3EQPA

Crystal structure of ack1 with compound t95
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
274
structure length
268
Chain Sequence
LTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activated CDC42 kinase 1
publication title Identification and optimization of N3,N6-diaryl-1H-pyrazolo[3,4-d]pyrimidine-3,6-diamines as a novel class of ACK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 268
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3eqpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3eqpA01
5M4FA 2VTHA 4ASEA 3AT4A 4IVAA 1Y57A 3TTIA 1AGWA 4B8LA 4Q5EA 1SM2A 5F4NA 3PUPA 4PTCA 3PY0A 4C4JA 5FDPA 5I9VA 3PLAE 1ZYJA 4BIDA 3GT8A 3O7LB 4EYJA 1IEPA 3EQDA 4K8AA 1Y6AA 2WEVA 1NA7A 3W32A 4W9XA 2IPXA 3KRRA 4ANMA 3DXPA 5M44A 4XV1A 4F9CA 4XCUA 3MH0A 4AGDA 3C4WA 4QP6A 4DG3E 4CZTA 3GFEA 2NRUA 2R3JA 3F5UA 2UV2A 3UIMA 2ITTA 2CPKE 2BDJA 4GUBA 4QTBA 4LRJA 2ZYBA 4U41A 4JG7A 2I0EA 3DBCA 1WCCA 2X9EA 5AR4A 4EH3A 4IC8A 2HELA 4NM7A 3EN5A 3NUAA 5EDRA 2I40A 2C6DA 2BAKA 5J9LA 3OUNB 3P79A 3SLSA 2IW8A 4O7SA 2BZJA 2W4JA 4CVAA 2CGVA 4A9UA 5GZAA 2WAJA 5BUJA 3L9LA 3AC4A 4OW8A 4EOQA 2OW3A 4O7VA 4EHEA 3CQWA 4CKJA 3LE6A 5JFSA 2C0IA 3S2PA 3ORIA 2C6LA 4G5PA 3PA4A 4DBNA 4FL3A 1VR2A 2W1ZA 4CG9A 1QPDA 1KWPA 3QD3A 4IADA 1VYZA 1OUKA 3NUYA 3RGFA 3HAVA 3A7IA 3UZPA 5FXQA 2HWOA 2R5TA 1ZYCA 2RG5A 5BPYA 5DE2A 4HGSA 2E9PA 4IAKA 5I5ZA 3UQFA 4CD0A 1Y6BA 4RIYA 2ZV7A 4L46A 2BKZA 2HYYA 2W1DA 1U54A 3ZSGA 2XNNA 3R9HA 4RWLA 4A06A 2IO6A 5HLPA 3MA6A 3OTUA 3MFUA 2PULA 4HGLA 3CGOA 3LMIA 2CLXA 3R1QA 4Q5HA 3Q96A 4G34A 3MIYA 4L52A 1OL2A 5AR7A 1XO2B 4FIFA 3NPCA 4I6HA 4PY1A 4E6QA 4EH4A 3B8RA 4FSZA 4UWBA 1OPLA 5IH6A 3P0MA 4QMOA 4R7HA 4QQTA 2YZLA 2W1CA 4AFJA 3LQ8A 3HMPA 3P5KA 5CWZA 2FYSA 3HMIA 4PPBA 3DXNA 2BR1A 3GQLA 5KE0A 4E5AX 5CEMA 3PA5A 1RJBA 3LPBA 4JQEA 3EFWA 3PVWA 5HU9A 5JFXA 2Z7QA 3W18A 4HVSA 3E3PA 5HORA 5A9UA 4GIIA 5HVKA 4V0GB 3ZUUA 3LLTA 3LQ5A 2BKKA 4J97A 1YHSA 3NVKI 3H9RA 1BI7A 4W4YA 4M97A 4R3CA 3VVHA 2XA4A 3P7BA 4AW1A 5IUIA 3VWAA 4RWKA 3RPVA 2WTCA 3C51A 2GNIA 4JIAA 2H8HA 3T9TA 3UZTA 1JSVA 2C1AA 3E8EA 3H9OA 2V0DA 4GT5A 3UC4A 4BHZA 5KMIA 3DBFA 4S32A 2R0IA 2W1EA 1MRUA 4D58A 3PVBA 3NNWA 2GNJA 4BDEA 4NM3A 4YU2A 3R8VA 2W1HA 4AGCA 4MCVA 4XP3A 4BY9E 5I9XA 4IB1A 3FMJA 2JDSA 2FGIA 3UNZA 5KCVA 4B7TA 1CM8A 2R3MA 3MA3A 1YWRA 2QOHA 2PVHA 5M4UA 1JSUA 2BRGA 2UVXA 3EWHA 4J53A 2NP8A 3D83A 3EN7A 3LFBA 4GJ3A 5HCXA 5BYZA 3TZMA 5HTCA 3CS9A 3O2MA 5I3RA 3IOKA 2X7OA 4FI1A 1Q8TA 3TDVA 4ZMFA 4HZRA 2ITVA 4XJ0A 4JL9A 1QMZA 3QRTA 4ZOGA 3LJ2A 2OJGA 5AV1A 3AC2A 3BHYA 2HOGA 4KIOA 4X3FC 2JD5A 4G6NA 2CGXA 3PSCA 4RX9A 3O96A 4XG7A 4KS7A 4L43A 1MRVA 4ASXA 5FGKA 5B2MA 5J9YA 4MWHA 4QPMA 3ZUVA 5BVEA 1MRYA 3FLSA 3DJ5A 2CN8A 4ITIA 2YM8A 3G0EA 4DH8A 3TKUA 4CXAA 3FEGA 2PVKA 3QYZA 5EHOA 3NVMB 4M69A 4QYYA 2J5EA 4AT5A 5AP0A 3BCEA 4XBUA 3ZEWA 3ZONA 2BRNA 3TNHA 4DTKA 3DPKA 4PMSA 1JWHA 5IA5A 5TE0A 3HKOA 3BELA 3FI3A 3LXLA 4JDKA 2GHLA 4S2ZA 4EOJA 3UQGA 2VU3A 2ITYA 1NW1A 3PSBA 4CYIA 4B99A 4EH5A 3R04A 5EKNA 4ACMA 4NIFB 3FXZA 4WG3A 4AOTA 4G3CA 3MSSA 4RRVA 5FTQA 4QYHA 4E6CA 4IMYA 4OBQA 3FYJX 2VTIA 4BCPA 1ZZLA 5EI8A 3KREA 2A4LA 3MPTA 5IH4A 4PP7A 5IA1A 4A7CA 4PTEA 4ALWA 3POZA 4BBFA 1O6KA 4MH7A 4OGRA 2QCSA 5HQ0A 1XWSA 4JAIA 1RE8A 2QHMA 5JZNA 5JFVA 4DH5A 5DR6A 1GZKA 3UMWA 4EI4A 1H00A 3WF9A 5CU4A 4CV9A 4QMTA 4R78A 4KKEA 4KRDA 4MXZA 2YCSA 2IW6A 3ZDIA 4F70A 2PWLA 4HYUA 4RSSA 3CPBA 2XIZA 3I5ZA 3PXRA 3BQCA 3GU7A 3EQIA 1FVTA 1JKKA 2QODA 2W96B 3FPMA 3PG3A 2ZV8A 2W5HA 2QLQA 5LCJA 4L3JA 2YCFA 4XG3A 1ZXEA 4QMLA 3VS5A 3ZZWA 2RGPA 4ZZNA 4DFLA 3IO7A 2XKDA 3Q4UA 4I5MA 2P2HA 3FKNA 3IDBA 4IWPA 4WSYA 2GHMA 4O7RA 4U5JA 1OB3A 4JRVA 4D55A 3NEWA 4QPSA 4OR5A 3TZ7A 3WARA 2XYUA 2PZYA 2F7EE 3TTJA 1Z57A 5IEXA 3QTRA 3DZOA 1M2PA 3PJCA 3E3BX 4FKQA 4XX9A 4BFMA 5JSMA 1PW2A 4LFIA 4ZTSA 4GT3A 4GFOA 4J96A 1UVRA 2CKEA 3BHUA 3DNEA 3NAYA 4NSTA 4TZRA 1YHVA 4ANQA 4QP9A 3QF9A 2OXYA 3QXOA 4PV0A 4YTCA 5AUTA 3JS2A 3RCJA 2ZV2A 4EK5A 3N9XA 2LAVA 4CFVA 4YTFA 4DEBA 1WBNA 3NLBA 4FTCA 4O6EA 4RQVA 1UV5A 1WBVA 3FKLA 4EOLA 2J4ZA 5GJDA 1Z5MA 4PF4A 1UU8A 2YM3A 1AQ1A 5K3YA 4JI9A 5CSXA 3NNVA 3O0GA 3IGOA 5M07A 3DFCB 1OL6A 1YVJA 3L8XA 3I0QA 1U46A 2C6IA 1E9HA 5L3AA 4CLIA 2GCDA 3O17A 3HDMA 4O38A 3P23A 3QBNA 4W8EA 3AT3A 4M0ZA 3FMNA 3L8VA 5IQDA 2C6MA 5LQFA 3REPA 3ZFMA 5K4IA 4NEUA 4QMQA 4LI5A 4O7WA 1OL1A 5CYIA 3CY2A 4NJ3A 3N51A 3QQHA 1IA8A 4QP4A 1U5QA 2CGUA 3TJDA 2UW3A 5DEWA 4FV3A 1NVQA 3Q3BA 2VO3A 2ZB1A 4XG2A 4OAUC 4DTBA 4RIWA 2UZTA 2CNVA 3QRJA 3PVUA 1H27A 4EUTA 4FTIA 4KABA 4TRLA 3OT8A 5DBXA 4UMTA 5M57A 3EQFA 2CCIA 3BE2A 1OKWA 4R5YA 3PJ2A 4UYNA 1GZ8A 4Z16A 1QPJA 4GL9A 3C13A 4N4SA 3UG1A 3MWUA 2DYLA 3H10A 4ZIMA 4F7SA 5AP4A 3BYMA 3DTWA 4WIHA 5IPJA 4AZEA 1UWJA 4O81A 3QRUA 3QKMA 3KULA 2OXDA 4GRBA 4I1ZA 3RMFA 3U8WA 1ZY4A 2IJMA 3IOPA 3MESA 3P1AA 1FVVA 3A7JA 4DITA 2QLUA 2P33A 3ZSHA 4EORA 3O23A 3B2WA 4E5WA 4AXAA 4M15A 1SVEA 4UZDA 2W4OA 5D41A 3UC3A 2DWBA 5ANGA 2Y7JA 4JNWA 5B0XA 4OT5A 1G3NA 5GZ8A 5L2SA 3V5WA 1OMWA 3MTLA 1LP4A 3CBLA 4GFMA 4PDOA 3CSVA 1OVEA 1OIQA 4UY9A 3QU0A 4BKJA 2Z2WA 2WTJA 3RAWA 4I6FA 4MBLA 2XK4A 5CY3A 2IVTA 5CVGA 4RG0A 1LUFA 1H26A 2NRYA 4FT9A 2R3HA 2UZEA 4XV9A 3C0IA 1ZRZA 4PMTA 4FIIA 1H07A 4RJ4A 5J79A 1H1RA 3HAMA 4RIYB 3SOAA 2BROA 3TV7A 4D4SA 5K5XA 5FBOA 1U54B 3MDYA 4I92A 4LOQA 1IAJA 4KIKA 4XRLA 2C3LA 4FTLA 2R3QA 4DEIA 2H96A 3M42A 5LJJA 4BCNA 2OIDA 4WHZA 4Y72A 4F4PA 1JPAA 5GIOE 3L9MA 3ZLSA 4MQ1A 5I9WA 3NYVA 4AZTA 1UNLA 2J51A 4H3QA 4ZS4A 5CX9A 4YUQA 3EFLA 4XP2A 2QONA 2OFUA 3U51A 1R0EA 1J3HA 3BIZA 3EZVA 4PMMA 1AD5A 2VRXA 3IK3A 5ANEA 2A27A 3TV4A 2VTTA 3AC3A 4FSRA 4F0FA 2KULA 1YWVA 5CQWA 1UA2A 4ZY5A 4BDJA 3WE4A 4DINA 4IWDA 4D2WA 2WO6A 3LMHA 1H1WA 5HE2A 1J1CA 1Q8UA 4L7SA 3HV7A 4USFA 2WMSA 2X2LA 2WFYA 1DS5A 4C3RA 3LZBA 3OOMA 4DGOA 4IACA 1Q4LA 3NUNA 3ZBFA 4TYEA 5L8KA 2WTDA 4OUCA 2QG5A 3VS2A 3DKGA 2GQGA 1FBNA 3BV3A 3A4PA 2YM5A 3BBTB 1PMUA 3P7CA 1NVRA 4JBVA 2BZIB 2PMOX 2OSCA 2RFDA 3DTCA 3DU8A 2ITUA 4GH2A 4NFMA 3R1SA 5CSHA 1W8CA 3LIJA 3WZUA 5DNRA 2HK5A 4MEDA 4CV8A 2VV9A 2BFXA 4X3FB 5EI6A 4RVMA 3ULZA 3TUDA 1OIUA 5DT4A 2VX0A 3DA6A 2QURA 2BAJA 4EC8A 3H30A 4CLJA 3PTGA 1YHWA 5LXMA 3FMEA 4WUNA 2ZVAA 2OG8A 1KV1A 3VUTA 3VS7A 3C0HA 3DB8A 4QO9A 4U3ZA 2RSVA 4YLKA 4EH7A 3NGAA 4IZYA 2UW7A 3VS1A 5CNOA 1CKJA 1WBPA 1PKDA 3G6GA 4J95A 4NW5A 3IW5A 1B6CB 3ZBXA 4IEBA 2Q0BA 4WG5A 4DLJA 3WILA 2X4FA 5HLWA 3GCSA 4EH6A 5KKRB 1FMOE 3OWJA 4C34A 2ETRA 5K5NA 3TIYA 4BKYA 2Y4PA 5F1ZA 4MD9E 2YDKA 4F7NA 4BDIA 2QNJA 2X8DA 3S0OA 5T6KA 2R3IA 2VN9A 3E93A 3EKKA 3A8XA 2R3FA 1U4DA 4FIHA 2R3RA 4ZZOA 1J1BA 3O8TA 4H58A 4FEQA 4XEYA 3NZ0A 1QL6A 3GU4A 5G6VA 3OOGA 3SX9A 5CNNA 4M69B 1V1KA 2CLQA 2YAKA 2BZKB 2QR7A 2WGJA 4BCQA 2OJFE 3DNDA 3ZRLA 3PPKA 3RPOA 4FEVA 5AR5A 2WQEA 5F20A 4K1BA 1PMVA 3IDCA 4U0IA 1H25A 2X81A 5LMBA 4B9DA 3EQCA 1OKYA 4FL1A 1SZMA 3KRJA 3NUPA 1YDSE 3NR9A 2EUFB 4GS6A 4BC6A 3ALNA 3GOPA 4I0SA 3ZYAA 3EHAA 4UZHA 1PJKA 3G33A 4YTHA 2PMNX 4R77A 3V51A 5I3OA 1H24A 2ZM4A 5A46A 4JX7A 4D0XA 2ONLC 4PRJA 5GJGA 4L67A 2O65A 4MD7E 2IVUA 4OTWA 4X2KA 4J8NA 3NCGA 4FC0A 3Q9YA 4JQ7A 2UW6A 5HGIA 3IG7A 1STCE 1FOTA 2BRHA 2PUUA 2HXQA 4V04A 2XYNA 1P4FA 5HE1A 3BWFA 1E1XA 4M12A 5AV0A 2BFYA 5T3QA 4LGGA 2C5YA 2QR8A 1V0PA 3UO4A 1REKA 3TN8A 5L2WA 3U6JA 4WNOA 3RTPA 3CD8A 5AUUA 4C02A 1DAYA 2PVLA 3BLHA 3MBLA 3MH2A 3R71A 3SDJA 4P90A 4FG8A 4YZBA 4JG8A 3ZH8A 4AN9A 2PMLX 4O0TA 3BEAA 4XLIA 3FMDA 5L2QA 2XKCA 4U9AA 3JVRA 4J52A 1YXTA 3VAPA 3FMLA 4R5SA 3T8OA 1Y8YA 2JIVA 3MN3A 4G6LA 4XUFA 3ULIA 2H9VA 2QO2A 5J5SA 3NS9A 2J9MA 5IA2A 3K5UA 4F9WA 1XBCA 4CYJA 3FMHA 3OXTA 3OW3A 3RM7A 4W4WA 4JLCA 4S33A 3MS9A 4I21A 2B7AA 5EKOA 3I0OA 5JMSA 4TWPA 5EW8A 4E7WA 4CFMA 2PYWA 2FUMA 5CF4A 5CF8A 4J7BA 4HVIA 4AZSA 4FEXA 5D12A 3MJ1A 3VS3A 2XKFA 4G5JA 3BRBA 3ORTA 3UQCA 3AC5A 5C03A 2YERA 1XBBA 4ZK5A 3G15A 2F7XE 3V6RA 3W8QA 3R8ZA 3ZO1A 4D28A 4O1PA 2Y9QA 5GINE 1QPCA 1Q3DA 5J8IA 2J0IA 5CEPA 2AYPA 3VW6A 4QP3A 2W1FA 4YJUA 1ZYLA 5CU0A 2PSQA 4BTFA 4JVGA 1Y91A 3L8SA 3WF7A 2PVJA 3FKOA 4RPVA 4R6VA 4C35A 2B1PA 2VO6A 4UMPA 4D5KA 3NIEA 3OF0A 4QMPA 3W2QA 3R83A 1WBOA 3ACJA 4M0YA 4AA5A 4FUXA 4IAIA 4QP1A 1W84A 2OF4A 3TJCA 4C57A 1LEWA 5CENA 5FG8A 5CAUA 1JKLA 4KKGA 1J7IA 3LFDA 5EOLA 5C01A 4CRSA 5EM8A 4ZY4A 3D5VA 3NSZA 4S31A 2X39A 4WKQA 4GW8A 3VBWA 4ERWA 4G3DA 1P4OA 2FSOX 4BDDA 1PYEA 4C2WA 3CKXA 3CR0A 1ZWSA 1H0VA 4C8BA 4JBQA 4FNXA 4HYSA 4RIWB 1XJDA 2ITNA 4C3PA 2G1TA 4S34A 3ZUTA 3V5TA 4WG4A 1BUHA 3A4OX 2PY3A 4LM5A 4QMXA 4BCFA 4FTUA 3OWKA 3PE1A 3RPYA 5DRBA 3IDPA 3LW0A 3UNJA 3F82A 2JKOA 3H0YA 2XK8A 2GQSA 3SG9A 3GC7A 4UYAA 4XNEA 1OGUA 2BRBA 2XNBA 2J2IB 2BDFA 1IASA 2WPAA 3LCSA 3GEQA 4I5PA 5EM7A 5IKWA 5LVNA 4KUJA 3OCGA 4O86A 4WOVA 1PHKA 1W0XC 2OJJA 3PRFA 3RZFA 5DRDA 5ANIA 1UNHA 3TZ9A 3RNIA 3KULB 3ZFYA 5ETAA 1ND4A 3UO6A 4TW9A 5E92A 2FA2A 3K2LA 4LUDA 2B9IA 5DH3A 1I44A 3NNUA 4FKSA 5HVJA 5L6OA 3LKMA 5I9YA 3ZC5A 2C6KA 5EK7A 3F5XA 3DOGA 4BL1A 4DFXE 2XRWA 4AFEA 3DAJA 4H36A 4Q2AA 4ASZA 5CI7A 1QPEA 4IXPA 4L3PA 2HZIA 1PXJA 5T68A 4EWHA 5I0BA 5EHLA 3FSKA 3OW4A 3HL7A 3VHKA 2X1NA 3EKNA 2OK1A 3QQGA 1LEZA 1Q61A 4HJOA 3RM6A 3CTJA 3R30A 2F2CB 3EN4A 4P5ZA 4BKZA 3CLYA 2X7FA 3UOKA 4O0RA 3LXKA 5DFPA 4F9YA 3S95A 2PVNA 3ZO3A 3QUEA 4CGAA 2VGOA 1J7LA 3Q4ZA 3UTOA 4X2GA 4EZ5A 5A4CA 2X8EA 5E90A 1P14A 1XR1A 3C4CA 5EDPA 3OXIA 2X6DA 2XK7A 4AP7A 4YZNA 4H3BA 3PFQA 4D0WA 4X21A 4YO4A 2H6DA 3BYOA 3AQVA 2CKPA 4UN0C 3QLFA 1H01A 2C6EA 4KIKB 3R9NA 3LCOA 4L42A 4AG8A 3QTUA 3P78A 4G17A 4JS8A 2W1IA 2XVDA 3W2OA 4EKKA 3PZEA 5ETCA 3RALA 4XV3A 5C4LA 3TI1A 5J1WA 3L8PA 4IFCA 2B9HA 4AAAA 3D5XA 3MFTA 4HYIA 4FOCA 4KIPA 5H8EA 3KA0A 3NX8A 3QTWA 3PXYA 3KXXA 3G9LX 5FTGA 4BICA 1PXOA 2XNGA 3CKWA 4QYFA 4RIOA 3VQUA 1FINA 2QU5A 4UV0A 1XQZA 4F09A 2WIPA 1R1WA 2PE0A 4J98A 5L6PA 4HCVA 5LMKA 2J6MA 2PE2A 1CDKA 2YZAA 4M7IA 5AR3A 5AP6A 2JDRA 1F3MC 2R64A 1DI8A 2BHEA 4RVLA 4HW7A 4KS8A 3TDWA 3BYUA 3QCYA 5AP7A 4IDVA 3SHEA 4EUUA 5E8ZA 4DEEA 4C58A 1UU9A 5FEQA 2QOFA 1PY5A 3W1FA 2OH4A 2VX3A 4L01A 4C4EA 3U6IA 4TKSA 4JR3A 5ANKA 3A7HA 5IQIA 2FB8A 3QTXA 4CFNA 5C8KA 1M2QA 4IM0A 2QOOA 5AJQA 2RIOA 1J7UA 5AUZA 3GU5A 4FNWA 4FKIA 3COMA 1X8BA 2P2IA 3TT0A 3D0EA 4BZOA 4UX9A 3R02A 5DI1A 5KMOA 3E7VA 4YMJA 2I6LA 3DV3A 2V5QA 4G6OA 2R3NA 3ALOA 4AZVA 5CF6A 3W2PA 3QWKA 4YJQA 3FZOA 3GC9A 1BKXA 3PE2A 4MHAA 4MF1A 3DQXA 5LMKC 2XMYA 3ZRKA 4U42A 3BGQA 3HUBA 3QRKA 2ITPA 4RFMA 4I4FA 3IPHA 4CFUA 5AMNA 3SG8A 3E8CA 4M3QA 5E8UA 4QMUA 2EB3A 2BAQA 3G9NA 3WF5A 3RPSA 3IW8A 4IWQA 3AOXA 4AOIA 1QCFA 3MVJA 3HRBA 2BALA 4U7ZA 2OGVA 4O22A 3EQBA 3PZHA 2WIHA 4KAOA 3TNWA 3VBVA 2ZMDA 4GEOA 3ERKA 5DT3A 3SQQA 4HGTA 4L00A 4QPAA 1HCLA 3GGFA 4EOOA 3MIAA 3VS4A 5H9BA 2J0JA 4AUAA 1VEBA 1MQBA 3C4EA 3KKVA 4HGEA 3KMWA 4MVFA 3PJ3A 2QVSE 4JR7A 4L3LA 3W2CA 2BTSA 2BHHA 5I4NA 4U44A 1HOWA 5A14A 1XH5A 3BQRA 3QKLA 4FV9A 3AC1A 3BU3A 3O50A 4Z9LA 2C3JA 3UG2A 4BZNA 4YTIA 4MBIA 4BDAA 2JIIA 3HECA 3PVGA 5EYKA 3LJ1A 5HEZA 3V8TA 4B4LA 4BYIA 5KZIA 5ITAA 2XK9A 2ITQA 2A19B 4P4CA 1V0BA 5FXRA 3GI3A 4UALA 2JLDA 3VF8A 5AUWA 5DN3A 3WZEA 5LOHA 3MH1A 5IEVA 3Q9WA 3JR1A 4GK4A 5DT0A 5HX6A 3MY0A 3ZM4A 4LOOA 3OS3A 3W8LA 3C0GA 3HP5A 2VWWA 5AUXA 5HNBA 3VO3A 2X8IA 3SRVA 4CFXA 4O83A 2QOKA 5BMSA 1DM2A 4UWYA 3GNIB 4TTHB 2UVYA 3AD5A 3NAXA 2W17A 5ETIA 4ZTRA 3RAKA 3A2CA 5C4KA 2B4SB 2EWAA 3DZQA 4M8TA 3QZGA 4WBOA 4F6SA 1S9JA 2XF0A 3UIUA 4AT4A 5HO8A 1A06A 4GFGA 4HPTE 3N4UA 1ZOEA 2UZNA 1P5EA 3O8UA 2PVFA 3RI1A 3QD0A 1FPUA 2ZOQA 3F2RA 4NL0A 2R4BA 4AW0A 4DFNA 3AMAA 4NU1A 3RINA 4IVCA 5A4LA 3DLZA 3NYOA 4JIKA 3QHWA 3V5JA 2XEYA 4ENXA 3BGPA 1H0WA 1BLXA 4RLKA 4XMOA 1F0QA 3SW7A 3EJ1A 3CEKA 4DH7A 3F69A 5KKRC 4YBKA 4RT7A 5AV4A 1O6LA 4XH6A 2RKUA 4F7LA 3N4VA 2F7ZE 4FTTA 4O7ZA 5IQGA 4C36A 4KA3A 5DG5A 4BDBA 2BILB 3GB2A 2GNGA 3SV0A 4BZDA 2WD1A 1ERKA 3CD3A 3MW1A 4TYJA 4F6WA 4IX3A 5I9UA 4FKPA 4NK9A 4WO5A 2F2UA 4D4VA 3NIZA 4ZJJA 4GIHA 4NT4A 1ZMVA 5BMMA 4O82A 3R7IA 2VTAA 4I5HA 4QTDA 5KHWA 1KE5A 2F49A 4YZCA 3FYKX 5IQCA 5EOBA 5AEPA 4HCTA 5HBEA 4E93A 4M66A 5FP5A 5JGDA 1UU7A 5CAVA 3E62A 3HRFA 4FNYA 5CEKA 5FRIA 1GNGA 4F1TA 3QWJA 1XKKA 3OEZA 4YLJA 1RW8A 2W4KA 3M2WA 2VGPA 4ENYA 4IBMA 4LRMA 4QP7A 2C5XA 2IG7A 5IQFA 4GKIA 4IVBA 4GJ2A 3PSDA 4B8MA 3KXGA 3AC8A 2ZJWA 3FL4A 2P3GX 4DEGA 2F4JA 5DA3A 4DFZE 4I6QA 3QTZA 3NYNA 3TWJA 3R7VA 5A3XA 2OJIA 4I5CA 3VUDA 4KINA 1NT2A 4D1XA 4ZSGA 4KIQA 5ACBC 3BPRA 4LL0A 3ORNA 3VQHA 3C7QA 1Q8WA 1VYWA 1ZARA 3F3TA 1YWNA 4RJ6A 5EM5A 3C5UA 3F3VA 3KC3A 2VNYA 3Q53A 4GU6A 3LLAA 5DYJA 4XOZA 5HICA 5KZ0A 2VTPA 4QTEA 2C6TA 3FI2A 3OD6X 5DOSA 3NCZA 4UB7A 5EFQA 1PKGA 2Y6MA 4C4FA 5AP3A 4CCBA 4E4NA 5IU2A 2ETMA 2UZWE 2ZM1A 3BYVA 4GK3A 3S00A 5IQBA 4WBBB 5FLFA 3T3VA 3R7GA 4TPTA 3BHVA 2JDTA 5TO8A 2G15A 2GPHA 4X6RA 5AP2A 4AGWA 3A8WA 1WFCA 4R8QA 3WBLA 4IQ6A 4BCJA 4BTKA 1WVYA 4XYFA 3PIYA 4RLLA 4BVUA 4XBRA 4Y8DA 2B9FA 4YJTA 4QMZA 3LFEA 1F5QA 3P4KA 3R73A 4ZS0A 1PMNA 4PL4A 5CAOA 2XJ2A 4JX3A 4IAFA 3P08A 3TNQB 5CS6A 1KSWA 3LHJA 3PXZA 3UDBA 4BWPA 5EYMA 4O6LA 5IQEA 3PJ1A 2WTKC 4Y73A 4C3FA 5E8TA 4CTCA 4QT1A 3FC2A 2SRCA 2QI8A 1URWA 2Q83A 2YLEA 4BGQA 3BEGA 3DKOA 4MXYA 3QCXA 4OTRA 5JKGA 3MY1A 3D5UA 4DT8A 4NH1A 4KBKA 3HA8A 4YSMA 4H1MA 4K77A 4RMZA 4BI1A 3QTQA 4BB4A 4D4RA 1H28A 2XBJA 1ZOHA 3HP2A 5CSPA 4D9TA 5HZNA 2W05A 5DVRA 4AWIA 1BI8A 3ORZA 4FK6A 4D2TA 4IW0A 3ANRA 4TYGA 2BVAA 3EQRA 3Q6UA 3WE8A 3Q9XA 3B8QA 3IONA 2UW4A 4P5QA 1K9AA 4PQNA 1OZ1A 1I09A 4RVTA 2NPQA 4Q9SA 4BDHA 5DR9A 2XZSA 3PLSA 5CI6A 4YC6A 5CANA 2O0UA 5KMLA 4ZLYA 1UNGA 4IE9A 4F08A 2JGZA 3FE3A 5K4JA 5JRSA 1YI6A 3R7YA 2W5AA 4EK3A 3R9OA 3ROYA 1YXSA 5F95A 3C4FA 4G2FA 4K9YA 5HLNA 3ZM9A 3L1SA 2OO8X 5AIKA 3W10A 4AT3A 2YA9A 1NY3A 1PXPA 2ESMA 4FV7A 5A54A 5DLSA 4QTAA 4U45A 2HENA 3E88A 3ET7A 3CC6A 4IIRA 4W8DA 3ZU7A 2XIRA 3QZHA 3UE4A 4OTDA 3DCVA 3R1NA 2P55A 3T9IA 2OLCA 4JT3A 4O2PA 4YZ9A 3R9RA 4CNHA 3PY3A 3RWPA 3DK6A 2XUUA 3QQJA 4ACHA 4KRCA 2WZJA 1WBSA 3Q9ZA 2X6EA 5HD4A 3R7UA 4X2FA 2J0LA 3BE9A 5LVOA 5DGZA 3QX4A 4E73A 4D4YA 5HG8A 3EFKA 1JLUE 5E91A 4GKHA 5EQEA 4H05A 3DKFA 3UOHA 3KQ7A 1OECA 3AXWA 3D7TA 3HZTA 4BCHA 5CAPA 4FOBA 5IF1A 4AN2A 1Q41A 3PJ8A 5LARA 5KMNA 3C9WA 3OCBA 5CSVA 3C50A 4FX3A 5KMJA 3QXPA 4Z7GA 2G9XA 4IX4A 5TKDA 5A6NA 4EK6A 5AUVA 4BIBA 1CMKE 2GQRA 3DT1A 2R3KA 2Z7RA 3OVVA 5FEDA 5KMKA 3ZLXA 5JH6A 4IAYA 3ATTA 4X7QA 3FQHA 3SGCA 1JAMA 2C0TA 3GQIA 4BWKA 1P2AA 5JN2A 3UO5A 4JG6A 2X7GA 4FGRA 3DFAA 2P4IA 1U59A 5IUGA 3I60A 3MVHA 2YN8A 4I3ZA 2OXXA 2OWBA 3ZMMA 1Z9XA 3POOA 3DY7A 5K9IA 4LL5A 2HW6A 3FZSA 3QUDA 5CT0A 1UKHA 3PPZA 5FEEA 3FLWA 4GYGA 3A60A 3FAAA 3VN9A 4FR4A 4FV4A 4U43A 5HBJA 3OEFX 4XV2A 4F0IA 1IRKA 3TCPA 5AX3A 3GP0A 4D2SA 3FZRA 3K3IA 3U4UA 1T45A 4FKUA 4NCTA 4OAVB 3LFFA 2G2FA 2QOIA 4F1MA 1KE8A 4FZFB 4CEGA 2PMIA 2E9UA 4U40A 4DGNA 3QQFA 4JAJA 3RAIA 3Q4CA 4I24A 4TL0A 3CP9A 1OL7A 3ENMA 4Z3VA 4IB5A 5IA4A 4YJRA 3BYSA 3FLZA 3GCUA 4ONAA 1MP8A 3VRYA 2GS7A 3PA3A 4EZ3A 1XH7A 2VTLA 4APPA 3R8PA 3F3WA 1ZMWA 2PVMA 1S9IA 1OUYA 2ETKA 2GFSA 2XBAA 3MTFA 2AC5A 2C0OA 3GC8A 4YHJA 3KEXA 3G90X 4FTMA 4PMPA 5AM7A 4DG0E 2XIYA 3DBEA 3BV2A 3QA0A 3VC4A 2V7AA 4FUYA 4I20A 1UWHA 2V22A 4FE2A 2QKWB 2EXMA 3QYWA 5HHWA 4H39A 5L6WL 4Z7HA 3AD4A 3QAME 2VWXA 4TNBA 3FHRA 4NCTC 3VS6A 4E6AA 4E8AA 2I7QA 3ITZA 3Q2JA 2GU8A 3UMXA 1JOWB 3HGKA 3QCQA 3R0TA 5EM6A 4IZ7A 2YABA 2WMXA 5F94A 1TKIA 4FZDB 2XNMA 3CCNA 5AV2A 3PRIA 4YC3A 5C1QB 4DF3A 2WOTA 4FV5A 2WHBA 2DS1A 2HW7A 3GENA 2F57A 5CU6A 3QGWA 3MI9A 3HLLA 4RA5A 1U5RA 5C8MA 3LCTA 4RA4A 2R0UA 2Y4IC 2YACA 3HUCA 5TR6A 4CMOA 2VX1A 2VWUA 3UIXA 4B0GA 4LGDA 4EH2A 3FBVA 2JFMA 5EI2A 4FSQA 2UUEA 3CGFA 5CEQA 4ZSAA 4RC4A 4KNBA 3K3JA 3UVRA 2OJ9A 4PNIA 4UBAA 4BCIA 4C61A 5K0KA 5BUIA 1APME 3A62A 1GIIA 3H3CA 4GVJA 3SRVB 4F6UA 2VTNA 5IEYA 1EH4A 3AG9A 1JKTA 3F5GA 2YITA 4RJ5A 4RJ7A 3UYTA 3THBA 4F99A 3FC1X 3R01A 4O0VA 4DH1A 5D11A 3TNIA 3LM0A 4L53A 4KBAA 5KNJA 3WZDA 3KRLA 3MY5A 1Q5KA 4EONA 1GZNA 4C4HA 2ZDUA 5J95A 5AX9A 5AIRA 5D7AA 5HD7A 4A9TA 3ELJA 4MTAA 4MX9A 3HX4A 4EHVA 2GNLA 5J87A 3FY0A 2W99B 4BTMA 4RBLA 3BI6A 2UZDA 4RQKA 3VIDA 5E4HA 1M52A 5CXZA 3L9NA 2WU7A 4BI2A 2VWZA 4BR3A 3ZDUA 5HE0A 2VTRA 5AM6A 4Y85A 2F9GA 4X0MA 3WI6A 3E87A 3EFJA 1Q24A 4G9CA 3I7CA 2ERZE 2YISA 4RC2A 4ZLOA 4EJNA 4II5A 4BDGA 3F6XA 3MFRA 3QZFA 3I4BA 1YOLA 2HXLA 5E1EA 4JDJA 3NUSA 3DGKA 2PZPA 4FIEA 4M84A 5B2LA 1JSTA 4FTRA 4FVRA 5AADA 4JDIA 3ID6C 3MGYA 3VW8A 1REJA 1LR4A 3S4QA 1IR3A 4BDCA 4FEUA 3WOWA 1FMKA 4LG4A 2J7TA 4GK2A 3KVXA 1TQPA 4I0TA 4QP8A 1PRYA 4QNAA 4MNEA 4DEAA 3EOCA 3D2KA 4XS2A 2XIKA 2WU6A 4XHKB 2Z7LA 4MWIA 5CQUA 3BLRA 3W2SA 3KXNA 1L8TA 3QALE 2YDIA 4D2VA 1WAKA 4EOPA 4U79A 4ZLZA 3COHA 3PIZA 3ZZEA 4ANOA 3HNGA 1BX6A 4RX5A 3I81A 2B53A 1GJOA 2C5NA 4R1VA 4C4GA 3QZIA 4FG7A 3C4ZA 3GUBA 2VO0A 4QYEA 3NUUA 3ACKA 1ZYSA 4O96A 2GS2A 1CKIA 5E8XA 3TKHA 2DUVA 3I79A 4G9RA 1DI9A 2OU7A 2Q0NA 3RP9A 2GS6A 4AW2A 3BGZA 1W98A 3CQEA 2WTKB 1H1PA 4FTKA 5AR2A 1OL5A 2JDOA 4YURA 2IVSA 5KHXA 3M11A 4RZWA 3VUMA 3RWQA 3F7ZA 5HESA 3C1XA 2PPQA 4CQGA 4AX8A 4ZMEA 3EQHA 2VTMA 4WNMA 3OUKA 4ZY6A 3Q52A 3ENHA 2WXVA 3FV8A 3UPXA 5B7VA 2ITWA 2XEZA 3PY1A 4QMNA 2OICA 3CTHA 3G0FA 1UKIA 2OKRA 4Y46A 2B55A 5CZIA 3V8SA 4AZFA 2CDZA 4G3FA 4KSQA 5KX8A 2BIYA 3AGMA 4X6QC 4A4LA 3ZLWA 3DXQA 4ACCA 4E26A 2XNOA 5FBNC 3G2FA 2VAGA 4FKGA 1W7HA 3KY2A 4QQ5A 4APCA 1KV2A 4XRJA 2UZUE 2KTYA 1OBGA 5M09A 4RX7A 2ZMCA 5CASA 1OPJA 3FLYA 1G8AA 2VWBA 4EYMA 4EC9A 2PU8A 2C6OA 4FSYA 4LYNA 1ZAOA 3QC4A 3F7WA 4JOAA 5FUTA 5H3QA 3S1HA 3SXSA 3K5VA 2JIUA 2BZHB 4AGUA 3QD4A 4O7TA 1YOJA 3MH3A 1CTPE 3FL5A 3EB0A 5G1XA 4F64A 3DLSA 1M7NA 2GSFA 3F61A 3D15A 2IZSA 3FUPA 3KCKA 3R2YA 4FT5A 4FV1A 5GZ9A 4YBJA 2QQ7A 3HYHA 1PXLA 4DHFA 2C5OA 1YQJA 4DN5A 2CN5A 4DEDA 4JBPA 1YDTE 4L68A 2YDJA 4CZUA 5EH0A 3ZO2A 2WTIA 4HZSA 3VS0A 2ACXA 4BN1A 5HNGA 2XNPA 3LAUA 3ZO4A 3UPZA 3FI8A 4AACA 3QA8A 3QFVA 4DG2E 4XLVA 4BCGA 3OWLA 2X2MA 4TYHA 3TUCA 4YPSA 1VJYA 4BI0A 1PXIA 2PZ5A 2WMRA 3H0ZA 3NUXA 4PUZA 3GU8A 3R6XA 4F0GA 3HV5A 2PZIA 2BIKB 1OI9A 4ID7A 4O21A 4O91A 3VBQA 3WYXA 2OBJA 5ACKA 3IW7A 3TIZA 4AU8A 4FT0A 4K33A 5EYDA 4E4LA 3PWDA 5L8LA 2WMWA 5HE3A 4IM2A 4AQCA 3TEIA 5BVWA 4D2PA 4EQCA 2O64A 3D9VA 3ZTXA 2ITXA 4FTOA 1OKVA 3CTQA 3I5NA 4ZSJA 3LM5A 1B39A 3VUIA 4BYJA 4RIXA 5AP5A 3S3IA 1H8FA 3E92A 3QTSA 2UW8A 2UZVA 4IX5A 4AA4A 3FLNC 4YPDA 4BRXA 3M1SA 4M13A 3D7TB 4K6ZA 3I1AA 4QD6A 2RFEA 3HRCA 4AOJA 2HY0A 2B9JA 3FJQE 4PPCA 5IDPA 2PK9A 1E1VA 4RJ8A 4IB0A 2CHLA 3RK7A 4FV6A 1FGKA 1O9UA 1O6YA 2OI4X 3DAKA 4O27B 2BUJA 4Q9ZA 3ODYX 4D1SA 4BDFA 4U6RA 3KVWA 2EU9A 4UXLA 2BTRA 5HG9A 4AF3A 4AN3A 2BMCA 5ICPA 4KSPA 2PUNA 2PZRA 1WVXA 4N6YA 3ZXZA 3LOKA 4FSMA 4FK3A 4DH3A 1WMKA 2FSTX 4E1ZA 3I7BA 5ETFA 5C9CA 3TZ8A 4GMYA 4NJDA 4Y95A 5TOZA 5BX0A 1RDQE 3RBWA 4HNIA 5FP6A 3NMUF 3OG7A 3PG1A 3UNKA 4YC8A 3UP7A 1JQHA 2VWIA 4JBOA 2WQNA 5KUPA 1XH8A 4R3PA 4ANBA 3R00A 4MK0A 4ZTHA 3LMGA 4FV8A 5DPVA 2VD5A 4BCOA 2YIWA 3GXLA 2C3IB 4GT4A 5EQYA 3COIA 4UMQA 2JAVA 5GJFA 2FVDA 2YIYA 3KU2A 4PP9A 2O2UA 3SW4A 4UEUA 4MQ2A 3EMGA 4V01A 3T3UA 4G31A 3A99A 5FQDC 4XG9A 4USEA 3PXFA 5J9ZA 3F5PA 3FI4A 4XG8A 3VJOA 4R7BA 3LFNA 4FSNA 4WA9A 2XS0A 2HWPA 4DYMA 1W83A 4FBXA 1PMEA 4DAWA 4CFWA 3TUBA 1KE7A 2Y4IB 2VTQA 5C27A 3W33A 3F9NA 1M7QA 1YDRE 3BHHA 3JPVA 1Q3WA 1SVHA 4YNOA 1MQ4A 3SXRA 3Q2MA 2IZRA 4ZEGA 5AA8A 2UZLA 3GU6A 3I6UA 4DGLC 2JEDA 4FYOA 3D7ZA 1W82A 1G8SA 4LMUA 5K0XA 3KMMA 4YSJA 3GOKA 3SD0A 4EK4A 4NM0A 4N70A 3OT3A 3CIKA 2OIBA 4IB3A 4FSWA 3LXPA 4DGGA 4W4VA 3HDNA 3HVCA 3OTVA 2I0VA 3R22A 4ZTMA 4OTPA 2Z7SA 5HIEA 4M14A 2RFSA 1BL6A 4OTGA 5HTBA 4YHFA 2QOLA 4NKSA 4TWNA 3R8LA 5FWKK 4RC3A 1PYXA 1R3CA 4X3JA 4AA0A 2W1GA 2OH0E 4TY1A 5CZHA 3F2NA 3PXQA 4RWIA 2WMQA 2EXEA 4C2VA 4IHPA 3R9DA 4EHZA 5IISA 5JZJA 2CKOA 2WB8A 4R1YA 4E5BA 4X2JA 3OCTA 3KXHA 3VNTA 3WZKA 1Q8YA 2WMBA 4D1ZA 4GG5A 2XCKA 3D4QA 2RL5A 4EK8A 3NDMA 4KKHA 4YJVA 4EZ7A 2BDWA 3A7GA 3U6HA 5GHVA 4CTBA 2FH9A 1ZZ2A 5HG7A 5M56A 5EG3A 1ZMUA 2W06A 2UZOA 2X4ZA 4U3YA 3EYHA 2UW5A 3ZFXA 5DHJA 4PNKA 4UMUA 3QGYA 4DT9A 5M55A 1YXXA 2XIXA 4E3CA 5BVNA 4H3PA 2P0CA 2ZM3A 4RJ3A 3ZXTA 3ZC6A 4A4XA 5LVPA 2C5VA 5DEYA 5HCYA 1ZYDA 5AR8A 4E4MA 3DK3A 3G51A 4L44A 4O84A 4MXXA 4EQMA 4O0XA 4DFUA 3D5WA 4X3FA 2R9SA 1JNKA 2IWIA 3F2AA 4USDA 4L7FA 3HV6A 1TVOA 4BBMA 4CKRA 3KGAA 3LVPA 5BVKA 4FYNA 2I0HA 2PL0A 2XH5A 4DFBA 3LXNA 5M4CA 4FTNA 3O71A 3V04A 4BWXA 3U55A 1YXUA 1H1SA 4QYGA 4DLIA 2JFLA 1GZOA 3BWJA 5D7VA 4ITHA 1WBTA 4DFYA 4G3GA 2O5KA 4QTCA 4U80A 3GVUA 4WUAA 3VBYA 2VZ6A 2GTNA 5BUEA 1PXMA 1Q62A 1SNXA 5AWMA 2WOUA 4KWPA 5E1SA 2A1AB 4FSUA 5AV3A 3KF7A 3FQSA 3OHTA 2GFCA 3R1YA 4LOPA 4MNEB 4PDYA 5E8WA 2YIRA 2OIQA 3AT2A 3OROA 5HKMA 3FZ1A 5LMAA 3GCPA 3BZ3A 4XG6A 4ITJA 1IAHA 1A48A 3CJGA 3K54A 3ROCA 3PDTA 3GCQA 3UOLA 4FTQA 3UYSA 4F7JA 3Q04A 4HVGA 2QD9A 4QQCA 4O0SA 3P7AA 5HU3A 5BYLA 3MFSA 2PUIA 2V7OA 4YJPA 5I9ZA 3R63A 2QOCA 1PXKA 5CT7A 5IG1A 2YM6A 4H1JA 4YNEA 2QO9A 4FKTA 4U81A 5C26A 1YI4A 2B52A 5CF5A 2ZDTA 2X0GA 4RX8A 4DGMA 4ZXTA 4M67A 5AA9A 1OIRA 4LUEA 4CCUA 1PXNA 3FHIA 2V62A 3HV4A 3L9PA 3R2BA 3JY9A 4XG4A 2WEIA 4F9BA 2XK6A 5AUYA 1WBWA 3IKAA 4JJRA 4O0WA 4QMSA 5GIPE 3C4XA 4FZ7A 4ALUA 3A61A 2X2KA 5D1JA 1PF8A 4OTHA 5J7HA 4CRLA 4FT3A 2E9VA 4MKCA 4QOXA 5E8SA 3DDQA 3GBZA 2WMUA 2VO7A 3V8WA 3PP0A 3SAYA 3D2IA 5E9EA 4FF8A 4EHGA 2XP2A 4FTJA 3FSFA 3P9JA 2JITA 4U8ZA 4WD5A 4EJ7A 4LV8A 4J99A 3QHRA 4WRGA 3FZPA 4NWMA 2J0MB 3U9CA 3VBTA 2FO0A 2YCQA 3QQUA 4C37A 4EBWA 5JGBA 2CJMA 4MXOA 4FZ6A 3V6SA 1GAGA 4EL9A 3ORKA 2WQMA 4O0UA 2HY81 4RVKA 3IW4A 3ZSIA 2LGCA 5ANDA 2IN6A 4EBVA 3E8NA 3HEGA 4Y5HA 4K11A 4MXCA 3E64A 2H34A 3RK9A 4FKLA 4CQEA 5HIDA 3WF6A 4TN6A 4PX6A 1BL7A 3I6WA 1H08A 1MUOA 4GV1A 4OBPA 3ZHPC 1XHAA 1L3RE 2QU6A 4C7TA 5IQAA 4IJPA 4K18A 4PPAA 3R7OA 4ZSEA 3FXWA 4HVHA 2NO3A 3VHEA 2R7BA 2WQOA 5CU2A 4ZZMA 3OBJA 4MBJA 4O7NA 4UMRA 5HTIA 4AW5A 3V3VA 3ODZX 1FGIA 2R7IA 3RKBA 3RJCA 2HCKA 4G16A 4FKOA 2CNUA 2XB7A 3VF9A 3W55A 2IZTA 2BCJA 4FG9A 3ORLA 4WNPA 1FVRA 3RHXA 3U4WA 4CT2A 3U54A 4PTGA 3VJNA 2UZBA 5CXHA 4XOYA 2E9NA 3MYGA 4CKIA 4ZJVA 4TYHB 5CEIA 3F66A 4ORKA 2W5BA 4IJ9A 4ZTLA 1KUTA 3P86A 3EIDA 3SA0A 2HAKA 1OIYA 3DKCA 4O7YA 4EEVA 1H4LA 2J0KA 3KXMA 2QOBA 5H8BA 2CNQA 1OITA 4CMTA 4F1OA 3U87A 5CVFA 2WMVA 3NW6A 4FMQA 4IC7A 3IW6A 4IVDA 3V01A 2JKMA 5DWRA 2C1BA 3VUGA 5JQ8A 3DDPA 3LCKA 3V5QA 3SC1A 3CE3A 3UP2A 1GOLA 5HNIX 2W9FB 5LWMA 4RIXB 4I4EA 4CSVA 4DE4A 4ARKA 1SYKA 4V05A 3MB6A 4IAZA 4AZWA 3R8MA 4EH9A 4HNFA 2WTVA 4TYIA 2YIXA 5CSWA 5FTOA 2G2IA 4JQ8A 4GCJA 5JEBA 1ZOGA 3EL8A 3JY0A 5C8NA 4FKVA 4FGBA 5EDQA 2O63A 5M4IA 4NFNA 4CG8A 5AP1A 2PVRA 2WMAA 4FZAB 4F63A 4BTJA 2CCHA 5HBHA 4DC2A 5GNKA 4L8MA 5KBQA 2ITZA 2R3OA 3Q4TA 1ATPE 2GTMA 3F3UA 5L8JA 1IA9A 2PUPA 5BVOA 3DBQA 3SXFA 4IZ5A 4BGGA 4DTAA 3EYGA 5CAQA 4IANA 3UODA 2OZAA 1KE9A 3FZTA 4GYIA 3CPCA 1TQMA 5ANOA 4Z55A 2Z8CA 2B0QA 1URCA 3GFWA 3MV5A 5EQPA 2GNFA 4E6DA 3KL8A 3PXKA 3R28A 3KCFA 4QQJA 5AAFA 5IMEA 4MAOA 1YOMA 4HYHA 3SVVA 4FEWA 1BMKA 3B2TA 3LCDA 3IS5A 3LFQA 2HZ4A 3QC9A 3UBDA 3Q5IA 5EYCA 3IQ7A 3D94A 5M53A 2WMTA 1XH6A 2GMXA 2R2PA 4QP2A 2HZNA 2EXCX 3CJFA 4NTTA 3Q60A 2FSMX 3TG1A 3KN6A 4ZP5A 2ZB0A 4GG7A 4BF2A 2NNWB 2CGWA 3KK9A 3W16A 4B6LA 2JBPA 2VWVA 4L45A 2W9ZB 3LFSA 4EQUA 1R78A 4KB8A 4C33A 2OF2A 3CXWA 2YAAA 2QO7A 3DJ6A 4ACDA 4E20A 5JQ5A 1KOBA 4FKRA 3VULA 5L2IA 3KN5A 2IW9A 5IA0A 4IZAA 2QG7A 3ETAA 2ERKA 1H1QA 3NW5A 5H2UA 4IAAA 3COKA 3O7LD 4XP0A 2XM9A 4RGJA 3G5DA 1XH4A 4J8MA 2O3PA 4AS0A 4WT6A 5CTPA 4RFZA 2W7XA 4F9AA 4YLLA 5IMXA 4ACGA 3WYYA 4ZJIA 3GCVA 1M17A 4BCKA 3UGCA 4DA5A 5LVMA 2JBOA 2BRMA 3KXZA 3BU5A 2Y6OA 2A0CX 4CZYB 4I41A 3BX5A 2YWPA 5BQ0A 1R39A 1SMHA 3NYXA 3KMUA 3FDNA 5CVHA 2YCRA 4YJOA 4GVAA 5F9EA 3FXXA 3UIBA 4WRSA 3BU6A 4A4OA 2WKMA 5IUHA 4W9WA 3DBDA 4RWJA 5EHYA 5M51A 2WNTA 3Q32A 3QX2A 1FQ1B 4EH8A 1JKSA 4MXAA 4EOKA 3R8UA 2G01A 3G6HA 2YHVA 5HO6A 1TQIA 4QMWA 2DQ7X 4BIEA 3MPAA 4IWOA 4I0RA 3U9NA 3A7FA 4MYGA 5EW9A 4ZSLA 1T46A 2R3PA 5E8VA 3KRWA 1XH9A 5J7BA 4FL2A 1K2PA 3BHTA 1OM1A 4OTQA 4FIGA 4F65A 2OFVA 4QRCA 3ATSA 2PE1A 4YP8A 4ALVA 1OBDA 2Z60A 4BCMA 3O51A 3LFCA 3NW7A 3H9FA 2RFNA 2RF9A 1Q97A 2VTOA 3WF8A 1GIHA 5BNJA 2JKQA 3EQPA 2IVVA 3MVLA 2PHKA 2YJRA 4YZMA 2IZUA 3FMMA 5HOAA 4YJSA 5TF9A 5JGAA 3W2RA 3MB7A 3QQKA 5KBRA 3UOJA 3TXOA 5M08A 4MF0A 4M68A 3FPQA 3DJ7A 1ZY5A 3OXZA 4QMVA 3BLQA 2CSNA 3KFAA 5TT7A 5IA3A 2QC6A 4A9RA 3NWWA 5JFWA 2A2AA 3DS6A 1XBAA 2GNHA 4OLIA 1JVPP 4TT7A 3Q6WA 2O8YA 4W4XA 3LFAA 5BYYA 5M06A 4N6ZA 2ZAZA 4A9SA 1CKPA 3ZLYA 4FODA 3WIKA 4Y5QA 2XK3A 5HO7A 3E5AA 3KB7A 2VWYA 4DCAA 5LCKA 2E2BA 3RVGA 2ZV9A 5A4EA 4E4XA 5HX8A 2I1MA 2YM7A 3DB6A 4PL5A 3UVPA 4TNDA 5BVDA 5CU3A 1J91A 5ANJA 3RPRA 4V0GA 1WVWA 4ERKA 4G1WA 1BYGA 3ORPA 3OWPA 4FKJA 4FNZA 4L9IA 4LGHA 4O1OA 4JXFA 1OKZA 3TKIA 3FQEA 3JVSA 1VZOA 2ITOA 3MVMA 4TWCA 2HIWA 2Y0AA 3E7OA 4KBCA 3UJGA 4C4IA 5A4TA 3HMMA 4FV2A 3KF4A 4EKLA 4ZTQA 2BPMA 1V0OA 3TACA 4A9YA 3TL8A 5A6OA 3VUKA 3UZRA 3KRXA 2C4GA 3OCSA 4NKAA 4PDSA 3FLQA 4EOIA 5CEOA 4TXCA 1SVGA 2VTJA 5IH5A 1Y8GA 2ONLA 3UVQA 4NYEA 4I93A 5KMMA 3KK8A 2C30A 2WQBA 4GSBA 3ORXA 3OFMA 2YLFA 4ANLA 5L2TA 3PPJA 1RQQA 4DBXA 4YZDA 4FT7A 4O0YA 4P2KA 1JBPE 1R0PA 4UXQA 3RCDA 5HI2A 1YXVA 3RZBA 2JKKA 5LVLA 3R7EA 4AE6A 4PDPA 2PTKA 4CFFA 2YFXA 3MJ2A 3QD2B 3ZOSA 1Q8ZA 4WSQA 2REIA 3AMBA 3VUHA 1NVSA 2JAMA 3OBGA 2CMWA 2W0JA 5DIAA 2YWVA 4K2RA 1Q99A 4I94A 4R3RA 4G3EA 5IQHA 3QUPA 2UVZA 3PIXA 4LRKA 4HOKA 4PL3A 4O7LA 5AAGA 3ZRMA 4P7EA 2R3LA 1KOAA 4FV0A 4BHNA 4O2ZA 5DMZA 3Q5ZA 2XM8A 3JXWA 4NW6A 5LWNA 4IM3A 5J5TA 4ASDA 4A07A 1B38A 4RFYA 5JRQA 4IFGA 3JYAA 4FA2A 3FY2A 3AMYA 1WZYA 3V5PA 3ZCLA 2GHGA 4HVDA 4YGAA 5E8YA 4EOSA 2VNWA 4C38A 2XNEA 1M2RA 3F3ZA 4NZWB 3WZJA 3SOCA 5D9HA 2I0YA 3QTIA 3RK5A 4D5HA 1YI3A 2WTWA 3EZRA 4J1RA 4MNFA 5HCZA 4N57A 3AGLA 4LMNA 3EN9A 3O8PA 1HCKA 2Z02A 3QRIA 5D10A 2XCHA 2B54A 3CQUA 4N0SA 4TWOA 3ORMA 4NTSA 3C5IA 4JDHA 3OY3A 1NXKA 4NIFA 1IG1A 1KE6A 2Y8OA 3HA6A 4IH8A 4X2NA 2C68A 3E63A 2C3KA 5FDXA 5HIBA 4ANNA 3OP5A 3CY3A 5CALA 3ZEPA 4BBEA 2VTSA 4BDKA 4NUSA 4FKWA 2C47A 4UWCA 3DQWA 3RAHA 3TNPC 3F88A 4ZAUA 3LQ3A 2EVAA 5AFVA 3QL8A 4LQMA 1YRPA 3NRMA 2QHNA 4S30A 3PP1A 5J1VA 4I6BA 4OT6A 1GIJA 1ZLTA 2YJSA 2QKRA 3DAEA 2XJ1A 4R7IA 2QOQA 2GDOA 1G5SA 3RHKA 3EH9A 4NM5A 3FWQA 3EN6A 4HPUE 4I23A 5BVFA 4EWQA 1DAWA 5JK3A 4FVPA 2JC6A 3OY1A 2E9OA 4LV5A 3II5A 2V55A 2C69A 5FM2A 3QQLA 4GUEA 4GU9A 4L6QA 2UW9A 2RG6A 4KD1A 2J50A 2YM4A 3HV3A 4AE9A 4WNKA 4DCEA 5IZFA 4OTIA 4YJNA 4QMMA 4MD8E 4I22A 5AAEA 1GY3A 3ANQA 1LPUA 3H4JA 4OTFA 5CLPA 3SKCA 3DK7A 3HMNA 5E7RA 3NNXA 5EW3A 2G2HA 4FTAA 4ZTNA 4C59A 3QKKA 2OZOA 4YHTA 3HMOA 5FXSA 3V5LA 4RZVA 3OZ6A 3OMVA 1UU3A 1YKRA 4HCUA 1K3AA 3IGGA 4QNYA 1OPKA 4C62A 5IDNA 4FVQA 3QLGA 2R3GA 3VRZA 2AC3A 2XRUA 5HVYA 3JUHA 1M14A 2XJ0A 3MPMA 3R21A 4JRNA 2OZAB 3QCSA 1YW2A 1A9UA 2FSLX 5JT2A 3PWYA 2UW0A 2AUHA 3PYYA 4U97A 4ANSA 2XKEA 4DEHA 2EB2A 2J5FA 4CT1A 4YR8A 3E8DA 4FICA 5HG5A 5FD2A 1SNUA 3FMKA 3TM0A 3AD6A 3EL7A 4Y83A 4CMUA 3GC0A 4J71A 4OBOA 5DR2A 3IECA 3D14A 3OC1A 4FIJA 5FM3A 4D2RA 3BKBA 3N4TA 2HZ0A 3ZS5A 4EOMA 2YEXA 4FSTA 2J90A 2X9FA 4IDTA 4PWNA 2VUWA 2CKQA 3TV6A 3LJ0A 2YIQA 1CSNA 4IX6A 5H8GA 2WELA 3VBXA 2PVYA 2JDVA 3EQGA 3BBWA 4K0YA 4YO6A 3RNYA 4BGHA 5A4QA 5KO1A 4D9UA 4QMYA 5L4QA 3WIGA 4C0TA 5B2KA
chains in the Genus database with same CATH superfamily
5M4FA 2VTHA 4ASEA 3AT4A 4IVAA 1Y57A 3TTIA 1AGWA 4B8LA 4Q5EA 1SM2A 5F4NA 3PUPA 4PTCA 3PY0A 4C4JA 5FDPA 5I9VA 3PLAE 1ZYJA 4BIDA 3GT8A 3O7LB 4EYJA 1IEPA 3EQDA 4K8AA 1Y6AA 2WEVA 1NA7A 3W32A 4W9XA 2IPXA 3KRRA 4ANMA 3DXPA 5M44A 4XV1A 4F9CA 4XCUA 3MH0A 4AGDA 3C4WA 4QP6A 4DG3E 4CZTA 3GFEA 2NRUA 2R3JA 3F5UA 2UV2A 3UIMA 2ITTA 2CPKE 2BDJA 4GUBA 4QTBA 4LRJA 2ZYBA 4U41A 4JG7A 2I0EA 3DBCA 1WCCA 2X9EA 5AR4A 4EH3A 4IC8A 2HELA 4NM7A 3EN5A 3NUAA 5EDRA 2I40A 2C6DA 2BAKA 5J9LA 3OUNB 3P79A 3SLSA 2IW8A 4O7SA 2BZJA 2W4JA 4CVAA 2CGVA 4A9UA 5GZAA 2WAJA 5BUJA 3L9LA 3AC4A 4OW8A 4EOQA 2OW3A 4O7VA 4EHEA 3CQWA 4CKJA 3LE6A 5JFSA 2C0IA 3S2PA 1ST0A 4F78A 3ORIA 2C6LA 4G5PA 3PA4A 4DBNA 4FL3A 1VR2A 2W1ZA 4CG9A 1QPDA 1KWPA 3QD3A 4IADA 1VYZA 1OUKA 3NUYA 3RGFA 3HAVA 3A7IA 3UZPA 5FXQA 2HWOA 2R5TA 1ZYCA 2RG5A 5BPYA 5DE2A 4HGSA 2E9PA 4IAKA 5I5ZA 3UQFA 4CD0A 1Y6BA 4RIYA 2ZV7A 4L46A 2BKZA 2HYYA 2W1DA 1U54A 3ZSGA 2XNNA 3R9HA 4RWLA 4A06A 2IO6A 5HLPA 3MA6A 3OTUA 3MFUA 2PULA 4HGLA 3CGOA 3LMIA 2CLXA 3R1QA 4Q5HA 3Q96A 4G34A 3MIYA 4L52A 1OL2A 5AR7A 1XO2B 4FIFA 3NPCA 4I6HA 4PY1A 4E6QA 4EH4A 3B8RA 4FSZA 4UWBA 1OPLA 5IH6A 3P0MA 4QMOA 4R7HA 4QQTA 2YZLA 2W1CA 4AFJA 3LQ8A 1ST4A 3HMPA 3P5KA 5CWZA 2FYSA 3HMIA 4PPBA 3DXNA 2BR1A 3GQLA 5KE0A 4E5AX 5CEMA 3PA5A 1RJBA 3LPBA 4JQEA 3EFWA 3PVWA 5HU9A 5JFXA 2Z7QA 3W18A 4HVSA 3E3PA 5HORA 5A9UA 4GIIA 5HVKA 4DHJA 4V0GB 3ZUUA 3LLTA 3LQ5A 2BKKA 4J97A 1YHSA 3NVKI 3H9RA 1BI7A 4W4YA 4M97A 4R3CA 3VVHA 2XA4A 3P7BA 4AW1A 5IUIA 3VWAA 4RWKA 3RPVA 2WTCA 3C51A 2GNIA 4JIAA 2H8HA 3T9TA 3UZTA 1JSVA 2C1AA 3E8EA 3H9OA 2V0DA 4GT5A 3UC4A 4BHZA 5KMIA 3DBFA 4S32A 2R0IA 2W1EA 1MRUA 4D58A 3PVBA 3NNWA 2GNJA 4BDEA 4NM3A 4YU2A 3R8VA 2W1HA 4AGCA 4MCVA 4XP3A 4BY9E 5I9XA 4IB1A 3FMJA 2JDSA 2FGIA 3UNZA 5KCVA 4B7TA 1CM8A 2R3MA 3MA3A 1YWRA 2QOHA 2PVHA 5M4UA 1JSUA 2BRGA 2UVXA 3EWHA 4J53A 2NP8A 3D83A 3EN7A 3LFBA 4GJ3A 5HCXA 5BYZA 3TZMA 5HTCA 3CS9A 3O2MA 5I3RA 3IOKA 2X7OA 4FI1A 1Q8TA 3TDVA 4ZMFA 4HZRA 2ITVA 4XJ0A 4JL9A 1QMZA 3QRTA 4ZOGA 3LJ2A 2OJGA 5AV1A 3AC2A 3BHYA 2HOGA 4KIOA 4X3FC 2JD5A 4G6NA 2CGXA 3PSCA 4RX9A 3O96A 4XG7A 4KS7A 4L43A 1MRVA 4ASXA 5FGKA 5B2MA 5J9YA 4MWHA 4QPMA 3ZUVA 5BVEA 1MRYA 3FLSA 3DJ5A 2CN8A 4ITIA 2YM8A 3G0EA 4O4DA 4DH8A 3TKUA 4CXAA 3FEGA 2PVKA 3QYZA 5EHOA 3NVMB 4M69A 4QYYA 2J5EA 4AT5A 5AP0A 3BCEA 4XBUA 3ZEWA 2XANA 3ZONA 2BRNA 3TNHA 4DTKA 3DPKA 4PMSA 1JWHA 5IA5A 5TE0A 3HKOA 3BELA 3FI3A 3LXLA 4JDKA 2GHLA 4S2ZA 4EOJA 3UQGA 2VU3A 2ITYA 1NW1A 4FJVA 3PSBA 4CYIA 4B99A 4EH5A 3R04A 5EKNA 4ACMA 4NIFB 3FXZA 4WG3A 4AOTA 4G3CA 3MSSA 4RRVA 5FTQA 4QYHA 4E6CA 4IMYA 4OBQA 3FYJX 2VTIA 4BCPA 1ZZLA 5EI8A 4BJJA 3KREA 2A4LA 3MPTA 5IH4A 4PP7A 5IA1A 4A7CA 4PTEA 4ALWA 3POZA 4BBFA 1O6KA 4MH7A 4OGRA 2IEWA 2QCSA 5HQ0A 1XWSA 4JAIA 1RE8A 2QHMA 5JZNA 5JFVA 4DH5A 5DR6A 1GZKA 3UMWA 4EI4A 1H00A 3WF9A 5CU4A 4CV9A 4QMTA 4R78A 4KKEA 4KRDA 4MXZA 2YCSA 2IW6A 3ZDIA 4F70A 2PWLA 4HYUA 4RSSA 3CPBA 2XIZA 3I5ZA 3PXRA 3BQCA 3GU7A 3EQIA 1FVTA 1JKKA 2QODA 2W96B 3FPMA 3PG3A 2ZV8A 2W5HA 2QLQA 5LCJA 4L3JA 2YCFA 4XG3A 1ZXEA 4QMLA 3VS5A 3ZZWA 2RGPA 4ZZNA 4DFLA 3IO7A 2XKDA 3Q4UA 4I5MA 2P2HA 3FKNA 3IDBA 4IWPA 4WSYA 2GHMA 4O7RA 4U5JA 1OB3A 4JRVA 4D55A 3NEWA 4QPSA 4OR5A 3TZ7A 3WARA 2XYUA 2PZYA 2F7EE 3TTJA 1Z57A 5IEXA 3QTRA 3DZOA 1M2PA 3PJCA 3E3BX 4FKQA 4XX9A 4BFMA 5JSMA 1PW2A 4LFIA 4ZTSA 4GT3A 4GFOA 4J96A 1UVRA 2CKEA 3BHUA 3DNEA 3NAYA 4NSTA 4TZRA 1YHVA 4ANQA 4QP9A 3QF9A 2OXYA 3QXOA 4PV0A 4YTCA 5AUTA 3JS2A 3RCJA 2ZV2A 4EK5A 3N9XA 2LAVA 4CFVA 4YTFA 4DEBA 1WBNA 3NLBA 4FTCA 4O6EA 4RQVA 1UV5A 1WBVA 3FKLA 4EOLA 2J4ZA 5GJDA 1Z5MA 4PF4A 1UU8A 2YM3A 1AQ1A 5K3YA 4JI9A 5CSXA 3NNVA 1TFFA 3O0GA 3IGOA 5M07A 3DFCB 1OL6A 1YVJA 3L8XA 3I0QA 1XMMA 1U46A 2C6IA 1E9HA 5L3AA 4CLIA 2GCDA 3O17A 3HDMA 4O38A 3P23A 3QBNA 4W8EA 3AT3A 4M0ZA 3FMNA 3L8VA 5IQDA 2C6MA 5LQFA 3REPA 3ZFMA 5K4IA 4NEUA 4QMQA 4LI5A 4O7WA 1OL1A 5CYIA 3CY2A 4NJ3A 3N51A 3QQHA 1IA8A 4QP4A 1U5QA 2CGUA 3TJDA 2UW3A 5DEWA 4FV3A 1NVQA 3Q3BA 2VO3A 2ZB1A 4XG2A 4OAUC 4DTBA 4RIWA 2UZTA 2CNVA 3QRJA 3PVUA 1H27A 4EUTA 4FTIA 4KABA 4TRLA 3OT8A 5DBXA 4UMTA 5M57A 3EQFA 2CCIA 3BE2A 1OKWA 4R5YA 3PJ2A 4UYNA 1GZ8A 4Z16A 1QPJA 4GL9A 3C13A 4N4SA 3UG1A 3MWUA 2DYLA 3H10A 4ZIMA 4F7SA 5AP4A 3BYMA 3DTWA 4WIHA 5IPJA 4AZEA 1UWJA 4O81A 3QRUA 3QKMA 3KULA 2OXDA 4GRBA 4I1ZA 3RMFA 3U8WA 1ZY4A 2IJMA 3IOPA 3MESA 3P1AA 1FVVA 3A7JA 4DITA 2QLUA 2P33A 3ZSHA 4EORA 3O23A 3B2WA 4E5WA 4AXAA 4M15A 1SVEA 4UZDA 2W4OA 5D41A 3UC3A 2DWBA 5ANGA 2Y7JA 4JNWA 5B0XA 4OT5A 1G3NA 5GZ8A 5L2SA 3V5WA 1OMWA 3MTLA 1LP4A 3CBLA 4MUQA 1XMLA 4GFMA 4PDOA 3CSVA 1OVEA 1OIQA 4UY9A 3QU0A 4BKJA 2Z2WA 2WTJA 3RAWA 4I6FA 4MBLA 2XK4A 5CY3A 2IVTA 5CVGA 4RG0A 1LUFA 1H26A 2NRYA 4FT9A 2R3HA 2UZEA 4XV9A 3C0IA 1ZRZA 4PMTA 4FIIA 1H07A 4RJ4A 5J79A 1H1RA 3HAMA 4RIYB 3SOAA 2BROA 3TV7A 4D4SA 5K5XA 5FBOA 1U54B 3MDYA 4I92A 4LOQA 1IAJA 4KIKA 4XRLA 2C3LA 4FTLA 2R3QA 4DEIA 2H96A 3M42A 5LJJA 4BCNA 2OIDA 4WHZA 4Y72A 4F4PA 1JPAA 5GIOE 3L9MA 3ZLSA 4MQ1A 5I9WA 3NYVA 4AZTA 1UNLA 2J51A 4H3QA 4ZS4A 5CX9A 4YUQA 3EFLA 4XP2A 2QONA 2OFUA 3U51A 1R0EA 1J3HA 3BIZA 3EZVA 4PMMA 1AD5A 2VRXA 3IK3A 5ANEA 2A27A 3TV4A 2VTTA 3AC3A 4FSRA 4F0FA 2KULA 1YWVA 5CQWA 1UA2A 4ZY5A 4BDJA 3WE4A 4DINA 4IWDA 4D2WA 2WO6A 3LMHA 1H1WA 5HE2A 1J1CA 1Q8UA 4L7SA 3HV7A 4USFA 2WMSA 2X2LA 2WFYA 1DS5A 4C3RA 3LZBA 3OOMA 4DGOA 4IACA 1Q4LA 3NUNA 3ZBFA 4TYEA 5L8KA 2WTDA 4OUCA 2QG5A 3VS2A 3DKGA 2GQGA 1FBNA 3BV3A 3A4PA 2YM5A 3BBTB 1PMUA 3P7CA 1NVRA 4JBVA 2BZIB 2PMOX 2OSCA 2RFDA 3DTCA 3DU8A 2ITUA 4GH2A 4NFMA 3R1SA 5CSHA 1W8CA 3LIJA 3WZUA 5DNRA 2HK5A 4MEDA 4CV8A 2VV9A 2BFXA 4X3FB 5EI6A 4RVMA 3ULZA 3TUDA 1OIUA 5DT4A 2VX0A 3DA6A 2QURA 2BAJA 4EC8A 3H30A 4CLJA 3PTGA 1YHWA 5LXMA 3FMEA 4WUNA 2ZVAA 2OG8A 1KV1A 3VUTA 3VS7A 3C0HA 3DB8A 4QO9A 4U3ZA 2RSVA 4YLKA 4EH7A 3NGAA 4IZYA 2UW7A 3VS1A 5CNOA 1CKJA 1WBPA 1PKDA 3G6GA 4J95A 4NW5A 3IW5A 1B6CB 3ZBXA 4IEBA 2Q0BA 4WG5A 4DLJA 3WILA 2X4FA 5HLWA 3GCSA 4EH6A 5KKRB 1FMOE 3OWJA 4C34A 2ETRA 5K5NA 3TIYA 4BKYA 2Y4PA 5F1ZA 4MD9E 2YDKA 4F7NA 4BDIA 2QNJA 2X8DA 3S0OA 5T6KA 2R3IA 2VN9A 3E93A 3EKKA 3A8XA 2R3FA 1U4DA 4FIHA 3BL9A 2R3RA 4ZZOA 1J1BA 3O8TA 4H58A 4FEQA 4XEYA 3NZ0A 1QL6A 3GU4A 2NYAA 5G6VA 3OOGA 3SX9A 5CNNA 4M69B 1V1KA 2CLQA 2YAKA 2BZKB 2QR7A 4QDVA 2WGJA 4BCQA 2OJFE 3DNDA 3ZRLA 3PPKA 3RPOA 4FEVA 5AR5A 2WQEA 5F20A 4K1BA 1PMVA 3IDCA 4U0IA 1H25A 2X81A 5LMBA 3AKKA 4B9DA 3EQCA 1OKYA 4FL1A 1SZMA 3KRJA 3NUPA 4LV7A 1YDSE 3NR9A 2EUFB 4GS6A 4BC6A 3ALNA 3GOPA 4I0SA 3ZYAA 3EHAA 4UZHA 1PJKA 3G33A 4YTHA 2PMNX 4R77A 3V51A 5I3OA 1H24A 2ZM4A 5A46A 4JX7A 4D0XA 2ONLC 4PRJA 5GJGA 4BJJB 4L67A 2O65A 4MD7E 2IVUA 4OTWA 4X2KA 4J8NA 3NCGA 4FC0A 3Q9YA 4JQ7A 2UW6A 5HGIA 3IG7A 1STCE 1FOTA 2BRHA 2PUUA 2HXQA 4V04A 2XYNA 1P4FA 5HE1A 3BWFA 1E1XA 4M12A 5AV0A 2BFYA 5T3QA 4LGGA 2C5YA 2QR8A 1V0PA 3UO4A 1REKA 3TN8A 5L2WA 3U6JA 4WNOA 3RTPA 3CD8A 5AUUA 4C02A 1DAYA 2PVLA 3BLHA 3MBLA 3MH2A 3R71A 3SDJA 4P90A 4FG8A 4AXFA 4YZBA 4JG8A 3ZH8A 4AN9A 2PMLX 4O0TA 3BEAA 4XLIA 3FMDA 5L2QA 2XKCA 4U9AA 3JVRA 4J52A 1YXTA 3VAPA 3FMLA 4R5SA 3T8OA 1Y8YA 2JIVA 3MN3A 4G6LA 4XUFA 3ULIA 2H9VA 2QO2A 5J5SA 3NS9A 2J9MA 5IA2A 3K5UA 4F9WA 1XBCA 4CYJA 3FMHA 3OXTA 3OW3A 3RM7A 4W4WA 4JLCA 4S33A 3MS9A 4I21A 2B7AA 5EKOA 3I0OA 5JMSA 4TWPA 5EW8A 4E7WA 4CFMA 2PYWA 2FUMA 5CF4A 5CF8A 4J7BA 4HVIA 4AZSA 4FEXA 5D12A 3MJ1A 3VS3A 2XKFA 4G5JA 3BRBA 3ORTA 3UQCA 3AC5A 5C03A 2YERA 1XBBA 1W2FA 4ZK5A 3G15A 2F7XE 3V6RA 3W8QA 3R8ZA 3ZO1A 4D28A 4O1PA 2Y9QA 5GINE 1QPCA 1Q3DA 5J8IA 2J0IA 5CEPA 2AYPA 3VW6A 4QP3A 2W1FA 4YJUA 1ZYLA 5CU0A 2PSQA 4BTFA 4JVGA 1Y91A 3L8SA 3WF7A 2PVJA 3FKOA 4RPVA 4O4EA 4R6VA 4C35A 2B1PA 2VO6A 4UMPA 4D5KA 3NIEA 3OF0A 4QMPA 3W2QA 3R83A 1WBOA 3ACJA 4M0YA 4AA5A 4FUXA 4IAIA 4QP1A 1W84A 2OF4A 3TJCA 4C57A 1LEWA 5CENA 5FG8A 5CAUA 1JKLA 4KKGA 1J7IA 3LFDA 5EOLA 5C01A 4CRSA 5EM8A 4ZY4A 3D5VA 3NSZA 4S31A 2X39A 4WKQA 4GW8A 3VBWA 4ERWA 4G3DA 1P4OA 2FSOX 4BDDA 1PYEA 4C2WA 3CKXA 3CR0A 1ZWSA 1H0VA 4O4BB 4C8BA 4JBQA 4FNXA 4HYSA 4RIWB 1XJDA 2ITNA 4C3PA 2G1TA 4S34A 3ZUTA 3V5TA 4WG4A 1BUHA 3A4OX 2PY3A 4LM5A 4QMXA 4BCFA 4FTUA 3OWKA 3PE1A 3RPYA 5DRBA 3IDPA 3VONA 3LW0A 3UNJA 3F82A 2JKOA 3H0YA 2XK8A 2GQSA 3SG9A 3GC7A 4UYAA 4XNEA 1OGUA 2BRBA 2XNBA 2J2IB 2BDFA 1IASA 2WPAA 3LCSA 3GEQA 4I5PA 5EM7A 5IKWA 5LVNA 4KUJA 3OCGA 4O86A 4WOVA 1PHKA 1W0XC 2OJJA 3PRFA 3RZFA 5DRDA 5ANIA 1UNHA 3TZ9A 3RNIA 3KULB 3ZFYA 5ETAA 1ND4A 3UO6A 4TW9A 5E92A 2FA2A 3K2LA 4LUDA 2B9IA 5DH3A 1I44A 3NNUA 4FKSA 5HVJA 5L6OA 3LKMA 5I9YA 3ZC5A 2C6KA 5EK7A 3F5XA 3DOGA 4BL1A 4DFXE 2XRWA 1TZDA 4AFEA 3DAJA 4H36A 4Q2AA 4ASZA 5CI7A 1QPEA 4IXPA 4L3PA 2HZIA 1PXJA 5T68A 4EWHA 5I0BA 5EHLA 3AKJA 3FSKA 3OW4A 3HL7A 3VHKA 2X1NA 3EKNA 2OK1A 3QQGA 1LEZA 1Q61A 4HJOA 3RM6A 3CTJA 3R30A 2F2CB 3EN4A 4P5ZA 4BKZA 3CLYA 2X7FA 3UOKA 4O0RA 1G8KA 3LXKA 5DFPA 4F9YA 3S95A 2PVNA 3ZO3A 3QUEA 4CGAA 2VGOA 1J7LA 3Q4ZA 3UTOA 4X2GA 4EZ5A 5A4CA 2X8EA 5E90A 1P14A 1XR1A 3C4CA 5EDPA 3OXIA 2X6DA 2XK7A 4AP7A 4YZNA 4H3BA 3PFQA 4D0WA 4X21A 4YO4A 2H6DA 3BYOA 3AQVA 2CKPA 4UN0C 3QLFA 1H01A 2C6EA 4KIKB 3R9NA 3LCOA 4L42A 4AG8A 3QTUA 3P78A 4G17A 4JS8A 2W1IA 2XVDA 3W2OA 4EKKA 3PZEA 5ETCA 3RALA 4XV3A 5C4LA 3TI1A 5J1WA 3L8PA 4IFCA 2B9HA 4AAAA 3D5XA 3MFTA 4HYIA 4FOCA 4KIPA 5H8EA 3KA0A 3NX8A 3QTWA 3PXYA 3KXXA 3G9LX 5FTGA 4BICA 1PXOA 2XNGA 3CKWA 4QYFA 4RIOA 3VQUA 1FINA 2QU5A 4UV0A 1XQZA 4F09A 2WIPA 1R1WA 2PE0A 4J98A 5L6PA 4HCVA 5LMKA 2J6MA 2PE2A 1CDKA 2YZAA 4M7IA 5AR3A 5AP6A 2JDRA 1F3MC 2R64A 1DI8A 2BHEA 4RVLA 4HW7A 4KS8A 3TDWA 3BYUA 3QCYA 5AP7A 4IDVA 3SHEA 4EUUA 5E8ZA 4DEEA 4C58A 1UU9A 5FEQA 2QOFA 1PY5A 3W1FA 2OH4A 2VX3A 4L01A 4C4EA 3U6IA 4TKSA 4JR3A 5ANKA 3A7HA 5IQIA 2FB8A 3QTXA 4CFNA 5C8KA 1M2QA 4IM0A 3NFFB 2QOOA 5AJQA 2RIOA 1J7UA 5AUZA 3GU5A 4FNWA 4FKIA 3COMA 1X8BA 2P2IA 3TT0A 3D0EA 4BZOA 4UX9A 3R02A 5DI1A 5KMOA 3E7VA 1W2DA 4YMJA 2I6LA 3DV3A 2V5QA 4G6OA 2R3NA 3ALOA 4AZVA 5CF6A 3W2PA 3QWKA 4YJQA 3FZOA 3GC9A 1BKXA 3PE2A 4MHAA 4MF1A 3DQXA 5LMKC 2XMYA 3ZRKA 4U42A 3BGQA 3HUBA 3QRKA 2ITPA 4RFMA 4I4FA 4DDIA 3IPHA 4CFUA 5AMNA 3SG8A 3E8CA 4M3QA 5E8UA 4QMUA 2EB3A 2BAQA 3G9NA 3WF5A 3RPSA 3IW8A 4QDEA 4IWQA 3AOXA 4AOIA 1QCFA 3MVJA 3HRBA 2BALA 4U7ZA 2OGVA 4O22A 3EQBA 3PZHA 2WIHA 4KAOA 3TNWA 3VBVA 2ZMDA 4GEOA 3ERKA 5DT3A 3SQQA 4HGTA 4L00A 4QPAA 1HCLA 3GGFA 4EOOA 3MIAA 3VS4A 5H9BA 2J0JA 4AUAA 1VEBA 1MQBA 3C4EA 3KKVA 4HGEA 3KMWA 4MVFA 3PJ3A 2QVSE 4JR7A 4L3LA 3W2CA 2BTSA 2BHHA 5I4NA 4U44A 1HOWA 5A14A 1XH5A 3BQRA 3QKLA 4FV9A 3AC1A 3BU3A 3O50A 4Z9LA 2C3JA 3UG2A 4BZNA 4YTIA 4MBIA 4BDAA 2JIIA 3HECA 3PVGA 5EYKA 3LJ1A 5HEZA 3V8TA 4B4LA 4BYIA 5KZIA 5ITAA 3UDTA 2XK9A 2ITQA 2A19B 4P4CA 1V0BA 5FXRA 3GI3A 4UALA 2JLDA 3VF8A 5AUWA 5DN3A 3WZEA 5LOHA 3MH1A 5IEVA 3W0PA 3Q9WA 1OGYA 3JR1A 4GK4A 5DT0A 5HX6A 3MY0A 3ZM4A 4LOOA 3OS3A 3W8LA 3C0GA 3HP5A 2VWWA 5AUXA 5HNBA 3VO3A 2X8IA 3SRVA 4CFXA 4O83A 2QOKA 5BMSA 1DM2A 4UWYA 3GNIB 4TTHB 2UVYA 3AD5A 3NAXA 2W17A 5ETIA 4ZTRA 3RAKA 3A2CA 5C4KA 2B4SB 2EWAA 2XALA 3DZQA 4M8TA 3QZGA 4WBOA 4F6SA 1S9JA 2XF0A 3UIUA 4AT4A 5HO8A 1A06A 4GFGA 4HPTE 3N4UA 1ZOEA 2UZNA 1P5EA 3O8UA 2PVFA 3RI1A 3QD0A 1FPUA 2ZOQA 3F2RA 4NL0A 2R4BA 4AW0A 4DFNA 3AMAA 4NU1A 3RINA 4IVCA 5A4LA 3DLZA 3NYOA 4JIKA 3QHWA 3V5JA 2XEYA 4ENXA 3BGPA 1H0WA 1BLXA 4RLKA 4XMOA 1F0QA 3SW7A 3EJ1A 3CEKA 4DH7A 3F69A 5KKRC 4YBKA 4RT7A 5AV4A 1O6LA 4XH6A 2RKUA 4F7LA 3N4VA 2F7ZE 4FTTA 4O7ZA 5IQGA 4C36A 4KA3A 5DG5A 4BDBA 2BILB 3GB2A 2GNGA 3SV0A 4BZDA 2WD1A 1ERKA 3CD3A 3MW1A 4TYJA 4F6WA 4IX3A 5I9UA 4FKPA 4NK9A 4WO5A 2F2UA 4D4VA 3NIZA 4ZJJA 4GIHA 4NT4A 1ZMVA 5BMMA 4O82A 3R7IA 2VTAA 4I5HA 4QTDA 5KHWA 1KE5A 2F49A 4YZCA 3FYKX 5IQCA 5EOBA 5AEPA 4HCTA 5HBEA 4E93A 4M66A 3PUFC 5FP5A 5JGDA 1UU7A 5CAVA 3E62A 3HRFA 4FNYA 5CEKA 5FRIA 1GNGA 4F1TA 3QWJA 1XKKA 3OEZA 4YLJA 1RW8A 2W4KA 3M2WA 2VGPA 4ENYA 4IBMA 4LRMA 4QP7A 2C5XA 2IG7A 5IQFA 4GKIA 4IVBA 4GJ2A 3PSDA 4B8MA 3KXGA 3AC8A 2ZJWA 3FL4A 2P3GX 4DEGA 2F4JA 5DA3A 4DFZE 4I6QA 3QTZA 3NYNA 3TWJA 3R7VA 5A3XA 2OJIA 4I5CA 3VUDA 4KINA 1NT2A 4D1XA 4ZSGA 4KIQA 5ACBC 3BPRA 4LL0A 3ORNA 3VQHA 3C7QA 1Q8WA 1VYWA 2A98A 1ZARA 3F3TA 1YWNA 4RJ6A 5EM5A 3C5UA 3F3VA 3KC3A 2VNYA 3Q53A 4GU6A 3LLAA 5DYJA 4XOZA 5HICA 5KZ0A 2VTPA 4QTEA 2C6TA 3FI2A 3OD6X 5DOSA 3NCZA 4UB7A 5EFQA 1PKGA 2Y6MA 4C4FA 5AP3A 4CCBA 4E4NA 5IU2A 2ETMA 2UZWE 2ZM1A 3BYVA 4GK3A 3S00A 5IQBA 4WBBB 5FLFA 3T3VA 3R7GA 4TPTA 3BHVA 2JDTA 5TO8A 2G15A 2GPHA 4X6RA 5AP2A 4AGWA 3A8WA 1WFCA 4R8QA 3WBLA 4IQ6A 4BCJA 4BTKA 1WVYA 4XYFA 3PIYA 4RLLA 4BVUA 4XBRA 4Y8DA 2B9FA 4YJTA 3W0QA 4QMZA 3LFEA 1F5QA 3P4KA 3R73A 4ZS0A 1PMNA 4PL4A 5CAOA 2XJ2A 4JX3A 2XARA 4IAFA 3P08A 3TNQB 5CS6A 1KSWA 3LHJA 3PXZA 3UDBA 4BWPA 5EYMA 4O6LA 5IQEA 3PJ1A 2WTKC 4Y73A 4C3FA 5E8TA 4CTCA 4QT1A 3FC2A 2SRCA 2QI8A 1URWA 2Q83A 2YLEA 4BGQA 3BEGA 3DKOA 4MXYA 3QCXA 4OTRA 3BL7A 5JKGA 3MY1A 3D5UA 4DT8A 4NH1A 4KBKA 3HA8A 4YSMA 4H1MA 4K77A 4RMZA 4BI1A 3QTQA 4BB4A 4D4RA 1H28A 2XBJA 1ZOHA 3HP2A 5CSPA 4D9TA 5HZNA 2W05A 5DVRA 4AWIA 1BI8A 3ORZA 4FK6A 4D2TA 4IW0A 3ANRA 4TYGA 2BVAA 3EQRA 3Q6UA 3WE8A 3Q9XA 3B8QA 3IONA 2UW4A 4P5QA 1K9AA 4PQNA 1OZ1A 1I09A 4RVTA 2NPQA 4Q9SA 4BDHA 5DR9A 3BLAA 2XZSA 3W0NA 3PLSA 5CI6A 4YC6A 5CANA 2O0UA 5KMLA 4ZLYA 1UNGA 4AXCA 4IE9A 4F08A 2JGZA 3FE3A 5K4JA 5JRSA 1YI6A 1G8JA 3R7YA 2W5AA 4EK3A 3R9OA 3ROYA 1YXSA 5F95A 3C4FA 4G2FA 4K9YA 5HLNA 3ZM9A 3L1SA 2OO8X 5AIKA 3W10A 4AT3A 2YA9A 1NY3A 1PXPA 2ESMA 4FV7A 5A54A 3O5AA 5DLSA 4QTAA 4U45A 4DHIB 2HENA 3E88A 3ET7A 3CC6A 4IIRA 4W8DA 3ZU7A 2XIRA 3QZHA 3UE4A 4OTDA 3DCVA 3R1NA 2P55A 3T9IA 2OLCA 4JT3A 4O2PA 4YZ9A 3R9RA 4CNHA 3PY3A 3RWPA 3DK6A 2XUUA 3QQJA 4ACHA 1VLRA 4KRCA 2WZJA 1WBSA 3Q9ZA 2X6EA 5HD4A 3R7UA 4X2FA 2J0LA 3BE9A 5LVOA 5DGZA 3QX4A 4E73A 4D4YA 5HG8A 3EFKA 1JLUE 5E91A 4GKHA 5EQEA 4H05A 3W0SA 3DKFA 3UOHA <