2V7AA

Crystal structure of the t315i abl mutant in complex with the inhibitor pha-739358
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
270
structure length
269
Chain Sequence
DKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIIIEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
publication title Crystal Structure of the T315I Abl Mutant in Complex with the Aurora Kinases Inhibitor Pha-739358.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 81
structure length 269
sequence length 270
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2v7aA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2v7aA01
1H1PA 3BWFA 1UKHA 3QALE 1GZOA 4Y73A 5E8SA 3F2NA 5CALA 1ZXEA 3ZFMA 5FDPA 4BYJA 2XA4A 2V7AA 2WMTA 3EHAA 1KE7A 4FC0A 4JG7A 4IAAA 4ITJA 2YIWA 3LFBA 4F1OA 2HK5A 5CASA 4ZOGA 1L3RE 1YW2A 4RWJA 4K9YA 4PUZA 3PDTA 3R7GA 4R7BA 3PA3A 5DA3A 5FTQA 2ERZE 3Q4ZA 3TDWA 2IWIA 4F6WA 4V01A 4DH5A 4XG8A 3V8SA 1WBPA 1BL6A 5AJQA 4C38A 3CJFA 4PPBA 2P2HA 3SLSA 5AP0A 5KMJA 2FSTX 2JFMA 2WTKC 3T9IA 4HPUE 3JR1A 3QYZA 3D5UA 4A9TA 2JD5A 4AUAA 1WVWA 3UIBA 3H9RA 3NW5A 5C4KA 1WBVA 3MPTA 2QU5A 3P4KA 2GFSA 2HYYA 4A9SA 4HYIA 1OKWA 2YEXA 5J9YA 4XHKB 3D0EA 3QFVA 3ZO2A 4ZJVA 5GIPE 2PZ5A 2BKZA 3LQ5A 4BI1A 4QD6A 4D1XA 4ZTNA 4Z3VA 2ZMDA 1SNXA 4XEYA 5CSPA 2W06A 3TNWA 3JVSA 4FV3A 3CEKA 3HGKA 2QOHA 2UV2A 3BI6A 2WQNA 3KRLA 3R00A 4U81A 4D5KA 2UZTA 3Q04A 5CQWA 4AW2A 4QNYA 3ZMMA 2Z7RA 2O3PA 4IXPA 4WIHA 1Q8WA 5I9VA 3HV6A 3R9NA 2C0IA 3LE6A 1GIJA 3DZOA 4RWKA 2B9HA 4R6VA 2IW8A 4F9YA 3EFWA 3FMLA 3KF4A 4OLIA 2WTCA 2G2IA 3NYNA 3RGFA 4FOCA 2ZAZA 2EVAA 4EZ3A 5CEMA 4BDBA 2ZM4A 1PKDA 2WMAA 5GJDA 4FV5A 2O5KA 4DEBA 5LMKC 4FZAB 3ZSIA 5KBQA 5JMSA 2C4GA 4R3PA 4NT4A 4FK6A 4IWDA 1AD5A 3DA6A 2OH0E 2B9JA 5IQIA 2EB3A 2BKKA 4ALUA 5A4LA 4WG4A 4W4WA 2WQEA 3BEGA 4HW7A 4MQ1A 2YLFA 1YXXA 3NUUA 5A54A 3RAWA 2W1CA 5AUUA 4RC2A 3BYVA 3ZUVA 4HPTE 4J95A 4IHPA 3FZTA 4WOVA 3ANRA 2I6LA 2CLXA 4FT5A 3I0OA 1RJBA 4DG3E 2R3FA 1Z9XA 3AC2A 3PA5A 1OZ1A 1IRKA 5ANJA 4DFNA 2A1AB 3L8PA 4DTBA 2QURA 4C4HA 4IB0A 4EH4A 3ZM4A 5DRBA 3QZHA 5HIEA 3JYAA 1GIHA 2P3GX 3TNHA 4NWMA 4HGEA 4BCKA 4HCTA 3MIYA 2ITYA 2WTIA 2UW4A 1Z5MA 4U3YA 2OH4A 1JNKA 5CENA 4B4LA 1YDRE 4DG2E 2YIRA 1KOAA 4BDIA 3VIDA 4GEOA 4ZMFA 2VTIA 4CCBA 3FY0A 3NDMA 4GMYA 3ZEWA 3PPKA 3ZZEA 1YDSE 3ORIA 5M07A 1GZ8A 4HGTA 4CFNA 2HENA 3R73A 4MNEB 1HCKA 3PJCA 5HE1A 4B99A 2X7FA 5CNNA 4U3ZA 3SX9A 5EHYA 4KS8A 4F0IA 2AC3A 4FYNA 2VWUA 2UW5A 3GQIA 3W18A 4U80A 4C7TA 1NVSA 4FG8A 4PQNA 5JGBA 2UVYA 1VJYA 1GY3A 4FKIA 4MD8E 4GSBA 4MAOA 2XMYA 5EQPA 1VYWA 3R7IA 1H0WA 2XK9A 3QTQA 2QO9A 4BDKA 2YA9A 3OXTA 3VQUA 4CCUA 2YZLA 2PMOX 4ANOA 3MVJA 5CVFA 2QQ7A 3OCBA 1H07A 3W2QA 2YM6A 5HIBA 2X39A 2B9IA 1IAJA 3HRBA 4MH7A 3TV7A 3LCTA 4P7EA 4BCHA 3IDCA 3ZOSA 1URCA 4A4XA 3TKUA 2QO2A 2XF0A 3QLFA 4G6OA 5CXZA 4NSTA 1G3NA 2ITXA 2XK6A 3DV3A 4FZ7A 3MTLA 4I5PA 2W4JA 4DEDA 4ZY5A 2PZRA 3V8WA 4ENYA 2FVDA 1H1WA 4HCUA 3PPZA 2H8HA 4YZNA 3NLBA 4MXOA 3HP2A 4PNKA 2W99B 3UOKA 2XKCA 1PY5A 2REIA 1UU7A 3CP9A 4F08A 4YMJA 2PVFA 3BBTB 4D4YA 2E9UA 3DT1A 2CJMA 3R21A 2W5HA 4DFYA 1DI8A 3DJ5A 2R3HA 4RC3A 5BMSA 3QCYA 5A6NA 4LMUA 4L68A 1DI9A 2QLQA 5LVMA 3EWHA 4FTRA 2Z02A 3VBYA 3REPA 5HBHA 1BLXA 4R3CA 1Y6BA 2B52A 2B54A 4DCEA 3QA0A 2PULA 3SRVB 2W1ZA 4CNHA 3LFCA 5DG5A 5E8TA 5JRSA 1V0BA 2G1TA 1ZMVA 3C1XA 3DNEA 5DEYA 1ZYDA 2GQRA 1H00A 3FQEA 3GT8A 3R1QA 4L6QA 2J5FA 3WF7A 4AZWA 4BBMA 4XCUA 4Z55A 3R2BA 2YITA 3SOCA 4R77A 4Z9LA 2NNWB 3Q9YA 3HECA 4YJPA 4IVAA 4R8QA 1W8CA 2QCSA 3ZLYA 2XEZA 1KE8A 2JDSA 4CFWA 4FNWA 4RLKA 5B2LA 4ZEGA 2R3NA 4HCVA 3UOLA 4EUTA 2PUNA 1U59A 1JQHA 3SXSA 1GNGA 4L3LA 3K2LA 4KIPA 3R8MA 4XV3A 2QONA 3R9HA 3PYYA 4GUBA 3OY1A 4QTEA 3WARA 4KIKB 1Y6AA 4DEIA 4IX5A 3QD4A 5D10A 1UNGA 3LZBA 4IAIA 3VBTA 3VRZA 4C59A 5KMLA 4Q5HA 3A7HA 3BIZA 5DEWA 5AX9A 4F1MA 2VWXA 4CQGA 4OTDA 4K77A 5ANGA 1LPUA 2FB8A 2X6EA 4IQ6A 3WZKA 3BYMA 3OXIA 3QZFA 5CXHA 4KKEA 4FEUA 3A4PA 4YLJA 3EZVA 4UZHA 5DBXA 3OFMA 3F88A 2XK7A 4ASEA 4TNBA 4O6EA 4I5HA 2OLCA 3HYHA 1RQQA 4FG9A 2ITVA 1YVJA 2FO0A 2W05A 4FTKA 1BI8A 5J87A 3EQIA 4NM3A 4QTAA 4WO5A 4NIFB 5DR6A 4NM0A 3KA0A 5FBNC 4IADA 2E2BA 4R3RA 2C6IA 4FV6A 4EEVA 4AU8A 4PP7A 1U54A 4E4LA 2XIXA 3MH2A 4M67A 5AUWA 3TNPC 2WAJA 3G90X 4Q2AA 2W4OA 4ZJIA 4CSVA 1LEZA 3IW8A 4I5MA 5HG7A 4YPDA 3TXOA 4CGAA 4GIIA 5A4CA 3D7TB 5IMXA 1PXJA 4C33A 3O23A 2XM9A 3W33A 1OIUA 3QLGA 4M3QA 4RJ4A 4E1ZA 4RQKA 4D2TA 4O7VA 3MYGA 3GC7A 2BRHA 2FSLX 2GCDA 4IB1A 4U44A 4O0SA 4QMOA 3V01A 3RM6A 3QRTA 3LJ0A 4WNPA 1RDQE 1UNHA 3HMPA 4M13A 4AF3A 4CD0A 3G33A 4FUYA 4L52A 3UVRA 4BF2A 4ERWA 4BWKA 4E4XA 3FE3A 3KB7A 2C1AA 4OW8A 5J5TA 5CZHA 3TUCA 3PIZA 4O6LA 4M69B 2IVVA 1KE9A 2P55A 4I6HA 3NW6A 4EHVA 4DF3A 4ACHA 4ACDA 3RTPA 2W1FA 3RK9A 3GCPA 4TKSA 4F9CA 4Y72A 2B4SB 3FMHA 3IQ7A 5M08A 4ZSJA 5LWNA 3FZOA 2R3PA 4X2KA 4DFBA 2XCHA 4L42A 4J8MA 4PTEA 3F69A 1FPUA 4DGGA 5HX6A 4DFXE 5DFPA 5FDXA 5L2SA 3KKVA 4EOQA 4S32A 4K0YA 1YI6A 2RG5A 4XV9A 1PJKA 4F0FA 1PMVA 2VTHA 3V5JA 3QC9A 5GHVA 4U9AA 4MNEA 1PXOA 3VC4A 4IACA 1PHKA 3HMMA 3WBLA 5KCVA 5D7VA 3FLNC 1H28A 2GSFA 3GVUA 2O63A 4AFEA 4Z7HA 4EL9A 5HE2A 3IOPA 1M2QA 4QQJA 5LARA 2W1GA 5AUTA 5CSHA 3CXWA 1SZMA 3RAHA 3RAKA 4C3PA 5IQHA 2FA2A 3CKXA 4FT0A 1NT2A 1P2AA 2W17A 4DEHA 3LQ3A 3SW7A 3TNQB 4FL1A 2OJGA 2WMUA 3UMWA 2BILB 2RG6A 2XUUA 2PVHA 3E87A 4QPSA 3SGCA 4BGQA 3QKMA 1YI4A 4FBXA 1PF8A 2PU8A 3LJ2A 1X8BA 3OTUA 4QPAA 3P78A 4J97A 3R9OA 4NEUA 1Q8ZA 1Y57A 5T68A 4QTDA 2J0KA 2QOQA 3BGQA 3GNIB 3IDPA 3PY0A 2HY81 4MBIA 4YO6A 5TOZA 4BI2A 1XR1A 2VTAA 4EWQA 5K5NA 3FMDA 1TQIA 3QTSA 4EQMA 4J71A 4TYEA 3IW7A 4LOPA 4E6QA 4O21A 5LMKA 2C68A 3B8RA 3RAIA 1YOJA 3ZLWA 5F94A 3C50A 4K18A 2OK1A 3FC2A 2PVYA 1TKIA 5HNBA 2P0CA 4JR7A 4JRNA 3I7BA 4FEWA 4D9TA 4Y46A 4QYYA 3KY2A 4G5PA 4E93A 3OROA 5G1XA 4JLCA 2G2HA 4YPSA 3RPOA 3AGMA 2B7AA 4ZTQA 4JAJA 1APME 3D5XA 4BDEA 3DTCA 2I0EA 4MD7E 4EK6A 5FP5A 3UC3A 4BYIA 3CSVA 4BFMA 5HTCA 5LXMA 2WPAA 4G3EA 4U5JA 4XS2A 3R8VA 3UBDA 4PMSA 4L45A 3WF9A 5BNJA 3SRVA 3U51A 2EXEA 5CEQA 2PZPA 5CI7A 5HQ0A 4FTTA 5D41A 2VWWA 5AP3A 2E9OA 3TDVA 1PXIA 1Q41A 1WBWA 4F9BA 3E7VA 4EKKA 3I6UA 5AX3A 2YCRA 5DR9A 5IQAA 3MN3A 4LFIA 4FV4A 4C58A 1H26A 3ZLSA 3NCZA 4D4SA 5AV2A 3GC0A 2Y4PA 3OP5A 4BHNA 3NIZA 4E26A 3P0MA 1UA2A 3I7CA 5J7HA 3F82A 2XJ1A 5JSMA 2C5YA 2C6DA 4FIJA 2EU9A 2CKPA 3ZH8A 4S31A 4A06A 3U4WA 4KIQA 5DN3A 4GUEA 4MXXA 3JY0A 2WOTA 4U6RA 3MY0A 3P86A 1OIRA 2YCFA 3MA6A 3TI1A 2Y8OA 3BX5A 2XJ2A 3FMKA 3FQHA 5CYIA 3LXPA 3BE2A 4QQ5A 4FKSA 5BMMA 3LLAA 4F70A 4I93A 4O0RA 4W9WA 4WUAA 3UIMA 4UEUA 5HTBA 1OKYA 5KZIA 5E1EA 4DE4A 5HG8A 4GYIA 2HW6A 3WILA 4HZRA 2IJMA 3LXLA 3VUTA 4B8MA 4M15A 4X3FC 2BR1A 3DLSA 3RCJA 3UNKA 3VF9A 4AGCA 3EQGA 2WIHA 4FNZA 3A7IA 5KMNA 3TZ9A 2WTVA 4E4NA 3S1HA 4JIAA 1KUTA 4EYMA 4AN3A 5AP5A 1YXUA 3L1SA 4LL5A 4C3RA 2YIQA 4GG7A 2W1HA 4MWHA 1E9HA 3ZXTA 4JG6A 4BN1A 5DYJA 5EW3A 1JKTA 2F2CB 3DY7A 4FEQA 3DOGA 2X8EA 4ORKA 1DS5A 4ZLZA 3Q2JA 3QX2A 2I0HA 4IIRA 3CGOA 4G31A 3JXWA 3GU4A 3SC1A 1JSUA 4N57A 3LFNA 2BZKB 2VN9A 3CQUA 4D2RA 4JIKA 4BZOA 5AV4A 2W1EA 2XIYA 4PWNA 3MS9A 3EIDA 5HORA 3BQRA 3BU5A 3FKOA 3C4EA 5I0BA 3P7CA 4C4EA 2C3KA 3K5VA 3UYSA 3G6HA 2Y4IB 4FYOA 4WSYA 4IVCA 4NW5A 3SKCA 3BLRA 2YN8A 1F3MC 4X2FA 5E90A 4ITHA 3E63A 4AGDA 2GNGA 4L46A 1M7NA 4FTAA 4CV9A 4F0GA 4A7CA 2OXDA 3TM0A 1WAKA 3MFUA 4HVSA 2XM8A 3U6HA 4M69A 4FSYA 3UP7A 2W5BA 5H8GA 4EH6A 3ALNA 4MBLA 5IUHA 5KUPA 3FC1X 3V8TA 5C4LA 4YR8A 5AEPA 5M4IA 3MGYA 2CNQA 2F7EE 3NUYA 3PJ1A 1FGKA 4EK5A 1WBNA 2BZHB 2KULA 4I1ZA 4U40A 5A3XA 4JBPA 3W2CA 1F5QA 5FUTA 2V62A 4EI4A 2AYPA 3HL7A 4YP8A 2V0DA 3OMVA 5IDPA 4Q5EA 3RCDA 4YO4A 5BVEA 3PTGA 4LMNA 4DLJA 5IQEA 1PXLA 1QPJA 3L8XA 3PJ3A 4NYEA 1UNLA 2FYSA 2C6OA 2IZSA 3G5DA 3KCKA 3NIEA 3UVQA 2FSMX 3ZUUA 4CYIA 5L3AA 4FZ6A 5FD2A 2DWBA 4BRXA 3N4UA 2W9ZB 2Q83A 3QQJA 4M0YA 3QZGA 2X2MA 4YC6A 4F7NA 5IA3A 3DK7A 3R7EA 4J7BA 3VS0A 3EFKA 4DFZE 4I6QA 3DK3A 5ITAA 3G51A 5FM2A 4F4PA 2WU6A 5M56A 4DT9A 1HOWA 3WI6A 4E5BA 2GHMA 4LI5A 5ANIA 1ZZLA 4ASDA 2VO0A 4ZLOA 2XK4A 3VBWA 1BYGA 1YQJA 3EKNA 3KFAA 3Q52A 4RT7A 4O7RA 1REKA 3EQRA 4L67A 3ELJA 1PKGA 3QXOA 4DH1A 3C0GA 3DK6A 4RWLA 4UYAA 3VUGA 5AV3A 1WMKA 1TQPA 2H96A 4P2KA 5AADA 4PDPA 3BQCA 5M51A 3OY3A 4HGSA 5JFWA 3R9RA 2HXQA 4NU1A 5AUXA 4JRVA 1AGWA 4U41A 2F57A 5JKGA 1OECA 1QL6A 3VVHA 5CVHA 3KRXA 1A48A 3IS5A 4EQUA 3FSKA 1O6YA 5JH6A 4FVRA 1OL7A 2XYNA 1S9IA 2WGJA 1RW8A 2Y0AA 3JS2A 3QX4A 4O81A 3EKKA 4GK4A 2VGPA 2OGVA 1Y91A 3PP1A 4FV1A 3FKNA 5EOBA 3E3BX 4TY1A 4TN6A 2QI8A 3ZU7A 4CMOA 4HVHA 2CMWA 1Q4LA 4MK0A 2QC6A 4QMSA 4ZK5A 3F3UA 3FSFA 5EFQA 5AA8A 4E6CA 1XH9A 5C8MA 5GZ9A 3CS9A 5E1SA 4C61A 1OPJA 2XKDA 3LFAA 5EM6A 2WMWA 3R0TA 1PXPA 2Y6OA 5A4QA 5CTPA 2PVMA 3O7LB 3SA0A 3KVXA 1O6LA 5LVNA 5FM3A 2JKKA 5HGIA 3OCSA 4GJ2A 4B8LA 1NVQA 2UW8A 2OJJA 4MNFA 1H1RA 2I40A 3NUNA 2QG5A 1M52A 3GBZA 4HVDA 3PRFA 4V05A 5CT0A 3QKLA 4R5YA 3VQHA 2WQOA 1SVGA 4JS8A 4JAIA 4O7WA 1ZAOA 2HZ0A 2XH5A 2BAKA 2ZM1A 5EDQA 3IPHA 2JAMA 2VWIA 2ZV9A 4NZWB 4RRVA 3PE2A 5FRIA 4YJRA 3S4QA 1XH8A 3CD3A 2PVRA 3DDPA 4IANA 1JAMA 3K3IA 3FI3A 2WO6A 3QRUA 3G2FA 3U54A 2UZVA 3DCVA 4JNWA 2BPMA 4MXAA 4WUNA 5HLPA 4A4OA 2BAJA 3QTIA 5E92A 4O91A 5FTGA 3NVKI 4RQVA 1DM2A 5AP4A 5AR8A 5H8EA 3NUSA 2XKFA 4AW0A 2ZDUA 3W32A 4FKUA 4AZSA 3MPAA 2X0GA 3SOAA 3LFSA 5IA4A 2QNJA 4EC8A 1IAHA 1OL1A 2ZJWA 3E8EA 3AC3A 4AN9A 4ZSGA 2X9EA 1BMKA 3TL8A 3VS5A 3QF9A 4IAFA 5I3OA 3KQ7A 4DTAA 2YIYA 3FLSA 4NM7A 3CKWA 3COKA 4MXZA 5DIAA 4WNKA 2X2LA 3GU8A 4LG4A 2BZIB 3UOJA 1HCLA 4QOXA 1OM1A 3HVCA 5CANA 1OKVA 4QP6A 2YFXA 4WRGA 4YJQA 5E8VA 4CFFA 4AWIA 4O82A 3HV3A 3D5VA 4PX6A 1V0PA 4FK3A 4CT2A 5HLNA 3VUIA 5CF6A 3P1AA 4BVUA 3VS6A 1EH4A 1XH5A 4WBOA 3FI4A 5BVNA 3DKCA 3KU2A 4RIYB 2WMRA 1J3HA 3G6GA 5IA1A 1OPKA 1I44A 3GOKA 5A14A 2CHLA 3C4WA 5EG3A 5ETIA 4IMYA 1JKKA 3ORTA 4F09A 5L8KA 4OAVB 4GT5A 4TRLA 5JGAA 3KXXA 3MVLA 2PHKA 5L6OA 4QMWA 2WQMA 1NW1A 1CTPE 4N0SA 3HV5A 5A46A 3QUEA 4JL9A 1Q99A 4AS0A 3VBQA 4DCAA 2OICA 4PTCA 4FIHA 3N4TA 2C0TA 3PSCA 4IB3A 3RINA 3LXKA 2PVJA 4FIEA 4O0WA 2OSCA 4ZSEA 3CTQA 4EOMA 4IAKA 2HAKA 5KMKA 3F9NA 3HMNA 3PWDA 4S34A 3LVPA 2PVLA 2UW6A 4K8AA 5L2QA 2EB2A 5EK7A 5IZFA 4QNAA 2VTNA 3VS3A 4OBPA 5CLPA 4C35A 5FEDA 4AGWA 4I3ZA 1PRYA 1YHSA 1H0VA 2WQBA 3E8CA 2PMLX 3LM0A 3QGWA 3HV7A 2VWZA 2WZJA 4KBKA 3LIJA 3GCQA 3TZMA 4NH1A 5L2IA 2GTMA 4BWPA 3FLYA 2BFXA 3E62A 4ANBA 5FLFA 4XV2A 2AUHA 4I94A 4B7TA 3B2WA 4EBVA 4N70A 2OZAA 4AG8A 4GFMA 4BC6A 2JKOA 5E4HA 2VTPA 4RBLA 4BCOA 2GS6A 5E8UA 2J4ZA 1PMEA 3R7OA 4W4YA 3FYJX 2VTOA 2XJ0A 1GJOA 2PE0A 3SG8A 3FZ1A 4B9DA 4JBQA 4F99A 3M11A 2JIVA 5H2UA 5EOLA 4A9YA 2JDOA 4TWCA 1JSTA 5IPJA 3II5A 3JUHA 4I21A 5CNOA 4PMMA 3BV2A 3VULA 1DAWA 5K9IA 3WIGA 3SXFA 5IQFA 1OI9A 2VNYA 2WXVA 3PRIA 4X3FA 3NGAA 4TWOA 4C2WA 3NNUA 3QQGA 4RIWB 5ETFA 5HIDA 3VAPA 4LUDA 3D15A 4CMUA 4RLLA 1Q8UA 1JVPP 5JN2A 4YSMA 2VX1A 4I6FA 4K11A 3JY9A 3RZBA 3LKMA 4O22A 3D14A 5K4IA 3AC5A 3ORMA 1ZARA 3ZEPA 3OVVA 4O7ZA 2QR8A 2YDKA 4OGRA 3BHVA 3FKLA 4HYSA 4D0WA 4YBKA 2BMCA 2PL0A 5T6KA 1F0QA 4FT9A 3NUAA 3QTRA 4JVGA 5FQDC 4X2NA 2BTSA 5BYZA 3ZO4A 4IM2A 3G9LX 1PXMA 1GIIA 4QMMA 3OTVA 5HI2A 5D1JA 5CF8A 3UZPA 2CGUA 4UXLA 3UG2A 5FTOA 4U97A 4PP9A 1WVXA 5GZ8A 4YBJA 4ZSLA 4UZDA 4CRSA 5HVYA 4BGGA 3H30A 1YXTA 4RIXA 4ZY6A 3VJOA 2H6DA 3V3VA 2ZYBA 3OW3A 3PZHA 5HHWA 3ID6C 2ETKA 2R3JA 4EOOA 4GS6A 4I20A 5B2KA 4BCIA 4D4VA 4JBVA 2OO8X 2WTDA 1CKPA 3LMIA 3WZJA 3A7JA 3RWPA 5C8KA 4DTKA 3RPYA 3ORLA 4DT8A 4XOYA 2QOCA 5HNIX 4EJNA 4I92A 4KD1A 4QMYA 1M2RA 3LFFA 4ALWA 5M4CA 2BRNA 3MW1A 5D7AA 5GINE 2VTLA 2J50A 2C6TA 4OTGA 3TACA 3TIYA 4XRLA 2QLUA 4CFXA 4FSMA 5CEPA 4XG6A 5ANOA 4X2JA 5JT2A 4NTTA 4D2WA 2XK3A 2A19B 4GFOA 4ONAA 3GFWA 3HMOA 1MP8A 2ITZA 3GOPA 4X6RA 4ANNA 3UJGA 4D4RA 1TVOA 5DE2A 4AE6A 2O65A 5E9EA 4WA9A 3BYSA 5E8WA 3E8DA 4BWXA 3FI2A 3I4BA 3A99A 4GJ3A 5K4JA 2W1DA 3MI9A 1OIQA 4FKQA 4H3BA 2YM3A 3P08A 3WF8A 3UYTA 4ZS4A 1W84A 2H34A 5CSXA 3PIXA 3U87A 4AT4A 4BHZA 1SMHA 3R7VA 4C2VA 5HLWA 2CLQA 3P5KA 3UPXA 4J8NA 4O7SA 4DG0E 4E7WA 4FNYA 5E8ZA 4RVKA 4BDAA 5IA2A 3HKOA 5F9EA 5IA0A 5EQYA 2HELA 2HWPA 4A9UA 4O7LA 3MY1A 2VTTA 3DFCB 4P90A 4FZDB 3TJDA 4RA4A 3CBLA 1W83A 3OOMA 2WMSA 2BUJA 1GOLA 1WZYA 3MH0A 5IH5A 5J9ZA 4PPCA 1ZOEA 4IVBA 1PMNA 3RM7A 2QOFA 2VNWA 5IMEA 4CLIA 3BGPA 4GKHA 5A4TA 4L01A 4EH8A 4FUXA 3C51A 4OUCA 1YHWA 5IU2A 1LUFA 5LCJA 2PE1A 2YJSA 5HE3A 4DH3A 4LRKA 4XG4A 1KE6A 4RIYA 3MTFA 2X6DA 3FLWA 4ASZA 3O51A 1VZOA 4YJSA 4PL4A 2G2FA 4RIOA 5KKRB 1JPAA 4WRSA 4XLIA 4PMPA 4BZDA 4CFUA 2C47A 4AX8A 3DKGA 3HX4A 4O0TA 3V04A 4ZZOA 2RF9A 4EOKA 4YSJA 4EKLA 2KTYA 4HVIA 4L3PA 1CM8A 3ZCLA 4UMUA 3ZFXA 4QP7A 4DH8A 1YXVA 3EL7A 3S95A 2JDTA 4XH6A 1Y8YA 4FKVA 4PDSA 4QO9A 2HY0A 3KXGA 4XLVA 2ZOQA 3OXZA 3QXPA 3SD0A 3E92A 4QRCA 4GL9A 1KE5A 5AAEA 2I0VA 2IZRA 3NNXA 3UOHA 3VS4A 4QQCA 4O83A 3FHRA 2CSNA 3FXXA 3EFJA 3BHUA 4FEVA 1G8SA 2WD1A 3GU7A 2ETMA 3FL4A 3IGGA 4O0YA 4YTHA 4OTPA 4FIFA 4FSNA 5AR7A 3QQFA 4RG0A 3DB6A 5ACKA 4EONA 1BL7A 1UWJA 2R7BA 2VZ6A 3AQVA 3MFSA 4BICA 3HA6A 5JFSA 4O38A 2VWYA 3UODA 4EYJA 3MY5A 3OC1A 3KEXA 5EKOA 2VUWA 3BEAA 4G2FA 3QTWA 3QKKA 3KXZA 3NSZA 3GC8A 3KN5A 5H8BA 4D2PA 4O1OA 3GGFA 1TQMA 2XNBA 3FPMA 4F6UA 3GENA 3H9OA 3AD4A 5HU3A 3BYOA 3PSBA 5KX8A 5HG9A 2UZEA 3PE1A 2VTRA 2YM5A 3DNDA 3E5AA 4LGHA 4ZS0A 4BCMA 3EQHA 2VX3A 1H1SA 2IZTA 4TXCA 5AP1A 5AV0A 4CTBA 2GTNA 4JQEA 1W7HA 4YNEA 4FT7A 5BVKA 2J9MA 3HEGA 2XK8A 3LQ8A 3C5IA 5F1ZA 3L8VA 4FEXA 2X4ZA 5EM7A 1Q97A 1A06A 2OJFE 1E1VA 4RIWA 5AA9A 2R3MA 2QG7A 5BQ0A 1J7IA 2VU3A 2C1BA 2WELA 3BZ3A 3OEZA 1U46A 3MJ1A 2UZWE 3HLLA 3QZIA 4H3QA 4K2RA 2YHVA 4IAYA 3UPZA 2R2PA 2R3OA 4C4JA 5EW8A 3LCDA 4RX8A 3AT4A 4W8DA 3CY3A 3AT2A 3ZTXA 1J1BA 2OKRA 2IW6A 4HGLA 5CU0A 3QRJA 5E8XA 1Q3DA 2JIIA 3V5TA 1YWRA 2B1PA 3ODYX 1SM2A 4ZTMA 4X2GA 4OT6A 4FIGA 5DWRA 4I0SA 3O8UA 5C1QB 4O2ZA 2GQGA 4JDJA 5EHLA 5TE0A 3ROYA 2R3KA 4QTCA 4DN5A 5JGDA 1U5QA 4I4FA 4OTFA 2F7XE 3S0OA 2ETRA 4V0GB 4C3FA 2CN5A 2YM8A 3OWJA 2EWAA 5J9LA 1VEBA 3OEFX 3UO5A 3NAXA 1MQBA 2HZIA 3FY2A 5JQ5A 3D2IA 3VUMA 3AXWA 5CAPA 3U6IA 4UALA 2NRYA 2YDIA 1CKIA 2QOIA 2B53A 5IA5A 5BVWA 1YKRA 1CSNA 4JDHA 2BDJA 5JZNA 2UVZA 4QP1A 3CD8A 3Q4TA 4EJ7A 1MRYA 2OXXA 4U0IA 3ZRKA 3E64A 4D58A 4F9WA 1KV2A 2DS1A 2WEVA 1H08A 3PVGA 4YZCA 3ODZX 3P23A 3H4JA 4FV0A 5KE0A 2QODA 4FKPA 2PVNA 3EH9A 3VO3A 4P5QA 3PLAE 3NNWA 3VBVA 2PUIA 1QPEA 2O64A 5HG5A 3UC4A 3B2TA 5DNRA 4FF8A 4CMTA 2XIKA 3O8PA 3P7AA 3ZZWA 4EOSA 3RHXA 3D9VA 1OKZA 3DXNA 4UWBA 3C9WA 2BDWA 2F7ZE 4WT6A 4C4IA 5DMZA 1OMWA 4Y95A 4CKJA 1M14A 3AC1A 4RVTA 4FNXA 3ZHPC 1PXKA 4FMQA 4CVAA 5CEOA 2R3IA 3KMWA 3FDNA 3PVWA 1Q8YA 2BRBA 3EB0A 2WFYA 3N4VA 4KSQA 4CZYB 2WB8A 3MFRA 4OTWA 3EN7A 4KS7A 4O7TA 2Y4IC 4R7HA 1CKJA 3A62A 3LFEA 4EH3A 4TWPA 5HCYA 3L9MA 2YLEA 3SQQA 4AGUA 2W1IA 3R71A 4PDOA 4Z16A 4IX3A 4DITA 3FMEA 3FXWA 5D11A 2IVUA 4YURA 5HBJA 4CXAA 3TZ7A 3BRBA 5K0XA 3ET7A 4TYHB 4ACMA 2C5NA 3Q5IA 4XG7A 3ATSA 4FE2A 4H1JA 4M7IA 1ZWSA 5HESA 3C7QA 4F1TA 2J2IB 4QP8A 3ZSGA 4FTOA 5D12A 1Q62A 2QO7A 4UBAA 3ZXZA 3SG9A 1SNUA 2XRWA 5KZ0A 3IECA 3R7YA 5D9HA 5DPVA 4BR3A 3CGFA 2BZJA 1UU9A 3UQFA 2GNIA 4WG5A 1H4LA 3POZA 4E6DA 3U55A 1R0EA 2PSQA 4JOAA 5FP6A 3UNJA 4AA4A 2ITTA 4YZ9A 5FGKA 2IPXA 2UZBA 4ZSAA 2YERA 3RPRA 4TNDA 3HUCA 3ROCA 3CTJA 1FVRA 3QAME 2XNOA 4OTQA 3NPCA 4KIKA 4IJ9A 2V7OA 4XG2A 4ZJJA 4GH2A 4MF0A 4P5ZA 4AFJA 3FPQA 5CSVA 1FVVA 3NX8A 5IQGA 2J5EA 3BU3A 5C01A 3PZEA 2BIYA 4EHGA 5BUIA 2PZIA 3COIA 3E3PA 4QP9A 2R0UA 4CKIA 4NW6A 2JDVA 2XBAA 3FMMA 3BE9A 2OF4A 4GK3A 4FKTA 3DAKA 5A4EA 3ZSHA 2YWPA 2A4LA 3QYWA 2UZUE 3I81A 5F4NA 1SYKA 4XP2A 4UMQA 4MVFA 3KL8A 4ZLYA 3AMBA 5FXRA 2R4BA 1BUHA 4OTIA 2LGCA 4ZTSA 4NIFA 5LCKA 2ITUA 2HWOA 2V55A 4RGJA 5I9YA 1WVYA 2QR7A 2BRGA 4AZFA 5CF4A 3AC8A 4XOZA 4G1WA 4G6NA 1M17A 2GHGA 4D9UA 2UW3A 4FICA 4GV1A 5DH3A 5DVRA 2B9FA 3CR0A 5M09A 2YIXA 1ZYLA 4NK9A 1J1CA 3OBGA 4F9AA 4ITIA 2QOOA 3D7TA 5CI6A 4FIIA 2BALA 3RK7A 1ERKA 4HVGA 5HU9A 2YAKA 4FTQA 5JK3A 5ANEA 1BI7A 4QQTA 3LMHA 1OPLA 2V22A 3EYHA 1P14A 2UZOA 3R63A 3TKIA 3E7OA 4IM0A 2IW9A 1A9UA 3CCNA 3UO6A 3NYVA 3SHEA 4M68A 5IQBA 3ACKA 3GXLA 3JVRA 4LM5A 2YCQA 3IW4A 4IEBA 4AT5A 4XG3A 4M14A 3BCEA 3KF7A 2CCHA 1XWSA 2IG7A 4ZTHA 4RFMA 5BVDA 4DEEA 3QTUA 3SAYA 3PSDA 5IEYA 1BX6A 2GHLA 3NYOA 5ANKA 1XH4A 1M7QA 1P4FA 4EK3A 3C13A 4UMPA 4CG9A 2J0JA 4G16A 4XP3A 3R8PA 3S3IA 4WHZA 4EOJA 2WOUA 4MCVA 4Q9SA 5GJFA 5AUZA 4APCA 4MBJA 3SXRA 4BKYA 4ARKA 4M84A 4PTGA 4YHFA 1OVEA 1R39A 2WNTA 5K5XA 3KN6A 4KABA 4DC2A 2W7XA 3BHHA 4EHEA 2OZOA 4AQCA 4F7JA 4YTIA 2PMIA 1RE8A 4CRLA 5AUVA 1ZOHA 3SV0A 3ANQA 3BBWA 3POOA 5EH0A 4TYGA 5M53A 3F5XA 4JQ7A 4KA3A 1R1WA 3EL8A 4QTBA 4YZBA 5F20A 4I6BA 2ITWA 5FEEA 5CT7A 4X3JA 4APPA 1GAGA 1Y8GA 4FV8A 3CQEA 4KAOA 3KGAA 4S2ZA 4ALVA 3TZ8A 3PXQA 2GPHA 3D83A 4HJOA 1XO2B 3WE8A 2Z7LA 3O8TA 4OAUC 2X81A 4RSSA 4FSQA 4P4CA 5AM6A 1K3AA 2ONLC 4AW5A 3PLSA 1FINA 4X7QA 5HBEA 4AZVA 3LFQA 4BBFA 5KHWA 5M57A 2PY3A 3V5QA 4BY9E 1XBAA 1MUOA 3H0YA 1UWHA 2OU7A 2ITOA 5JQ8A 2VTSA 2OIQA 2WMQA 3I79A 3UMXA 4A4LA 5EDPA 5TR6A 3DFAA 4DHFA 4GCJA 3VUHA 1QCFA 3W8QA 1YI3A 2UZNA 3QQKA 1M2PA 5IG1A 2OIBA 1UVRA 4JX7A 3LPBA 2BFYA 3Q3BA 1BKXA 4TPTA 3I0QA 5HCZA 4RX5A 4L3JA 5HNGA 5DT0A 1PXNA 3RKBA 2VGOA 1Q3WA 2C5OA 1OITA 2HIWA 3M1SA 3L9PA 2C30A 4RZVA 2ZV8A 3F7ZA 1S9JA 1ZMWA 3LCSA 4AN2A 1K9AA 4JI9A 4ACGA 2RFEA 3DLZA 1UU3A 1G8AA 3A60A 3D94A 3C4FA 4DINA 5M4FA 2RKUA 3PXKA 4FTJA 5TO8A 5E8YA 2X9FA 2G01A 4LV8A 2PZYA 4KINA 3RZFA 5CEKA 3C0IA 4C0TA 3LHJA 4BTJA 5AR5A 1URWA 1JKSA 3TEIA 2PK9A 1IR3A 2Z60A 2I1MA 4TZRA 4UYNA 3U6JA 3CPCA 3TCPA 5B7VA 3UTOA 2C6KA 4Z7GA 2RL5A 4D28A 2CCIA 2DYLA 4ZXTA 3H10A 4EK4A 5BVOA 5CAOA 4YZDA 5J5SA 3Q6UA 2PUPA 3FHIA 3LCOA 4TYJA 2XS0A 5EM8A 4KSPA 4YTCA 4EH7A 1KOBA 4L8MA 5M55A 4RPVA 3QCQA 3ZONA 4IVDA 3LW0A 3UO4A 1XQZA 3TTIA 4NCTC 2JEDA 5DI1A 3DBFA 4LQMA 3AT3A 3P79A 3OD6X 4L7FA 4PL5A 3WZUA 4ENXA 4USFA 3MH3A 3MJ2A 2XNEA 3HUBA 5ACBC 5KMOA 4PV0A 2F49A 4IZ7A 3WZDA 2YWVA 3QRIA 3ETAA 4GW8A 4DGLC 3PA4A 4O96A 1GZKA 2OXYA 3R28A 3F66A 3BV3A 5CQUA 3DPKA 4GU9A 4AOTA 4KBAA 3BU6A 5M44A 5K0KA 2OI4X 3DJ6A 3OG7A 4FTNA 3RBWA 3MBLA 4ZZNA 2WTWA 5I5ZA 3TUDA 4FSZA 4U43A 5FBOA 3DXQA 2VWBA 4AA5A 3UGCA 2HOGA 2NO3A 1WFCA 1YOLA 3LAUA 3W2SA 2YDJA 3RPSA 4ANQA 2VWVA 5AP7A 3R02A 2XYUA 3EQFA 5B0XA 4BDJA 4BB4A 4F7LA 4ZTLA 2PE2A 2VO7A 4ID7A 3HA8A 3NYXA 3PJ2A 3CIKA 2QU6A 2G15A 3DQWA 4HYHA 4NKSA 1VYZA 3ENHA 3Q2MA 2OJ9A 4IAZA 3L8SA 4G3FA 3TNIA 4GT4A 4FKLA 2J0LA 3R04A 5CS6A 2GS2A 3QD0A 4BGHA 2XIZA 4AW1A 2F2UA 2YAAA 4X21A 1L8TA 4FKWA 1NY3A 4LL0A 5BX0A 2DUVA 3PUPA 3LMGA 3DS6A 4I41A 5KMIA 1OBDA 4JJRA 4A9RA 4J53A 2GFCA 3KMMA 1WBOA 4NFNA 3FZSA 2QD9A 3CPBA 3GI3A 4ERKA 4O7YA 4IH8A 1IA8A 3A4OX 3AMAA 3EFLA 2BDFA 4JT3A 1T46A 1UKIA 4J99A 4IBMA 3PG3A 1OGUA 2H9VA 5CU3A 3ZYAA 2X1NA 2RFNA 4QMQA 5I4NA 3HRCA 4BDHA 4BCQA 3UDBA 3FEGA 3GEQA 2VV9A 5AUYA 3BHYA 5TT7A 4BIEA 4D1ZA 4C34A 4EORA 3QRKA 4FVQA 3FAAA 2PUUA 2CGVA 5AP2A 5I9WA 4EH5A 2JC6A 4G17A 3LM5A 3FI8A 2QOBA 5EYMA 3UIXA 3VBXA 3HAMA 1KWPA 3RALA 2X4FA 5JFXA 2VTMA 3IONA 4LV5A 5DOSA 2C3IB 2R3RA 2IZUA 3BKBA 2JIUA 4I24A 1YOMA 2OJIA 4JDKA 4DBNA 4TL0A 3QQHA 4CYJA 2O0UA 2VAGA 2WTJA 3WF6A 4RX9A 3UZRA 4CFVA 1B6CB 4MTAA 3MIAA 1KV1A 2HXLA 5IH4A 4CZTA 4QP4A 4QT1A 3RMFA 3W2RA 4WG3A 4YGAA 5CU2A 4MHAA 3TUBA 4WBBB 2VRXA 1U54B 5KO1A 4PRJA 3F2AA 4RJ8A 2YISA 5L8JA 5CF5A 3G9NA 4UXQA 1PMUA 4XNEA 4ZIMA 3GU5A 3GUBA 3VUDA 4IE9A 4YJTA 2GU8A 4L00A 5E91A 4C4GA 3ZM9A 1B39A 2C6MA 2RGPA 2R3LA 4CLJA 2RSVA 3KXNA 4GVAA 5HZNA 2CPKE 3QGYA 3VN9A 5ICPA 2X7GA 4FG7A 4R5SA 5ANDA 2CKQA 3Q32A 2I7QA 4H1MA 2IVTA 4CG8A 5GJGA 5AP6A 4BKJA 1ZY4A 2EXCX 4QMUA 4CFMA 3W2PA 3SVVA 3A61A 4EOIA 2J0MB 4BTKA 1XJDA 2P2IA 3QD2B 3K3JA 4JDIA 3F3TA 3I60A 3C0HA 5KBRA 2BTRA 2E9PA 3C5UA 3FBVA 3RK5A 2RFSA 5KKRC 1W98A 3COMA 2NPQA 2RIOA 4YJUA 1ZYJA 3B8QA 3R83A 3R7UA 4M97A 4M12A 3I1AA 2CNVA 4R1YA 2CN8A 5ETAA 4AOIA 2OG8A 4O1PA 3KXMA 2X7OA 2YM7A 4FTLA 2JFLA 2WTKB 3ZRLA 4IDTA 3OWLA 3RVGA 3KRWA 4G34A 3TV6A 1JKLA 3KK8A 3QWJA 2VD5A 3MDYA 2C69A 2FGIA 3G15A 3PP0A 3LLTA 1FOTA 4FKGA 3R30A 4KWPA 4DEAA 4CZUA 1QMZA 3V6RA 4E4MA 3A2CA 3UIUA 1LP4A 1FBNA 3NW7A 1H25A 4RJ5A 4C02A 3KREA 3GC9A 4FGRA 3Q9ZA 2QHMA 2RFDA 3A7FA 3VW6A 4KKGA 1NA7A 1ZZ2A 2XVDA 1YWNA 1UV5A 3Q53A 2ITPA 3HMIA 2BHHA 3KCFA 4FL3A 5AAGA 3VS7A 3H9FA 3DZQA 4G3GA 4OR5A 2CKEA 3CQWA 2A2AA 3MVMA 4EUUA 4YJVA 2XNPA 5C26A 4Q9ZA 4QMVA 4BIDA 5HTIA 5DT4A 3RHKA 2AC5A 4IWOA 3F2RA 4RMZA 4OTHA 5CSWA 5TF9A 1IASA 3G0FA 1H24A 3K5UA 4HYUA 3OWKA 3Q5ZA 1XH7A 2WKMA 2WMBA 3GCSA 4KRDA 4EH2A 2LAVA 5FXSA 1R0PA 3FUPA 5H3QA 5HKMA 4IZYA 3HP5A 4OTRA 4LOOA 2BHEA 5EI2A 5GZAA 3DU8A 1J7UA 4L7SA 1ZY5A 3PXYA 4R1VA 2HCKA 2ONLA 4DA5A 4QP3A 4K1BA 4QMZA 3O96A 4NTSA 4E20A 1FGIA 5DR2A 3ORNA 4FA2A 2ZM3A 3PJ8A 4X6QC 5AR4A 2GS7A 3HNGA 2UVXA 4RFZA 5DGZA 4ZZMA 2HW7A 4C57A 4UX9A 2JLDA 2C6EA 3WE4A 2QKWB 4QYFA 3NZ0A 4YNOA 5DHJA 2BIKB 3EYGA 3W1FA 3C4CA 3ZFYA 3ATTA 3A8WA 3QD3A 4EHZA 2JBOA 4BIBA 3O71A 4YUQA 3R2YA 4NKAA 2WEIA 3PPJA 4D2SA 2OWBA 1G5SA 5LWMA 1XBCA 2JGZA 3ORXA 2R0IA 2ZB1A 3BPRA 4FTUA 3FJQE 3DKOA 3F6XA 2W5AA 1NVRA 1O9UA 5AMNA 1ZYCA 3C4ZA 3A7GA 3EOCA 3NR9A 4FODA 4C37A 5IISA 2CGWA 3R1NA 4PPAA 4FSWA 5C8NA 3L9LA 4GVJA 3F7WA 3W10A 4LOQA 2J51A 5AWMA 1FMOE 4UWCA 4KB8A 5G6VA 5I9ZA 4IWPA 4EQCA 3IKAA 4Y8DA 4MX9A 4Y83A 1W82A 4WNMA 5FEQA 3Q9WA 2C6LA 4E73A 5CEIA 2YJRA 3QTZA 2CKOA 3P9JA 3V5PA 4W4VA 3RPVA 4A07A 4KKHA 4AAAA 3MESA 3M42A 4QMPA 3HV4A 3QQLA 4KIOA 4CEGA 3VNTA 4CTCA 3IOKA 5I9XA 4GRBA 3DJ7A 1MRUA 4JXFA 2EUFB 1V0OA 4HNFA 4IX6A 3P7BA 1YHVA 4FTMA 1ZOGA 4RFYA 3RNIA 3OUNB 5J1VA 1STCE 4AT3A 2B55A 2C5XA 5EYDA 3TJCA 3WZEA 3MPMA 5IUIA 4F65A 3MSSA 2JAVA 4O27B 5CWZA 4EZ7A 3HZTA 4G9CA 4NCTA 5BUEA 2C5VA 3G0EA 5IQCA 2GNHA 3FMNA 5F95A 2WHBA 4RZWA 4D55A 5AR2A 4YC8A 3UZTA 5EHOA 2X8IA 5AIKA 4PY1A 1JSVA 3O50A 4AACA 4R7IA 3LFDA 2JBPA 3DBEA 5HO6A 2GQSA 1E1XA 4XRJA 3W55A 4RC4A 4IM3A 4PF4A 2PYWA 3GCUA 5CAVA 4FV9A 4U42A 3MB6A 4GU6A 5HD4A 5IDNA 4AE9A 1U5RA 2WU7A 4EWHA 1JOWB 3KXHA 4UMTA 2ZDTA 3BGZA 4IFGA 4RJ3A 5C27A 3F3VA 5HOAA 5L6WL 1VR2A 1ZLTA 2QOKA 3CJGA 4RVMA 3FYKX 3PIYA 4WD5A 3LJ1A 3BLHA 4U7ZA 2C0OA 3V5WA 3MVHA 4BCFA 2ZV7A 3IW5A 4YHJA 5I9UA 5J95A 5CX9A 2JDRA 3QUPA 4CQEA 3MB7A 4JX3A 2W0JA 4H05A 3ALOA 5LJJA 3ORKA 5H9BA 4AP7A 1NXKA 5L6PA 5CAQA 4FR4A 2ITNA 2GNFA 1MRVA 2F4JA 2HZNA 4DFLA 3LOKA 3ZRMA 2W96B 3OOGA 4FI1A 3VWAA 3PFQA 2FSOX 3QHWA 5LVLA 3ZDIA 4E3CA 3UQCA 3ORPA 2Z7QA 5CVGA 5L8LA 1MQ4A 2VTJA 3OT3A 4LYNA 4NJDA 5EYCA 2OIDA 5L2WA 3N51A 4GIHA 4C62A 4G6LA 2ITQA 4HNIA 4MWIA 4G9RA 5I3RA 3WIKA 2ZMCA 2P4IA 2UW9A 4O0VA 4O86A 5HICA 2BAQA 5B2MA 3DXPA 2FH9A 2BROA 4L43A 4O0UA 4BTFA 3S00A 2NP8A 2OFVA 3A8XA 2ZV2A 4FSUA 4M8TA 4MEDA 3EQPA 3KVWA 3KC3A 3EJ1A 3ZC6A 3NS9A 3EN5A 5HX8A 5LMBA 3FLQA 4JR3A 4RJ7A 4QMXA 5E7RA 3V5LA 5JRQA 4M66A 4MKCA 3HDMA 2WMXA 4O2PA 1IA9A 3TT0A 4G5JA 3SDJA 3W16A 3PXZA 1ND4A 3NUXA 4J98A 3M2WA 1Q8TA 2JKMA 4JBOA 4XMOA 4FTCA 4FV2A 3AG9A 4YLKA 5DT3A 3WF5A 3F3WA 4FT3A 5IEVA 2PWLA 3DB8A 2XCKA 4QMTA 2CNUA 1XHAA 3ORZA 2ZVAA 3FV8A 4C8BA 4CKRA 4DFUA 3DBDA 2VO6A 4RWIA 4L44A 4FTIA 4H36A 3DGKA 3KMUA 1FMKA 1JLUE 3BYUA 3Q4CA 3PWYA 4FSTA 4AZTA 3NUPA 2X8DA 1OL2A 1PYEA 1OB3A 3EQDA 3R8UA 1WBSA 3U9CA 4M0ZA 3VRYA 3VHEA 4KBCA 4YJOA 2OBJA 2WMVA 3EMGA 3K54A 3R9DA 2C3LA 3I5NA 3UE4A 4U79A 2IO6A 3Q6WA 3DQXA 4BCGA 4IX4A 1W0XC 4V04A 4AA0A 3ZC5A 4D1SA 3OHTA 5CU6A 5LMAA 1P5EA 1YXSA 3AMYA 2Y7JA 1OIYA 3FZRA 2Q0NA 2J6MA 4FOBA 3OT8A 4UMRA 1XH6A 4XP0A 4RA5A 4DH7A 5GNKA 3ERKA 5J8IA 3F5GA 5JZJA 1ATPE 2E9NA 1YDTE 2XZSA 4NFMA 5J7BA 3PVUA 1Q61A 3OS3A 4C36A 3F5UA 3FQSA 3QCXA 4H39A 3ULZA 3R1YA 5JFVA 3F61A 3UP2A 4BDGA 3FZPA 1JWHA 2Y9QA 2YABA 3OWPA 4TTHB 4YJNA 4XUFA 3VUKA 1U4DA 3WYXA 4DAWA 4RJ6A 4IJPA 3BHTA 4Y5HA 5L4QA 4N4SA 1T45A 1O6KA 2GNJA 3IG7A 3TG1A 3NVMB 2OFUA 4KNBA 2UUEA 3KULB 3HAVA 3ZO3A 5EQEA 4Y85A 3OCTA 2O8YA 4EH9A 3F5PA 4BBEA 5HO7A 3OCGA 5IUGA 2R3GA 3UG1A 3F3ZA 2XKEA 3RP9A 4QPMA 4BDCA 3ENMA 3QHRA 4BCPA 4U45A 5AR3A 2BRMA 3QTXA 2W9FB 4H3PA 4G3CA 3E93A 4NJ3A 4E8AA 3ZDUA 3R6XA 1Q24A 3MWUA 4JQ8A 4I23A 3R8ZA 3EN4A 4OT5A 2QVSE 4IW0A 4MYGA 1REJA 2ERKA 3T9TA 5TKDA 5EI6A 3VS2A 5KMMA 4QMNA 5IEXA 2ESMA 4XJ0A 5FXQA 2R3QA 3TKHA 4N6ZA 3D5WA 4FKRA 4DLIA 2YM4A 2PTKA 3LXNA 3DTWA 2QHNA 2R64A 3OF0A 3R22A 2F9GA 4HZSA 3AD6A 3ZLXA 5HVKA 4FL2A 3MH1A 1IG1A 3FMJA 4I4EA 4ANMA 3T3UA 4USEA 5EM5A 3EQCA 5IQDA 4DGOA 4B6LA 4ANSA 3MFTA 3R1SA 1OUKA 2QOLA 4XG9A 3E88A 2A27A 3ZS5A 3ULIA 3GP0A 2V5QA 3SW4A 3KK9A 4QYGA 4YZMA 1IEPA 4BDDA 5A9UA 3QBNA 3QQUA 2P33A 1WCCA 1Q5KA 3Q4UA 3NMUF 3NWWA 3EQBA 3IGOA 4ZTRA 4FZFB 5AFVA 2R9SA 4LRMA 2B0QA 2Z7SA 2XNNA 4BDFA 3OBJA 4BTMA 2DQ7X 2XRUA 4GYGA 4I22A 3UVPA 4D0XA 3AOXA 4FVPA 4YLLA 4FGBA 3D4QA 1H8FA 2R7IA 3GFEA 3ITZA 5K3YA 5T3QA 2XB7A 3AGLA 5CY3A 1K2PA 3DBCA 3PY1A 4HOKA 4R78A 2XEYA 4H58A 3VJNA 1H1QA 1H27A 4YHTA 3UNZA 2UW0A 3MV5A 3ZBXA 5HEZA 3CTHA 2BCJA 1DAYA 2JKQA 2A0CX 4F7SA 3T3VA 3UQGA 3PXFA 5HO8A 4IZ5A 4O7NA 4F6SA 1ZMUA 4F64A 2J7TA 3MA3A 3HDNA 3OUKA 4O0XA 2BVAA 5C03A 3ZUTA 4E6AA 4I5CA 5CU4A 3BELA 5A6OA 2PPQA 2SRCA 3PG1A 4ANLA 1FQ1B 4EK8A 4TWNA 4DBXA 4K6ZA 3U8WA 3FLZA 5AM7A 4NUSA 4USDA 4ASXA 1V1KA 4OBQA 4DGNA 5EDRA 4WNOA 3BWJA 4CV8A 1QPCA 4XYFA 3VS1A 3D2KA 3IW6A 2C3JA 4RX7A 5DRDA 3D7ZA 4PNIA 3EN6A 3S2PA 5BPYA 4ZY4A 4K33A 1LR4A 2VX0A 1CDKA 2XIRA 2Z2WA 5BUJA 2XNMA 3FL5A 3I6WA 3WYYA 3ZBFA 3ZO1A 3E8NA 4I0RA 3WOWA 2O2UA 1J91A 4V0GA 3GCVA 4UV0A 5LQFA 3IK3A 4QYEA 5J1WA 1KSWA 2UZDA 3Q60A 3O7LD 3QA8A 4N6YA 5IH6A 4U8ZA 4KRCA 4PMTA 3RNYA 4QP2A 4E5AX 2R5TA 4BL1A 2OZAB 1R78A 5DLSA 3DBQA 5BYLA 2CGXA 4FV7A 3I5ZA 4LRJA 4DYMA 5BVFA 4UN0C 4Y5QA 4LGGA 4IFCA 5HVJA 5HD7A 4I0TA 4YTFA 3THBA 1QPDA 5HE0A 3TIZA 2OF2A 3TV4A 4XBRA 1GZNA 3TTJA 3U9NA 3PVBA 2VO3A 2Z8CA 4XV1A 4S30A 4L53A 3PY3A 5LVOA 4D2VA 4PL3A 5EYKA 1J7LA 3KRRA 1I09A 2ACXA 2XNGA 4J96A 4X0MA 4XX9A 2IN6A 1JBPE 3GB2A 5AIRA 4RVLA 1PYXA 3LCKA 4MQ2A 3TN8A 3BLQA 3NRMA 4AXAA 3AD5A 4X3FB 4ZAUA 1ZYSA 5IKWA 4ZP5A 2UW7A 2XP2A 3EZRA 3W2OA 3AC4A 5FWKK 5L2TA 2VTQA 1Z57A 2HZ4A 3QC4A 5M4UA 4E5WA 3KRJA 1LEWA 2J0IA 1SVEA 4QMLA 4FX3A 3V6SA 2EXMA 2W4KA 2E9VA 3H0ZA 4GKIA 3GU6A 5M06A 2NRUA 4IC7A 3RWQA 4C4FA 3ACJA 4EZ5A 4TW9A 4EOLA 3IDBA 4MD9E 5BYYA 4PDYA 1CMKE 1OL5A 4XBUA 4IDVA 4EC9A 3QCSA 4NM5A 4YU2A 1OL6A 3GQLA 4TT7A 3DAJA 3C4XA 4O84A 1XBBA 3O2MA 4QYHA 4TYHA 4CT1A 4IC8A 5KNJA 5LOHA 3CY2A 3N9XA 4UWYA 3V51A 5J79A 4GG5A 3QL8A 5FG8A 2PMNX 5AAFA 4B0GA 1OUYA 3QUDA 4MXYA 4WSQA 2X2KA 2ZB0A 2GNLA 4FKOA 4L9IA 3QWKA 4OBOA 4RIXB 1AQ1A 2Q0BA 4IWQA 3O17A 4AZEA 5EKNA 1PW2A 3OW4A 3COHA 1XKKA 3KULA 4LUEA 1OBGA 4DEGA 4II5A 4IZAA 3DDQA 3RI1A 3CC6A 2WIPA 5EI8A 3NEWA 4JG8A 4MF1A 1UU8A 2XBJA 3CE3A 4TYIA 4YC3A 4UB7A 2OW3A 2YCSA 3RJCA 3TWJA 2UZLA 3NAYA 2GMXA 4GFGA 3R8LA 4ACCA 4F63A 4BKZA 3VF8A 4J1RA 4FKJA 3DAEA 3FWQA 4W4XA 5CZIA 2QKRA 1WBTA 3VHKA 4BI0A 3VW8A 3EN9A 1SVHA 1B38A 3DKFA 3H3CA 4IB5A 4W9XA 3W8LA 4LGDA 3T8OA 4EOPA 1FVTA 1ZRZA 1R3CA 2Y6MA 4GT3A 5C9CA 4S33A 2FUMA 3PXRA 5CAUA 4NL0A 5AV1A 4AOJA 3CLYA 3Q9XA 3FXZA 4BCJA 2PVKA 5HCXA 5IF1A 1P4OA 3U4UA 3JPVA 4G3DA 2YZAA 4DGMA 2YACA 3Q96A 5JEBA 4KUJA 2J90A 3QU0A 4J52A 4W8EA 4MXCA 4BZNA 2IVSA 4GK2A 4BCNA 4D5HA 3L9NA 4FSRA 4EBWA 2GDOA 3NCGA 4WKQA 5GIOE 5KHXA 5EW9A 5ETCA 2JITA 4ZMEA 2G9XA 1H01A 3NNVA 4UY9A 3OZ6A 3R01A 5LVPA 3IO7A 2I0YA 3HRFA 1YRPA 2CDZA 1YWVA 3O0GA
chains in the Genus database with same CATH superfamily
1H1PA 3BWFA 1UKHA 3QALE 1GZOA 4Y73A 5E8SA 3F2NA 5CALA 1ZXEA 3ZFMA 5FDPA 4BYJA 2XA4A 2V7AA 2WMTA 3EHAA 1KE7A 4FC0A 4JG7A 4IAAA 4ITJA 2YIWA 3LFBA 4F1OA 2HK5A 5CASA 4ZOGA 1L3RE 1YW2A 4RWJA 4K9YA 4PUZA 3PDTA 3R7GA 4R7BA 3PA3A 5DA3A 5FTQA 2ERZE 3Q4ZA 3TDWA 2IWIA 4F6WA 4V01A 4DH5A 4XG8A 3V8SA 1WBPA 1BL6A 5AJQA 4C38A 3CJFA 4PPBA 2P2HA 3SLSA 5AP0A 5KMJA 2FSTX 2JFMA 2WTKC 3T9IA 4HPUE 3JR1A 3QYZA 3D5UA 4A9TA 2JD5A 4AUAA 1WVWA 3UIBA 3H9RA 3NW5A 5C4KA 1WBVA 3MPTA 2QU5A 3P4KA 2GFSA 2HYYA 4A9SA 4HYIA 1OKWA 2YEXA 5J9YA 4XHKB 3D0EA 2XAMA 3QFVA 3ZO2A 4ZJVA 5GIPE 2PZ5A 2BKZA 3LQ5A 4BI1A 4QD6A 4D1XA 4ZTNA 4Z3VA 2ZMDA 1SNXA 4XEYA 5CSPA 2W06A 3TNWA 3JVSA 4FV3A 3CEKA 3HGKA 2QOHA 2UV2A 3BI6A 2WQNA 3KRLA 3R00A 4U81A 4D5KA 2UZTA 3Q04A 2X0OA 5CQWA 4AW2A 4QNYA 3ZMMA 2Z7RA 2O3PA 4IXPA 4WIHA 1Q8WA 5I9VA 3HV6A 3R9NA 2C0IA 3LE6A 1GIJA 3DZOA 4RWKA 2B9HA 4R6VA 2IW8A 4F9YA 3EFWA 3FMLA 3KF4A 4OLIA 2WTCA 2G2IA 3NYNA 3RGFA 4FOCA 2ZAZA 2EVAA 4EZ3A 5CEMA 4BDBA 2ZM4A 1PKDA 2WMAA 5GJDA 4FV5A 2O5KA 4DEBA 5LMKC 4FZAB 3ZSIA 5KBQA 5JMSA 2C4GA 4R3PA 4NT4A 4FK6A 4IWDA 1AD5A 3DA6A 2OH0E 2B9JA 5IQIA 2EB3A 2BKKA 4ALUA 5A4LA 4WG4A 4W4WA 2WQEA 3BEGA 4HW7A 4MQ1A 2YLFA 1YXXA 3NUUA 5A54A 3RAWA 2W1CA 5AUUA 4RC2A 3BYVA 3ZUVA 4HPTE 4J95A 4IHPA 3FZTA 4WOVA 3ANRA 2I6LA 2CLXA 4FT5A 3I0OA 1RJBA 4DG3E 2R3FA 1Z9XA 3AC2A 3PA5A 1OZ1A 1IRKA 5ANJA 4DFNA 2A1AB 3L8PA 4DTBA 2QURA 4C4HA 3VONA 4IB0A 4EH4A 3ZM4A 5DRBA 3QZHA 5HIEA 3JYAA 1GIHA 2P3GX 3TNHA 4NWMA 4HGEA 4BCKA 4HCTA 3MIYA 2ITYA 2WTIA 2UW4A 1Z5MA 4U3YA 2OH4A 1JNKA 5CENA 4B4LA 1YDRE 4DG2E 2YIRA 1KOAA 4BDIA 3VIDA 4GEOA 4ZMFA 2VTIA 4CCBA 3FY0A 3NDMA 4GMYA 3ZEWA 3PPKA 3ZZEA 1YDSE 3ORIA 5M07A 1GZ8A 4HGTA 4CFNA 2HENA 3R73A 4MNEB 1HCKA 3PJCA 5HE1A 4B99A 2X7FA 5CNNA 4U3ZA 3SX9A 5EHYA 4KS8A 4F0IA 2AC3A 4FYNA 2VWUA 2UW5A 3GQIA 3W18A 4U80A 4C7TA 1NVSA 4FG8A 4PQNA 5JGBA 4DDGA 2UVYA 1VJYA 1GY3A 4FKIA 4MD8E 4GSBA 4MAOA 2XMYA 5EQPA 1VYWA 3R7IA 1H0WA 2XK9A 3QTQA 2QO9A 4BDKA 2YA9A 3OXTA 3VQUA 4CCUA 2YZLA 2PMOX 4ANOA 3MVJA 5CVFA 2QQ7A 3OCBA 1H07A 3W2QA 2YM6A 5HIBA 2X39A 2B9IA 1IAJA 3HRBA 4MH7A 3TV7A 3LCTA 4P7EA 4BCHA 3IDCA 3ZOSA 1URCA 4A4XA 3TKUA 2QO2A 2XF0A 3QLFA 4G6OA 5CXZA 4NSTA 1G3NA 2ITXA 2XK6A 3DV3A 4FZ7A 3MTLA 4I5PA 2W4JA 4DEDA 4ZY5A 2PZRA 3V8WA 4ENYA 2FVDA 1H1WA 4HCUA 3PPZA 2H8HA 4YZNA 5BV3A 3NLBA 4MXOA 3HP2A 4PNKA 2W99B 3UOKA 2XKCA 1PY5A 2REIA 1UU7A 3CP9A 4F08A 4YMJA 2PVFA 3BBTB 4D4YA 2E9UA 3DT1A 2CJMA 3R21A 2W5HA 4DFYA 1DI8A 3DJ5A 2R3HA 4RC3A 5BMSA 3QCYA 5A6NA 4LMUA 4L68A 1DI9A 2QLQA 5LVMA 3EWHA 4FTRA 2Z02A 3VBYA 3REPA 5HBHA 1BLXA 4R3CA 1Y6BA 2B52A 2B54A 4DCEA 3QA0A 2PULA 3SRVB 2W1ZA 4CNHA 3LFCA 5DG5A 5E8TA 5JRSA 1V0BA 2G1TA 1ZMVA 3C1XA 3DNEA 5DEYA 1ZYDA 2GQRA 1H00A 3FQEA 3GT8A 3R1QA 4L6QA 2J5FA 3WF7A 4AZWA 4BBMA 4XCUA 4Z55A 4I6LA 3R2BA 2YITA 3SOCA 4R77A 4Z9LA 2NNWB 3Q9YA 3HECA 4YJPA 4IVAA 4R8QA 1W8CA 2QCSA 3ZLYA 2XEZA 1KE8A 2JDSA 4CFWA 4FNWA 4RLKA 5B2LA 4ZEGA 2R3NA 4HCVA 3UOLA 4EUTA 2PUNA 1U59A 1JQHA 3SXSA 1GNGA 4L3LA 3K2LA 4KIPA 3R8MA 4XV3A 2QONA 3R9HA 3PYYA 4GUBA 3OY1A 4QTEA 3WARA 4KIKB 1Y6AA 4DEIA 4IX5A 3QD4A 5D10A 1UNGA 3LZBA 4IAIA 3VBTA 3VRZA 4C59A 5KMLA 4Q5HA 4QDEA 3A7HA 3BIZA 5DEWA 5AX9A 4F1MA 2VWXA 4CQGA 4OTDA 4K77A 5ANGA 1LPUA 2FB8A 2X6EA 4IQ6A 3WZKA 3BYMA 3OXIA 3QZFA 5CXHA 4KKEA 4FEUA 3A4PA 4YLJA 3EZVA 4UZHA 5DBXA 3OFMA 3F88A 2XK7A 4ASEA 4TNBA 4O6EA 4I5HA 2OLCA 3HYHA 1RQQA 4FG9A 2ITVA 1YVJA 2FO0A 2W05A 4FTKA 1BI8A 5J87A 3EQIA 4NM3A 4QTAA 4WO5A 4NIFB 5DR6A 4NM0A 3KA0A 5FBNC 2X0QA 4IADA 2E2BA 4R3RA 2C6IA 4FV6A 4EEVA 4AU8A 4PP7A 1U54A 4E4LA 2XIXA 3MH2A 4M67A 5AUWA 3TNPC 2WAJA 3G90X 4Q2AA 2W4OA 4ZJIA 4CSVA 1LEZA 3IW8A 4I5MA 5HG7A 4YPDA 3TXOA 4CGAA 4GIIA 5A4CA 3D7TB 5IMXA 1PXJA 4C33A 3O23A 2XM9A 3W33A 1OIUA 3QLGA 4M3QA 4RJ4A 4E1ZA 4RQKA 4D2TA 4O7VA 3MYGA 3TYKA 3GC7A 2BRHA 2FSLX 2GCDA 4IB1A 4U44A 4O0SA 4QMOA 3V01A 3RM6A 3QRTA 3LJ0A 4WNPA 1RDQE 1UNHA 3HMPA 4M13A 4AF3A 4CD0A 3G33A 4FUYA 4L52A 3UVRA 4BF2A 4ERWA 4BWKA 4E4XA 3FE3A 3KB7A 2C1AA 4OW8A 5J5TA 5CZHA 3TUCA 3PIZA 4O6LA 4M69B 2IVVA 1KE9A 2P55A 4I6HA 3NW6A 4EHVA 4DF3A 4ACHA 4ACDA 3RTPA 2W1FA 3RK9A 3GCPA 4TKSA 4F9CA 4Y72A 2B4SB 3FMHA 3IQ7A 5M08A 4ZSJA 5LWNA 3FZOA 2R3PA 4X2KA 4DFBA 2XCHA 4L42A 4J8MA 4PTEA 3F69A 1FPUA 3P5JC 4DGGA 5HX6A 4DFXE 5DFPA 5FDXA 5L2SA 3KKVA 4EOQA 4S32A 4AXEA 4K0YA 1YI6A 2RG5A 4XV9A 1PJKA 4F0FA 1PMVA 2VTHA 3V5JA 3QC9A 5GHVA 4U9AA 4DDIA 4MNEA 1PXOA 3VC4A 4IACA 1PHKA 3HMMA 3WBLA 5KCVA 5D7VA 3FLNC 1H28A 2GSFA 3GVUA 2O63A 4AFEA 4Z7HA 4EL9A 5HE2A 3IOPA 1M2QA 4QQJA 5LARA 2W1GA 5AUTA 5CSHA 3CXWA 1SZMA 3RAHA 3RAKA 4C3PA 5IQHA 2FA2A 3CKXA 4FT0A 1NT2A 1P2AA 2W17A 4DEHA 3LQ3A 3SW7A 3TNQB 3UDSA 4DHZA 4FL1A 2OJGA 2WMUA 3UMWA 2BILB 2RG6A 2XUUA 2PVHA 3E87A 4QPSA 3SGCA 4BGQA 3QKMA 1YI4A 4FBXA 1PF8A 2PU8A 3LJ2A 1X8BA 3OTUA 4QPAA 3P78A 4J97A 3R9OA 4NEUA 1Q8ZA 1Y57A 5T68A 4QTDA 2J0KA 2QOQA 3BGQA 3GNIB 3IDPA 3PY0A 2HY81 4MBIA 4YO6A 5TOZA 4BI2A 1XR1A 2VTAA 4EWQA 5K5NA 3NFGB 3FMDA 1TQIA 3QTSA 4EQMA 4J71A 4TYEA 3IW7A 4LOPA 4E6QA 4O21A 5LMKA 2C68A 3B8RA 3RAIA 1YOJA 3ZLWA 5F94A 3C50A 4K18A 2OK1A 3FC2A 2PVYA 1TKIA 5HNBA 2P0CA 4JR7A 4JRNA 3I7BA 4FEWA 4D9TA 4Y46A 4QYYA 3KY2A 4G5PA 4E93A 3OROA 5G1XA 4JLCA 2G2HA 4YPSA 3RPOA 3AGMA 2B7AA 4ZTQA 4JAJA 1APME 3D5XA 4BDEA 3DTCA 2I0EA 4MD7E 4EK6A 5FP5A 3UC3A 4BYIA 3CSVA 4BFMA 5HTCA 5LXMA 2WPAA 4G3EA 4U5JA 4XS2A 3R8VA 3UBDA 4PMSA 4L45A 3WF9A 5BNJA 3SRVA 3U51A 2EXEA 5CEQA 2PZPA 5CI7A 5HQ0A 4FTTA 5D41A 2VWWA 5AP3A 2E9OA 3TDVA 1PXIA 1Q41A 1WBWA 4F9BA 3E7VA 4EKKA 3I6UA 5AX3A 2YCRA 5DR9A 5IQAA 3MN3A 4LFIA 4FV4A 4C58A 1H26A 3ZLSA 3NCZA 4D4SA 5AV2A 3GC0A 2Y4PA 3OP5A 4BHNA 3NIZA 4E26A 3P0MA 1UA2A 3I7CA 5J7HA 3F82A 2XJ1A 5JSMA 2C5YA 2C6DA 4FIJA 2EU9A 2CKPA 3ZH8A 4S31A 4A06A 3U4WA 4KIQA 5DN3A 4GUEA 4MXXA 3JY0A 2WOTA 4U6RA 3MY0A 3P86A 4O4EA 1OIRA 2YCFA 3MA6A 3TI1A 2Y8OA 3BX5A 2XJ2A 3FMKA 3FQHA 5CYIA 3LXPA 3BE2A 4QQ5A 4FKSA 5BMMA 3LLAA 4F70A 4I93A 4O0RA 4W9WA 4WUAA 3UIMA 4UEUA 5HTBA 4AXFA 1OKYA 2XARA 5KZIA 5E1EA 4DE4A 5HG8A 4GYIA 2HW6A 3WILA 4HZRA 2IJMA 3LXLA 3VUTA 4B8MA 4M15A 4X3FC 2BR1A 3DLSA 3RCJA 3UNKA 3VF9A 4AGCA 3EQGA 2WIHA 4FNZA 3A7IA 5KMNA 3TZ9A 2WTVA 4E4NA 3S1HA 4JIAA 1KUTA 4EYMA 4AN3A 5AP5A 1YXUA 3L1SA 4LL5A 4C3RA 2YIQA 4GG7A 2W1HA 4MWHA 1E9HA 3ZXTA 4JG6A 4BN1A 5DYJA 5EW3A 1JKTA 2F2CB 3DY7A 4FEQA 3DOGA 2X8EA 4ORKA 1DS5A 4ZLZA 3Q2JA 3QX2A 2I0HA 4IIRA 3CGOA 4G31A 3JXWA 3GU4A 3SC1A 1JSUA 4N57A 3LFNA 2BZKB 2VN9A 3CQUA 4D2RA 4JIKA 4BZOA 5AV4A 2W1EA 2XIYA 4PWNA 3MS9A 3EIDA 5HORA 3BQRA 3BU5A 3FKOA 3C4EA 5I0BA 3P7CA 4C4EA 4BJJB 2C3KA 3K5VA 3UYSA 3G6HA 2Y4IB 4FYOA 4WSYA 4IVCA 4NW5A 3SKCA 3BLRA 2YN8A 1F3MC 4X2FA 5E90A 4ITHA 3E63A 4AGDA 2GNGA 4L46A 1M7NA 4FTAA 4CV9A 4F0GA 4A7CA 2OXDA 3TM0A 1WAKA 2IEWA 3MFUA 4HVSA 2XM8A 3U6HA 4M69A 4FSYA 3UP7A 2W5BA 5H8GA 4EH6A 3ALNA 4MBLA 5IUHA 5KUPA 3FC1X 3V8TA 5C4LA 4YR8A 5AEPA 5M4IA 3MGYA 2CNQA 2F7EE 3NUYA 3PJ1A 1FGKA 4EK5A 1WBNA 2BZHB 2KULA 4I1ZA 4U40A 5A3XA 4JBPA 3W2CA 1F5QA 5FUTA 2V62A 4EI4A 2AYPA 3HL7A 4YP8A 2V0DA 3OMVA 5IDPA 4Q5EA 3RCDA 4YO4A 1OGYA 5BVEA 3PTGA 4LMNA 4DLJA 5IQEA 1PXLA 1QPJA 3L8XA 3PJ3A 4NYEA 1UNLA 2FYSA 2C6OA 2IZSA 3G5DA 3KCKA 3NIEA 3UVQA 2FSMX 3ZUUA 4CYIA 5L3AA 4FZ6A 5FD2A 2DWBA 4BRXA 3N4UA 2W9ZB 2IF8A 3QQJA 4M0YA 2Q83A 3QZGA 2X2MA 4YC6A 4F7NA 5IA3A 3DK7A 3R7EA 4J7BA 3VS0A 3EFKA 4DFZE 4I6QA 3DK3A 5ITAA 3G51A 5FM2A 4F4PA 2WU6A 5M56A 4DT9A 1HOWA 3WI6A 4E5BA 1W2CA 2GHMA 4LI5A 5ANIA 1ZZLA 4ASDA 2VO0A 4ZLOA 2XK4A 3VBWA 1BYGA 1YQJA 3EKNA 3KFAA 3Q52A 4RT7A 4O7RA 1REKA 3EQRA 4L67A 3ELJA 1PKGA 3QXOA 4DH1A 3C0GA 3DK6A 4RWLA 4UYAA 3VUGA 5AV3A 1WMKA 1TQPA 2H96A 4P2KA 5AADA 4PDPA 3BQCA 5M51A 3OY3A 4HGSA 5JFWA 3R9RA 2HXQA 4NU1A 5AUXA 4JRVA 1AGWA 4U41A 2F57A 5JKGA 1OECA 1QL6A 3VVHA 5CVHA 3KRXA 1A48A 3IS5A 4EQUA 3FSKA 1O6YA 5JH6A 4FVRA 1OL7A 2XYNA 1S9IA 2WGJA 1RW8A 2Y0AA 2AQXA 3JS2A 3QX4A 4O81A 3EKKA 4GK4A 2VGPA 1TZDA 1Y91A 2OGVA 3PP1A 4FV1A 3FKNA 5EOBA 3E3BX 4TY1A 4TN6A 2QI8A 3ZU7A 4CMOA 4HVHA 2CMWA 1Q4LA 4MK0A 2QC6A 4QMSA 4ZK5A 3F3UA 3FSFA 5EFQA 5AA8A 4E6CA 1XH9A 5C8MA 5GZ9A 3CS9A 5E1SA 4C61A 1OPJA 2XKDA 3LFAA 5EM6A 2WMWA 3R0TA 1PXPA 2Y6OA 5A4QA 5CTPA 2PVMA 3O7LB 3SA0A 3KVXA 1O6LA 5LVNA 5FM3A 2JKKA 5HGIA 3OCSA 4GJ2A 4B8LA 1NVQA 2UW8A 2OJJA 4MNFA 1H1RA 2I40A 3NUNA 2QG5A 1M52A 3GBZA 4HVDA 3PRFA 4V05A 5CT0A 3QKLA 4R5YA 3VQHA 2WQOA 1SVGA 4JS8A 4JAIA 4O7WA 1ZAOA 2HZ0A 2XH5A 2BAKA 2ZM1A 5EDQA 3IPHA 2JAMA 2VWIA 2ZV9A 4NZWB 4RRVA 3PE2A 5FRIA 4YJRA 3S4QA 1XH8A 4QDVA 3CD3A 2PVRA 3DDPA 4IANA 1JAMA 3K3IA 3FI3A 2WO6A 3QRUA 3G2FA 3U54A 2UZVA 3DCVA 4JNWA 2BPMA 4MXAA 4WUNA 5HLPA 4A4OA 2BAJA 3QTIA 5E92A 4O91A 5FTGA 3NVKI 4RQVA 1DM2A 5AP4A 5AR8A 5H8EA 3NUSA 2XKFA 4AW0A 2ZDUA 3W32A 4FKUA 4AZSA 3MPAA 2X0GA 3SOAA 3LFSA 5IA4A 2QNJA 4EC8A 1IAHA 1OL1A 2ZJWA 3E8EA 3AC3A 4AN9A 4ZSGA 2X9EA 1BMKA 3TL8A 3VS5A 3QF9A 4IAFA 5I3OA 3KQ7A 4DTAA 2YIYA 3FLSA 4NM7A 3CKWA 3COKA 4MXZA 5DIAA 4WNKA 2X2LA 3GU8A 4LG4A 2BZIB 3UOJA 1HCLA 4QOXA 1OM1A 3HVCA 5CANA 1OKVA 4QP6A 2YFXA 4WRGA 4YJQA 5E8VA 4CFFA 4AWIA 4O82A 3HV3A 3D5VA 4PX6A 1V0PA 4FK3A 4CT2A 5HLNA 3VUIA 5CF6A 3P1AA 4BVUA 3VS6A 1EH4A 1XH5A 4WBOA 3FI4A 5BVNA 3DKCA 3KU2A 4RIYB 2WMRA 1J3HA 3G6GA 5IA1A 1OPKA 1I44A 3GOKA 5A14A 2CHLA 3C4WA 5EG3A 5ETIA 4IMYA 1JKKA 3ORTA 4F09A 5L8KA 4OAVB 4GT5A 4TRLA 5JGAA 3KXXA 3MVLA 2PHKA 5L6OA 4QMWA 2WQMA 1NW1A 1CTPE 4N0SA 3HV5A 5A46A 3QUEA 4JL9A 1Q99A 4AS0A 3VBQA 4DCAA 2OICA 4PTCA 4FIHA 3N4TA 2C0TA 3PSCA 4IB3A 3RINA 3LXKA 2PVJA 4FIEA 4O0WA 2OSCA 4ZSEA 3CTQA 4EOMA 4IAKA 2HAKA 5KMKA 3F9NA 3HMNA 3PWDA 4S34A 3LVPA 2PVLA 2UW6A 4K8AA 5L2QA 2EB2A 5EK7A 5IZFA 4QNAA 2VTNA 3VS3A 4OBPA 5CLPA 4C35A 5FEDA 4AGWA 4I3ZA 1PRYA 1YHSA 1H0VA 2WQBA 3E8CA 2PMLX 3LM0A 3QGWA 3HV7A 2VWZA 2WZJA 4KBKA 3LIJA 3GCQA 3TZMA 4NH1A 5L2IA 2GTMA 4BWPA 3FLYA 2BFXA 3E62A 4ANBA 5FLFA 4XV2A 2AUHA 4I94A 4B7TA 3B2WA 4EBVA 4N70A 2OZAA 4AG8A 4GFMA 4BC6A 2JKOA 5E4HA 2VTPA 4RBLA 4BCOA 2GS6A 3W0QA 5E8UA 2J4ZA 1PMEA 3R7OA 4W4YA 3FYJX 2VTOA 2XJ0A 1GJOA 2PE0A 3SG8A 3FZ1A 4B9DA 4JBQA 4F99A 3M11A 2JIVA 5H2UA 5EOLA 4A9YA 2JDOA 4TWCA 1JSTA 5IPJA 3II5A 3JUHA 4I21A 5CNOA 4PMMA 3BV2A 3VULA 1DAWA 5K9IA 3WIGA 3SXFA 5IQFA 1OI9A 2VNYA 2WXVA 3PRIA 4X3FA 3NGAA 4TWOA 4C2WA 3NNUA 3QQGA 4RIWB 5ETFA 5HIDA 3VAPA 4LUDA 3D15A 4CMUA 4RLLA 1Q8UA 1JVPP 5JN2A 4YSMA 2VX1A 4I6FA 4K11A 3JY9A 3RZBA 3LKMA 4O22A 3D14A 5K4IA 3AC5A 3ORMA 1ZARA 3ZEPA 3OVVA 2AEGA 4O7ZA 2QR8A 2YDKA 4OGRA 3BHVA 3FKLA 4HYSA 4D0WA 4YBKA 2BMCA 2PL0A 5T6KA 1F0QA 4FT9A 3NUAA 3QTRA 4JVGA 5FQDC 4X2NA 2BTSA 5BYZA 3ZO4A 4IM2A 4JMQA 3G9LX 1PXMA 1GIIA 4QMMA 3OTVA 5HI2A 5D1JA 5CF8A 3UZPA 2CGUA 4UXLA 3UG2A 1ST4A 5FTOA 4U97A 4PP9A 1WVXA 5GZ8A 4YBJA 4ZSLA 4UZDA 4CRSA 5HVYA 4BGGA 3H30A 1YXTA 4RIXA 4ZY6A 3VJOA 2H6DA 3V3VA 2ZYBA 3OW3A 3PZHA 5HHWA 3ID6C 3PFYA 2ETKA 2R3JA 4EOOA 4GS6A 4I20A 5B2KA 4BCIA 4D4VA 4JBVA 2OO8X 2WTDA 1CKPA 3LMIA 3WZJA 3A7JA 3RWPA 5C8KA 4DTKA 3RPYA 3ORLA 4DT8A 4XOYA 2QOCA 5HNIX 4EJNA 4I92A 4KD1A 4QMYA 1M2RA 3LFFA 4ALWA 5M4CA 3BL9A 3UDZA 2BRNA 3MW1A 5D7AA 2I7QA 5GINE 2VTLA 2J50A 2C6TA 4OTGA 3TACA 3TIYA 4XRLA 2QLUA 4CFXA 4FSMA 5CEPA 4XG6A 5ANOA 4X2JA 5JT2A 4NTTA 4D2WA 2XK3A 2A19B 4GFOA 4ONAA 3GFWA 3HMOA 1MP8A 2ITZA 3GOPA 4X6RA 4ANNA 3UJGA 4D4RA 1TVOA 5DE2A 4AE6A 2O65A 5E9EA 4WA9A 3BYSA 5E8WA 3E8DA 4BWXA 3FI2A 3I4BA 3A99A 4GJ3A 5K4JA 2W1DA 3MI9A 1OIQA 4FKQA 4H3BA 2YM3A 3P08A 3WF8A 3UYTA 4ZS4A 1W84A 2H34A 5CSXA 3PIXA 3U87A 4AT4A 4BHZA 1SMHA 3R7VA 4C2VA 5HLWA 2CLQA 3P5KA 3UPXA 4J8NA 4O7SA 4DG0E 4E7WA 4FNYA 5E8ZA 4RVKA 4BDAA 5IA2A 3HKOA 5F9EA 5IA0A 5EQYA 2HELA 2HWPA 4A9UA 4O7LA 3MY1A 2VTTA 3DFCB 4P90A 4FZDB 3TJDA 4RA4A 3CBLA 1W83A 3OOMA 2WMSA 2BUJA 1GOLA 1WZYA 3MH0A 5IH5A 5J9ZA 4PPCA 1ZOEA 4IVBA 1PMNA 3RM7A 2QOFA 2VNWA 5IMEA 4CLIA 3BGPA 4GKHA 5A4TA 4L01A 4EH8A 4FUXA 3C51A 4OUCA 1YHWA 5IU2A 1LUFA 5LCJA 2PE1A 2YJSA 5HE3A 4DH3A 4LRKA 4XG4A 1KE6A 4RIYA 3MTFA 2X6DA 3FLWA 4ASZA 3O51A 1VZOA 4YJSA 4PL4A 2G2FA 4RIOA 5KKRB 1JPAA 4WRSA 4XLIA 4PMPA 4BZDA 4CFUA 2C47A 4AX8A 3DKGA 3HX4A 4O0TA 3V04A 4ZZOA 2RF9A 4EOKA 4YSJA 4EKLA 2KTYA 4HVIA 4L3PA 1CM8A 3ZCLA 4UMUA 3ZFXA 4QP7A 4DH8A 1YXVA 3EL7A 3S95A 2JDTA 4XH6A 1Y8YA 4FKVA 4PDSA 4QO9A 2HY0A 3KXGA 4XLVA 2ZOQA 3OXZA 3QXPA 3SD0A 3E92A 4QRCA 4GL9A 1KE5A 5AAEA 2I0VA 2IZRA 3NNXA 3UOHA 3VS4A 4QQCA 4O83A 3FHRA 2CSNA 3FXXA 3EFJA 3BHUA 4FEVA 1G8SA 2WD1A 3GU7A 2ETMA 3FL4A 3IGGA 4O0YA 4YTHA 4OTPA 4FIFA 4FSNA 5AR7A 3QQFA 4RG0A 3DB6A 5ACKA 4EONA 1BL7A 1UWJA 2R7BA 2VZ6A 3AQVA 3MFSA 4BICA 3HA6A 5JFSA 4O38A 2VWYA 3UODA 4EYJA 3MY5A 3OC1A 3KEXA 5EKOA 2VUWA 3BEAA 4G2FA 3QTWA 3QKKA 3KXZA 3NSZA 3GC8A 3KN5A 5H8BA 4D2PA 4O1OA 3GGFA 1TQMA 2XNBA 3FPMA 4F6UA 3GENA 3H9OA 3AD4A 5HU3A 3BYOA 3PSBA 5KX8A 5HG9A 2UZEA 3PE1A 2VTRA 2YM5A 3DNDA 3E5AA 4LGHA 4ZS0A 4BCMA 3EQHA 2VX3A 1H1SA 2IZTA 4TXCA 5AP1A 5AV0A 4CTBA 2GTNA 4JQEA 1W7HA 4YNEA 4FT7A 5BVKA 1TFFA 2J9MA 3HEGA 2XK8A 3LQ8A 3C5IA 5F1ZA 3L8VA 4FEXA 2X4ZA 5EM7A 1Q97A 1A06A 2OJFE 1E1VA 4RIWA 5AA9A 2R3MA 2QG7A 5BQ0A 1J7IA 2VU3A 2C1BA 2WELA 3W0RA 3BZ3A 3OEZA 1U46A 3MJ1A 2UZWE 3HLLA 3QZIA 4H3QA 4K2RA 2YHVA 4IAYA 3UPZA 2R2PA 2R3OA 4C4JA 5EW8A 1G8JA 3LCDA 4RX8A 3AT4A 4W8DA 3CY3A 3AT2A 3ZTXA 1J1BA 2OKRA 2IW6A 4HGLA 5CU0A 3QRJA 5E8XA 1Q3DA 2JIIA 3V5TA 1YWRA 2B1PA 3ODYX 1SM2A 4ZTMA 4X2GA 4OT6A 4FIGA 5DWRA 4I0SA 3O8UA 5C1QB 4O2ZA 2GQGA 4JDJA 5EHLA 5TE0A 3ROYA 2R3KA 4QTCA 4DN5A 5JGDA 1U5QA 4I4FA 4OTFA 2F7XE 3S0OA 2ETRA 4V0GB 4C3FA 2CN5A 2YM8A 3OWJA 2EWAA 5J9LA 1VEBA 3OEFX 3W0NA 3UO5A 2ZFYA 3NAXA 1MQBA 2HZIA 3FY2A 5JQ5A 3D2IA 3VUMA 3AXWA 5CAPA 3U6IA 4UALA 2NRYA 2YDIA 1CKIA 2QOIA 2B53A 5IA5A 5BVWA 1YKRA 1CSNA 4JDHA 2BDJA 5JZNA 2UVZA 4QP1A 3CD8A 3Q4TA 4EJ7A 1MRYA 2OXXA 4U0IA 3ZRKA 3E64A 4D58A 4F9WA 1KV2A 2DS1A 2WEVA