3EQPA

Crystal structure of ack1 with compound t95
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
274
structure length
268
Chain Sequence
LTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activated CDC42 kinase 1
publication title Identification and optimization of N3,N6-diaryl-1H-pyrazolo[3,4-d]pyrimidine-3,6-diamines as a novel class of ACK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 268
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3eqpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3eqpA01
4L01A 3SG8A 4GW8A 4O0SA 3EOCA 2XCKA 1TVOA 5J9ZA 5HTIA 4NL0A 4D2PA 4A9SA 3P1AA 4FKWA 4W9WA 3ZO1A 4Z7HA 2WTVA 4FICA 4FTCA 4RBLA 5I9ZA 4JG7A 4NK9A 2VTRA 4Y83A 4BDHA 3NUSA 2ZMDA 3UMWA 2QOBA 3DT1A 5FG8A 3FI3A 4HGSA 4IB3A 1OKZA 4ENXA 3MW1A 3IG7A 3KN5A 3FV8A 4B9DA 3ZS5A 3PP0A 3LCDA 3F61A 3IS5A 2F57A 3QCQA 1J7UA 1GIJA 5EW9A 2QKWB 1FOTA 1PKGA 2ITUA 2RG6A 3WE4A 4DE4A 3FZPA 4G3CA 5AV2A 2YIXA 4FKVA 1RJBA 4QP9A 4DINA 4DT9A 3R00A 2CNQA 3LCSA 4AP7A 2UW0A 4QTAA 2QOIA 1H01A 4RLLA 2RSVA 2YA9A 3DK7A 4PDOA 4DBNA 3P0MA 3EQBA 5DLSA 4AN3A 1YHVA 1YDTE 2UUEA 4IVDA 3CPBA 2UW3A 3MDYA 3NNXA 4OUCA 5CVHA 4BKZA 5HVKA 4DFZE 4AW2A 1WBOA 3UO5A 3EN5A 4JBVA 4MWHA 2YDKA 2I7QA 4YZ9A 4FL2A 2PTKA 4JI9A 5HE2A 4L67A 4EHZA 3ORTA 2R3KA 1YXTA 3OXTA 5C03A 4QPAA 2RKUA 3I6UA 2ZB1A 4DAWA 5KMOA 4C3FA 2PUUA 4O81A 3GCSA 4ZLZA 3GU5A 3ZU7A 1B6CB 1H28A 2OXDA 3EHAA 3QKLA 4DG0E 4UN0C 3ERKA 4L43A 5FLFA 3TNWA 4TXCA 1ERKA 5E8TA 3HRCA 5L2TA 4O2ZA 2IW6A 1S9IA 1ZY5A 2W99B 1W8CA 4QP4A 2OK1A 2IO6A 3KMWA 2F2CB 3LFAA 4RPVA 2HY81 4J97A 5EK7A 3TDWA 2R3MA 4PL3A 3RHKA 5AX9A 4BN1A 2G15A 3LM5A 5AA8A 3IOPA 2C47A 3CXWA 3HVCA 5AP0A 2G2IA 5JQ8A 4RLKA 4MXZA 4RA5A 4HCTA 4C7TA 4D4SA 4DFXE 5HIEA 4IDTA 3MFUA 3HRFA 2C5NA 4QP8A 1WFCA 1Z5MA 3HA8A 4OTFA 4EOLA 4WT6A 4RT7A 4NCTC 2QOKA 5AUZA 5IH5A 1KE9A 2IVSA 3QQFA 3QC4A 5C8KA 1NVQA 3H0YA 2YM6A 3PG1A 3PJ2A 4CQGA 4YPSA 5HQ0A 1BKXA 3FYKX 2B9FA 2CLXA 4MBLA 3TL8A 5K5NA 4F1OA 5HVYA 4XV9A 3PG3A 2WMWA 4BRXA 3I81A 5AIKA 3UJGA 1UNLA 3DLZA 3VVHA 4N57A 1ZMVA 4FKPA 4JBQA 3O8UA 2E2BA 3K3JA 3QWJA 4ARKA 3Q4TA 1Q8UA 2VV9A 3FMJA 3EKKA 4YPDA 5E91A 4ASXA 4NW6A 3KK9A 3R9RA 3ZFXA 2VTTA 2UZNA 3CGFA 3C50A 3W2RA 5CALA 2BRMA 4FV9A 3FI2A 4ERWA 3W2QA 2W9FB 4X6QC 4PDYA 3BHTA 2EXEA 5LOHA 5AADA 2JBOA 3R7IA 4JAIA 2W5BA 4HCVA 3ZZEA 2OH4A 4IX3A 2YACA 3EFWA 3ORPA 4KRDA 4M13A 4FEVA 4AACA 3QXPA 5HO6A 4H58A 4FSMA 5IA5A 4F7SA 5EYDA 4IZAA 3R8PA 4QMQA 1ZOHA 4IC7A 3E64A 1OPLA 2J0KA 2A27A 3PVWA 4I22A 4DCEA 3A4PA 5IH6A 3LE6A 5EDRA 4BWXA 2C6KA 2YIRA 5A14A 4KIOA 4O96A 3FY0A 4R5YA 3U8WA 1NA7A 4GIIA 3FZSA 3NAXA 2VX3A 4V01A 4MNFA 3I5NA 2W1EA 3NIEA 3QRTA 2EUFB 3QD3A 4NT4A 3FLNC 4O91A 4RC4A 4PUZA 1YRPA 4Y95A 3PA5A 1DS5A 3H0ZA 1WAKA 2F49A 3R73A 4FV7A 3AGLA 4OW8A 4G31A 3VJOA 4G1WA 4C36A 4R1YA 2VTSA 3BLHA 4M14A 5DRBA 3UQCA 2J0JA 5EQEA 4Y46A 1UNHA 2GNLA 1H00A 4R8QA 3NEWA 2XJ1A 3QCYA 4LI5A 4U40A 3RK7A 1UWJA 4QMNA 2VTQA 4FSWA 2QG7A 2C6LA 3COHA 3W2PA 4FUXA 2OXYA 5GIPE 4L68A 4RIYA 4NSTA 2I0YA 4TNBA 5EM7A 3JS2A 3NZ0A 3TV6A 4ALVA 4TRLA 4ZSGA 5I9UA 3ORZA 3RZBA 2PZPA 3LFBA 4LMUA 4V05A 5J1VA 1PYXA 2WIHA 4M68A 3QQGA 5IUIA 4EZ5A 5KX8A 5DH3A 4CYJA 1LUFA 3KL8A 5KKRC 5HG8A 2BZJA 2A0CX 3UOKA 3RVGA 3AC3A 3EB0A 3KRLA 1OBGA 2VWIA 5HI2A 2DYLA 4LRKA 3DV3A 2XNOA 3C4WA 5HZNA 2REIA 4RMZA 3MESA 3LCKA 4IH8A 1GZ8A 1TQMA 3HX4A 3EJ1A 4TKSA 4TT7A 2GPHA 3MTFA 4I92A 3RPRA 5K9IA 2WTCA 3B2TA 4RGJA 3QKKA 1FGKA 3OROA 3ACKA 3HMMA 4RX7A 1K2PA 1VYZA 3OHTA 4APCA 4E93A 3BHUA 2IZTA 3OEFX 4BI2A 2DS1A 2OJGA 4GU6A 3IO7A 2IVVA 3PIXA 3UPXA 4O22A 5JFXA 1PXLA 4HYHA 2I1MA 1W7HA 2B4SB 4R6VA 3P79A 4C59A 4DT8A 3G9LX 4EWQA 1PHKA 3HAVA 4G16A 5CTPA 3C13A 5K4IA 5GINE 1KV2A 1UA2A 3NUYA 1JAMA 4RRVA 3A7FA 3FSKA 4O7LA 3LFSA 2XCHA 4ACGA 1WBSA 4NM0A 1GY3A 4MXXA 4BBFA 3QGYA 1BI7A 4AW0A 2XKCA 4EK8A 3N4UA 3EYHA 2BFYA 2ZV9A 4AN9A 3H9FA 2UW8A 3GFEA 5JKGA 4EYJA 4PY1A 3P5KA 3WBLA 4P4CA 4I6HA 4DEIA 4XCUA 2Z60A 4A07A 4XG6A 5E1EA 4EEVA 3LLAA 1M2RA 3P7AA 4QPMA 2C6OA 2PE2A 4DFNA 4O0RA 3NUPA 3FWQA 4ITIA 5AM6A 1W82A 2YM7A 2H6DA 3QRUA 4FTQA 4UMPA 3ETAA 3JYAA 4BB4A 2Y6OA 3AXWA 4BCNA 3FMEA 3ZUVA 3D5UA 3KULB 2CLQA 3PVUA 4YZCA 4ZXTA 3QBNA 1ZYCA 4QRCA 5H3QA 3ALOA 2Y6MA 3A7HA 5H8BA 4AE6A 3ZLSA 4FSUA 4OTPA 3GU7A 3D0EA 1M2QA 3OWJA 4WNMA 3VNTA 4E5WA 4BIDA 3FQHA 3VC4A 4DH1A 4ZZMA 4MVFA 3FPQA 4F6UA 4AX8A 4EH3A 3KGAA 2XK7A 1O9UA 4OTQA 5JRSA 4D9UA 3U6JA 3FL4A 4APPA 1J1BA 3O7LB 3HV7A 4QOXA 5D9HA 3DBQA 2H34A 3PJ3A 4QTBA 4A4LA 2GSFA 3FL5A 4JQ8A 3R7UA 2YCRA 4AU8A 5FP6A 3LXLA 4D2RA 5HORA 4YMJA 5IU2A 3LKMA 3PPZA 4FTAA 4FT3A 3PY1A 2XRWA 3GENA 3V8WA 5AV1A 2R3FA 4XOYA 2C3IB 4IX4A 3DGKA 3OW4A 3UMXA 1GNGA 4KIQA 4LGGA 2QCSA 3LXPA 4M15A 4DC2A 5KKRB 2ZJWA 3MWUA 2I6LA 4AG8A 5J9LA 4XLIA 4D2TA 4XP3A 4UZDA 5BPYA 4LMNA 3O71A 4BC6A 4D4VA 4F09A 3T9IA 2P55A 2R3PA 3CQUA 3M2WA 4DTBA 4JDIA 4DEDA 3QL8A 4F1TA 5K4JA 3ZM9A 4RVLA 5AP6A 3GT8A 1R78A 1YDSE 3HUBA 4FL3A 4AA5A 1Q8YA 4G6NA 4K9YA 5M07A 1V1KA 3L9PA 4RWLA 3W8QA 2W5AA 3EQRA 5EI6A 1OUKA 2XP2A 3MB7A 3MY0A 3O50A 4NIFB 3KC3A 4XH6A 3VBQA 3MS9A 4BZOA 4W4WA 4CKIA 3HNGA 4LUDA 2I0HA 1U54B 4USEA 3OZ6A 4FIJA 1PMUA 5FUTA 5ANOA 4JBPA 4E8AA 5J7HA 2FYSA 2R64A 4JAJA 4DGNA 4HPUE 4EKKA 1A48A 4A4OA 3O17A 3QU0A 4O7VA 1OPJA 4FEXA 5BQ0A 4PNKA 4IVAA 2IJMA 3MVHA 4MAOA 3WI6A 3F2RA 3RINA 3NWWA 3PY0A 1W0XC 3NDMA 3MGYA 4EZ7A 3T9TA 4AUAA 2EB3A 4FNXA 4C4FA 1ATPE 1RDQE 1XBCA 3ZSGA 2J51A 3D9VA 5D41A 5TO8A 4EYMA 2GHMA 3EQFA 3VRZA 3BYUA 1YVJA 4S33A 3WIGA 3S00A 4FV5A 3HEGA 4NUSA 4ZSJA 5TE0A 3D14A 3QQKA 2E9OA 3DNDA 4E73A 3C4XA 3CBLA 3LFCA 5I3OA 2VGPA 4GEOA 2WQBA 3FE3A 3Q52A 1L8TA 1KWPA 4FTTA 4C61A 3RWQA 5LWNA 4GV1A 2CCHA 3PDTA 3FLYA 2NNWB 1UU8A 4PDPA 2GCDA 5F20A 5F95A 5DA3A 4NWMA 3TKUA 5KBQA 3E7OA 4ZSEA 4ZOGA 3GFWA 3FDNA 5HIDA 4F64A 2R9SA 4IM3A 5ANGA 3NW7A 3FLWA 3OFMA 2HZ0A 4L42A 1PW2A 5AR8A 3E7VA 4L46A 1E1VA 1ZRZA 3UZRA 5IG1A 4D4RA 3ZEPA 3G15A 3A8WA 3LJ1A 3L8VA 3RPVA 4KKGA 4PPAA 5D12A 3VUIA 4E7WA 4NKSA 3QA0A 4FIGA 3BLRA 4YJRA 3NR9A 4WG3A 2GHGA 2QLUA 3DBFA 3FSFA 3ACJA 4FZ7A 3R7EA 5GJDA 5ETAA 2A19B 1UVRA 3KB7A 4U41A 3UDBA 3VULA 4CTCA 3QZIA 2VUWA 4F0FA 3UC3A 4QT1A 4QP3A 1BYGA 3I4BA 4DN5A 4F63A 2PYWA 4O0UA 5J5SA 4JLCA 4DEGA 2QHMA 2ZDTA 3RAHA 3U6HA 4IDVA 4L00A 4WRGA 4DGOA 3OCBA 4F0GA 3DB8A 3QZFA 3CS9A 4Z9LA 4PTCA 2VRXA 4TTHB 4YTIA 3FHIA 2PVYA 5B7VA 4ANBA 4FGBA 3V01A 4C58A 2BHEA 5DEYA 4KA3A 5LMAA 3VF9A 1DI9A 3UE4A 3VW6A 4EBWA 3FQEA 2WGJA 4LOPA 5LVPA 5IMXA 4IEBA 1ZY4A 2C6MA 2Y7JA 3BHYA 4AOTA 4C4HA 1XH9A 4CZYB 2BTRA 3TDVA 2WMQA 4KS7A 5C4LA 2EXMA 4HGTA 5IA4A 4O1PA 1IA8A 2PE0A 4IWPA 4LOQA 3VRYA 4MXYA 4V0GA 3TV4A 2YAKA 5EI8A 3R2BA 4YJTA 5EOBA 3VHEA 3CJGA 3GGFA 1AD5A 4DFLA 4BCOA 4I6BA 4PMTA 5L2IA 4AE9A 5HLPA 4BZDA 5CSXA 1GJOA 3QLGA 4FV3A 3Q2JA 4DLIA 3W32A 4AS0A 2QOFA 4LV8A 5L2SA 3AD5A 4A9UA 4GT5A 4ALWA 3CR0A 4IM2A 4JVGA 4MKCA 4LOOA 2PHKA 4QQ5A 3U9NA 3R8LA 3S2PA 3VHKA 3DLSA 5GZ8A 2RFSA 5EHLA 4BWPA 2CMWA 4P90A 3V6SA 2OFUA 2RFDA 2YDIA 3IQ7A 4MF1A 4IZ5A 5I9WA 3DZQA 3UPZA 2JAMA 2IWIA 1T46A 2ITWA 1JKKA 5IMEA 2C5OA 4I6FA 4MD8E 4BDDA 3P23A 2BTSA 2VO0A 2H8HA 5DMZA 4YJQA 2XYNA 3VQHA 2J4ZA 2R3LA 3G5DA 4N0SA 5D7VA 3V3VA 4QTEA 1PY5A 2Q0BA 2X0GA 2X7OA 2JDOA 3NNWA 5EM8A 4YTCA 5CAPA 3N4VA 2ONLC 2R0IA 3NNVA 2XNBA 3K5UA 4Y72A 4FTLA 5FP5A 4YHFA 3QD2B 3QRIA 5CANA 1ZYDA 2V62A 4Z3VA 4HYUA 3BZ3A 3C0IA 3ZEWA 2NO3A 1M52A 3GXLA 5C1QB 3DFAA 4MD9E 1Q41A 3QTQA 5LMBA 2OZAA 4R5SA 2P2IA 3ROCA 3BIZA 1L3RE 3MFSA 4FL1A 4FE2A 3G9NA 4F0IA 2VTLA 4NEUA 3AC1A 3PPJA 2PVFA 4K2RA 5HLWA 2X7FA 4M7IA 2I0VA 3PE1A 3L9LA 5L6OA 2BFXA 3MB6A 4EQUA 2XZSA 1PXMA 2VTOA 2CGWA 2EWAA 2ITOA 2XK9A 4IE9A 2GS6A 4TWNA 5H9BA 4EL9A 5LCKA 4MQ2A 3RM6A 2P0CA 3TTJA 4O7NA 4B8MA 5CEOA 3RM7A 4AT5A 3DBCA 3NUXA 3U54A 4EH5A 4YJVA 3HUCA 3ZTXA 4CFUA 3DA6A 3LJ2A 5M56A 3C0GA 3JVSA 3L8SA 3WYXA 1QPDA 3R7GA 2QONA 4EOQA 3FXWA 4BTMA 4TW9A 2QHNA 4EOPA 3BRBA 3POOA 4IVBA 4FT9A 4K18A 4D1SA 3EZVA 4DGGA 1PXIA 1UU9A 2C0TA 2C4GA 5CEPA 4TYHA 3N9XA 3DBEA 3KXZA 5A4TA 4IJPA 2VWZA 2W4JA 3B8RA 5HO8A 2PL0A 5C8NA 3TUDA 4D55A 2PUNA 2H9VA 2WMRA 4U97A 3TT0A 3C0HA 3QD4A 4FSQA 3LVPA 4YTHA 4FEUA 2GFSA 3DAKA 5ETCA 4MBIA 3QALE 4BCJA 2W1GA 4OTWA 2YCQA 3CQEA 3DKOA 4FKGA 4BIEA 4D5HA 4KINA 3BQRA 4BI0A 2ITVA 4EHVA 3O51A 3PXYA 4PV0A 4L45A 4OT6A 4PTGA 5KMIA 3E62A 2CCIA 2ITXA 4AT4A 4Z16A 5FM3A 1GIIA 4FIFA 2Q83A 2JIVA 4L44A 3Q5IA 3TNHA 4USDA 4FNYA 3F5PA 3PP1A 2NRYA 3VIDA 2HENA 3KCFA 3PSBA 2X7GA 3CGOA 5CNOA 3W2SA 3FKLA 2GQGA 4B99A 3A4OX 4IB0A 1H1WA 3ID6C 4B4LA 1VR2A 4O7YA 4QMWA 3VN9A 5HTBA 5IQFA 3OUKA 3W8LA 3R8ZA 5LVOA 1J7LA 4FKJA 4JT3A 2FSMX 3UO4A 3VBYA 3VS2A 4C33A 4ZAUA 3S1HA 2C6TA 2OKRA 3NCGA 5LVMA 4U42A 3O7LD 4U8ZA 5BYZA 3GQIA 4ZTNA 3RNYA 4PDSA 4C4EA 5HNIX 4N6ZA 3ENMA 3KVXA 2RG5A 1H1SA 1EH4A 1NVRA 3MI9A 4NJDA 5KHWA 4L8MA 4Q5HA 2YEXA 2WTWA 4ZTLA 2Z02A 4OAUC 2RIOA 2OGVA 3F3VA 3BGZA 3E8NA 1FPUA 1GZKA 3PE2A 4CMUA 4TYJA 5AUUA 2VD5A 5J5TA 2I0EA 2C3KA 3OCGA 4ASEA 4G9RA 2WQOA 4JIAA 3OT3A 2PUPA 4W8EA 2A1AB 2OWBA 1OITA 4A4XA 3OOMA 5CEIA 3QTIA 5EQYA 4RIYB 5M09A 3BX5A 4FR4A 4YHTA 4F9WA 4H3QA 4IACA 3R01A 3WF8A 2B7AA 1BL7A 2QOQA 3MPMA 4FTKA 5C9CA 4CMTA 4CQEA 5GHVA 3UQGA 2WMBA 4RG0A 4JDJA 2GQSA 3KF4A 4IX5A 4FOCA 2F4JA 4U3ZA 3O96A 3EN9A 3BYSA 4E6QA 4O27B 1G8SA 3FYJX 5IA1A 3PWDA 4EUTA 4ASDA 4FYOA 2J5FA 3OBJA 5KBRA 5C8MA 4RVTA 1FQ1B 2ITQA 1J91A 2HW6A 3ZLWA 4TYIA 4I93A 2YZAA 4BCMA 4R7HA 4DEHA 4QMVA 4AGUA 3QAME 1G5SA 1Y8GA 2VWBA 3I0OA 5EI2A 3LAUA 5HCXA 3W10A 2W1ZA 4FEQA 4RJ7A 4AF3A 4F7JA 3TCPA 5L8LA 1TKIA 2PMLX 3II5A 4L6QA 4QP2A 4NU1A 3RZFA 3HYHA 2EVAA 4RJ4A 3ZM4A 4C34A 4YJUA 5ANEA 4DHFA 2WTDA 2J7TA 3W18A 3ZBFA 2ZOQA 4BHNA 3C4CA 3R04A 2O3PA 4TZRA 3IW7A 5DHJA 4CV9A 4OTRA 3ULZA 4BR3A 2XNMA 3U6IA 1XH4A 5CSHA 4UWYA 5AR5A 3RCJA 3VS3A 4U44A 3Q3BA 3UZPA 4BYIA 1KE6A 3IPHA 3REPA 4W9XA 5E92A 3OY1A 4O83A 2BAKA 3EQDA 5IA0A 5M53A 3WZEA 2X8EA 4UWBA 4OTHA 4DH8A 2P3GX 3E8DA 4FKSA 1H0WA 3M42A 3JXWA 4EOKA 5AUWA 4U79A 4LV5A 1BX6A 2ZV2A 4BCPA 3FI8A 4BDAA 4KKEA 2BZHB 2B54A 3ZHPC 4IWDA 3OF0A 4M12A 5CWZA 3SOAA 1I44A 3R7VA 3V8TA 1ZZ2A 3I1AA 3QZHA 3TV7A 3V6RA 5HX8A 5IUHA 2JIIA 4RVMA 5H2UA 3VUHA 4R78A 1JKTA 4IIRA 5DN3A 4ANLA 5M4CA 1YDRE 1PMNA 3NAYA 4G6OA 4AGWA 2HIWA 4YR8A 4AZEA 2VTMA 3D7TA 3DCVA 2O8YA 2X4FA 1YW2A 3R1NA 1OMWA 3EIDA 1P4FA 1ZWSA 2W7XA 3V5LA 4FC0A 4HYIA 1F3MC 3DU8A 4FSRA 3NUUA 5DT3A 3CSVA 2OICA 3UNKA 4FKUA 1YXXA 3W1FA 3BU6A 5AP2A 4DITA 4I5HA 4FSYA 5AR4A 1NT2A 3MIYA 4TWOA 4IAIA 3AT3A 3AC4A 3E93A 4BTKA 5IUGA 3E63A 3LCOA 4WOVA 4S32A 2VTJA 4XX9A 3A61A 3HA6A 3BE2A 3P9JA 4O84A 2F7ZE 4C35A 4CVAA 4TL0A 1Q8ZA 4FT5A 5JZNA 2YM4A 3ELJA 3PY3A 3WF9A 5CY3A 1GZOA 1QPEA 2OI4X 3AMYA 5TOZA 4PL5A 5E7RA 2HZ4A 3LJ0A 2J9MA 4QYYA 5M51A 1U5QA 2X2LA 3MJ1A 2IW8A 3BYOA 2VTNA 4GKIA 2KTYA 1XQZA 3M1SA 5JGBA 4FT0A 4YURA 3BU3A 2CGVA 4RIXB 2BRBA 2XNPA 4F9BA 2X6DA 3O2MA 3R9NA 4ZTMA 5B2MA 5BX0A 3HGKA 2PVLA 1OKVA 1NY3A 1ZOEA 4CXAA 3BGPA 3LLTA 5CXZA 5CSWA 5AAGA 1V0PA 2X2MA 3CIKA 5IDNA 3PIYA 4MNEB 5HKMA 2XRUA 4D0XA 3GCQA 1PYEA 3EQHA 2J0MB 3BYMA 3I7CA 3F9NA 1OIRA 4D2VA 2YCSA 3OXIA 4YC6A 4EORA 5J79A 1OL6A 3UNJA 4IAFA 3ZONA 3VS6A 4BDIA 4LUEA 4ZMFA 3G51A 4ITJA 5AUXA 1JLUE 2UW4A 3CC6A 3GOKA 3KN6A 5CAVA 4MD7E 4DLJA 4X3FB 2XIRA 4WO5A 3D2KA 4G5PA 4M8TA 2ZYBA 3NW5A 3R8VA 1YWNA 2XH5A 4OTGA 5BUIA 3FPMA 1LP4A 2EB2A 2JKKA 2FSTX 4UX9A 2O5KA 2WMXA 1V0BA 4MCVA 5BVOA 1PXOA 3W2CA 5E4HA 2J5EA 1B39A 3RAKA 5EHOA 2UW5A 3SDJA 4XG3A 3IK3A 2B9HA 3Q4UA 5A54A 2XF0A 4MXAA 5LMKC 4DGLC 3VUGA 1REJA 3RALA 4KIKB 4AT3A 1APME 2VNWA 4BICA 5HU9A 2FO0A 3AGMA 1A06A 1ZZLA 4OLIA 1U4DA 2VO7A 2XKEA 5EYKA 3W55A 4BWKA 4CT2A 3MY5A 5AUYA 2QD9A 3NSZA 1CKIA 2BALA 4XEYA 2PU8A 1YOMA 3ORIA 3UG1A 4AW1A 5CAOA 3CKWA 3CLYA 4FV6A 2UW6A 2QOOA 3HMOA 4B0GA 2BDFA 4TWPA 5DR2A 4FTJA 4FKQA 3R7OA 1JBPE 4QMOA 3S3IA 2VTAA 4TY1A 4BGQA 4E5AX 3TUBA 3MTLA 1OL5A 3OWLA 2Z8CA 4TNDA 3KRWA 3UYTA 5AP3A 4W8DA 3TZ9A 1VZOA 4K8AA 3F66A 5FBOA 3FY2A 3DDPA 3ZDIA 4O7WA 4LL5A 2WD1A 5G6VA 2BAQA 3GEQA 4G2FA 3UTOA 4DFBA 4PMMA 3RKBA 3D4QA 2BR1A 2IN6A 4E4XA 3RWPA 1MRVA 4L52A 2YLEA 4WBOA 3C4ZA 4YSMA 4XG2A 3MIAA 3TZMA 3OCTA 3E3BX 4JIKA 4PX6A 2IG7A 3E8EA 2PZIA 2ONLA 2B9IA 3BEAA 4J52A 4J99A 3WOWA 4LGDA 5AV4A 4NTSA 3SQQA 2ITZA 2UZWE 4NFNA 4I0TA 4YJPA 4OBPA 1P5EA 3C9WA 1REKA 1WBPA 3SXFA 3R30A 1FMKA 2C6IA 3D5VA 4RIWA 2XYUA 5CU0A 5AP7A 4H05A 4GT4A 5FQDC 1ZOGA 4ACMA 5I9XA 5JRQA 4O7RA 2ZM1A 4HVSA 5JZJA 5CS6A 3PTGA 3TZ8A 3LCTA 4WSQA 4FKTA 3EQPA 3MH0A 4GL9A 2WQEA 5A6OA 4L7SA 4O1OA 2FH9A 4MQ1A 2C5XA 3HDMA 5AX3A 5LVNA 3Q53A 3A7GA 3SHEA 5EDPA 1CDKA 3GB2A 3C5IA 2OF2A 4F9AA 4FF8A 5AAEA 5B0XA 4I24A 3PA3A 5CT0A 1P4OA 3P08A 3QTXA 3P7BA 5BVKA 3UP2A 3SKCA 5ICPA 3BLQA 4UB7A 4FG7A 2CGUA 3W33A 4I4EA 3TTIA 2VWUA 2JFLA 3QC9A 4XV2A 5LQFA 4MXOA 2R3QA 3DXNA 3UO6A 5I5ZA 2UV2A 2OO8X 2ZM4A 3PFQA 2ETMA 5E8XA 4ANNA 5FGKA 1HOWA 1E1XA 2Z7RA 3KXNA 4TN6A 3BV2A 3TJCA 5EG3A 5JFVA 3QX4A 4TYGA 2Y4IB 5AP4A 2GNFA 4H36A 4CT1A 1UKHA 3QRKA 3MH1A 2FUMA 3KU2A 5F94A 4C38A 4XLVA 2PVRA 5KNJA 3WZKA 2XBAA 4QMXA 3WZUA 4F9YA 4Z55A 1Z57A 3KREA 1YWRA 2NP8A 5HCYA 4GRBA 1YXSA 2YCFA 4R3CA 4OBOA 3WE8A 2E9PA 1Q4LA 4FKIA 4G3FA 3U9CA 2XK8A 2VWVA 4JDKA 2B52A 4YZDA 5HO7A 3N4TA 1J1CA 2G2HA 4ZEGA 4I5PA 1YHSA 1R3CA 3EFJA 4XRJA 1W83A 2WHBA 4WNOA 4RWJA 4EBVA 3QTRA 4R3PA 3LW0A 2E9VA 3IW4A 1H8FA 4BTJA 4RZWA 2GTNA 4E4MA 3RPSA 4ANSA 2H96A 2ITYA 5FD2A 3MA3A 4XS2A 4OTIA 3OMVA 4YLLA 4BHZA 3NCZA 2QOHA 4D0WA 3R0TA 2YIYA 4CLIA 1LPUA 3LM0A 3E5AA 3E92A 3LQ8A 1OM1A 4E4LA 5HD4A 2R3NA 4WHZA 5CZIA 3KA0A 3ANQA 3OG7A 4QPSA 5EYCA 4AGDA 4ZSAA 4JRNA 5I4NA 5D7AA 4EH2A 4WBBB 1FMOE 3L8XA 4XNEA 4G3GA 4ONAA 3OW3A 5A4LA 2YERA 3PIZA 2WU6A 2JKMA 4BDCA 3T3VA 4Z7GA 4B6LA 4QNAA 3BWFA 3QXOA 5LCJA 4BCHA 3ET7A 4BYJA 2XMYA 3EN6A 4QMTA 4UMQA 3KXHA 3QF9A 3PLAE 5IQAA 5F9EA 3UBDA 3UVRA 4I0SA 4RX9A 3UNZA 4J7BA 4TYHB 1Q61A 5IF1A 3R8UA 2GS7A 5J1WA 2QG5A 4G3DA 4E6CA 3MN3A 2R4BA 1VJYA 2WTIA 3ITZA 4ZJJA 3NRMA 4EH4A 3NYXA 4ZS4A 4C0TA 4FG8A 3E88A 2XK4A 5AV0A 2XNGA 3FKOA 3LFFA 2F9GA 4FV0A 4JS8A 3C4FA 4C3PA 3GNIB 5TKDA 4CKJA 4RA4A 2X9EA 2X39A 2C69A 1T45A 1MRYA 3PRFA 3SOCA 1SNXA 4QO9A 4RC2A 5CSVA 2PVKA 2OJIA 3D94A 3ZRMA 3RCDA 2WTJA 4C37A 2QO2A 2XA4A 2XM8A 3OTVA 5M55A 3EFLA 4ANQA 3U4UA 3Q6WA 4FTRA 5FTQA 4ASZA 3LXKA 5KMKA 3PJ8A 4QMYA 5DR6A 1AQ1A 4UXLA 3AD6A 2X81A 3NLBA 3RJCA 2B0QA 1PMVA 1H1PA 4DCAA 1KV1A 4G9CA 4IADA 5TF9A 3DK6A 5HBJA 4PPBA 3S4QA 3KMUA 1WZYA 2CDZA 5DT4A 5IDPA 4P2KA 4ZTQA 3F5GA 3FUPA 1U46A 3QZGA 1ZYJA 2Y9QA 3QWKA 4ZLYA 4E3CA 4Y5HA 3SRVB 5D1JA 4G5JA 2VWWA 4CCBA 5IQDA 4AQCA 3H9RA 4PNIA 3TG1A 4DYMA 2HWPA 4M69B 2ITPA 2X8IA 4YC8A 4R7BA 1FVTA 1MP8A 2ZDUA 4FTMA 1E9HA 1JSVA 4XJ0A 1K9AA 2Y4PA 2LGCA 4BBEA 3FBVA 4FI1A 2UZUE 4OBQA 5HNGA 1JNKA 3ROYA 4ACDA 4DGMA 4XYFA 1IAJA 3HMIA 3WF7A 5L4QA 1QCFA 2ERKA 4FODA 5EHYA 3MH3A 4BIBA 2BAJA 4BCQA 2R3GA 3VS0A 2XBJA 5JQ5A 5HU3A 4FZDB 3EZRA 3QQHA 4DG3E 3DPKA 3OT8A 3SG9A 3AC5A 1R0PA 3Q60A 3NYNA 3Q9YA 5ETIA 5HVJA 5CENA 4AOIA 4ANOA 4BDBA 3M11A 4L3LA 4WUNA 2XVDA 4E4NA 4FVQA 4Q5EA 2UZEA 3VAPA 4O6LA 3BU5A 3VJNA 4KKHA 4HVHA 3GQLA 2B53A 5C4KA 3OS3A 4QNYA 3RAIA 3A2CA 4YC3A 5J8IA 2OIQA 4AXAA 3GU8A 5HEZA 3OXZA 5HNBA 4IWOA 3IKAA 1XH5A 4LYNA 5KZIA 3P86A 5LVLA 1WMKA 2QVSE 2BDJA 4H1JA 1UU3A 5KUPA 4LG4A 2X6EA 2ZV7A 3TNQB 4FUYA 4F99A 3OOGA 4O82A 5CF8A 3W2OA 4BF2A 3AOXA 3R1QA 1Y6BA 2FSOX 3HRBA 2HCKA 4KB8A 4ZJIA 4NYEA 3HKOA 5HLNA 3FMMA 3ULIA 4KBKA 4KSPA 2R7IA 4IB5A 4UYAA 2W96B 4U9AA 4C57A 2CN5A 1YKRA 3FAAA 4WUAA 4V04A 4NCTA 3KXXA 4AN2A 3W16A 4I0RA 4IANA 4IVCA 4CKRA 4BDJA 1M14A 4WIHA 2HY0A 4PP9A 4KS8A 3OC1A 4PRJA 4YJSA 2UVZA 1YHWA 4OT5A 3SW7A 1YOJA 5AEPA 3MFTA 5F1ZA 5KZ0A 4ZLOA 3E3PA 4FV4A 5JT2A 3FC1X 2G01A 5ACKA 4O38A 5DGZA 4FKRA 2WEIA 5ANJA 4PWNA 2OU7A 1W84A 4RIOA 5L8JA 4EUUA 5M08A 3NVMB 4F9CA 3OVVA 3EL8A 3BI6A 4JNWA 3Q4CA 3HV6A 3ZMMA 4QYGA 3R21A 1HCKA 1URCA 4P5QA 5AR7A 5A6NA 2XNNA 1UKIA 4FT7A 4TWCA 4GT3A 2YZLA 4N4SA 3GC0A 4JBOA 4Y5QA 4KAOA 5I9YA 2B55A 3LZBA 3R2YA 4PTEA 3KRXA 5CEQA 1IG1A 4MX9A 2VZ6A 4LRMA 4LRJA 4QQJA 4B7TA 1PXNA 4I5MA 5KO1A 4J96A 4WNKA 2GU8A 5L2QA 3WIKA 3ATTA 2UZBA 3H9OA 5CASA 5DT0A 3EN4A 3ZRKA 1MUOA 2W4OA 3CY3A 3LXNA 1Q97A 4D4YA 3KULA 3ODZX 4UMUA 3ANRA 4IQ6A 3PPKA 5CU3A 4FOBA 2JAVA 4D9TA 4EOOA 1OL2A 2VTIA 3WF6A 1R0EA 4L7FA 5FEQA 3DY7A 5JK3A 5A4EA 4EONA 2B9JA 1FGIA 2WMTA 5DYJA 3AD4A 5B2LA 3WZDA 3AMAA 5HGIA 4UEUA 2XKDA 3QHWA 3ZDUA 2PVNA 3KXMA 3COIA 1GAGA 3GP0A 2CSNA 4G3EA 1OI9A 4X2KA 3RPYA 1LEZA 2WPAA 1YI6A 2J6MA 5CQUA 3QTUA 5GIOE 4NFMA 3LFEA 4AGCA 4R77A 2VO3A 2R3JA 3ZZWA 3ZH8A 4HGLA 4WNPA 1JWHA 3MFRA 4DFYA 3COMA 4MXCA 4KIPA 4UY9A 3PXKA 4JG6A 3VW8A 3UVPA 5AFVA 4XUFA 3DQXA 3ZO3A 4X7QA 3IGGA 4CSVA 3IW8A 3UVQA 1MRUA 4DEEA 3FMHA 4K33A 1O6LA 4OGRA 2WU7A 1YWVA 4PPCA 3ZFMA 4MTAA 5IA2A 4RC3A 4ZTRA 3VS7A 2A2AA 2XEZA 1AGWA 2UZDA 3FZOA 2WFYA 3WYYA 1CSNA 3LHJA 5IPJA 2YWPA 4F6SA 2BROA 2XUUA 2YM3A 4FG9A 1B38A 2E9UA 2WZJA 5DEWA 4I21A 3ZFYA 3TKHA 2C3LA 1G8AA 3HAMA 3ORLA 1LR4A 1KE5A 3PVBA 2VNYA 4J98A 1XJDA 4DEBA 5EW8A 4ZTSA 5A4CA 3LQ3A 4HPTE 5JEBA 4EOIA 3HV5A 3ORMA 4NIFA 2Z7QA 5FWKK 4U43A 4O21A 3H4JA 2JGZA 2R3IA 3D15A 3GC9A 4CEGA 3ZO2A 1Z9XA 4BTFA 1U54A 3HMPA 4O6EA 5FXRA 3VUDA 3I5ZA 3ZUUA 4GFOA 3PXFA 5HE0A 1OL7A 3SXSA 4IAZA 2HYYA 5CZHA 4OTDA 4CD0A 1XWSA 3TNIA 2W5HA 1XKKA 3BBTB 4PL4A 4S30A 3S0OA 4DH3A 1PRYA 2BVAA 4P7EA 3C5UA 3DAJA 4BZNA 5IEVA 3SVVA 4IC8A 4AAAA 2GS2A 3Q2MA 2O65A 2XIYA 1RW8A 2XKFA 4F08A 5FRIA 3QUPA 4I23A 4YZMA 5DNRA 4ALUA 1H24A 2YLFA 2DUVA 3PLSA 5GJFA 1QPCA 5L6WL 5AUTA 5IH4A 2JDRA 3O8TA 2W17A 1CKJA 1WBTA 2X4ZA 1OIQA 4I5CA 2Y8OA 2HZNA 4IZ7A 5AP5A 4BL1A 2RGPA 2OZOA 1GOLA 4BDEA 1XBAA 2W05A 4RWKA 1Q24A 4YUQA 5KE0A 5DOSA 3H3CA 5LXMA 4GK2A 3WILA 4QMZA 3ENHA 3VWAA 2GNGA 1Y57A 3EFKA 4YLKA 4ZTHA 1UWHA 2C68A 1JOWB 1JKLA 3GOPA 3P78A 1H1RA 4GG5A 1ZARA 2BZKB 4QQTA 5CLPA 2W4KA 3V5PA 3KRRA 4IB1A 5IQCA 2WTKB 4FVRA 5HIBA 1O6YA 4D58A 4E6DA 2X2KA 5HBEA 4XG9A 1CM8A 4DTKA 1OGUA 4RZVA 1WCCA 4GVAA 2PSQA 3L9NA 2YM5A 4AW5A 3VBXA 1PXJA 1WVXA 3VO3A 3B8QA 3ZXZA 4RJ6A 5GJGA 4AZFA 2OJJA 5GZ9A 3EYGA 2JITA 3QYZA 5CEKA 1S9JA 1TQIA 2PZ5A 4X6RA 4F7LA 1J3HA 5IQEA 2YJRA 1YI3A 5EKNA 3UYSA 2ZVAA 4EC9A 2AYPA 3QCXA 1GIHA 5DRDA 1ZYSA 2XNEA 2W9ZB 2X8DA 1FBNA 3AT4A 1ZAOA 4F65A 5CXHA 3R6XA 4W4YA 4I6QA 2WMAA 3VUMA 2RF9A 3QQUA 2EXCX 3UGCA 5HG9A 4FMQA 5BYLA 4N6YA 3GU6A 4GMYA 4AZTA 3GUBA 2WEVA 3KY2A 5HG7A 3OP5A 2R0UA 3Q9XA 4XP2A 3UC4A 2ETRA 3EMGA 2C1AA 3FZRA 4X3FC 4BVUA 5L2WA 4GKHA 2FSLX 1R1WA 3HZTA 1OKWA 5FDXA 3L1SA 4CFVA 3FLSA 4YO4A 4YU2A 3NS9A 4RQKA 2WMVA 2XIZA 3FZTA 2HOGA 4GYIA 1WBWA 5EH0A 2UZLA 4JX3A 2WB8A 3DQWA 3I6WA 3Q04A 4J95A 3MVLA 4HZSA 4U80A 3BHHA 5EDQA 1JQHA 4XBRA 4KSQA 5ITAA 1NW1A 3C7QA 4FGRA 3QHRA 4DH7A 1QPJA 2ZB0A 4CFNA 5JN2A 5HE1A 4G34A 4NZWB 2F7XE 3DKFA 3HP5A 3R02A 2GHLA 3BWJA 3DTCA 5BVWA 1OL1A 1OVEA 3NW6A 4X2JA 5CQWA 1Y91A 2QQ7A 3FMNA 3F7WA 3PXRA 1SVEA 1XH6A 3I60A 3AMBA 3Q4ZA 5AWMA 2ZAZA 4D1XA 5BVNA 4USFA 5IQIA 5T3QA 2PE1A 4CRLA 4ZY5A 3TM0A 1YI4A 3UODA 3R1SA 4AZWA 3NUAA 1H4LA 4K77A 2UZVA 3FLZA 5AIRA 2QOCA 4BCKA 1IAHA 2GFCA 4I94A 3QGWA 4GH2A 2PMIA 2PMNX 1DAYA 3V04A 3V5TA 2V0DA 3RK5A 3UQFA 5BUEA 3LFQA 5DG5A 3GCPA 2BZIB 3OEZA 4EI4A 3K3IA 3KQ7A 4EH9A 2I40A 3ORXA 4JDHA 3G0FA 5IEXA 3EQGA 5M4IA 4R7IA 4O7TA 3LIJA 3ZC6A 2JDTA 3C4EA 4M97A 4O0YA 5ACBC 3BGQA 3CEKA 3BELA 3O0GA 5A46A 4F1MA 4NM7A 5CT7A 5DR9A 3DNEA 4GSBA 3QA8A 4IAAA 1DI8A 4JQ7A 4Q9SA 3LMGA 4KBAA 5E1SA 3BQCA 3OWKA 4GIHA 1Y8YA 3R9HA 5CEMA 2HXQA 3U4WA 4XRLA 4AFJA 5LWMA 5ANKA 4YJOA 4IWQA 2FVDA 5ANIA 5CU6A 3MV5A 5FTOA 3RBWA 2QOLA 1M7QA 5KMJA 3NVKI 2PZYA 3VS4A 4BDKA 4U5JA 3A99A 2WIPA 4FNZA 2BCJA 2BHHA 1PMEA 1JKSA 3PYYA 3IECA 2JD5A 5TT7A 4BGGA 3MPTA 4C3RA 3Q9ZA 5CU2A 2YDJA 4UMRA 4AFEA 3IONA 3GCVA 4GS6A 2W1IA 2XIKA 2HXLA 3O23A 3PRIA 5E8VA 4CMOA 5KMMA 2GNJA 4FTOA 5DIAA 2GNIA 2JFMA 3TUCA 1IASA 2FA2A 3GC8A 4IHPA 4GFMA 2ZV8A 2QNJA 3A8XA 3F3TA 3N51A 2RFNA 3QLFA 5DI1A 3DK3A 3HP2A 3WF5A 3MBLA 4KBCA 1DAWA 3IOKA 2BMCA 1UV5A 5FEDA 5KHXA 3WARA 2QLQA 3ZXTA 1X8BA 1BMKA 1SVHA 4G17A 3TXOA 4IFCA 5KMLA 5AR2A 3QD0A 1OECA 2OIBA 2ZMCA 1H27A 1U5RA 2AUHA 2Y4IC 3F3ZA 5LJJA 4QP7A 1NXKA 4CFFA 2WXVA 5CYIA 1UNGA 4HW7A 5I0BA 2JIUA 3BE9A 4L3JA 4P5ZA 1RQQA 3CTQA 3FXZA 1H08A 2JC6A 2CNVA 4IZYA 2PWLA 5BNJA 3DTWA 4RJ8A 4O7SA 3SV0A 1JPAA 4UXQA 3K5VA 3SGCA 3LFDA 3FQSA 3F3WA 3G6HA 5I3RA 4HJOA 4O0TA 1BUHA 4YJNA 4EQMA 4FSNA 2VWYA 3CY2A 2C1BA 4FNWA 1Q8TA 4FZFB 4Q9ZA 5JMSA 2J2IB 2BKZA 3ZLXA 3ZUTA 2P2HA 3TACA 5GNKA 2J50A 4CTBA 3QQLA 3R28A 2GQRA 1VEBA 5CF4A 4EQCA 4KD1A 3CKXA 2HK5A 4JR3A 3CTJA 4QQCA 1PXKA 2CKEA 3CP9A 1MQBA 2BILB 3LQ5A 4FSTA 4K6ZA 2BRHA 3PUPA 3WZJA 2YHVA 3SXRA 3UP7A 2WNTA 4LQMA 2HELA 2OBJA 3CE3A 4J1RA 2CKPA 3GU4A 3SD0A 1BI8A 5DFPA 2BRNA 1OB3A 2PPQA 4EH8A 4FKOA 3GI3A 3MVMA 3Q32A 3ZRLA 5KMNA 2X1NA 2OJFE 3JPVA 4KWPA 3ZLYA 2IPXA 4O0XA 5E90A 2VX0A 4QP6A 3MA6A 4RX5A 4UYNA 5CI7A 4GUEA 3BHVA 5HBHA 5H8EA 5CF6A 5IQHA 1Q8WA 3FC2A 3JR1A 2XJ0A 4U3YA 4NJ3A 2XIXA 5JFSA 3IDCA 1Y6AA 4J71A 2DWBA 3T8OA 4JQEA 4CFXA 1ZMWA 3H10A 4FZAB 3B2WA 4FV1A 1U59A 1TQPA 3QUDA 4WG4A 3RK9A 1CKPA 3EQIA 5C26A 4GJ2A 5HICA 4DEAA 3EN7A 3O8PA 4EK6A 2UW9A 3NIZA 3BCEA 3PSCA 3OY3A 3EKNA 5C01A 3ODYX 4YZBA 2HZIA 4HNFA 3BEGA 5CF5A 2XEYA 2OJ9A 3IDPA 4EJNA 3VBWA 4J8MA 3ZO4A 5HX6A 1W98A 3DB6A 3F2NA 1O6KA 2CN8A 4HNIA 4CFWA 2E9NA 4XBUA 4ZS0A 3V5QA 1DM2A 4MK0A 4D2SA 4A9RA 5DPVA 2PUIA 3IW6A 4DA5A 3KRJA 3OBGA 1SYKA 3HV4A 4JJRA 4QTDA 4AOJA 4IAKA 2YAAA 2JBPA 4LFIA 3IGOA 4V0GB 5A3XA 3LFNA 2UZOA 3DKCA 3MPAA 4OAVB 4DFUA 2ERZE 4LGHA 3C1XA 4C62A 3FJQE 4GG7A 4YSJA 3ZOSA 4QP1A 4DBXA 5AUVA 5HE3A 2OXXA 4EC8A 4EZ3A 2VU3A 2WELA 4O0VA 3FEGA 1OUYA 4YNOA 3V51A 5BVFA 1R39A 2HW7A 4CZUA 2QU5A 4R1VA 3PZEA 2ETKA 4A9YA 1STCE 4E5BA 5KCVA 4M66A 3CPCA 3MYGA 2WKMA 5B2KA 2R7BA 3KKVA 2W1DA 4AA4A 3DKGA 2AC3A 4YBJA 5DVRA 3FKNA 2V7AA 4FTNA 4ITHA 1PF8A 4WRSA 4Y73A 5EFQA 4A9TA 4D2WA 3JY9A 5E9EA 5L6PA 5M4FA 1KSWA 4UWCA 4XV1A 2WQMA 5CVGA 3UG2A 3ZYAA 5I9VA 4L53A 2WOUA 3DFCB 2CHLA 4UBAA 2QR8A 4IX6A 4QMMA 3EL7A 3DZOA 3TKIA 4NM3A 5JSMA 4XHKB 3LMIA 1I09A 2WAJA 4MHAA 2QURA 4FK3A 4BCGA 2FGIA 2V22A 1SVGA 2C6EA 4MEDA 2IZUA 4U0IA 2Z2WA 3R1YA 3R9OA 3R63A 4J53A 5EKOA 5JFWA 1URWA 2OG8A 3G0EA 2PY3A 2WO6A 4GYGA 2OZAB 5J7BA 3ZSHA 4MBJA 4FIIA 5H8GA 4EJ7A 2QC6A 3FLQA 4S31A 4H1MA 4X2FA 3BPRA 2VN9A 5T6KA 5A9UA 4B8LA 2C3JA 2GNHA 2IVUA 3V5WA 2CJMA 1OBDA 2P33A 4JRVA 4CRSA 3HMNA 2CGXA 4O2PA 3RAWA 4FK6A 3QFVA 5FM2A 4ZK5A 3F7ZA 3KF7A 3ZSIA 4X2NA 2UZTA 4EWHA 4EHGA 4CLJA 5GZAA 3IDBA 4YO6A 4ACCA 3NNUA 1RE8A 1XO2B 3PZHA 3UZTA 4HCUA 3PVGA 4FV2A 2W1HA 4RFZA 3SAYA 2UW7A 5AA9A 3TEIA 2YIWA 3RPOA 1SMHA 4ERKA 4I4FA 2GMXA 4ZY4A 2EU9A 3F88A 2ZM3A 5AJQA 5EM5A 2C5VA 4M0ZA 3VS5A 5K3YA 4U45A 1SNUA 2OIDA 3D2IA 1KE7A 3HECA 4EOMA 3PA4A 4FBXA 2CNUA 2ITTA 5EM6A 3KK8A 3TI1A 3TWJA 2Z7SA 1KOBA 3TJDA 4RIXA 3R22A 3JY0A 4KABA 5M4UA 2GTMA 3QRJA 5M44A 2W1CA 2YN8A 4XG7A 4II5A 4AZVA 1UU7A 2UVYA 4DH5A 3QTZA 3F6XA 2G1TA 4K0YA 4YHJA 1QL6A 4JG8A 3AC2A 4D5KA 1Q3DA 2XK3A 4TPTA 5CSPA 4MNEA 1OIYA 4HYSA 4IJ9A 4WSYA 4Y85A 2ESMA 3SX9A 4PMSA 1IRKA 2Z7LA 3MJ2A 3CCNA 2C0IA 4CNHA 1K3AA 3C51A 3EQCA 5BVEA 5K5XA 3F5XA 4GJ3A 2ITNA 4HGEA 3Q9WA 4NKAA 2J0LA 2O64A 3POZA 2ACXA 4QYHA 5J87A 3RI1A 5FDPA 2QKRA 5J95A 2XS0A 4UALA 2G9XA 3KEXA 5CI6A 5HHWA 3AG9A 4DF3A 5HD7A 2VAGA 4KUJA 4GU9A 5IKWA 2Y0AA 4X3FA 4A7CA 4YGAA 4C2VA 4ID7A 4IXPA 5FXQA 3OUNB 1XBBA 4RSSA 5G1XA 3BYVA 3TIZA 2IZRA 3KMMA 4AZSA 5JGAA 1H25A 3MH2A 4JOAA 5AV3A 3DJ7A 2VGOA 3PJ1A 4FVPA 4L9IA 4BGHA 4FA2A 3R7YA 3U51A 1WVYA 4X21A 3DS6A 2RL5A 3NX8A 3F3UA 3OD6X 4GUBA 4YZNA 4KIKA 4WA9A 3RMFA 4BDFA 4ZZNA 5E8WA 4QYFA 4S34A 5F4NA 2PVJA 3ZCLA 4BBMA 2XM9A 2DQ7X 5E8ZA 2YJSA 3NYVA 3KFAA 2W1FA 3ZBXA 3U87A 4C8BA 4CGAA 3VBVA 4TYEA 2Q0NA 2V5QA 1H07A 2C6DA 3TZ7A 4IM0A 1PJKA 2WMSA 3F82A 3AQVA 4KNBA 1JSTA 1WVWA 1H1QA 2WQNA 3PXZA 5HOAA 4ACHA 5M57A 3DXQA 3DXPA 3QYWA 4ORKA 1OIUA 4ZZOA 3COKA 3BV3A 4IFGA 5BUJA 5IA3A 2OH0E 4GCJA 2VTHA 3MVJA 2QI8A 2CKOA 3K54A 5D11A 3DAEA 4HVDA 3KXGA 2YITA 4OR5A 4C2WA 4H3PA 5L8KA 3GBZA 2B1PA 2YABA 3RGFA 2A4LA 4O7ZA 4G6LA 3V5JA 4BI1A 1KOAA 5TR6A 3D83A 5K0XA 3UOLA 1F0QA 4YTFA 4NH1A 2W06A 2O0UA 2OF4A 4FIHA 1HCLA 3FMLA 4I3ZA 1OZ1A 1XHAA 2FB8A 3SC1A 3JUHA 3D7ZA 5DBXA 4E6AA 4UMTA 3CQWA 3R9DA 3BBWA 4ANMA 3FI4A 3UOJA 4CZTA 4S2ZA 2HAKA 1M7NA 1ZYLA 3NYOA 4EH7A 1H0VA 3DOGA 4QYEA 5AR3A 4MWIA 3FHRA 4AWIA 4ENYA 1YXUA 3S95A 1IR3A 4D1ZA 4IBMA 4RJ5A 1FVRA 2JDSA 4MYGA 2BRGA 1ZLTA 4GVJA 4FIEA 3AT2A 1XR1A 3GC7A 5CAQA 3LMHA 5IQGA 4DG2E 1M17A 1JVPP 5IZFA 4D28A 1WBNA 3VQUA 4O86A 3PSDA 4YLJA 3KVWA 4HVGA 4M0YA 3R8MA 2YIQA 3FZ1A 2R2PA 5IQBA 3I7BA 4M67A 4GK3A 3IW5A 3SA0A 1CTPE 4ZJVA 5L3AA 5IEYA 3Q5ZA 5EW3A 5E8YA 5CNNA 3I0QA 5E8UA 5HCZA 3JVRA 4E26A 1YOLA 3VBTA 4PF4A 2JKQA 4XG8A 4UV0A 4XMOA 4C4GA 2LAVA 4J8NA 4EK3A 2BKKA 1Q62A 2XK6A 4C02A 5D10A 5A4QA 2PZRA 3MY1A 3CJFA 5CU4A 2OLCA 2XB7A 2BPMA 1XH7A 2R3RA 3G33A 2PK9A 4R3RA 4RJ3A 3FMKA 3K2LA 3L9MA 4BY9E 3VUTA 2C5YA 4EH6A 3NUNA 3CD8A 4GFGA 1OPKA 5FXSA 4RQVA 2QU6A 2CPKE 4Q2AA 3LPBA 1GZNA 3F69A 3QX2A 3AC8A 3D7TB 5BMMA 3QTWA 2GDOA 1VYWA 3Q6UA 2F2UA 5LMKA 1IA9A 2O63A 2W0JA 4QMUA 4JX7A 3MSSA 5C27A 4CG9A 5CX9A 2WTKC 3EWHA 3SLSA 4M84A 4I41A 4K1BA 4K11A 5HESA 2PULA 4QMSA 2RFEA 4XOZA 5EYMA 3A60A 2R3OA 4BDGA 3HV3A 3L8PA 4KRCA 4BFMA 3GCUA 2QODA 4IAYA 5FTGA 1SM2A 4BKYA 3RNIA 4FEWA 4W4VA 2IW9A 3CTHA 1V0OA 4ZP5A 5JGDA 2UVXA 3ORNA 5LARA 3HDNA 3QKMA 2X9FA 4I1ZA 5K0KA 3TN8A 3UIMA 4CYIA 1JSUA 3V8SA 2G2FA 3I79A 2F7EE 1FINA 2YWVA 4O0WA 4PMPA 5BMSA 2JLDA 2O2UA 5AMNA 3Q96A 2OW3A 2YISA 4XP0A 3U55A 2OSCA 3HLLA 2NRUA 1KE8A 5E8SA 3A7IA 4QD6A 3R83A 3DDQA 3NPCA 2JKOA 1Q5KA 1QMZA 3QQJA 4IW0A 4L3PA 3TNPC 4A06A 1KUTA 3T3UA 2BDWA 2VX1A 3H30A 1WBVA 3OTUA 4H3BA 4CV8A 1SZMA 3F5UA 4EK4A 4DTAA 3UIUA 5DE2A 3RTPA 4JL9A 4RFYA 5IISA 1H26A 3P4KA 5FBNC 3P7CA 4FX3A 5BVDA 4CCUA 3QUEA 4RX8A 3ALNA 5DWRA 2BUJA 4EOSA 4UZHA 4ZSLA 4QTCA 4I20A 3NMUF 3TIYA 4FTIA 4C4JA 4F7NA 5J9YA 4F4PA 4C4IA 1CMKE 5CAUA 3D5WA 3FMDA 3THBA 1PXPA 3ORKA 4RFMA 2VTPA 3R71A 2XJ2A 3D5XA 1Q99A 3OCSA 4BCFA 1BLXA 4JR7A 4MF0A 3DJ5A 2J90A 2R5TA 4FYNA 1NVSA 3ATSA 4RWIA 1YQJA 2PVHA 4EKLA 4BCIA 4F6WA 1ND4A 4E1ZA 2V55A 3G90X 2R3HA 2QR7A 5JH6A 3PXQA 4HOKA 2BIKB 2JDVA 2OFVA 3GVUA 4IMYA 5FEEA 4U7ZA 4X2GA 4CG8A 2VWXA 2HWOA 5AP1A 1PKDA 4YNEA 5ANDA 4EHEA 4BKJA 2QO7A 2VO6A 3BKBA 2WOTA 3UIXA 2BIYA 4GK4A 4FV8A 1A9UA 2JEDA 3PJCA 3G2FA 1FVVA 4M3QA 4LM5A 2IVTA 4HVIA 3A7JA 3QTSA 4XG4A 3KCKA 4FZ6A 1YXVA 2NPQA 3FXXA 4RVKA 5T68A 3SRVA 3SW4A 1IEPA 4E20A 3E8CA 1ZMUA 3UIBA 3UOHA 2SRCA 4PP7A 4H39A 3VUKA 4M69A 4FTUA 2P4IA 3QCSA 5AAFA 4QMLA 1XH8A 2C0OA 4WKQA 3NGAA 4N70A 1G3NA 1MQ4A 3OWPA 3HL7A 1OKYA 4FSZA 1Q3WA 5ETFA 3LOKA 4ZY6A 1LEWA 5AM7A 4QMPA 5HTCA 3CD3A 4NM5A 2KULA 2PVMA 1BL6A 2IZSA 2AC5A 3RHXA 1P2AA 4ZMEA 1P14A 4MH7A 4FKLA 1ZXEA 3F2AA 4ZIMA 5EQPA 4WD5A 3A62A 4YBKA 4NW5A 1F5QA 3DJ6A 4X0MA 4HZRA 2C30A 4RIWB 3VF8A 5EOLA 5M06A 4CFMA 5BYYA 3E87A 4W4XA 3ZC5A 2QO9A 2PMOX 4YP8A 2J0IA 4NTTA 1J7IA 4XV3A 5HG5A 4JXFA 2YM8A 2CKQA 4LL0A 4EOJA 2V7OA 3PWYA 2YFXA 1M2PA 4AA0A 3DBDA 3RP9A 4EK5A 2WMUA 4PQNA 4F70A 4Y8DA 4U6RA 4WG5A 3VS1A 4U81A 4X3JA 3G6GA 3EH9A 5CVFA
chains in the Genus database with same CATH superfamily
4L01A 3SG8A 4GW8A 4O0SA 3EOCA 2XCKA 1TVOA 5J9ZA 5HTIA 4NL0A 4D2PA 4A9SA 3P1AA 4FKWA 4W9WA 3ZO1A 4Z7HA 2WTVA 4FICA 4FTCA 4RBLA 5I9ZA 4JG7A 4NK9A 2VTRA 4Y83A 4BDHA 3NUSA 2ZMDA 3UMWA 2QOBA 3DT1A 5FG8A 3FI3A 4HGSA 4IB3A 1OKZA 4ENXA 3MW1A 3IG7A 3KN5A 3FV8A 4B9DA 3ZS5A 3PP0A 3LCDA 3F61A 3IS5A 2F57A 3QCQA 1J7UA 1GIJA 5EW9A 2QKWB 1FOTA 1PKGA 2ITUA 2RG6A 3WE4A 4DE4A 3FZPA 4G3CA 5AV2A 2YIXA 4FKVA 1RJBA 4QP9A 4DINA 4DT9A 3R00A 2CNQA 3LCSA 4AP7A 2UW0A 4QTAA 2QOIA 1H01A 4RLLA 2RSVA 2YA9A 3DK7A 4PDOA 4DBNA 3P0MA 3EQBA 5DLSA 4AN3A 1YHVA 1YDTE 2UUEA 2X0PA 4IVDA 3CPBA 2UW3A 3MDYA 3NNXA 4OUCA 5CVHA 4BKZA 5HVKA 4DFZE 4AW2A 1WBOA 3UO5A 3EN5A 4JBVA 4MWHA 2YDKA 2I7QA 4YZ9A 4FL2A 2PTKA 4JI9A 4BJJA 5HE2A 4L67A 4EHZA 3ORTA 2R3KA 1YXTA 3OXTA 5C03A 4QPAA 2RKUA 3I6UA 2ZB1A 4DAWA 5KMOA 4C3FA 2PUUA 4O81A 3GCSA 4ZLZA 3GU5A 3ZU7A 1B6CB 1H28A 2OXDA 3EHAA 3QKLA 4DG0E 4UN0C 3ERKA 4L43A 5FLFA 3TNWA 4TXCA 1ERKA 5E8TA 3HRCA 5L2TA 4O2ZA 2IW6A 1S9IA 1ZY5A 2W99B 1W8CA 3NFFB 4QP4A 2OK1A 2IO6A 3KMWA 2F2CB 3LFAA 4RPVA 2HY81 4J97A 5EK7A 3TDWA 2R3MA 4PL3A 3RHKA 2X0OA 5AX9A 4BN1A 2G15A 3LM5A 5AA8A 3IOPA 2C47A 3CXWA 3HVCA 5AP0A 4MUQA 2G2IA 5JQ8A 4RLKA 4MXZA 4RA5A 4HCTA 4C7TA 4D4SA 4DFXE 5HIEA 4IDTA 3MFUA 3HRFA 2C5NA 4QP8A 1WFCA 1Z5MA 3HA8A 4OTFA 4EOLA 4WT6A 4RT7A 4NCTC 2QOKA 5AUZA 5IH5A 1KE9A 2IVSA 3QQFA 3QC4A 5C8KA 1NVQA 3H0YA 2YM6A 3PG1A 3PJ2A 4CQGA 4YPSA 5HQ0A 1BKXA 3FYKX 2B9FA 2CLXA 4MBLA 4AAYA 3TL8A 5K5NA 4F1OA 5HVYA 4XV9A 3PG3A 2WMWA 4BRXA 3I81A 5AIKA 3UJGA 1UNLA 3DLZA 3VVHA 4N57A 1ZMVA 4FKPA 4JBQA 3O8UA 2E2BA 3K3JA 3QWJA 4ARKA 3Q4TA 1Q8UA 2VV9A 3FMJA 3EKKA 4YPDA 5E91A 4ASXA 4NW6A 3KK9A 3R9RA 3ZFXA 2VTTA 2UZNA 3CGFA 3C50A 3W2RA 5CALA 2BRMA 4FV9A 3FI2A 4ERWA 3W2QA 2W9FB 4X6QC 4PDYA 3BHTA 2EXEA 5LOHA 5AADA 2JBOA 3R7IA 3VONA 4JAIA 2W5BA 4HCVA 3ZZEA 2OH4A 4IX3A 2YACA 3EFWA 3ORPA 4KRDA 4M13A 4FEVA 4AACA 3QXPA 5HO6A 4H58A 4FSMA 5IA5A 4F7SA 5EYDA 4IZAA 3R8PA 4QMQA 1ZOHA 4IC7A 3E64A 1OPLA 2J0KA 2A27A 3PVWA 4I22A 4DCEA 3A4PA 5IH6A 3LE6A 5EDRA 4BWXA 2C6KA 2YIRA 5A14A 4KIOA 4O96A 3FY0A 4R5YA 3U8WA 1NA7A 4GIIA 3FZSA 3NAXA 2VX3A 4V01A 4MNFA 3I5NA 2W1EA 3NIEA 3QRTA 2EUFB 3QD3A 4NT4A 3FLNC 4QEBA 4O91A 4RC4A 4PUZA 1YRPA 4Y95A 3PA5A 1DS5A 3H0ZA 1WAKA 2F49A 3R73A 4FV7A 3AGLA 4O4CA 4G31A 4OW8A 4G1WA 3VJOA 3BLAA 3PUFC 4C36A 4R1YA 2VTSA 3W0QA 3BLHA 4M14A 5DRBA 3UQCA 2J0JA 5EQEA 4Y46A 1UNHA 2GNLA 1H00A 4R8QA 3NEWA 2XJ1A 3QCYA 4LI5A 4U40A 3RK7A 1UWJA 4QMNA 2VTQA 4FSWA 2QG7A 2C6LA 4JMQA 3COHA 3W2PA 4FUXA 2OXYA 5GIPE 4L68A 4RIYA 4NSTA 2I0YA 4TNBA 5EM7A 3JS2A 3NZ0A 3TV6A 4ALVA 4TRLA 4ZSGA 5I9UA 3ORZA 3RZBA 2PZPA 3LFBA 4LMUA 4V05A 5J1VA 1PYXA 2WIHA 4M68A 3QQGA 5IUIA 4EZ5A 5KX8A 5DH3A 4CYJA 1LUFA 3KL8A 5KKRC 5HG8A 2BZJA 2A0CX 3UOKA 3RVGA 3AC3A 3EB0A 3KRLA 1OBGA 2VWIA 5HI2A 2DYLA 4LRKA 3DV3A 4AXEA 2XNOA 3C4WA 5HZNA 2REIA 4RMZA 3MESA 3LCKA 4IH8A 1GZ8A 1TQMA 3HX4A 3EJ1A 4TKSA 4TT7A 2GPHA 3MTFA 4I92A 3RPRA 5K9IA 2WTCA 3B2TA 4RGJA 3QKKA 1FGKA 3OROA 3ACKA 3HMMA 4RX7A 1K2PA 1VYZA 3OHTA 4APCA 4E93A 3BHUA 2IZTA 3OEFX 4BI2A 2DS1A 2OJGA 4GU6A 3IO7A 2IVVA 3PIXA 3UPXA 4O22A 5JFXA 1PXLA 4HYHA 2I1MA 1W7HA 2B4SB 4R6VA 3P79A 4C59A 4DT8A 3G9LX 2NYAA 1TZDA 1PHKA 4EWQA 2AQXA 4G16A 3HAVA 5CTPA 3C13A 5K4IA 5GINE 1KV2A 1UA2A 3NUYA 1JAMA 4RRVA 3A7FA 3FSKA 4O7LA 3LFSA 3KIOC 2XCHA 4ACGA 1WBSA 4NM0A 1GY3A 4MXXA 4BBFA 1XMLA 3QGYA 1BI7A 4AW0A 2XKCA 4EK8A 3N4UA 3EYHA 2BFYA 2ZV9A 4AN9A 3H9FA 2UW8A 3GFEA 5JKGA 4EYJA 4PY1A 3P5KA 5B2MA 3WBLA 4P4CA 4I6HA 4DEIA 4XCUA 2Z60A 4A07A 4XG6A 5E1EA 4EEVA 3LLAA 1M2RA 3P7AA 4QPMA 2C6OA 2PE2A 4DFNA 4O0RA 3NUPA 3FWQA 4ITIA 3PFYA 5AM6A 1W82A 2YM7A 2H6DA 3QRUA 4FTQA 4UMPA 3ETAA 3JYAA 4BB4A 2Y6OA 3AXWA 4BCNA 3FMEA 3ZUVA 3D5UA 3KULB 2CLQA 3PVUA 4YZCA 2XAMA 4ZXTA 3QBNA 1ZYCA 4QRCA 5H3QA 3ALOA 2Y6MA 3A7HA 5H8BA 4AE6A 3ZLSA 4FSUA 4OTPA 3GU7A 3D0EA 1M2QA 3OWJA 4WNMA 3VNTA 4E5WA 4BIDA 3FQHA 3VC4A 4DH1A 4ZZMA 4MVFA 3FPQA 4F6UA 4AX8A 4EH3A 3KGAA 2XK7A 1O9UA 4OTQA 5JRSA 4D9UA 3U6JA 3FL4A 4APPA 1J1BA 3O7LB 3HV7A 4QOXA 5D9HA 3DBQA 2H34A 3PJ3A 4QTBA 4A4LA 2GSFA 3FL5A 4JQ8A 3R7UA 2YCRA 4AU8A 5FP6A 3LXLA 4D2RA 5HORA 4YMJA 5IU2A 3LKMA 3PPZA 4FTAA 4FT3A 3PY1A 2XRWA 3GENA 3V8WA 5AV1A 2R3FA 4XOYA 2C3IB 4IX4A 3DGKA 3OW4A 3UMXA 1GNGA 4KIQA 4LGGA 2QCSA 3LXPA 4M15A 4DC2A 5KKRB 2ZJWA 3MWUA 2I6LA 4AG8A 5J9LA 4XLIA 4D2TA 4XP3A 4UZDA 5BPYA 4LMNA 3O71A 4BC6A 4D4VA 4F09A 3T9IA 2P55A 2R3PA 3CQUA 3M2WA 4DTBA 4JDIA 4DEDA 3QL8A 4F1TA 5K4JA 3ZM9A 4RVLA 5AP6A 3GT8A 1R78A 1YDSE 3HUBA 4FL3A 4AA5A 1Q8YA 4G6NA 4K9YA 5M07A 1V1KA 3L9PA 4RWLA 3W8QA 2W5AA 3EQRA 5EI6A 1OUKA 2XP2A 3MB7A 3MY0A 3O50A 4NIFB 3KC3A 4XH6A 3VBQA 3MS9A 4BZOA 4W4WA 2XARA 4CKIA 3HNGA 4LUDA 2I0HA 1U54B 4USEA 3OZ6A 4FIJA 1PMUA 5FUTA 5ANOA 4JBPA 4E8AA 5J7HA 2FYSA 2R64A 4JAJA 4DGNA 4HPUE 4EKKA 1A48A 4A4OA 3O17A 3QU0A 4O7VA 1OPJA 4FEXA 5BQ0A 4PNKA 4IVAA 2IJMA 3MVHA 4MAOA 3WI6A 3F2RA 3RINA 3NWWA 3PY0A 1W0XC 3NDMA 3MGYA 4EZ7A 3T9TA 4AUAA 2EB3A 4FNXA 4C4FA 1ATPE 1RDQE 1XBCA 3ZSGA 2J51A 3D9VA 5D41A 5TO8A 4EYMA 2GHMA 3EQFA 3VRZA 3BYUA 1YVJA 4S33A 3WIGA 3S00A 4FV5A 3HEGA 4NUSA 4ZSJA 5TE0A 3D14A 3QQKA 2E9OA 3DNDA 4E73A 3C4XA 3CBLA 3LFCA 5I3OA 2VGPA 4GEOA 2WQBA 3FE3A 3Q52A 1L8TA 1KWPA 4FTTA 4C61A 3RWQA 5LWNA 4GV1A 2CCHA 3PDTA 3FLYA 2NNWB 1UU8A 4PDPA 2GCDA 5F20A 5F95A 5DA3A 4NWMA 3TKUA 5KBQA 3E7OA 4ZSEA 4ZOGA 3GFWA 3FDNA 5HIDA 4F64A 2R9SA 4IM3A 5ANGA 3NW7A 3FLWA 3OFMA 2HZ0A 4L42A 1PW2A 5AR8A 3E7VA 4L46A 1E1VA 1ZRZA 3UZRA 5IG1A 4D4RA 3ZEPA 3G15A 3A8WA 3LJ1A 3L8VA 3RPVA 4KKGA 4PPAA 5D12A 3VUIA 4E7WA 4NKSA 3QA0A 4FIGA 3BLRA 4YJRA 3NR9A 4WG3A 2GHGA 2QLUA 3DBFA 3FSFA 3ACJA 4FZ7A 3R7EA 5GJDA 5ETAA 2A19B 1UVRA 3KB7A 4U41A 3UDBA 3VULA 4CTCA 1TFFA 3QZIA 2VUWA 4F0FA 3UC3A 4QT1A 4QP3A 1BYGA 3I4BA 4DN5A 4F63A 2PYWA 4O0UA 5J5SA 4JLCA 4DEGA 2QHMA 2ZDTA 3RAHA 3U6HA 4IDVA 4L00A 4WRGA 4DGOA 3OCBA 4F0GA 3DB8A 3QZFA 3CS9A 4Z9LA 4PTCA 2VRXA 4TTHB 4YTIA 3FHIA 2PVYA 5B7VA 4ANBA 4FGBA 3V01A 4C58A 2BHEA 5DEYA 4KA3A 5LMAA 3VF9A 1DI9A 3UE4A 3VW6A 4EBWA 3FQEA 2WGJA 4LOPA 5LVPA 5IMXA 4IEBA 1ZY4A 2C6MA 2Y7JA 3BHYA 4AOTA 4C4HA 1XH9A 4CZYB 2BTRA 4AXDA 3TDVA 2WMQA 4KS7A 5C4LA 2EXMA 4HGTA 5IA4A 4O1PA 1IA8A 2PE0A 4IWPA 4LOQA 3VRYA 4MXYA 4V0GA 3TV4A 2YAKA 5EI8A 3R2BA 4YJTA 5EOBA 3VHEA 3CJGA 3GGFA 1AD5A 4DFLA 4BCOA 5BV3A 4I6BA 4PMTA 5L2IA 4AE9A 5HLPA 4BZDA 5CSXA 1GJOA 3QLGA 4FV3A 3Q2JA 4DLIA 3W32A 4AS0A 2QOFA 4LV8A 5L2SA 3AD5A 4A9UA 4GT5A 4ALWA 3CR0A 4IM2A 4JVGA 4MKCA 4LOOA 2PHKA 4QQ5A 3U9NA 3R8LA 3S2PA 3VHKA 3DLSA 5GZ8A 2RFSA 5EHLA 4BWPA 2CMWA 4P90A 3TYKA 3V6SA 2OFUA 2RFDA 2YDIA 3IQ7A 4MF1A 4IZ5A 5I9WA 3DZQA 3UPZA 2JAMA 2IWIA 1T46A 2ITWA 1JKKA 5IMEA 2C5OA 4I6FA 4MD8E 4BDDA 3P23A 2BTSA 2VO0A 2H8HA 5DMZA 4YJQA 2XYNA 3VQHA 2J4ZA 2R3LA 3G5DA 4N0SA 5D7VA 3V3VA 4QTEA 1PY5A 2Q0BA 2X0GA 2X7OA 2JDOA 3NNWA 5EM8A 4YTCA 5CAPA 3N4VA 2ONLC 2R0IA 3NNVA 2XNBA 3K5UA 4Y72A 4FTLA 5FP5A 4YHFA 3QD2B 3QRIA 5CANA 1ZYDA 2V62A 4Z3VA 4HYUA 3BZ3A 3C0IA 3ZEWA 2NO3A 1M52A 3GXLA 5C1QB 3DFAA 4MD9E 1Q41A 3QTQA 5LMBA 2OZAA 4R5SA 2P2IA 3ROCA 3BIZA 1L3RE 3MFSA 4FL1A 4FE2A 3G9NA 4F0IA 2VTLA 4NEUA 3AC1A 3PPJA 2PVFA 4K2RA 5HLWA 2X7FA 4M7IA 2I0VA 3PE1A 3L9LA 5L6OA 2BFXA 3MB6A 4EQUA 2XZSA 1PXMA 2VTOA 2CGWA 2EWAA 2ITOA 2XK9A 4IE9A 2GS6A 4TWNA 5H9BA 4EL9A 5LCKA 4MQ2A 3RM6A 2P0CA 3TTJA 4O7NA 4B8MA 5CEOA 3RM7A 1W2DA 3DBCA 3NUXA 4AT5A 4EH5A 3U54A 4YJVA 3HUCA 3ZTXA 4CFUA 3DA6A 3LJ2A 5M56A 3C0GA 3JVSA 3L8SA 3WYXA 1QPDA 3R7GA 2QONA 4EOQA 3FXWA 4BTMA 4TW9A 2QHNA 4EOPA 3BRBA 3POOA 4IVBA 4FT9A 4K18A 4D1SA 3EZVA 4DGGA 1PXIA 1UU9A 2C0TA 2C4GA 5CEPA 4TYHA 3N9XA 3DBEA 3KXZA 5A4TA 4IJPA 2VWZA 2W4JA 3B8RA 5HO8A 2PL0A 5C8NA 3TUDA 4D55A 2PUNA 2H9VA 2WMRA 4U97A 3TT0A 3C0HA 3QD4A 4FSQA 3LVPA 4YTHA 4FEUA 2GFSA 3DAKA 5ETCA 4MBIA 3QALE 4BCJA 2W1GA 4OTWA 2YCQA 3CQEA 3DKOA 4FKGA 4BIEA 4D5HA 4KINA 3BQRA 4BI0A 2ITVA 4EHVA 3O51A 3PXYA 4PV0A 4L45A 4OT6A 4PTGA 5KMIA 3E62A 3P5JC 2CCIA 2ITXA 4AT4A 4Z16A 5FM3A 1GIIA 4FIFA 2Q83A 2JIVA 4L44A 2ZFYA 3Q5IA 3TNHA 4USDA 4QDVA 4FNYA 3F5PA 3PP1A 2NRYA 3VIDA 2HENA 3KCFA 3PSBA 2X7GA 3CGOA 5CNOA 3W2SA 3FKLA 2GQGA 4B99A 3A4OX 4IB0A 1H1WA 3ID6C 4B4LA 1VR2A 4O7YA 4QMWA 3VN9A 5HTBA 5IQFA 3OUKA 3W8LA 3R8ZA 5LVOA 1J7LA 4FKJA 4JT3A 2FSMX 3UO4A 3VBYA 3VS2A 4C33A 4ZAUA 3S1HA 2C6TA 2OKRA 3NCGA 5LVMA 3NFGB 4U42A 3O7LD 4U8ZA 5BYZA 3GQIA 4ZTNA 3RNYA 4PDSA 4C4EA 5HNIX 4N6ZA 3ENMA 3KVXA 2RG5A 1H1SA 1EH4A 1NVRA 3MI9A 4NJDA 5KHWA 4L8MA 4Q5HA 2YEXA 2WTWA 4ZTLA 2Z02A 4OAUC 2RIOA 2OGVA 3F3VA 3BGZA 3E8NA 1FPUA 1GZKA 3PE2A 4CMUA 4TYJA 5AUUA 2VD5A 5J5TA 2I0EA 2C3KA 3OCGA 4ASEA 4G9RA 2WQOA 4JIAA 3OT3A 2PUPA 4W8EA 2A1AB 2OWBA 1OITA 4A4XA 3OOMA 5CEIA 3QTIA 5EQYA 4RIYB 5M09A 3BX5A 4FR4A 4YHTA 4F9WA 4H3QA 4IACA 3R01A 3WF8A 2B7AA 1BL7A 2QOQA 3MPMA 4FTKA 5C9CA 4CMTA 4CQEA 5GHVA 3UQGA 2WMBA 4RG0A 4JDJA 2GQSA 3KF4A 4IX5A 4FOCA 2F4JA 4U3ZA 3O96A 3AKJA 3EN9A 3BYSA 4E6QA 4O27B 1G8SA 3FYJX 5IA1A 3PWDA 4EUTA 4ASDA 4FYOA 2J5FA 3OBJA 5KBRA 5C8MA 4RVTA 1FQ1B 2ITQA 1J91A 2HW6A 3ZLWA 4TYIA 4I93A 2YZAA 4BCMA 4R7HA 4DEHA 4QMVA 4AGUA 3QAME 1G5SA 1Y8GA 2VWBA 3I0OA 5EI2A 3LAUA 5HCXA 3W10A 2W1ZA 4FEQA 4RJ7A 4AF3A 4F7JA 3TCPA 5L8LA 1TKIA 2PMLX 3II5A 4L6QA 4QP2A 4NU1A 3RZFA 3HYHA 2EVAA 4RJ4A 3ZM4A 4C34A 4YJUA 5ANEA 4DHFA 2WTDA 2J7TA 3W18A 1W2FA 2ZOQA 3ZBFA 3C4CA 3R04A 4BHNA 2O3PA 4TZRA 3IW7A 5DHJA 4CV9A 4OTRA 3ULZA 4BR3A 2XNMA 3U6IA 1XH4A 5CSHA 4UWYA 5AR5A 3RCJA 3VS3A 4U44A 3Q3BA 3UZPA 4BYIA 1KE6A 3IPHA 3TMOA 3REPA 4W9XA 5E92A 3OY1A 4O83A 2BAKA 3EQDA 5IA0A 5M53A 3WZEA 2X8EA 4UWBA 4OTHA 4DH8A 2P3GX 3E8DA 4FKSA 1H0WA 3M42A 3JXWA 4EOKA 5AUWA 4U79A 4LV5A 1BX6A 2ZV2A 4BCPA 3FI8A 4BDAA 4KKEA 2BZHB 2B54A 3ZHPC 4IWDA 3OF0A 4M12A 5CWZA 3SOAA 1I44A 3R7VA 3V8TA 1ZZ2A 3I1AA 3QZHA 3TV7A 3V6RA 5HX8A 5IUHA 2JIIA 4RVMA 5H2UA 3VUHA 4R78A 1JKTA 4IIRA 5DN3A 4ANLA 5M4CA 1YDRE 1PMNA 3NAYA 4G6OA 4AGWA 2HIWA 4YR8A 4AZEA 2VTMA 3D7TA 3DCVA 2O8YA 2X4FA 1YW2A 3R1NA 1OMWA 3EIDA 1P4FA 1ZWSA 2W7XA 3V5LA 4FC0A 4HYIA 1F3MC 3DU8A 4FSRA 3NUUA 5DT3A 3CSVA 2OICA 3UNKA 4FKUA 1YXXA 3W1FA 3BU6A 5AP2A 4DITA 4I5HA 4FSYA 5AR4A 1NT2A 3MIYA 4TWOA 4IAIA 3AT3A 3AC4A 3E93A 4BTKA 5IUGA 3E63A 3LCOA 4WOVA 4S32A 2VTJA 4XX9A 3A61A 3HA6A 3BE2A 3P9JA 4O84A 2F7ZE 4C35A 4CVAA 4TL0A 1Q8ZA 4FT5A 5JZNA 3AKKA 2YM4A 3ELJA 3PY3A 3WF9A 5CY3A 1GZOA 1QPEA 2OI4X 3AMYA 5TOZA 4PL5A 5E7RA 2HZ4A 3LJ0A 2J9MA 4QYYA 5M51A 1U5QA 2X2LA 3MJ1A 2IW8A 3BYOA 2VTNA 4GKIA 2KTYA 1XQZA 3M1SA 5JGBA 4FT0A 4YURA 3BU3A 2CGVA 4RIXB 2BRBA 2XNPA 4FRFA 2X6DA 3O2MA 3R9NA 4F9BA 4ZTMA 5BX0A 3HGKA 2PVLA 1OKVA 1NY3A 1ZOEA 4CXAA 3BGPA 3LLTA 1VLRA 5CXZA 5CSWA 5AAGA 1V0PA 2X2MA 3CIKA 5IDNA 3PIYA 4MNEB 5HKMA 2XRUA 4D0XA 3GCQA 1PYEA 3EQHA 2J0MB 3BYMA 3I7CA 3F9NA 1OIRA 4D2VA 2YCSA 3OXIA 4YC6A 4EORA 5J79A 1OL6A 3UNJA 4IAFA 3ZONA 3VS6A 4BDIA 4LUEA 4ZMFA 3G51A 4ITJA 5AUXA 1JLUE 2UW4A 3CC6A 3GOKA 3KN6A 5CAVA 4MD7E 4DLJA 4X3FB 2XIRA 4WO5A 3D2KA 4G5PA 4M8TA 4QDEA 2ZYBA 3NW5A 3R8VA 1YWNA 2XH5A 4OTGA 5BUIA 3FPMA 1LP4A 2EB2A 2JKKA 2FSTX 4UX9A 2O5KA 2WMXA 1V0BA 4MCVA 5BVOA 1PXOA 3W2CA 5E4HA 2J5EA 1B39A 3RAKA 5EHOA 2UW5A 3SDJA 4XG3A 3IK3A 2B9HA 3Q4UA 5A54A 2XF0A 4MXAA 5LMKC 4DGLC 3VUGA 1REJA 3RALA 4KIKB 4AT3A 1APME 2VNWA 4BICA 5HU9A 2FO0A 3AGMA 1A06A 1ZZLA 4OLIA 1U4DA 3BL7A 2VO7A 2XKEA 5EYKA 3W55A 4BWKA 4CT2A 3MY5A 5AUYA 2QD9A 3NSZA 1CKIA 2BALA 4XEYA 2PU8A 1YOMA 3ORIA 3UG1A 4AW1A 5CAOA 3CKWA 3CLYA 4FV6A 2UW6A 2QOOA 3HMOA 4B0GA 2BDFA 4TWPA 5DR2A 4FTJA 4FKQA 3R7OA 1JBPE 4QMOA 3S3IA 2VTAA 4TY1A 4BGQA 4E5AX 3TUBA 3MTLA 1OL5A 3OWLA 2Z8CA 4TNDA 3KRWA 3UYTA 5AP3A 4W8DA 3TZ9A 1VZOA 4K8AA 3F66A 5FBOA 3FY2A 3DDPA 3ZDIA 4O7WA 4LL5A 2WD1A 5G6VA 2BAQA 3GEQA 4G2FA 3UTOA 4DFBA 4PMMA 3RKBA 3D4QA 2BR1A 2IN6A 4E4XA 3RWPA 1MRVA 4L52A 2YLEA 4WBOA 3C4ZA 4YSMA 4XG2A 3MIAA 3TZMA 3OCTA 3E3BX 4JIKA 4PX6A 2IG7A 3E8EA 2PZIA 2ONLA 2B9IA 3BEAA 4J52A 4J99A 3WOWA 4LGDA 5AV4A 4NTSA 3SQQA 2ITZA 2UZWE 4NFNA 4I0TA 4YJPA 4OBPA 1P5EA 3C9WA 1REKA 1WBPA 3SXFA 3R30A 1FMKA 2C6IA 3D5VA 4RIWA 2XYUA 5CU0A 5AP7A 4H05A 4GT4A 5FQDC 1ZOGA 4ACMA 5I9XA 5JRQA 4O7RA 2ZM1A 4HVSA 5JZJA 5CS6A 3PTGA 3TZ8A 3LCTA 4WSQA 4FKTA 3EQPA 3MH0A 4GL9A 2WQEA 5A6OA 4L7SA 4O1OA 2FH9A 4MQ1A 2C5XA 3HDMA 5AX3A 5LVNA 3Q53A 3A7GA 3SHEA 5EDPA 1CDKA 3GB2A 3C5IA 2OF2A 4F9AA 4FF8A 5AAEA 5B0XA 4I24A 3PA3A 5CT0A 1P4OA 3P08A 3QTXA 3P7BA 5BVKA 3UP2A 3SKCA 5ICPA 3BLQA 4UB7A 4F78A 4FG7A 2CGUA 3W33A 4I4EA 3TTIA 2VWUA 2JFLA 3QC9A 4XV2A 5LQFA 4MXOA 2R3QA 3DXNA 3UO6A 5I5ZA 2UV2A 2OO8X 2ZM4A 3PFQA 2ETMA 5E8XA 4ANNA 5FGKA 1HOWA 1E1XA 2Z7RA 3KXNA 4TN6A 3BV2A 3TJCA 5EG3A 5JFVA 3QX4A 4TYGA 2Y4IB 5AP4A 2GNFA 4H36A 4CT1A 1UKHA 3QRKA 3MH1A 2FUMA 3KU2A 5F94A 4C38A 4XLVA 2PVRA 5KNJA 3WZKA 2XBAA 4QMXA 3WZUA 4F9YA 4Z55A 1Z57A 3KREA 1YWRA 2NP8A 5HCYA 4GRBA 1YXSA 2YCFA 4R3CA 4OBOA 3WE8A 2E9PA 1Q4LA 4FKIA 4G3FA 3U9CA 2XK8A 2VWVA 4JDKA 2B52A 4YZDA 5HO7A 3N4TA 1J1CA 2G2HA 4ZEGA 1ST0A 4I5PA 1YHSA 1R3CA 3EFJA 4XRJA 1W83A 2WHBA 4WNOA 4RWJA 4EBVA 3QTRA 4R3PA 3LW0A 2E9VA 3IW4A 1H8FA 4BTJA 4RZWA 2GTNA 4E4MA 3RPSA 4ANSA 2H96A 2ITYA 5FD2A 3MA3A 4XS2A 4OTIA 3OMVA 4YLLA 4BHZA 3NCZA 2QOHA 4D0WA 3R0TA 2YIYA 4CLIA 1LPUA 3LM0A 3E5AA 3E92A 3LQ8A 1OM1A 4E4LA 5HD4A 2R3NA 4WHZA 5CZIA 3KA0A 3ANQA 3OG7A 4QPSA 5EYCA 4AGDA 4ZSAA 4JRNA 5I4NA 5D7AA 4EH2A 4WBBB 1FMOE 3L8XA 4XNEA 4G3GA 4ONAA 3OW3A 5A4LA 2YERA 3PIZA 2WU6A 2JKMA 4BDCA 3T3VA 4Z7GA 4B6LA 4QNAA 3BWFA 3QXOA 5LCJA 4BCHA 3ET7A 4BYJA 2XMYA 3EN6A 4QMTA 4UMQA 3KXHA 3QF9A 3PLAE 5IQAA 5F9EA 3UBDA 3UVRA 4I0SA 4RX9A 3UNZA 4J7BA 4TYHB 1Q61A 5IF1A 3R8UA 2GS7A 5J1WA 2QG5A 4G3DA 4E6CA 3MN3A 2R4BA 1VJYA 2WTIA 3ITZA 4ZJJA 3NRMA 4EH4A 3NYXA 4ZS4A 4C0TA 4FG8A 3E88A 2XK4A 5AV0A 2XNGA 3FKOA 3LFFA 2F9GA 3W0NA 4FV0A 4JS8A 3C4FA 4C3PA 3GNIB 5TKDA 4CKJA 4RA4A 2X9EA <