 2YM6A 1PHKA 3PVWA 2HW6A 2UV2A 4KINA 3W2CA 2C6OA 3KU2A 4JQEA 3RWQA 4ACDA 4HW7A 1ND4A 1XH7A 3U4WA 3KULA 4RWIA 4NKAA 3HRCA 4KBCA 4HGSA 1Q62A 3F2AA 3TXOA 4BTJA 1H1WA 2DWBA 3NUSA 3SGCA 2FO0A 4F7LA 2C47A 4U9AA 1YDTE 4DEEA 4ZTRA 3FAAA 4E5AX 2GNHA 4I6BA 4YJPA 4FF8A 3R63A 2GNJA 1T46A 5J8IA 3AKLA 4WG3A 1PXMA 4NJ3A 2IZUA 5AM6A 4XV3A 2DS1A 3MIYA 2OSCA 2ITXA 4J95A 3P5JC 4GL9A 4DGOA 1Q4LA 3IGOA 3MWUA 2XCKA 3PJCA 5ANJA 4E26A 5I0BA 3GC7A 5CX9A 4Q9ZA 4D4SA 3ALOA 4I0SA 3EWHA 1YVJA 1OPLA 2ITQA 2OIDA 5DI1A 4RVLA 3C1XA 3TKUA 2WTKB 2F2UA 1PKDA 1OL2A 1PRYA 5DLSA 2DUVA 2H96A 2WO6A 5I9WA 3TUBA 4QRCA 4QYEA 3QFVA 4OTHA 2EVAA 1K2PA 4E4MA 2C6LA 3AMYA 3Q6WA 3QZIA 1UKIA 5CF5A 4MXOA 2PUNA 5C1QB 5EOLA 2X8EA 4B6LA 4PX6A 4X2FA 4XG2A 4BICA 3F82A 3MVHA 4GU6A 1LEWA 2BRBA 1UV5A 3LAUA 4D2SA 3RK9A 4YTFA 1H1SA 1HCKA 4H3QA 3UC3A 4D0WA 4O7SA 2XEZA 4H1MA 4EONA 4FTTA 4RLLA 5IA5A 2GHMA 2XH5A 3DAEA 4JAJA 4KS8A 5EH0A 3CTHA 1J7UA 3NRMA 1W98A 1GIIA 2IVSA 4KNBA 4G5PA 2GMXA 4IFCA 2PZYA 3OFMA 4A9YA 5BPYA 3RPOA 3NAXA 1LUFA 5ANOA 1JSTA 1MUOA 2OIQA 3KCKA 2VWUA 1J7IA 3CQWA 3JY9A 4M0ZA 3C4EA 4QPAA 5FM2A 5M53A 1JVPP 3DTWA 3KVWA 5BVNA 3WZEA 2ITPA 4FJVA 3NYVA 1S9JA 2GNFA 3TG1A 5C26A 5D11A 5K5XA 4BCFA 4HGTA 4RX8A 4WIHA 4KIQA 4S31A 5DHJA 4DHZA 2ZMDA 2WQEA 5HBJA 2ZDTA 3EQBA 3ZO2A 2W4KA 3CIKA 1ERKA 1YXXA 4CZUA 4E8AA 2PYWA 2GNIA 2WTIA 4RJ5A 5HBEA 4GFOA 3R6XA 2B53A 4U6RA 5AIRA 2R3JA 5AV2A 2Y4IB 4XCUA 2JBOA 3LFSA 1H28A 4V0GA 4C2VA 4AZFA 4Q9SA 4CG8A 4FKPA 4RFMA 5LVLA 3FQEA 4I4EA 4TYEA 5TOZA 5LMAA 4EH4A 4TTHB 2BMCA 3RBWA 4AOIA 3V6RA 3F3TA 2HZNA 3MJ1A 4G5JA 5LVMA 3FKOA 3ZLYA 1Q99A 2YJSA 3ZZWA 3H3CA 4PMTA 5A9UA 2XANA 2UVZA 2LAVA 5AR3A 1PXIA 3KF4A 5EW3A 4LQMA 3MFUA 1OVEA 1YXUA 3MFRA 3OTUA 2R3RA 5BYLA 3W18A 5ANDA 4JJRA 2HWPA 1R1WA 2QOOA 3BQRA 5EDRA 5AR8A 2WZJA 3MJ2A 4QMLA 4CTBA 4EOKA 2EWAA 1J1BA 2BAKA 2PHKA 2ZFYA 3EN6A 5BUIA 4V01A 3CQEA 2JKKA 5M57A 1JKSA 3OEFX 3P86A 4YP8A 2HCKA 2OJGA 3DKOA 1W7HA 3GOKA 3M2WA 4ACGA 4BI2A 2HY0A 4MYGA 4QNYA 4AXEA 4DGMA 2J50A 3Q96A 4A4OA 3P7BA 2VX3A 3PRFA 2VTNA 3K5VA 3DFAA 3GU8A 4YHJA 5L3AA 3LQ8A 2P2HA 5I9XA 4NYEA 4YBJA 4ZXTA 4I21A 1VYZA 5IQIA 4NT4A 4USEA 5FXQA 5HICA 3T3VA 4ZTLA 1GOLA 2X4FA 3F3UA 3F5XA 3LLTA 4RRVA 1GJOA 2W1ZA 2WD1A 3KRRA 3WZUA 4EOOA 4G6OA 2W1GA 3GI3A 5TT7A 1PXLA 2JKQA 3CC6A 1U46A 2ITYA 4WHZA 1Y6AA 5HZNA 2C5NA 3BYOA 3HMNA 4L3JA 4PP7A 5M06A 3MFTA 3RM7A 4YUQA 1WBVA 5DRDA 2XAMA 3VBVA 3UQGA 4DN5A 4LRJA 3CEKA 1U54A 3R7YA 3U8WA 4CKRA 5K9IA 4EWHA 2C6EA 3AT4A 3QD0A 3TEIA 4K18A 3R1NA 5CEPA 3MBLA 2PZIA 4QYGA 2OK1A 3IOKA 4TZRA 4E4XA 3NMUF 3QUPA 4BCIA 3GU5A 3F9NA 2UZVA 4KSQA 4CLJA 1PXOA 5LXMA 3FMKA 4IX3A 1XH9A 3AC3A 3NNUA 3Q9ZA 3P4KA 1F0QA 4R8QA 3C9WA 5DPVA 4DGGA 2Q83A 4WRSA 5IQAA 2AC5A 1UWHA 3UIXA 5JZNA 3QQJA 4FTMA 3NUXA 3U6JA 2BUJA 3VVHA 4XG7A 1OPKA 2UZUE 4D58A 4Z7GA 5KBRA 5KMOA 3TDWA 1IEPA 2CJMA 2VU3A 5BVWA 3O8PA 3Q53A 3A99A 5FBOA 4YURA 2WMSA 3G5DA 4D2VA 3BGZA 3TTIA 3DY7A 3A60A 3Q4UA 4FZDB 4ASZA 4PDYA 4RX7A 5ANEA 5E7RA 3ZDIA 4O0XA 4XRJA 4J1RA 4XH6A 4XNEA 3P23A 2Z7LA 5EHLA 1H08A 2ZM1A 3CTQA 2JITA 2UW0A 3C5UA 4DINA 2VO3A 5JT2A 4HYUA 4EUUA 4BTMA 4CMUA 3COMA 5KUPA 5AADA 2XYNA 2X7FA 4L3PA 3UNKA 4L43A 4FNZA 4HYHA 5CEIA 2P3GX 3TJDA 2UVXA 5D7AA 2IW6A 5EDPA 3KMWA 2QLQA 4M69A 1YOMA 5EW8A 2C5VA 3SRVA 4C33A 4O0SA 3IECA 5L4QA 4DA5A 4GRBA 1P2AA 5CY3A 3CD3A 1QL6A 2WMAA 3LXPA 1MRVA 3F3WA 5FTOA 2X8DA 3W0PA 1J7LA 4QMMA 3NR9A 1KOBA 4D2TA 1BUHA 3C4FA 4IM3A 2XVDA 5LVPA 2VWWA 3VJOA 3VUHA 3D7TA 3ZXZA 1IRKA 2I6LA 2X2MA 4LI5A 3DBEA 3UIBA 2CNVA 2ERKA 3SLSA 4IZ7A 3AMBA 2Z7RA 1WBSA 4GFMA 4ZEGA 2XBJA 3TM0A 5LJJA 2RFEA 1SM2A 2JAVA 4LGGA 2QG5A 3ZSIA 3DKGA 4TYGA 3NDMA 4E6CA 2VWXA 3S00A 4CYJA 2X39A 5IQEA 3FI3A 4KIKB 3VBWA 5A4EA 3ZBXA 3KMMA 2YM8A 1GZ8A 4CQGA 5HTBA 4ZZOA 5C8NA 2ETMA 4NFMA 4ITHA 5JKGA 3JR1A 3EQDA 2P33A 3QCQA 2YWVA 4BB4A 4AXFA 4MHAA 4YJUA 5HOAA 4LV8A 3CCNA 3PIZA 4FTJA 2R7IA 3WF9A 4O0YA 4CMOA 1JKLA 2HZ0A 2PL0A 4TT7A 4EK5A 5IQFA 5CQWA 3QC4A 2R3PA 5CSVA 3ZEWA 3W2OA 3BLHA 4LG4A 4D4YA 1SMHA 2RIOA 3QCYA 4UMUA 4F63A 4JX7A 4F9BA 4FIHA 3AD5A 5HNIX 2WB8A 3NW6A 2YAAA 3PZHA 3TV7A 4BDCA 4YC6A 2FSTX 5KMNA 3QKMA 3M1SA 2GQSA 2UW9A 4NCTA 3A8XA 4HNFA 3SDJA 1OL6A 3R7EA 5CAOA 2HZIA 4AE9A 4BGGA 2FGIA 3NIZA 5JN2A 5B2LA 2RKUA 2CCHA 3LFBA 1E1VA 2C5XA 4U5JA 4BY9E 4ZAUA 2R5TA 4ZTHA 1PF8A 3PXYA 4JG7A 1ZYLA 4QMZA 2VTOA 4JRVA 2XNEA 3GCQA 3L9MA 3KVXA 2OF2A 1FGKA 5BX0A 4ZY6A 3AT3A 3VUGA 3LCTA 4ZTNA 1KE6A 4ENXA 2YCFA 3LFQA 5JRSA 3LFFA 3OW4A 2J0IA 3FMNA 4PDOA 2YJRA 5BVOA 4EOLA 2WMBA 3C0IA 4FKGA 3IG7A 1YDSE 3LXKA 3ZTXA 2X8IA 5L2TA 3OVVA 4ZSEA 1E9HA 1YKRA 3BX5A 1WZYA 3H0ZA 3DDQA 1XH5A 1ZYDA 1FVTA 4ZJVA 2YCQA 2B9JA 3GT8A 4OTFA 4OTIA 3D9VA 4EZ5A 2UZBA 3NUAA 3COKA 1ZLTA 4ZY4A 3EFJA 4NCTC 5AP0A 4O4FA 2OJIA 4TN6A 4RIYB 3MH2A 4O7ZA 4OAVB 1VJYA 2ZV9A 2C1AA 5IUIA 4Y46A 4U81A 2GTNA 3QRJA 1SYKA 3JVRA 4JOAA 4S30A 3MH3A 5CVHA 2XK9A 4I93A 4F6WA 3PUFC 1VYWA 3A4OX 4CV9A 4XLIA 4WO5A 3A7JA 2XB7A 5JGDA 1P4OA 4QQJA 4C4FA 2QOIA 4R77A 4S34A 2WMTA 3FZTA 3MS9A 4FV3A 5IDNA 3FC1X 4D1SA 3EJ1A 4IWQA 3P7CA 4D0XA 5M07A 4GK2A 3Q6UA 1KSWA 4F78A 2CLXA 4HGLA 3O8UA 3EN4A 5DE2A 3IONA 2JDOA 4EQUA 3HZTA 3OT8A 4TYIA 4FTOA 4HCUA 5D12A 3DLZA 2R3FA 3G33A 4QP9A 3THBA 3ZZEA 4BJJB 2VX1A 4PPBA 3VRZA 3G0EA 3D0EA 4XV1A 3B8RA 1W84A 2PE2A 4CFXA 4JMQA 4U7ZA 3GNIB 2JFLA 4L68A 4HZRA 2VTSA 4O7TA 3U54A 3LIJA 3FZPA 4GG5A 1DM2A 4I6FA 3VN9A 2XCHA 4EH3A 4ZY5A 4R1YA 3SOCA 3L9PA 1BL7A 1OL7A 3TNIA 2XBAA 3G0FA 3ZS5A 4R3PA 1UU8A 5LOHA 4G6NA 2W1EA 3A61A 3ATTA 4N6ZA 4FBXA 2NRYA 3DBFA 3RALA 4G31A 5J95A 1M17A 5IEVA 2JIVA 3V6SA 4KBAA 4R7BA 4IBMA 3NVMB 2HZ4A 4B7TA 3PYYA 4IB0A 5CTPA 2J0KA 4AG8A 3UOJA 1IAHA 3V3VA 4YNOA 1TVOA 3HDNA 3BHUA 2HIWA 4YJOA 1VZOA 4LL5A 4UWCA 4DDIA 2HENA 2VV9A 3TIYA 2PUPA 4ITIA 3R9HA 4GU9A 2XEYA 4QTDA 3OHTA 3EKKA 1IR3A 1O6YA 4FZ6A 4V04A 5KMLA 3IW6A 2GFSA 5AV1A 3ZHPC 3NGAA 3Q04A 4YJTA 4D28A 3L9NA 1DI9A 3WIKA 5BYYA 1ZYJA 1ZYSA 2PVJA 2RGPA 5JFSA 4QOXA 4KB8A 5FUTA 2QR8A 5AP1A 4FL1A 2X6EA 4JI9A 4YTHA 3TNQB 4YMJA 4DH5A 4MNEB 3BV2A 2ACXA 4C57A 3NYXA 3VO3A 2V7OA 4I5PA 4JBPA 4I23A 4X7QA 3NAYA 5HX6A 4IAYA 3QC9A 3DS6A 1REKA 2WMRA 3Q9WA 3OEZA 4TYJA 4BDFA 2VWBA 2UZEA 3ZRKA 2JEDA 2WGJA 3ANQA 3MY5A 2BDWA 3UYSA 5JQ5A 4HVSA 2J2IB 4FA2A 5C8KA 3LCOA 5BVDA 2G9XA 4JX3A 4HVGA 2OJJA 2UZNA 4C2WA 2PVHA 5IF1A 5BVEA 3W2PA 2VWYA 3UNZA 4E1ZA 4NJDA 3ZCLA 4RWLA 4KSPA 4CZTA 4G9CA 2FUMA 3FQSA 4IZYA 4CKIA 4CNHA 2QOHA 3GU7A 5CXZA 4D9TA 2VGPA 4GCJA 4PY1A 3ZO4A 2R3QA 4I20A 3D2KA 1ZRZA 1XKKA 3DT1A 4I0TA 4DFXE 5H8EA 4FT5A 4R7IA 4PL5A 4BRXA 4FX3A 4K1BA 2ONLC 5CF6A 1OITA 2YDJA 4NM5A 2YIRA 3NSZA 3PXRA 4YPSA 1OECA 5EM5A 1YHWA 2WQMA 3QALE 3SD0A 5IMXA 1Q97A 2VRXA 4IH8A 1GY3A 4BDJA 4KKHA 4F6UA 4I3ZA 3UOHA 3OMVA 3PG1A 2OZAA 4GK3A 3GEQA 2YEXA 4W9WA 3LM5A 2KULA 4OGRA 3D7ZA 5KHXA 5L6PA 4LGHA 2W17A 5DYJA 4Y5HA 3OWLA 3RAWA 3ENMA 2OG8A 3EMGA 4FV5A 3QHRA 3DJ6A 4OTDA 3C4XA 4FT3A 3VONA 2VTQA 3NYNA 4RJ3A 1LR4A 4ANSA 5DR9A 3FL5A 3ELJA 4EH8A 3V5QA 2JDVA 3OOGA 1Q24A 3UO4A 2XKDA 4O6LA 2J4ZA 1W83A 2C69A 4FVRA 4QMVA 4XG9A 3LM0A 4UN0C 3HRFA 4IAKA 3Q3BA 4AOJA 1LPUA 4JDKA 2Z7SA 5HCXA 2PVLA 4DFNA 1GAGA 3AG9A 3IW4A 3BRBA 4NTTA 2O5KA 5HCYA 3W8QA 4EOSA 4FE2A 3MB6A 5K4JA 1PMVA 4F08A 3LMHA 4G2FA 3CJFA 1O9UA 4IZAA 3DAJA 4NL0A 4EEVA 4CFFA 3GP0A 1OGUA 4FT7A 4NW6A 3VWAA 1JOWB 2P55A 4ACHA 2XKCA 5A14A 3U4UA 1BKXA 4EH9A 2P4IA 5HVKA 3OCTA 4RBLA 4OLIA 4HGEA 2UZOA 3HA8A 4JDHA 3LMGA 4IMYA 4FGRA 1PXKA 1FMKA 4MVFA 1MRYA 2XNBA 3JVSA 3VJNA 4LUDA 2C5OA 1JPAA 2OWBA 3I60A 4QNAA 5M4FA 4BF2A 3EKNA 4MF0A 4C4EA 4DTKA 1PMEA 2YZAA 3R7GA 3F3ZA 2NRUA 1Q8ZA 4FL2A 3I5ZA 2ZYBA 2VO6A 1H07A 3PRIA 4JBQA 4X3JA 2PULA 3PY3A 3S95A 1PKGA 5CLPA 3QX4A 4XV2A 4RIXA 4FTAA 2QG7A 3ODZX 4RZVA 3V5TA 3ZO1A 1H8FA 2PY3A 3RJCA 3CE3A 4BKJA 2E2BA 3GGFA 2R4BA 5IG1A 2G2HA 3KREA 4O82A 4P5QA 4F9CA 4M68A 4Q5EA 2XNMA 1E1XA 4C3FA 1G3NA 2IPXA 4U43A 4RIWB 3FHIA 3M42A 4QP7A 5K5NA 3BLAA 5HE2A 3E87A 2AC3A 3RTPA 2YZLA 5CSHA 1OL1A 1UVRA 4KD1A 4FUXA 3KULB 3NUUA 2IVTA 2Y9QA 3FLQA 3PE2A 3QD3A 4PPAA 4UEUA 1YWRA 2UW3A 5CZHA 4AF3A 4AXCA 1H27A 2PUIA 3DBQA 2O2UA 5FXRA 2EB2A 2CDZA 1J3HA 3GC9A 3TMOA 2OF4A 2UVYA 4HPUE 4EOPA 4MXCA 2YCRA 2RSVA 4XS2A 3PSCA 4ACMA 2G01A 4OR5A 4NWMA 1V1KA 5I9ZA 3UZRA 4AXDA 5M51A 4AW5A 2GQRA 2VTTA 4AGUA 5DFPA 3HL7A 2R7BA 3FZSA 2VN9A 3N4TA 2CNQA 3ZMMA 5HEZA 1Z57A 4C37A 1H26A 4FSQA 4RPVA 2WXVA 2W0JA 2BZHB 4ZK5A 4O7WA 3AT2A 2XAOA 3NW7A 3CJGA 5FP5A 3C50A 3AC4A 5AEPA 4QP4A 2BRMA 2YM7A 1P14A 4I22A 3I7CA 4IACA 4S33A 5E91A 2CGXA 4V05A 4DBNA 2XA4A 3UMWA 4RJ7A 4XOYA 3KXMA 1WFCA 1QPCA 4G17A 5HQ0A 3UOKA 1Y6BA 4P2KA 4YNEA 5DIAA 4U8ZA 5CAPA 3VUKA 3C7QA 3PUPA 4FC0A 2R3NA 2WMUA 4TWPA 5HIEA 3FMLA 3IKAA 5ANKA 3F7WA 4MXXA 5FDXA 3R00A 3BKBA 1IA9A 5BNJA 4DLIA 4BL1A 3TWJA 4XRLA 3QWJA 5D10A 3H9OA 3DNEA 2YABA 2BROA 1ZOGA 4YHFA 1I44A 2JIUA 3LQ3A 2B7AA 1M52A 5E4HA 3QLGA 1Q61A 3TIZA 2B9IA 2BHEA 4AQCA 1OKVA 4YZDA 2RFNA 3IK3A 4QTAA 3HV6A 1UNHA 2OIBA 2R3IA 3DQXA 4IJ9A 3BU6A 4CFUA 3A2CA 2IVVA 2ETKA 1J91A 1H0WA 3DZQA 4F9WA 4YU2A 1XBBA 4GT3A 2BVAA 4MXYA 1Q8WA 3Q4ZA 4L3LA 2PVMA 4PP9A 4QO9A 4V0GB 1T45A 3A7HA 4R78A 1KWPA 4P90A 4FKWA 3AKJA 1SNXA 3OW3A 5IQBA 5IH4A 4ZMFA 3OXTA 2YLEA 2W9FB 4HCTA 1M2RA 4M7IA 5GHVA 4I0RA 2V5QA 4C3PA 5IEYA 1PMUA 1YDRE 1BMKA 4JDJA 4IWPA 2J7TA 1Q41A 4K77A 4WRGA 3RK7A 3VW8A 3ZU7A 3W33A 3FPQA 4U44A 1JSUA 2FA2A 3PLAE 3VQHA 3L8VA 3VS7A 4CSVA 4W4YA 4QMQA 3F5PA 3HAVA 4L8MA 4XBRA 3NLBA 4WNPA 3SXRA 5C9CA 5IISA 3CTJA 1A48A 3H9RA 4PNKA 4FSWA 4EK8A 3KA0A 3PJ2A 4P5ZA 4PV0A 5L2SA 2Y7JA 3WF5A 1H4LA 1QPEA 3P7AA 4LUEA 4TPTA 4EK6A 4ZLYA 5HI2A 4MD9E 3ZLSA 5HIDA 4JG8A 2C3JA 4ANNA 1BLXA 5AAGA 5DT3A 5IZFA 1Y8YA 1Z5MA 2QI8A 5ACBC 4EHZA 1M7NA 1TQMA 4TW9A 4CCBA 2G2IA 1XJDA 3EN5A 1OKWA 4FG7A 5GZ9A 3VS4A 5J9LA 1YOJA 2R3MA 5BV3A 4C35A 3ZC5A 4KABA 1BI7A 3BYSA 1W2FA 4J99A 5EYCA 5DEYA 5EYKA 3S2PA 4M15A 4AZSA 4BDDA 2ITUA 2WELA 3KRLA 1GZOA 1PXNA 4I6QA 5I3OA 4U45A 1B6CB 2ZV7A 3GXLA 3DTCA 3E3PA 4C02A 4J98A 2RL5A 3FUPA 5IH5A 4FMQA 1FINA 2XKEA 5DR2A 5FG8A 3DDPA 2W9ZB 3HV3A 3K3JA 3QUDA 5L2QA 4LDTA 3BLRA 2YM3A 3LE6A 4GMYA 3D5XA 4XG8A 5HO8A 5CAQA 2ETRA 5HX8A 2XNOA 2W4JA 2VTIA 1R0PA 2PSQA 3DJ5A 3WBLA 2RFSA 1QMZA 3QRTA 1U54B 3DB6A 5A6NA 4F6SA 3OD6X 2VZ6A 5KMKA 1XBCA 1YHSA 3SX9A 2C0OA 3SW4A 5FM3A 3KB7A 3AD4A 2XRWA 3RWPA 3BHTA 4XEYA 5IA4A 5C4KA 5EOBA 2YA9A 3V8SA 3VS0A 5M4UA 2IZRA 4A7CA 4ASXA 3PA5A 3DPKA 4FTQA 4AA5A 3R8PA 2X0PA 4E20A 4F70A 5LCKA 4RT7A 4A4XA 4I41A 2YHVA 4BBMA 4BVUA 1PJKA 5DT4A 5CU3A 3RAHA 3VUTA 1APME 4FKLA 4IB1A 4QQ5A 4ZIMA 2EB3A 3WYYA 3PPJA 4FEWA 2QOBA 1SVGA 2XS0A 4WBOA 3WARA 2BDJA 4ZTSA 3HMPA 5K3YA 3BIZA 2PVKA 4DCEA 4I92A 5AUVA 4BDAA 4D9UA 1KE9A 3EFKA 3NEWA 4XX9A 3EQFA 4U0IA 4AW1A 3SVVA 2XALA 3OXZA 4ZMEA 4K11A 4OTQA 4XG3A 1HCLA 3POOA 4D55A 3EL8A 2IG7A 2CN5A 4I6HA 2Q0BA 3F69A 4O91A 4AOTA 3VBQA 2QOCA 5KKRB 5KMJA 4EQCA 4F7JA 3SXFA 3PFYA 1CKJA 3EOCA 4BDGA 5FTGA 4M69B 4FYOA 2FSMX 3SRVB 5TO8A 4RVMA 3PA3A 4KAOA 3PLSA 3F5GA 1WBWA 5KO1A 4BCPA 1XMMA 4AUAA 1H00A 3BHYA 4M67A 3GQIA 3TKIA 5CALA 4YO4A 1Q8UA 4DFYA 5CSXA 2B4SB 3KCFA 3W2QA 3D7TB 3HECA 3WF7A 3JYAA 1K3AA 5EFQA 1A9UA 1OIUA 1W2CA 2W06A 3H9FA 1WAKA 4IANA 5AM7A 3AC8A 3TNHA 4CEGA 4FKUA 5HTIA 1U5QA 2CPKE 2I0HA 4M97A 4IHPA 1TQPA 3SAYA 3FE3A 5EHOA 4C61A 3MY0A 1L3RE 4GT5A 4WUNA 4AA0A 3UO6A 4AGCA 1Y91A 1ZY5A 5EDQA 2C4GA 4FSRA 2B0QA 2GFCA 1XR1A 3IPHA 5KZ0A 4X6QC 3C4CA 5LARA 5CEOA 4FSZA 3TTJA 5GJGA 3RP9A 1OGYA 3D14A 5IU2A 3NZ0A 3CPBA 3Q4TA 1H01A 4EHVA 3RPRA 2XYUA 5AP2A 4Y72A 5EKOA 4UY9A 1IA8A 3R8UA 3UZTA 4O1OA 1XHAA 2X6DA 3QLFA 4FSTA 3PP0A 4EBWA 4XG4A 2YAKA 5E90A 2UW7A 3D5WA 3VBYA 3JPVA 4RVTA 3AQVA 3ACJA 3KL8A 4PUZA 3HDMA 4WBBB 3NS9A 3EQRA 3BL9A 5J1WA 3PXZA 3W0OA 2J0JA 3HV4A 2VWIA 1FPUA 2BRHA 4FG8A 4ZSGA 3R01A 4DFBA 4OTPA 3C0GA 3BWFA 3SW7A 2CKOA 2HY81 4JS8A 4NSTA 5LVNA 5CU6A 3NW5A 1RE8A 2JDSA 1YI6A 4FV0A 5AA9A 3KF7A 5TR6A 2LGCA 4MNFA 3TV4A 4QP6A 3ID6C 4H3BA 5J5TA 3PVBA 2WU7A 3PSDA 4O7VA 3GU4A 4Y95A 4LOOA 4MD7E 2H8HA 2X4ZA 2CGVA 3AGMA 4RA5A 3RPYA 2VTAA 3MY1A 3UG2A 1UNGA 4EJNA 4EOJA 3O51A 3S0OA 4JR7A 3F66A 4FT0A 3RZFA 3ZOSA 3F6XA 2W1FA 4BYIA 4J71A 3KK8A 3RZBA 4IX6A 3IOPA 4FIJA 3PJ1A 4I6LA 3OC1A 4II5A 4E6AA 4Q5HA 4QMOA 4DE4A 2ESMA 4YTCA 5AAEA 3ZONA 2YIYA 5J9ZA 2QQ7A 4ZLOA 4F7NA 3FI2A 3HGKA 3NUYA 4FEQA 4G34A 5CQUA 2B9FA 4B8MA 5IMEA 1DI8A 3OY3A 2Y4IC 4R1VA 5CSWA 2BTRA 5AIKA 4DEIA 4W4WA 3VUIA 1CDKA 4LMNA 5D9HA 1QPJA 4N4SA 4WNOA 4C36A 4IFGA 5M4CA 1NW1A 4MBJA 2F2CB 3FY2A 3NNWA 4NIFA 4JQ7A 4JL9A 3ZSGA 4O2PA 1QPDA 5LWNA 4IQ6A 3O17A 4CFWA 3UVPA 4BDBA 3F2NA 4XP3A 4EL9A 4MD8E 5BUJA 4X6RA 2FB8A 5JFVA 5D1JA 2W5AA 3DA6A 1R3CA 2XIXA 4QPMA 4IC7A 4AN2A 5A46A 3HP2A 3LCSA 3NNXA 2QVSE 3Q4CA 3PY1A 3QQFA 1TZDA 1TKIA 2JAMA 3R28A 4FKJA 4U3ZA 3ZFMA 5EM7A 5BUEA 3K5UA 3BBTB 3DNDA 4FZ7A 3SC1A 5CF4A 2Z7QA 3R30A 4M14A 5EYMA 4FKRA 3QD4A 5A4QA 4WG5A 5DOSA 4D4RA 4O4EA 4EZ7A 2BRNA 4O83A 3R1SA 3B8QA 4OBPA 2XF0A 3DK7A 5AP6A 4LOQA 4X2GA 5JK3A 3RCJA 3A7GA 4YGAA 4UXLA 4S2ZA 4RC2A 2XNPA 5LMBA 5ETAA 1GIHA 2UZTA 3R7VA 3QTSA 2B55A 2VTPA 4EBVA 2A0CX 2QNJA 1XH6A 2JD5A 5BVK