3EQPA

Crystal structure of ack1 with compound t95
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
274
structure length
268
Chain Sequence
LTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Activated CDC42 kinase 1
publication title Identification and optimization of N3,N6-diaryl-1H-pyrazolo[3,4-d]pyrimidine-3,6-diamines as a novel class of ACK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 268
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3eqpA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3eqpA01
5A6NA 3C4CA 5B7VA 3FPQA 3ZFXA 2WMWA 3GI3A 4MD9E 4RX8A 4UWYA 2YIRA 3NUNA 3WF6A 4E93A 3EJ1A 4Y72A 4ZTMA 3DBFA 2QOOA 4FT3A 4D2SA 2R3PA 3H3CA 4KWPA 4NW5A 2W1CA 4NM7A 4X2NA 5HCYA 3FZOA 4FL3A 4O0WA 4G3GA 4H36A 3MSSA 3HYHA 4ITJA 4QMWA 4AZEA 1PKDA 3EN9A 4EH4A 3IPHA 3QZFA 3QUPA 3NCZA 3Q5IA 4U41A 5H8BA 4EYJA 4F63A 3P79A 2JIUA 4MWIA 3KF4A 4MQ2A 4F1TA 4MQ1A 5A4QA 3I81A 3DGKA 4H39A 4JQ8A 3PLSA 2VX1A 4HPUE 3UQGA 4B8MA 2GHMA 2PE0A 1O6YA 3IONA 4ACMA 4C0TA 3L9LA 3OXIA 4IX3A 3SKCA 4CYIA 4XRJA 4EOOA 3ZUTA 2ITZA 1AD5A 1P4OA 4K2RA 1YW2A 2JFLA 4DITA 3EOCA 2UZUE 5KBQA 4O82A 4FTLA 4FKOA 3UOKA 3BE2A 4TWPA 3ZFYA 3UZTA 3ZEPA 2UZLA 4J71A 1OKYA 3FEGA 4C2WA 5IISA 4A4LA 4ZLYA 3AC3A 4GVAA 4ARKA 5EK7A 2WZJA 3PPZA 2Z7SA 3M1SA 4D1ZA 3GUBA 3NUAA 4IFCA 2W1EA 5CX9A 3N4UA 5CU2A 2IZRA 3DB6A 2XKDA 4AE6A 4EQMA 4RJ6A 1IRKA 3P7AA 2HWPA 4FEVA 3QALE 2GNFA 4F65A 3ORNA 3IECA 2YCSA 4YTHA 3ZLXA 3UQCA 3EZRA 4I1ZA 3EYHA 3LAUA 4NEUA 2WXVA 3SX9A 3PJ1A 4YTCA 2PSQA 2PZ5A 4PTGA 3O23A 4IAZA 5CU6A 4KIQA 5KE0A 2C6TA 3AT3A 4IWQA 4QMTA 4L00A 4FTCA 5ITAA 3OTVA 4BGHA 4YPSA 5AWMA 4FK6A 4K6ZA 3IDBA 3QQFA 2PMOX 3R2BA 2BAJA 4OUCA 4YLKA 3FZSA 3WF5A 2UZEA 3CY3A 4YBKA 4B4LA 3QWKA 1PXOA 3HMMA 4IVDA 4LUEA 5BYLA 3PE1A 3M2WA 4PL4A 2F7XE 3BCEA 3EN6A 5E1EA 2BKZA 2XEYA 4ZTRA 4D9TA 3MS9A 4A06A 4EH3A 3E63A 5C1QB 3A99A 1G3NA 3EN7A 3QGYA 4GEOA 3BGZA 1LEZA 4GIIA 4OTFA 3ZDUA 5CAUA 2I40A 4QMZA 4MBLA 1MQBA 4GKIA 3F2AA 1MRUA 4MAOA 4D55A 2YWVA 3DXPA 3OZ6A 4O7RA 3F66A 3C1XA 5HD4A 2CCIA 3HA8A 4HGSA 5CTPA 2EB3A 5L2WA 4D2WA 2GQSA 5JSMA 1CSNA 3OMVA 3PJ2A 3PXYA 1XH7A 2WU6A 4ZTHA 5L8JA 3VS7A 5EYMA 3WOWA 2GCDA 2J0KA 1XHAA 1YDTE 2JD5A 3QC9A 4YMJA 3SA0A 3GU6A 4FTUA 2I0VA 4QMYA 3RJCA 4PDPA 5CAPA 1M14A 3LMHA 4ANSA 5CENA 3VQUA 3D9VA 4C62A 5HTCA 1T45A 2VTSA 4HYHA 2GS2A 4QRCA 5DR2A 4AZFA 5HG7A 3TL8A 2WO6A 4MF1A 4QMMA 3QBNA 3K3IA 4JOAA 5GZ8A 2O64A 3LFFA 3GU4A 4IDVA 5FD2A 5G6VA 4FZAB 3R1SA 4KIKA 4XG9A 3TI1A 4CZYB 4EBVA 3BHUA 4TWCA 5J9ZA 3ROCA 4QNAA 1Q3WA 1V0BA 4FKSA 3TKIA 3GU5A 3B2TA 3MV5A 4RIXA 1CDKA 3LXKA 4QYYA 3KK8A 5AIKA 3QGWA 1REJA 3LFAA 2VTTA 5IQGA 4NTSA 3QCYA 3S2PA 4BB4A 3EQPA 3KA0A 5A4TA 4DH5A 3UVQA 3KULA 4C33A 5H2UA 5A4CA 3FMDA 5KBRA 3BHTA 4ZJJA 2YJSA 3RALA 4EBWA 4YLLA 4FR4A 2CLXA 4WRGA 2P3GX 4HZSA 3D83A 4PP9A 4EOPA 4PTCA 1YI3A 4C3PA 2C6DA 2ZV7A 3VRYA 4A9TA 3WIKA 3C51A 1YI4A 4FUXA 4E3CA 3QQKA 5IDNA 2R3FA 3NX8A 2RG6A 5DVRA 4TNBA 5TR6A 2DWBA 3IW6A 4FKJA 3JVSA 4U81A 1WBPA 2VWIA 1J1BA 4MCVA 5LMBA 5AUZA 2XIZA 1NY3A 4FIHA 3FDNA 1A48A 4YJOA 3W2OA 4IWDA 5HE3A 3QQLA 2ETMA 2YDKA 4S31A 4N70A 4DG3E 4ACDA 4FGBA 2I0HA 2JDVA 2WMUA 4C4FA 3PVGA 3QQGA 5LQFA 4UXQA 1H07A 1XH6A 3BGQA 4H58A 4IDTA 4PX6A 3ZC5A 4UMUA 4UXLA 3HL7A 4CTCA 4YZBA 4FODA 4BCPA 2XZSA 3QCSA 4BHNA 3OWKA 2GMXA 4BVUA 5HU9A 1DAWA 4P5QA 3R7OA 5BVOA 4WG3A 4KRDA 3OOMA 1YXXA 3V8SA 3CGFA 4O22A 3UNKA 4IX5A 4L3PA 5CXZA 2XJ0A 1YKRA 2R3OA 3QHRA 4R7HA 2PZIA 3CPCA 4AF3A 4UYAA 4IZYA 4B0GA 3F2RA 4FV0A 1ZMUA 2WOTA 4GK3A 3MVLA 4F7SA 4RG0A 1PHKA 5CZHA 4L43A 3QD3A 3LM0A 3ALOA 3PY3A 4FEWA 3ENMA 4KBKA 4RZVA 3VHKA 2CKOA 1FQ1B 5CT0A 1M2PA 2PVKA 2QOIA 3LFEA 2JBOA 3ITZA 2Y4PA 2OXXA 3D94A 5IA2A 3VBTA 1OUYA 2YM4A 3F3ZA 4RA4A 3PRFA 4RJ4A 5CASA 3FWQA 4HCVA 2VNWA 2UZTA 4FKLA 2CNQA 3TJDA 5FUTA 3JPVA 3HRCA 1F5QA 3O17A 5IQIA 3QLGA 1J7LA 3D2KA 2Y6MA 3GU7A 3I5ZA 5AADA 3QRUA 2X9FA 4IZAA 2XK8A 3C13A 5J79A 4FL1A 2CKEA 1QPDA 2E2BA 2G9XA 5E8TA 3C0HA 4QQCA 4ENYA 3CCNA 4JG8A 2XNEA 2Z02A 1BL6A 4R3RA 2ZB0A 2R7BA 3OP5A 4OBPA 4TL0A 4QT1A 2X0GA 4DGOA 4DEGA 2PZPA 2P33A 5IQDA 2JDRA 2W9FB 1U54B 3AT4A 3KXHA 5FXRA 1RDQE 4O84A 1OM1A 1WZYA 4N6ZA 2C6KA 2OFVA 4CLJA 2Y6OA 4X6QC 3LJ0A 2DS1A 1PXKA 2A2AA 5DN3A 1KV2A 2GFSA 4ASDA 5B2LA 3TM0A 2LGCA 3BQCA 4X0MA 5ANOA 2GFCA 5FM3A 3ATSA 4FOCA 2WPAA 3U6IA 5M57A 4DEDA 5GJGA 4Y83A 3W2CA 3E8DA 4M7IA 5IUHA 1OI9A 2YCQA 3A8WA 3FLZA 2C3LA 3MN3A 3MPTA 4QTBA 3U9NA 1JSVA 4HZRA 2C3IB 2O5KA 2IW9A 1IA9A 4ZMFA 5GJDA 4FT5A 5IQHA 3IK3A 4DT8A 1TQMA 3LFDA 2QO9A 2R3JA 4QMXA 3EKNA 5EI8A 2XNGA 3F3VA 2WELA 1VEBA 3PY0A 3PYYA 3EFKA 3FKOA 2ZM3A 3EZVA 5JRSA 3NS9A 1YXUA 4YNOA 2WTJA 4PNIA 3ZO1A 1GY3A 2GS6A 5IUGA 1KE6A 2CMWA 2VWVA 2CJMA 2WMQA 3DXQA 4ORKA 4R5SA 2ZYBA 4ENXA 4AP7A 5HBJA 3C4ZA 3RPRA 3WI6A 2XNMA 1PXIA 3AMYA 3DOGA 3E8CA 1ERKA 4JG7A 1KOBA 5T6KA 4AX8A 4E1ZA 2ZB1A 3DA6A 5HORA 3OY1A 1FMOE 2UW3A 4NM5A 2B55A 3E88A 3H9OA 2IZSA 2X1NA 5KMMA 3CSVA 4XV9A 2UV2A 3I7CA 2W1IA 4MF0A 4L6QA 4HVSA 4M97A 3LPBA 4AGDA 2VO6A 5AM6A 3M42A 2P4IA 4KB8A 4YLJA 4R1YA 4G31A 2EXMA 4XG2A 3R8MA 2VX3A 2R3IA 4BI0A 2HXQA 3L8XA 4HVHA 4CSVA 1OKVA 3R7IA 3OROA 3CS9A 3EFLA 4LRKA 4W4WA 2WIPA 2UW4A 3GU8A 3R6XA 3PA4A 4RWJA 3UIMA 3UNJA 4U0IA 2JIIA 3VS5A 5BVDA 5J95A 5EKNA 5TOZA 2HCKA 4X3FB 2G2FA 3DFAA 4PPAA 1LR4A 3D2IA 3ODYX 4E6QA 3OF0A 4V0GA 1STCE 4EWHA 1KV1A 1OIQA 3MFTA 4FV2A 4ZY4A 4H3BA 1JOWB 3RGFA 2VTLA 3C4WA 5D7AA 5L2QA 3R9DA 2PMLX 1O6KA 3OD6X 3F2NA 4GFMA 3R8ZA 3LQ3A 1PYXA 3AD5A 2OBJA 4FIGA 3EQBA 3L9PA 1ZZ2A 4G34A 4HW7A 3UDBA 2W4OA 4ANOA 4LI5A 1Q8YA 1YHWA 1YHVA 3LCDA 5BVEA 5D10A 2GS7A 4O38A 5AR3A 1GIHA 1PMNA 4A9UA 1NW1A 4O1OA 2BVAA 4TY1A 4MBJA 1PXNA 3P78A 3WF9A 3PVUA 1BI8A 3ZM9A 4JXFA 4RWLA 5HLWA 2F4JA 1V1KA 2FSTX 3LFNA 5AP0A 5ANEA 4C02A 3EQHA 4LGDA 2J6MA 2SRCA 3W18A 1OL2A 4TNDA 4E4NA 4KAOA 2V7OA 2RSVA 4YURA 3HRBA 4G5JA 2QG5A 3SXSA 4C36A 3ZM4A 4EOSA 4FKPA 5E8VA 2FSLX 4JBVA 4I5CA 4DCEA 4DN5A 3G15A 1PKGA 2BKKA 4RJ5A 4NCTA 5BUIA 2IVUA 5J1WA 3TUCA 4M69B 5CY3A 1GOLA 2FSMX 3EL7A 2OIQA 1PXPA 4O91A 4DEIA 5LVLA 4DH7A 4QMNA 2ZM4A 4CFFA 3PG1A 3ZU7A 3PXFA 3K5UA 3VWAA 5M53A 2C6LA 3ZRKA 3BHVA 1WBTA 1WCCA 3HZTA 2OJJA 2WAJA 4UBAA 1JSUA 3NVMB 3IDCA 3D5UA 5FDXA 5FBOA 2PVNA 4CRLA 1YXSA 3LW0A 3WZEA 4K8AA 3HP5A 1WMKA 4N0SA 3DQWA 3AGLA 4O86A 3L9NA 4BDJA 1L3RE 1H26A 5KMJA 4RIXB 1Q8UA 4DTAA 3BU6A 5KMOA 3Q6UA 5J9YA 3IS5A 4M13A 3PJ3A 4TYEA 4JBOA 4IANA 3VS2A 4LMNA 1W0XC 4N4SA 3U55A 3QLFA 3K54A 4OTHA 2WD1A 3KMWA 3OT8A 4FTAA 4MXAA 4BCJA 2XB7A 4PP7A 1H00A 4RC3A 2CCHA 3NYVA 4QNYA 5H3QA 4DFZE 3JS2A 3RTPA 3ZMMA 3HV5A 4IEBA 4UWCA 4FV7A 3ZOSA 2IO6A 3KRRA 3P86A 2G1TA 2QOCA 4FKWA 3DCVA 5KMKA 3DV3A 2Q83A 2ITNA 4EH9A 2WMRA 5ETAA 4BCHA 4UALA 3C5UA 5K0KA 3TACA 4FZ7A 1YDSE 4LOPA 4UYNA 1FBNA 1UKHA 4E4XA 1JAMA 4FA2A 2W99B 2A27A 1BMKA 1DAYA 3AXWA 4JVGA 5J87A 2RFEA 2PVFA 4RA5A 3AGMA 4M84A 4I94A 2XK4A 1SMHA 3ENHA 5ETCA 4PDSA 4PQNA 2B9HA 1ZAOA 3NWWA 3ROYA 2EVAA 4A9YA 5AUXA 3UMWA 1H0WA 4II5A 5GZAA 3G9NA 4GW8A 4AGWA 2GNGA 1WFCA 4QD6A 4BZNA 2O3PA 4ZXTA 1A9UA 2UW6A 2ERZE 1UNHA 3FXWA 3QQUA 4RVKA 4BDGA 5CF5A 3QXOA 3F88A 2X6DA 3LOKA 2WMVA 3LXLA 5TT7A 4DFNA 3PIXA 4QMSA 5ANJA 2V62A 5E92A 3LLAA 2OXDA 4W9WA 3CIKA 3JY0A 4RWIA 4O0RA 3PVBA 5CSVA 4IB1A 5L3AA 4M0ZA 3BV3A 4C3RA 3P7BA 4CKIA 4WBBB 4I5MA 3VIDA 5AAFA 1H08A 4JG6A 4AOTA 1JSTA 2HELA 4C3FA 3BIZA 2NNWB 3ZXZA 4U45A 1Y6BA 4FIJA 1GZNA 3WYYA 2BRBA 3NEWA 3EWHA 5E1SA 2PUPA 1YWNA 5A14A 4WSQA 3QD2B 3FMJA 1KWPA 2G15A 1KE8A 3OTUA 4PMPA 1OBDA 2BR1A 4CZUA 4ID7A 1URWA 1JKSA 4FT0A 2UUEA 2WQOA 5E8ZA 5ANDA 3RWQA 3E5AA 3ODZX 4L67A 5FEDA 4X21A 4EHEA 3E64A 2OJ9A 3W8QA 1WBWA 5JZNA 1W8CA 3SOAA 3OT3A 4RJ3A 5TO8A 2UZOA 4F1OA 2C6IA 3R21A 3SOCA 3S4QA 5GIOE 5IUIA 4AXAA 2CKPA 4C7TA 2W05A 4KINA 3KEXA 5L8LA 1V0PA 4MNFA 2BTRA 1DI8A 3QKMA 4IC8A 2PMNX 5E8XA 3R7GA 3RP9A 3EYGA 3FSFA 5IQAA 3BLRA 4IB3A 3ZHPC 3L8VA 4BI1A 5A4LA 3SGCA 2JEDA 4B6LA 2XIXA 5DRBA 3V6SA 5JT2A 4FKIA 4L3JA 4XRLA 3UC4A 4FMQA 4IHPA 1R0EA 3ZS5A 2QD9A 4ANLA 5CU4A 3C4XA 2W1GA 3HV3A 4C34A 4QTCA 4EK6A 3TZ9A 4FEXA 5C4LA 1SNXA 4IACA 3CXWA 3SC1A 5K0XA 1XJDA 3GCQA 3KXGA 4KKGA 3G2FA 4ZZNA 1IAHA 3QU0A 3NGAA 3CJFA 5TKDA 1IA8A 1Z57A 2QO7A 2AYPA 2BAQA 3ZEWA 4U7ZA 3ZRLA 4EH8A 4NKAA 4EUUA 2F9GA 3NNUA 3NSZA 3NW7A 5J8IA 4OT5A 1REKA 2XJ1A 4BR3A 4WBOA 3FSKA 2XF0A 3MI9A 4P7EA 4MWHA 4L42A 3ZXTA 3R83A 3NPCA 4CFUA 4OTIA 4PDYA 4R7BA 5HX6A 2Q0BA 2VWBA 5FTOA 3NNVA 4F0GA 4NJ3A 2OH0E 3O71A 4AT4A 5CQUA 4Y5QA 3PTGA 4LV8A 1O6LA 2ETRA 3DTCA 5FLFA 3SLSA 4CXAA 5HX8A 1P14A 4BWPA 3W2SA 4FTOA 1R1WA 3I1AA 1WVWA 3FXXA 4I20A 1L8TA 4APCA 4GKHA 3OY3A 4YHJA 4ZY5A 4IWPA 2I6LA 2R3MA 4FKQA 4H1JA 2AC3A 3SD0A 4IXPA 3FMNA 2ZJWA 4J7BA 5FP5A 1ZOHA 3W2PA 3RNYA 3FY2A 4FIIA 3NUUA 4AZVA 2P2IA 2J0MB 1GZOA 3GC0A 1XR1A 2JGZA 1SYKA 1K3AA 1WAKA 5KNJA 2LAVA 5CEPA 5F9EA 4D58A 2A19B 4F6SA 4GG7A 2CDZA 2QOFA 3P7CA 3A60A 4V0GB 2CHLA 3FI2A 2ZV2A 4RLLA 1J91A 5A9UA 3DNDA 3TXOA 3QX2A 4DBXA 4MX9A 3KCFA 2JITA 3AC4A 3ACJA 2QHNA 4EHGA 5CSWA 5DEYA 5CEOA 4I21A 3R1QA 4QOXA 4CYJA 2W4JA 4U8ZA 4PPCA 3HKOA 4UZDA 2RF9A 4WOVA 4RMZA 1ZYJA 4NW6A 4XOYA 2C5XA 5IA0A 5IKWA 3OEFX 3A7HA 3RWPA 3EMGA 3UO6A 2PVMA 4ALVA 3BBTB 3AT2A 4OBQA 5KUPA 2C5VA 4ACGA 4HCTA 4IZ7A 2PHKA 4BDKA 3EB0A 4IMYA 5CSPA 4FV3A 2VTJA 4L7SA 3OOGA 4ANMA 3D7ZA 5AM7A 4C59A 3GP0A 5L8KA 3VUHA 1OL6A 1BX6A 1VJYA 2OZOA 5HG9A 4Y46A 1H1WA 5EDPA 2OJGA 5IQBA 5I4NA 3QWJA 3RZBA 2CNUA 4O7WA 4BTMA 4YJTA 4X3FC 4W9XA 1X8BA 4GL9A 4F6WA 1U54A 2P2HA 3LE6A 3LVPA 3I5NA 4ITHA 5AUWA 5FM2A 2NP8A 3IW4A 4MVFA 3FMHA 2V7AA 3MYGA 3P9JA 3F7ZA 3R28A 2XBAA 3Q4ZA 5DHJA 3R01A 5E90A 4LYNA 1UWHA 5DA3A 5HE1A 5BNJA 2R3RA 5AP5A 4ZTLA 5A6OA 3DY7A 1LP4A 2CNVA 5CQWA 4HVGA 3NW6A 5F94A 3EQIA 1I09A 5EYKA 4BCGA 1WBOA 3U8WA 3GC7A 4J97A 4C35A 2BMCA 3PIZA 1NVRA 1TQPA 4FSNA 5C01A 5IH6A 4ZK5A 1U4DA 4Z55A 5CALA 4ZSJA 4X2GA 4FV9A 1OPJA 4S32A 1W83A 3FMKA 4X3JA 3ZUVA 4BY9E 4R1VA 2CKQA 4GT3A 3PZEA 3R2YA 3DKOA 2YM3A 2RL5A 2HAKA 3OWPA 4GJ3A 1CKIA 1UKIA 1E1XA 2R3LA 2FUMA 4FG9A 4O96A 4YUQA 4KSPA 1B38A 4O1PA 1NVSA 1ATPE 3H9RA 5D12A 5AMNA 2WEIA 2C0IA 5CEIA 3THBA 2W1ZA 4CTBA 1BKXA 5AUUA 4FV5A 2GQGA 3R7VA 1KE7A 2JDSA 3PRIA 3QCQA 4GFGA 3CLYA 2QOQA 5CT7A 3TN8A 4YZDA 4WNPA 4QP7A 5D41A 4CKRA 3B8QA 4EKLA 4LGHA 4QYGA 3MY0A 4O2ZA 4CZTA 3TUDA 2G01A 5EM5A 4D4SA 5A46A 4KA3A 3KXZA 2C3JA 4L9IA 3KRLA 4IAFA 4YJVA 5CVFA 4BC6A 4O7ZA 1ZYLA 3RK7A 4ZSGA 3N4TA 4IX4A 1GIIA 3PIYA 4DINA 2J90A 2XP2A 3MVHA 4ZEGA 3HX4A 3KVWA 4YJQA 5AR4A 5HVJA 4QP8A 3FI8A 3IOKA 3VS6A 2V0DA 4X3FA 5LCJA 2W1DA 2YLFA 3MH1A 3RM6A 3LLTA 4BHZA 1ZYCA 5HEZA 2VTRA 5EM6A 3OHTA 4JR3A 1OGUA 1Q24A 1H1RA 4G9CA 2PVHA 3CY2A 2C6MA 3CTHA 4MTAA 1KSWA 5DWRA 5EDQA 3SDJA 4ZP5A 2WMAA 3EL8A 3FYKX 2RFSA 3LZBA 3R00A 3T3UA 2PZYA 3RZFA 4Z7GA 2BILB 3QHWA 1Q3DA 4DHFA 4TYGA 5K5XA 4FT9A 5BMMA 4LG4A 4HGLA 3ZUUA 3A2CA 1XBAA 1Y57A 4RFYA 3NAYA 3EQDA 1OPKA 3HEGA 3E8NA 5FXSA 5C8NA 4P2KA 3VW8A 5M06A 5HG8A 4WA9A 5EQEA 2IN6A 4WD5A 2PL0A 4WO5A 1OIUA 4YC8A 3O96A 4BIBA 3KRXA 2UVZA 1WBVA 5HVKA 4EOKA 4L52A 5I9YA 4W8DA 5DT4A 3S0OA 4K9YA 4BFMA 3WF7A 3Q6WA 1DM2A 5AV4A 2PWLA 3JR1A 5KMNA 3TDVA 2BZIB 4OTRA 3GEQA 4F7JA 3H0YA 3KCKA 3MY1A 4HYIA 3C4EA 1JKKA 4GUBA 4JBQA 4M69A 4DGGA 3ZSIA 1FVTA 3GC8A 3PVWA 5IMEA 2YFXA 3ZZEA 2NRUA 3K2LA 3Q53A 4XBUA 4FZDB 4G3EA 3PUPA 2XJ2A 3V3VA 2I1MA 4FE2A 2OIDA 3QRKA 4CCBA 3F3WA 4J98A 3LFBA 4M14A 4YSJA 5LJJA 1NA7A 4OT6A 4OTWA 2XM9A 3DXNA 4ZTQA 3UIUA 4DT9A 4B9DA 1BLXA 3SW4A 4ANBA 3DAJA 1GNGA 3IGOA 3NUYA 2ITPA 3A4PA 3OW3A 1DS5A 5JN2A 4FEUA 1QPEA 1FPUA 4LFIA 4ZS4A 3HDMA 2PTKA 3GXLA 4NK9A 3E7OA 4X2KA 2BZJA 3PWYA 3UO4A 1APME 3MTLA 5HE0A 2XIYA 3DZQA 3VN9A 2HZ4A 3HMNA 1Q5KA 2ITXA 2YA9A 2OXYA 4EKKA 4NU1A 4CFXA 3F82A 5AR5A 3Q2JA 3E92A 3MWUA 5EOLA 3L8PA 4F1MA 1H24A 3EHAA 4IVCA 3UP2A 5LCKA 2JKQA 4X2JA 3VUMA 4BTJA 4NTTA 3MBLA 3UIBA 5AA9A 3HNGA 3QX4A 2E9NA 5IMXA 3CQUA 1ZYDA 4DG2E 2IVTA 3VF8A 1Q8WA 5JGDA 1MUOA 4G6OA 3NZ0A 5EQYA 3JVRA 1XH4A 3MFRA 2C68A 4F6UA 3GNIB 2BZKB 4QQ5A 5KZIA 2H6DA 4EWQA 4FX3A 4XV2A 4D0XA 4EL9A 1DI9A 1R0PA 4YJRA 5BUEA 5JK3A 2C5NA 2V22A 3O8UA 4ZTNA 3ZONA 4Y8DA 3WZKA 1UV5A 1H1SA 4QMVA 4ZMEA 2QKWB 3VUKA 2WTWA 4ACHA 4U9AA 3NIEA 2QOKA 1OIYA 5FQDC 3CKXA 3ANRA 5FBNC 4XV3A 4H1MA 3TV7A 3W2RA 3VVHA 4F99A 3U54A 1F0QA 4FV6A 2RIOA 5CEKA 3CQWA 4AE9A 2C1BA 4MXCA 5AX3A 4OAVB 4G3FA 4G6NA 3V5JA 4F09A 3UOJA 5F4NA 4FSMA 4GFOA 4IJPA 2C30A 3W10A 5D9HA 4YZ9A 4GT4A 3DNEA 3FYJX 3FC2A 3R8LA 4FYNA 2WTIA 2R0UA 3OXTA 3U4WA 4EUTA 4DG0E 2OK1A 5K5NA 2H9VA 3BU5A 4UB7A 3CKWA 3O50A 2G2HA 2R5TA 5CAQA 3UODA 1XO2B 2PZRA 5BVKA 3V5TA 2F2CB 1CM8A 3QRJA 4GG5A 2EXCX 4U42A 3TTJA 4E5AX 3EN4A 2RFDA 2BALA 4G1WA 4JIKA 2OU7A 3GB2A 3QRIA 4KSQA 3EQFA 4GU9A 4X2FA 5CXHA 3SAYA 3TTIA 2VU3A 4NM0A 2RG5A 4QYFA 3RKBA 5JGBA 2WHBA 2X6EA 2WMTA 3FLQA 3GC9A 4D9UA 3V8WA 4BF2A 2QLUA 2R4BA 2B54A 2IVSA 4FICA 4YJUA 3I60A 1RQQA 3POZA 4IFGA 4NIFB 3RAWA 2IZTA 1UU9A 1PF8A 3TZ8A 4MXYA 3FMMA 3RAKA 3ORZA 2V55A 2E9PA 5I3OA 4AACA 4IQ6A 4RVTA 4MYGA 3CD8A 2BIKB 3QUDA 5CF8A 2E9VA 3RCDA 4DH1A 4D4RA 5IDPA 2IPXA 2GHGA 4FNWA 3DB8A 1JNKA 4RZWA 4FVPA 1OKWA 4P4CA 5CI6A 4AA5A 4EH5A 5JKGA 4XX9A 4AOJA 4NL0A 2XH5A 3R1YA 2QKRA 3IOPA 2ZVAA 4IJ9A 1B39A 1R3CA 2C5OA 3GQIA 4FT7A 5IQEA 3FL4A 4FTMA 1PJKA 3GCSA 1XBCA 3TG1A 1SVEA 3R04A 3KREA 2JFMA 4OR5A 5DH3A 2B4SB 2WNTA 2X8EA 3P0MA 2PVRA 3D5VA 4U3ZA 1Q41A 4Y85A 3O7LB 3MJ2A 4IIRA 4I4FA 3G0EA 5HNIX 4JDHA 4TKSA 1QL6A 3GVUA 4CV9A 3R1NA 3BV2A 4JBPA 2XKFA 3UO5A 3EH9A 2XEZA 4CQGA 4ACCA 2C6EA 3OXZA 1CTPE 3GFEA 2WQNA 3C7QA 4CMOA 4WUNA 1YXVA 2QODA 3S95A 4ANQA 2B9FA 4PWNA 1LPUA 1IG1A 4EJ7A 4NCTC 4CFVA 4O81A 2YIQA 2C5YA 4FNXA 4BCMA 3ZLSA 3L8SA 4RVLA 1PW2A 1M7NA 2YABA 3IO7A 3WILA 4J96A 3ET7A 3FHIA 3UYSA 4LUDA 3S1HA 2BDFA 3I0QA 3QZIA 3KY2A 4JX7A 4YNEA 3DKFA 3MFUA 2QU6A 4EC8A 4ZLOA 3R30A 4NKSA 4RT7A 5HE2A 3R9NA 5FWKK 5L4QA 2BUJA 1IEPA 2BHHA 3O8TA 4WIHA 5D1JA 4H05A 4FVQA 4ZZOA 4MK0A 4OAUC 2W1HA 1WVYA 4DF3A 4I6QA 4L7FA 1Q99A 5H8EA 3DTWA 3NVKI 3L9MA 2XIKA 4BZDA 5DE2A 3TNHA 2WKMA 3EQGA 5EM7A 4IADA 5BX0A 3QKKA 2YCRA 2VTQA 1JLUE 3FC1X 3KRJA 2BCJA 2PE1A 5CI7A 5IA3A 2XK7A 4LL0A 1ZYSA 3WBLA 3FLYA 4DTKA 4ASEA 2ZV9A 5I9UA 1ZLTA 3HDNA 2ZMCA 4Y95A 2Z7LA 3SVVA 3C50A 4CRSA 4FTNA 1JWHA 5CF4A 1PRYA 4BIEA 2J9MA 4O6EA 4LV5A 5HO7A 4HVDA 1BI7A 1QPCA 2ETKA 1K9AA 3KXXA 4AA4A 1XH9A 4YZMA 2I0YA 4ZOGA 4FIEA 4DH8A 3MESA 3BWJA 4K11A 4M8TA 4TZRA 5T3QA 5KX8A 1UU3A 2UW5A 3FZ1A 3HAVA 3VBVA 4O21A 3UG2A 3BI6A 3QYZA 2ITOA 3GBZA 4FTIA 2VRXA 4KKEA 1W84A 4HGEA 3QL8A 3RM7A 2X8IA 3Q96A 2X8DA 3U6JA 4K33A 4GVJA 2UW8A 3GT8A 3PJ8A 5AR8A 4DYMA 2OI4X 5ANIA 3F5GA 3F9NA 3MJ1A 1MRYA 1OUKA 2JDTA 5E8SA 2KTYA 3Q9YA 3QQJA 5CANA 5CAVA 1Y91A 3F6XA 3FL5A 1H1PA 5AX9A 2YIXA 3ZRMA 4EORA 3PY1A 3LCKA 2RFNA 5FXQA 5HBEA 2VAGA 4NM3A 2ACXA 2YAAA 4QPMA 1TVOA 5F20A 5EI6A 5FEEA 2PVJA 3HMOA 3PXZA 4U44A 3MB7A 5LVPA 3D0EA 5EG3A 5E4HA 4GYGA 4H3PA 5LMKC 3BKBA 3CJGA 2E9UA 4BDBA 5KMLA 3COMA 1M17A 4DEEA 3N4VA 3VUIA 5C27A 2WOUA 1YXTA 4RX7A 4I5PA 2QU5A 3T8OA 3ACKA 5AR2A 3F5UA 3NUPA 3UPXA 3ZLYA 1VZOA 3Q2MA 4XMOA 4C58A 5BUJA 5E9EA 4GCJA 4FKGA 3DBCA 1GJOA 5HG5A 3KL8A 2QO2A 4EJNA 3E3BX 4LMUA 4XP2A 4C38A 4D2PA 3KN5A 2EUFB 3UJGA 3UOLA 5JZJA 2HW7A 4R78A 1IR3A 4EQCA 5F1ZA 1UNGA 3SW7A 4DFUA 3PWDA 2J5FA 4S34A 5CZIA 4U6RA 4LM5A 2EWAA 5B2KA 2W06A 4JIAA 5AP3A 5JFXA 1J3HA 1U46A 4NFNA 4ZY6A 2JKMA 5AP6A 4DC2A 4XYFA 3Q9XA 3VC4A 1BUHA 2C4GA 4FSUA 4QMUA 3DPKA 4BCQA 4BTFA 2IJMA 2XNNA 2HXLA 4QPAA 3R8UA 2R2PA 4AW0A 5IG1A 4TYJA 1JVPP 1G8SA 2QONA 5JMSA 5BVFA 3QA8A 3I4BA 4IE9A 2VZ6A 3QKLA 5K3YA 4YO4A 3E62A 5I5ZA 1F3MC 3V51A 2OWBA 3MH2A 2BRHA 4YHFA 2OF4A 4MBIA 4O0YA 2W96B 3DDPA 4XLIA 5L2IA 5L6OA 3C5IA 3KN6A 4RJ8A 3MVJA 4RVMA 4LOOA 4L45A 5C8KA 2XKCA 5E7RA 2I7QA 3UMXA 3E8EA 5GHVA 4UMPA 3JY9A 4YR8A 4RSSA 4I3ZA 1MRVA 2OZAB 3G0FA 5IEYA 4UZHA 3AMBA 4UN0C 4HCUA 2X7GA 4C4GA 1WVXA 2QR7A 4HOKA 4F9YA 5M09A 4AS0A 1GZKA 1IASA 3FZTA 4EHZA 3QZHA 2CPKE 3V01A 5ACBC 3CR0A 4P90A 3SG9A 2VN9A 3KGAA 4QMPA 2OLCA 2Y4IB 5LWNA 5C26A 1GIJA 3FZPA 4XLVA 4E7WA 4L68A 5C4KA 5EW8A 2G2IA 1RJBA 4FNYA 5L6WL 1H01A 4DEBA 1U5QA 2DYLA 5LMKA 3R7UA 3TKUA 5IEVA 5DYJA 3V6RA 3T3VA 2WEVA 4BN1A 3MPAA 4GJ2A 4AWIA 4DBNA 2ERKA 1XQZA 3CP9A 3UGCA 5TF9A 4YBJA 2VD5A 5CSXA 4YO6A 4M0YA 4EOQA 3MY5A 1FINA 5B2MA 3KQ7A 4FUYA 3R9RA 2QVSE 3CE3A 3TNPC 3NDMA 4WSYA 4BDCA 3DBQA 4XG4A 1G5SA 5HESA 4YGAA 4BDAA 3KMUA 4F0FA 3ZDIA 1FGIA 4F9CA 3G90X 4FTKA 4XG7A 4CT1A 1I44A 4CD0A 4BDHA 3FI3A 4O0UA 4AAAA 5GINE 3MH3A 3KC3A 5M4UA 1M52A 1ZOGA 2XS0A 3LHJA 3OS3A 4IW0A 4JL9A 4G9RA 5I9VA 1FGKA 3A61A 3ZO4A 3TDWA 3ZC6A 3DQXA 3GCVA 3UZPA 3LCSA 4XCUA 4TYHB 4YHTA 4YZCA 5AAEA 2F2UA 3QAME 1Y8YA 4PY1A 4XEYA 4XHKB 4ZSAA 4BWKA 4RFMA 2XK9A 4WG5A 2FSOX 2JAVA 4WRSA 5A3XA 3ZBXA 3TNIA 4EK3A 3I7BA 3PE2A 5DRDA 2HZNA 2UVYA 1JKLA 4W4VA 5HICA 5JFVA 4MXZA 4KD1A 1PMVA 4PV0A 3UE4A 4CV8A 4FNZA 3SXFA 3V8TA 4TYIA 3V5QA 5J5TA 3T9IA 2GNLA 3ZSHA 4EH2A 1PMEA 2R3HA 4FTTA 2A4LA 4JAJA 4LQMA 4Y73A 2W9ZB 4EQUA 3AC1A 2IW8A 4DE4A 1XKKA 4OGRA 3FMLA 4L46A 5AUVA 3U51A 1EH4A 4OBOA 2HZIA 3R7EA 1OIRA 3VBWA 3H0ZA 5IA1A 3HLLA 4IAIA 1E1VA 2PULA 4TWNA 2J2IB 3OCTA 2IW6A 3OUNB 3QC4A 3R22A 4FTQA 4BDDA 4CEGA 4D4VA 3CPBA 3HECA 1PMUA 3CGOA 5FGKA 4A07A 4C4IA 4EZ3A 3HAMA 4NFMA 3ULZA 3RAHA 1V0OA 3O7LD 2VGPA 3PSBA 3ORXA 1J7UA 4DEHA 4JDKA 4EZ7A 1QMZA 1ZMWA 4Z7HA 2JDOA 4Q2AA 3PXRA 4D2VA 5KKRB 2ESMA 1RE8A 4PDOA 3TZMA 2GNJA 4KIOA 2H34A 5G1XA 4EEVA 4ZJVA 3QYWA 4QTDA 5B0XA 3ZO2A 5FDPA 2HENA 3C0GA 1YOLA 5CU0A 5EHYA 4A4OA 3OWJA 2ITVA 2HY0A 2EXEA 4AOIA 4M15A 1XH8A 3N51A 4IVBA 4DEAA 2YJRA 3ORKA 4O0SA 1YHSA 4RBLA 5IQCA 4QMLA 2WU7A 1K2PA 5DFPA 1FMKA 3HP2A 4U43A 2C3KA 1NT2A 4XG8A 2YWPA 4NWMA 4JT3A 3FPMA 4WT6A 4I23A 3Q4UA 3RHKA 4RIWB 3RPYA 1Q62A 3QD4A 4YP8A 2J5EA 4FF8A 4OTGA 3ZZWA 2VTNA 3ALNA 4MEDA 4RPVA 4WG4A 3HV7A 4H3QA 5BYYA 3F3TA 3LFCA 3D5XA 3ZSGA 5EYDA 3R71A 3FLSA 2J0JA 3QRTA 2X39A 4MH7A 5DMZA 1VYWA 4A9SA 3DK7A 4MNEB 5FG8A 2Y7JA 1UWJA 4YTIA 5M4CA 4UX9A 1ZY5A 1YOJA 4Q9SA 3LXNA 4I0TA 5IF1A 2GTNA 3OFMA 1J7IA 1P2AA 3F3UA 5AV1A 4NIFA 4IAAA 4IB0A 4BRXA 2HW6A 4GSBA 3UVRA 4IH8A 4MHAA 1KUTA 1Q97A 3PPJA 3KB7A 3F5PA 1NVQA 4CNHA 5KHXA 3MFSA 5CU3A 4EC9A 4GV1A 5AEPA 4LGGA 4TXCA 3LFSA 4JDIA 4GS6A 3REPA 2J0IA 4XP0A 1CMKE 2RKUA 4CG8A 3UPZA 3OCBA 4OTPA 3IKAA 3HMIA 4DAWA 2XUUA 4PTEA 2PVYA 4WNMA 3ZBFA 3RVGA 4XNEA 5A4EA 3MIAA 3Q60A 3CQEA 3JUHA 4F08A 3RK5A 5HLPA 2F49A 3A7IA 3EFWA 3R0TA 3WYXA 4TWOA 1FVVA 3UP7A 3WE4A 2E9OA 4V01A 5HI2A 3IW7A 5DR6A 2R3KA 4TW9A 2XIRA 5EW9A 3MH0A 3QTIA 4J8NA 5I3RA 2XCHA 2J4ZA 4AZSA 4BIDA 5CVHA 4JI9A 1AQ1A 2ZV8A 2UZNA 5DI1A 3DAEA 1PXLA 3P08A 4DH3A 1XBBA 3JXWA 2Z2WA 4D5HA 5HNBA 3R63A 3QTQA 2B7AA 5E8WA 4I24A 4EK4A 3LIJA 2JLDA 3V04A 3II5A 2ZDUA 2GQRA 4E6AA 3IW8A 1MQ4A 2X2LA 4QP2A 5ANKA 4DFLA 3CTQA 5CSHA 4WNOA 3VJOA 5AA8A 2DQ7X 2YM6A 2NO3A 3IW5A 4C37A 4BBEA 3H30A 3W55A 1YQJA 4A7CA 4BWXA 2O65A 4BBMA 4ZS0A 1W82A 3N9XA 1SNUA 4L3LA 5H8GA 3U4UA 4BGGA 1GAGA 4QYHA 2NPQA 4YJNA 4AT3A 4KNBA 4R3PA 4CFMA 3K3JA 2VWXA 5JRQA 2C0TA 2VUWA 5C8MA 4IB5A 4BYIA 4EZ5A 4EH7A 2AC5A 2VTIA 4D1SA 4BCKA 5C03A 2CGVA 5DG5A 5EM8A 3RMFA 1QPJA 5KMIA 4ZAUA 3R73A 3MW1A 2BFYA 3UYTA 3QTZA 1H28A 3A8XA 4FV4A 3VHEA 3PDTA 4B7TA 3PXKA 2JKOA 4JRNA 3BHHA 3RNIA 3VBQA 4E5BA 3OBGA 1OL7A 2J50A 5J7BA 5HD7A 3SRVA 4Z16A 1Z9XA 2GHLA 3VJNA 2YZLA 2H96A 1URCA 3BYMA 4RQKA 5IZFA 3QTXA 4IAYA 1FOTA 2FB8A 4G3DA 4IM3A 4M3QA 5LWMA 2PUUA 4XG6A 1YI6A 4S33A 4YSMA 4IAKA 2OSCA 4ASZA 4NSTA 3HUCA 2XM8A 3JYAA 3QUEA 4S2ZA 1ND4A 4IZ5A 5M4IA 3FQEA 4DA5A 4K18A 4PL5A 4UMQA 3OCSA 2HWOA 3MA3A 1BYGA 5CEQA 2X7FA 3QTRA 1YVJA 2OIBA 4I92A 4UV0A 3Q9WA 3UC3A 4J52A 5LOHA 3AD6A 5DR9A 4D4YA 3FY0A 3DJ7A 5DT0A 2VWWA 4AG8A 2ONLC 3DJ6A 4CMTA 2VGOA 3O51A 3EIDA 3PPKA 3TIYA 2CGWA 4RLKA 3DBEA 2PE2A 1AGWA 2WQEA 3OVVA 2R9SA 4ERWA 3FZRA 4I6BA 4JJRA 4ALUA 4C61A 1ZXEA 4BZOA 2BHEA 2XRUA 5FTGA 4BDEA 3UQFA 1UNLA 4WKQA 4RX5A 2PMIA 2QOLA 4U40A 1PXJA 2Y4IC 4AZTA 3DJ5A 4GMYA 2VTPA 4QMQA 4Q5EA 3RPOA 3FKNA 2QCSA 2VWZA 1PXMA 4FC0A 5HO8A 4XV1A 3E93A 3UBDA 4AT5A 4QPSA 2W5BA 3ETAA 3UG1A 4WUAA 4U5JA 3NYXA 5LVMA 4AN9A 1ZZLA 5JQ8A 3QTSA 3G6HA 4K0YA 4IWOA 4TPTA 4FIFA 4BKYA 3U87A 2YEXA 4CLIA 5AV0A 5CYIA 4QQTA 2GNIA 3BE9A 4USEA 2Z60A 4CCUA 4V04A 1R39A 1UVRA 3HVCA 5C9CA 3ATTA 3BYSA 2W5AA 3FV8A 4ZIMA 3MDYA 2WTKB 2ZM1A 3BEAA 4RRVA 4I41A 4RIYB 3WF8A 4CFWA 2ITTA 3LJ2A 2I0EA 4GK2A 4HJOA 5ANGA 2YDIA 4O2PA 3VNTA 3KK9A 2OICA 3W33A 2UW9A 2VO0A 3DDQA 1KE5A 3R8PA 5IEXA 2ITUA 2VTMA 1YDRE 5HZNA 4E8AA 2JC6A 5CNOA 1U59A 3QFVA 5J5SA 5IU2A 4O7YA 3CC6A 4D2RA 4F9BA 5AIRA 3DBDA 5LVNA 3NAXA 3OUKA 4I22A 4V05A 3GFWA 5J9LA 4GH2A 3G33A 4AA0A 3UVPA 3LQ5A 4CQEA 3NMUF 1UA2A 3R9HA 3HRFA 3MGYA 5AP7A 2YZAA 3EQRA 4GUEA 4RIOA 4RQVA 5TE0A 5IH4A 2YM8A 4OLIA 3U9CA 3BHYA 4UMRA 4X7QA 4FSYA 2ONLA 5F95A 2C69A 1H27A 4ZTSA 2GTMA 4AW2A 3ID6C 2OZAA 3CEKA 3DS6A 1LUFA 4APPA 2QNJA 3SG8A 2WMSA 5J1VA 2XRWA 3QTUA 4JR7A 3TIZA 4BDFA 2FYSA 4YC3A 2W4KA 3OWLA 2FGIA 2R3GA 3DLZA 3TV6A 4FK3A 4I6FA 3KKVA 4M12A 4BBFA 4EYMA 3OC1A 4EHVA 4O7NA 4JX3A 3VUTA 3WARA 3BLHA 2YM7A 4YPDA 4M66A 5GNKA 1E9HA 3NYNA 2X2MA 5HIDA 2HOGA 5HGIA 4DFXE 3LQ8A 3DFCB 4EOMA 3ULIA 2F57A 3C9WA 1SVHA 2Q0NA 4G16A 3D4QA 3DKCA 4K1BA 4YU2A 1OITA 3HGKA 2FO0A 3WE8A 4GIHA 5AJQA 3IQ7A 2P55A 5HCXA 3ORTA 2DUVA 2PUNA 3TNQB 4F64A 2R64A 1W98A 5KKRC 2EB2A 2A1AB 5IQFA 5IH5A 5BVNA 4TN6A 4A9RA 4W4XA 5ACKA 5J7HA 2WQMA 2ITQA 2XK6A 4R6VA 2YERA 1OMWA 4YZNA 1SZMA 5IPJA 2FVDA 4JNWA 1WBSA 3DK6A 4AZWA 4FTRA 4Z9LA 3L1SA 2NRYA 2Y9QA 4C4HA 4UEUA 4LRMA 3RHXA 3WZJA 2ZOQA 4E20A 2W1FA 4Q5HA 3BU3A 3F7WA 2XNPA 4PMSA 5CAOA 3ORMA 4CMUA 4AQCA 1YOMA 4N57A 3PSDA 3P1AA 3NYOA 5HU3A 5EFQA 2PUIA 4NUSA 4TYHA 1XH5A 5E8UA 3O0GA 3QA0A 1Q4LA 2GPHA 2O0UA 5JFWA 2O63A 3ELJA 4D5KA 5CS6A 3TJCA 2CGXA 3FAAA 4ANNA 1HCKA 2BIYA 5ETFA 4AGCA 3DK3A 3FQSA 2BRGA 3MIYA 2C47A 3UIXA 4KS7A 4FI1A 4QTAA 4UY9A 2WFYA 4P5ZA 2ZMDA 4FVRA 4J1RA 3WIGA 1P5EA 2GNHA 2HIWA 3BX5A 2BTSA 1SM2A 2H8HA 3TKHA 2W5HA 4KRCA 4QO9A 2R3QA 3VS3A 1FVRA 1VYZA 4IM2A 5EHLA 2FH9A 2J7TA 4U80A 2IVVA 3DKGA 3W32A 2FA2A 3MA6A 1B6CB 2QQ7A 5LVOA 2O8YA 2XNBA 3PA3A 3NNWA 2Y0AA 2J0LA 3BYOA 3KFAA 4PMMA 3VS4A 5K4IA 2B9IA 2WTVA 4LL5A 4KS8A 4R8QA 2B52A 3EN5A 3ORPA 3I6UA 2REIA 4FKUA 4J53A 1M2RA 5HTIA 4D28A 5E91A 3VULA 3HUBA 3LCOA 5BVWA 1GZ8A 3CBLA 2JBPA 5EHOA 4AU8A 1OBGA 5EQPA 3KRWA 2WB8A 4CGAA 3VO3A 4BI2A 5M4FA 4XP3A 3BLQA 3LXPA 5HO6A 3P4KA 4XS2A 4B8LA 3TNWA 4XG3A 4KKHA 1ZMVA 4F4PA 4BCOA 4I4EA 4O0VA 2OG8A 4EK8A 4IM0A 5EW3A 2XK3A 3BYVA 2XKEA 2KULA 2PVLA 3FJQE 3NW5A 5HLNA 3NR9A 4G17A 2IG7A 2OW3A 1OKZA 2JIVA 4J95A 4U97A 4C4EA 4F0IA 1T46A 4NYEA 2ITWA 1ZWSA 3BYUA 4C4JA 2OO8X 4FYOA 3LMIA 3TWJA 2YDJA 3P23A 2VWUA 3POOA 4E4LA 3EFJA 1QCFA 3BEGA 3COKA 4F7LA 3D7TA 3DT1A 3NNXA 1HCLA 3UOHA 4KBCA 3Q04A 3FKLA 4CFNA 4XBRA 4QTEA 5HQ0A 4RIWA 5ICPA 3G6GA 2QG7A 3Q9ZA 4FSQA 4KUJA 3SRVB 2XNOA 2VX0A 5A54A 2R7IA 3DU8A 3E3PA 4E6DA 1IAJA 4C2VA 1M7QA 2W0JA 2WMBA 3AC5A 3PFQA 4Q9ZA 4IVAA 4FSWA 2GDOA 2YCFA 3Q32A 5HOAA 4HGTA 4DFYA 4MNEA 2QC6A 5AR7A 3Q3BA 4L8MA 1S9JA 1YWRA 5HNGA 4FKRA 4JQEA 5I0BA 2O2UA 4I0SA 3MTFA 4CT2A 2VTAA 4O7LA 2WMXA 5AUYA 5BMSA 3NIZA 4JDJA 4XUFA 3TCPA 3RAIA 4AW5A 4XH6A 4G3CA 3S00A 4L53A 4OTDA 4QYEA 2GU8A 2C6OA 5EDRA 4NJDA 4HNFA 1OL5A 4EK5A 2VO3A 3OEZA 4DLIA 5JEBA 5HIBA 4Y5HA 3QXPA 5EYCA 3MPMA 5T68A 1H25A 3GCPA 4G6LA 3DZOA 2X2KA 5DOSA 2EU9A 4ASXA 2YIWA 5HKMA 4F7NA 5I9ZA 4BKZA 5AP2A 3O8PA 4USFA 3ZFMA 4G5PA 4BCNA 4AN3A 3GCUA 4WHZA 3IGGA 4UWBA 2XYUA 3V5LA 3VBXA 3TUBA 5AV3A 3PSCA 3B8RA 3DLSA 1Z5MA 3ZH8A 4O0XA 4AGUA 3FI4A 3KU2A 4A4XA 3TV4A 3VRZA 4O7TA 3K5VA 4FEQA 2HY81 4PUZA 2WIHA 4EI4A 1LEWA 2CN8A 1U5RA 5HTBA 1H4LA 4M67A 2UZBA 2XA4A 4FKVA 4D0WA 1OB3A 4PNKA 2W17A 2QURA 5M44A 4AFJA 4HVIA 3A7JA 4O7SA 2QR8A 2YHVA 2WTCA 3VW6A 1OL1A 2R0IA 3UZRA 1Y8GA 2W7XA 2Z7QA 3FLNC 3FHRA 4KIKB 4HPTE 5DIAA 3U6HA 2PYWA 4PL3A 5AFVA 3R8VA 5CLPA 2RGPA 3BRBA 2B53A 3KVXA 2YN8A 1OVEA 3UNZA 3B2WA 4EONA 2B9JA 2ZAZA 4L01A 4RWKA 4AW1A 5KO1A 2PK9A 4GYIA 4FV1A 2X9EA 2YM5A 4FV8A 2XYNA 4GRBA 4ZZMA 4O7VA 3KULB 3H4JA 3FBVA 3QF9A 3RCJA 3GGFA 2QOBA 3SHEA 3BQRA 4BKJA 4C8BA 4B99A 3FXZA 3RINA 5I9WA 3KXNA 5FP6A 4ZSEA 1ZRZA 3PLAE 2QLQA 4KBAA 4I6HA 1NXKA 3D5WA 1UU8A 5GZ9A 3SV0A 3OBJA 4MKCA 3KF7A 4UMTA 1UU7A 4L44A 4J99A 5K4JA 5I9XA 4FGRA 3OW4A 4XJ0A 4OW8A 3COIA 4BL1A 2X81A 3T9TA 3CD3A 4QQJA 4CG9A 4LOQA 2OGVA 3VS0A 2X4ZA 4W8EA 4YJSA 3VBYA 3ZCLA 3KXMA 3RK9A 1A06A 4PPBA 3W16A 2XVDA 3QTWA 2PPQA 3NUSA 4O0TA 4F9AA 3TZ7A 3TT0A 3PP1A 4C57A 4TRLA 1YWVA 3QZGA 2YAKA 3V5PA 3WZDA 2WTKC 3EQCA 1TKIA 2XBJA 4IBMA 2YACA 4AN2A 1CKPA 5M07A 4FL2A 4CVAA 4YC6A 3PZHA 4BCFA 3G51A 3MVMA 3PJCA 5H9BA 4D1XA 3NCGA 4IC7A 2OJFE 4F70A 2CGUA 4NT4A 5D11A 4DGMA 2BFXA 2UVXA 4QP4A 3BELA 5HHWA 1H8FA 5DGZA 4JAIA 5DT3A 2WGJA 3IG7A 4ZLZA 2V5QA 3A7FA 5AP1A 4ZJIA 4DCAA 1KE9A 5CWZA 4WNKA 1G8AA 2R3NA 1OPLA 4DLJA 5LXMA 2BAKA 1Q8TA 3C0IA 5M56A 4EOJA 4USDA 5AV2A 3Q52A 1KOAA 3E87A 3E7VA 4FSZA 4MXOA 3FUPA 4ONAA 4LRJA 4F9WA 2BDWA 4TTHB 3LCTA 2OH4A 3Q5ZA 1RW8A 2HZ0A 2Y8OA 3ANQA 4OTQA 3S3IA 2PY3A 3FMEA 2VV9A 3COHA 3AD4A 5HVYA 1JQHA 2QI8A 2BZHB 2CN5A 1OECA 5L2TA 3ORIA 4KABA 2A0CX 3AMAA 3PA5A 1PYEA 3RPVA 4GK4A 1J1CA 3OCGA 4RC2A 4FZFB 3O2MA 5LMAA 1YRPA 5AUTA 4BCIA 5ETIA 2F7ZE 3I6WA 4BYJA 4EOIA 4HYUA 4BTKA 5KHWA 2C0OA 3VQHA 3I0OA 3VUDA 4R7IA 2VWYA 4IX6A 4JLCA 4NZWB 5D7VA 3H9FA 4U3YA 4AUAA 3ZTXA 3ZLWA 4BDIA 4R77A 1H1QA 2OKRA 4FBXA 4ITIA 3RBWA 5L2SA 4PMTA 5DEWA 2ZDTA 5EH0A 4EOLA 5BQ0A 3A62A 4QP6A 4RX9A 3ZYAA 2J51A 1Y6AA 3DAKA 3R7YA 3F61A 4YTFA 3W8LA 4O27B 3SQQA 2BDJA 4I93A 3W2QA 3A7GA 4BICA 5FEQA 3LFQA 5JFSA 4FSTA 2VTOA 2VNYA 4RIYA 4QMOA 3SXRA 3F69A 4O83A 1JKTA 4YJPA 2Z8CA 1JBPE 2UW0A 2QHMA 4MD8E 2OJIA 3AOXA 3C4FA 3GQLA 4FKTA 4J8MA 1OZ1A 3A4OX 4K77A 4RGJA 5HBHA 2AUHA 1TQIA 5E8YA 4DFBA 3D14A 3AG9A 1CKJA 3QD0A 4O6LA 4KIPA 4RFZA 3FE3A 3EKKA 1O9UA 3QQHA 2HK5A 5HIEA 5AP4A 5EKOA 3IDPA 2UW7A 4E4MA 4D2TA 3ERKA 3RPSA 3V5WA 4AFEA 2YISA 4X6RA 5K9IA 3PXQA 2YITA 2B1PA 4R5YA 2P0CA 5EOBA 3R9OA 3HA6A 4I5HA 4PRJA 4S30A 5GIPE 4R3CA 4Z3VA 4JQ7A 1ZARA 2B0QA 4E73A 2BROA 1JPAA 4GT5A 1W7HA 1ZY4A 1S9IA 4E26A 3GENA 1SVGA 3D7TB 3HV4A 4DTBA 5BYZA 1HOWA 3W1FA 3LJ1A 4I0RA 3CTJA 5IA4A 5M51A 5HCZA 3WZUA 3BGPA 3P5KA 5DNRA 5FTQA 2YLEA 3M11A 4MXXA 4QP3A 2UZDA 3VAPA 4ZSLA 4HYSA 1BL7A 4RJ7A 3AC2A 5JQ5A 5GJFA 4HNIA 1ZOEA 3HV6A 3MB6A 4RC4A 4DGLC 1R78A 4U79A 3ZO3A 5BPYA 4XOZA 2BRMA 4GU6A 3HMPA 2VO7A 3F5XA 4MD7E 2UZWE 3Q4CA 4FSRA 5KCVA 3GOKA 4N6YA 2X4FA 5M55A 5JGAA 3H10A 1XWSA 3UTOA 3PG3A 4G2FA 3AC8A 5DPVA 2BRNA 5AAGA 3Q4TA 3R02A 4QP1A 4FG8A 3KMMA 2GSFA 1Q61A 3I79A 1WBNA 2UZVA 3PP0A 4QP9A 1P4FA 5LARA 4FG7A 4TT7A 5FRIA 2C1AA 2ITYA 4W4YA 3G9LX 5L6PA 3BPRA 2HYYA 2WQBA 3LM5A 4ERKA 5M08A 5JH6A 2WTDA 1H0VA 2XCKA 3GOPA 1Q8ZA 4JS8A 3BZ3A 5KZ0A 2QOHA 3LMGA 4FZ6A 4FOBA 4ALWA 4E5WA 2CSNA 1VR2A 2BPMA 2X7OA 3ORLA 3VUGA 5CEMA 3LKMA 2CLQA 5DLSA 3NLBA 2YIYA 2VTHA 1PY5A 3VF9A 5CF6A 2IZUA 4FTJA 3RI1A 3TEIA 4DGNA 1MP8A 2Z7RA 2F7EE 3FLWA 2JKKA 2OFUA 3BWFA 5CNNA 3FQHA 5CVGA 4NH1A 3QCXA 5DBXA 3G5DA 3BBWA 3NUXA 4E6CA 4EH6A 3AQVA 4M68A 2XMYA 5IA5A 4JRVA 3NRMA 4PF4A 2JAMA 3VS1A 4BGQA 1M2QA 4CKJA 2OF2A 3D15A 2PU8A 5EI2A 3OG7A 2IWIA
chains in the Genus database with same CATH superfamily
5A6NA 3C4CA 5B7VA 3FPQA 3ZFXA 2WMWA 3GI3A 4MD9E 4RX8A 4UWYA 2YIRA 3NUNA 3WF6A 4E93A 3EJ1A 4Y72A 4ZTMA 3DBFA 2QOOA 4FT3A 4D2SA 2R3PA 3H3CA 4KWPA 4NW5A 2W1CA 4NM7A 4X2NA 5HCYA 3FZOA 4FL3A 4O0WA 4G3GA 4H36A 3MSSA 3HYHA 4ITJA 4MUQA 4QMWA 4AZEA 1PKDA 3AKKA 3EN9A 4EH4A 3IPHA 3QZFA 3QUPA 3NCZA 4DDGA 3Q5IA 4U41A 5H8BA 4EYJA 4F63A 3P79A 2JIUA 4MWIA 3KF4A 4MQ2A 4F1TA 4MQ1A 5A4QA 3I81A 3DGKA 4H39A 4JQ8A 3PLSA 2VX1A 4HPUE 3UQGA 4B8MA 3BL7A 2GHMA 2PE0A 1O6YA 3IONA 4ACMA 4C0TA 3L9LA 3OXIA 4IX3A 3SKCA 4CYIA 4XRJA 4EOOA 3ZUTA 2ITZA 1AD5A 1P4OA 4K2RA 1YW2A 2JFLA 4DITA 3EOCA 2UZUE 5KBQA 4O82A 4FTLA 4FKOA 3UOKA 3BE2A 4TWPA 3ZFYA 3UZTA 3ZEPA 2UZLA 4J71A 1OKYA 3FEGA 4C2WA 5IISA 4A4LA 4ZLYA 3AC3A 4GVAA 4ARKA 5EK7A 2WZJA 3PPZA 2Z7SA 3M1SA 4D1ZA 3GUBA 3NUAA 4IFCA 2W1EA 5CX9A 1G8KA 3N4UA 5CU2A 2IZRA 3DB6A 2XKDA 4AE6A 4EQMA 4RJ6A 1IRKA 3P7AA 2HWPA 4FEVA 3QALE 2GNFA 4F65A 3ORNA 3IECA 2YCSA 4YTHA 3ZLXA 3UQCA 3EZRA 4I1ZA 3EYHA 3LAUA 4NEUA 2WXVA 3SX9A 3PJ1A 4YTCA 2PSQA 2PZ5A 4PTGA 3O23A 4IAZA 5CU6A 4KIQA 5KE0A 2C6TA 3AT3A 4IWQA 4QMTA 4L00A 4FTCA 5ITAA 3OTVA 2X0OA 4BGHA 4YPSA 5AWMA 4FK6A 4K6ZA 3IDBA 3QQFA 2PMOX 3R2BA 2AEGA 2BAJA 4OUCA 4YLKA 3FZSA 3WF5A 2UZEA 3CY3A 4YBKA 4B4LA 3QWKA 1PXOA 3HMMA 4IVDA 4LUEA 5BYLA 3PE1A 3M2WA 4PL4A 2F7XE 3BCEA 3EN6A 5E1EA 2BKZA 2XEYA 4ZTRA 4D9TA 3MS9A 4A06A 4EH3A 3E63A 5C1QB 3A99A 1G3NA 3EN7A 3QGYA 4GEOA 3BGZA 1LEZA 4GIIA 4OTFA 3ZDUA 5CAUA 2I40A 4QMZA 4MBLA 1MQBA 4GKIA 3F2AA 1MRUA 4MAOA 4D55A 2YWVA 3DXPA 3OZ6A 4O7RA 3F66A 3C1XA 5HD4A 2CCIA 3HA8A 4HGSA 5CTPA 2EB3A 5L2WA 4D2WA 2GQSA 5JSMA 1CSNA 3OMVA 3PJ2A 3PXYA 1XH7A 2WU6A 4ZTHA 5L8JA 3VS7A 5EYMA 3WOWA 2GCDA 2J0KA 1XHAA 1YDTE 2JD5A 3QC9A 4YMJA 3SA0A 3GU6A 4FTUA 2I0VA 4QMYA 3RJCA 4PDPA 5CAPA 1M14A 3LMHA 4ANSA 5CENA 3VQUA 3D9VA 4C62A 5HTCA 1T45A 2VTSA 4HYHA 2GS2A 4QRCA 5DR2A 4AZFA 5HG7A 3TL8A 2WO6A 4MF1A 4QMMA 3QBNA 3K3IA 4JOAA 5GZ8A 2O64A 3LFFA 3GU4A 4IDVA 5FD2A 5G6VA 4FZAB 3R1SA 4KIKA 4XG9A 3TI1A 4CZYB 4EBVA 3BHUA 4TWCA 5J9ZA 3ROCA 4QNAA 1Q3WA 1V0BA 4FKSA 3TKIA 3GU5A 3B2TA 3MV5A 4RIXA 1CDKA 3LXKA 4QYYA 3KK8A 5AIKA 3QGWA 1REJA 3LFAA 2VTTA 5IQGA 4NTSA 3QCYA 3S2PA 4BB4A 3EQPA 3KA0A 5A4TA 4DH5A 3UVQA 3KULA 4C33A 5H2UA 5A4CA 3FMDA 5KBRA 3BHTA 4ZJJA 2YJSA 3RALA 4EBWA 4YLLA 5BV3A 4FR4A 2CLXA 4WRGA 2P3GX 4HZSA 3D83A 4PP9A 4EOPA 4PTCA 1YI3A 4C3PA 2C6DA 2ZV7A 3VRYA 4A9TA 3WIKA 3C51A 1YI4A 4FUXA 4E3CA 3QQKA 5IDNA 2R3FA 3NX8A 2RG6A 5DVRA 4TNBA 5TR6A 2DWBA 3IW6A 4FKJA 3JVSA 4U81A 1WBPA 2VWIA 1J1BA 4MCVA 5LMBA 5AUZA 2XIZA 1NY3A 4FIHA 3FDNA 1A48A 4YJOA 3W2OA 4IWDA 5HE3A 3QQLA 2ETMA 2YDKA 4S31A 4N70A 4DG3E 4ACDA 4FGBA 2I0HA 2JDVA 2WMUA 4C4FA 3PVGA 3QQGA 5LQFA 4UXQA 1H07A 1XH6A 3BGQA 4H58A 4IDTA 4PX6A 3ZC5A 4UMUA 4UXLA 3HL7A 4CTCA 4YZBA 3PFYA 4AAYA 4FODA 4BCPA 2XZSA 3QCSA 4BHNA 3OWKA 2GMXA 4BVUA 5HU9A 1DAWA 4P5QA 3R7OA 5BVOA 4WG3A 4KRDA 3OOMA 1YXXA 3V8SA 3CGFA 1W2CA 4O22A 3UNKA 4DHJA 4IX5A 4L3PA 5CXZA 2XJ0A 1YKRA 2R3OA 3QHRA 4R7HA 2PZIA 3CPCA 4AF3A 4UYAA 4IZYA 4B0GA 3F2RA 4FV0A 1ZMUA 2WOTA 4GK3A 3MVLA 4F7SA 4RG0A 1PHKA 5CZHA 4L43A 3QD3A 3LM0A 4AXDA 3ALOA 3PY3A 4FEWA 3ENMA 4KBKA 4RZVA 3VHKA 2CKOA 1FQ1B 5CT0A 1M2PA 2PVKA 2QOIA 3LFEA 2JBOA 3ITZA 2Y4PA 2OXXA 3D94A 5IA2A 3VBTA 1OUYA 2YM4A 3F3ZA 4RA4A 3PRFA 4RJ4A 5CASA 3FWQA 4HCVA 2VNWA 2UZTA 4FKLA 2CNQA 3TJDA 5FUTA 3JPVA 3HRCA 1F5QA 3O17A 5IQIA 3QLGA 1J7LA 3D2KA 2Y6MA 3GU7A 3I5ZA 5AADA 3QRUA 2X9FA 4IZAA 2XK8A 2X0PA 4O4DA 3C13A 5J79A 4FL1A 2CKEA 1QPDA 2E2BA 2G9XA 5E8TA 3C0HA 4QQCA 4ENYA 3CCNA 4JG8A 2XNEA 2Z02A 1BL6A 4R3RA 2ZB0A 2R7BA 3OP5A 4OBPA 4TL0A 4QT1A 2X0GA 4DGOA 4DEGA 2PZPA 2P33A 5IQDA 2JDRA 2W9FB 1U54B 3AT4A 3KXHA 5FXRA 1RDQE 4O84A 1OM1A 1WZYA 4N6ZA 2C6KA 2OFVA 4CLJA 2Y6OA 4X6QC 3LJ0A 2DS1A 1PXKA 2A2AA 5DN3A 1KV2A 2GFSA 4ASDA 5B2LA 3TM0A 2LGCA 3BQCA 4X0MA 5ANOA 2GFCA 5FM3A 3ATSA 4FOCA 2WPAA 3U6IA 5M57A 4DEDA 5GJGA 4Y83A 3W2CA 3E8DA 4M7IA 5IUHA 1OI9A 2YCQA 3A8WA 3FLZA 2C3LA 3MN3A 3MPTA 4QTBA 3U9NA 1JSVA 4HZRA 2C3IB 2O5KA 2IW9A 1IA9A 4ZMFA 5GJDA 4FT5A 5IQHA 3IK3A 4DT8A 1TQMA 3LFDA 2QO9A 2R3JA 4QMXA 3EKNA 5EI8A 2XNGA 3F3VA 2WELA 1VEBA 3PY0A 3PYYA 3EFKA 3FKOA 2ZM3A 3EZVA 5JRSA 3NS9A 1YXUA 4YNOA 2WTJA 4PNIA 3ZO1A 1GY3A 2GS6A 5IUGA 1KE6A 2CMWA 2VWVA 2CJMA 2WMQA 3DXQA 4ORKA 4R5SA 2ZYBA 4ENXA 1TZDA 4AP7A 5HBJA 3C4ZA 3RPRA 3WI6A 2XNMA 1PXIA 3AMYA 3DOGA 3E8CA 1ERKA 4JG7A 1KOBA 5T6KA 4AX8A 4E1ZA 2ZB1A 3DA6A 5HORA 3OY1A 1FMOE 2UW3A 4NM5A 2B55A 3E88A 3H9OA 2IZSA 2X1NA 5KMMA 3CSVA 4XV9A 2UV2A 3W0RA 3I7CA 2W1IA 4MF0A 4L6QA 4HVSA 4M97A 3LPBA 4AGDA 2VO6A 5AM6A 3M42A 2P4IA 4KB8A 4YLJA 4R1YA 4G31A 2EXMA 4XG2A 3R8MA 2VX3A 2R3IA 4BI0A 2HXQA 3L8XA 4HVHA 4CSVA 1OKVA 3R7IA 3OROA 3CS9A 3EFLA 4LRKA 4W4WA 2WIPA 2UW4A 3GU8A 3R6XA 3PA4A 4RWJA 3UIMA 3UNJA 4U0IA 2JIIA 3VS5A 5BVDA 5J95A 5EKNA 5TOZA 2HCKA 4X3FB 2G2FA 3DFAA 4PPAA 1LR4A 3D2IA 3ODYX 4E6QA 3OF0A 4V0GA 1STCE 4EWHA 1KV1A 1OIQA 3MFTA 4FV2A 4ZY4A 4H3BA 1JOWB 3RGFA 2VTLA 3C4WA 5D7AA 5L2QA 3R9DA 2PMLX 1O6KA 3OD6X 3F2NA 4GFMA 3R8ZA 3LQ3A 1PYXA 3AD5A 2OBJA 4FIGA 3EQBA 3L9PA 1ZZ2A 4G34A 4HW7A 3UDBA 2W4OA 4ANOA 4LI5A 1Q8YA 1YHWA 1YHVA 3LCDA 5BVEA 5D10A 2GS7A 4O38A 5AR3A 1GIHA 1PMNA 4A9UA 1NW1A 4O1OA 2BVAA 4TY1A 4MBJA 1PXNA 3P78A 3WF9A 3PVUA 1BI8A 3W0PA 4JXFA 4RWLA 3ZM9A 5HLWA 2F4JA 1V1KA 2FSTX 3LFNA 5AP0A 5ANEA 4C02A 3EQHA 4LGDA 2J6MA 2SRCA 3W18A 1OL2A 4TNDA 4E4NA 4KAOA 2V7OA 2RSVA 4YURA 3HRBA 4G5JA 2QG5A 3SXSA 4C36A 3ZM4A 4EOSA 4FKPA 5E8VA 2FSLX 4JBVA 4I5CA 4DCEA 4DN5A 3G15A 1PKGA 2BKKA 4RJ5A 4NCTA 5BUIA 2IVUA 5J1WA 3TUCA 4M69B 5CY3A 1GOLA 2FSMX 3EL7A 2OIQA 1PXPA 4O91A 4DEIA 5LVLA 4DH7A 4QMNA 2ZM4A 4CFFA 3PG1A 3ZU7A 3PXFA 3K5UA 3VWAA 5M53A 2C6LA 3ZRKA 3BHVA 1WBTA 1WCCA 3HZTA 2OJJA 2WAJA 4UBAA 1JSUA 3NVMB 2A98A 3D5UA 3IDCA 5FDXA 5FBOA 2PVNA 4CRLA 1YXSA 3LW0A 3WZEA 4K8AA 3HP5A 1WMKA 4N0SA 3DQWA 3AGLA 4O86A 3L9NA 4BDJA 1L3RE 1H26A 5KMJA 4RIXB 1Q8UA 4DTAA 3BU6A 5KMOA 3Q6UA 5J9YA 3IS5A 4M13A 3PJ3A 4TYEA 4JBOA 4IANA 3VS2A 4LMNA 1W0XC 4N4SA 3U55A 3QLFA 3K54A 4OTHA 2WD1A 3KMWA 3OT8A 4FTAA 4MXAA 4BCJA 2XB7A 4PP7A 1H00A 4RC3A 2CCHA 3NYVA 4QNYA 5H3QA 4DFZE 3JS2A 3RTPA 3ZMMA 3HV5A 4IEBA 4UWCA 4FV7A 3ZOSA 2IO6A 3KRRA 3P86A 2G1TA 2QOCA 4FKWA 3DCVA 5KMKA 3DV3A 2Q83A 2ITNA 4EH9A 2WMRA 5ETAA 4BCHA 4UALA 3C5UA 5K0KA 3TACA 4FZ7A 1YDSE 4LOPA 4UYNA 1FBNA 1UKHA 4E4XA 1JAMA 4FA2A 2W99B 2A27A 1BMKA 1DAYA 3AXWA 4JVGA 5J87A 2RFEA 2PVFA 4RA5A 3AGMA 4M84A 4I94A 2XK4A 1SMHA 3ENHA 5ETCA 4PDSA 4PQNA 2B9HA 1ZAOA 3NWWA 3ROYA 2EVAA 4A9YA 5AUXA 3UMWA 1H0WA 4II5A 5GZAA 3G9NA 4GW8A 4AGWA 2GNGA 1WFCA 4QD6A 4BZNA 2O3PA 4ZXTA 1A9UA 2UW6A 2ERZE 1UNHA 3FXWA 3QQUA 4RVKA 4BDGA 5CF5A 3QXOA 3F88A 2X6DA 3LOKA 2WMVA 3LXLA 5TT7A 4DFNA 3PIXA 4QMSA 5ANJA 2V62A 5E92A 3LLAA 2OXDA 4W9WA 3CIKA 3JY0A 4RWIA 4O0RA 3PVBA 5CSVA 4IB1A 5L3AA 4M0ZA 3BV3A 4C3RA 3P7BA 4CKIA 4WBBB 4I5MA 3VIDA 5AAFA 1H08A 4JG6A 4AOTA 1JSTA 2HELA 4C3FA 3BLAA 3BIZA 2NNWB 3ZXZA 4U45A 1Y6BA 4FIJA 1GZNA 3WYYA 2BRBA 3NEWA 3EWHA 5E1SA 3UDSA 2PUPA 1YWNA 5A14A 4WSQA 3QD2B 3FMJA 1KWPA 2G15A 1KE8A 3OTUA 4PMPA 1OBDA 2BR1A 4CZUA 4ID7A 1URWA 1JKSA 4FT0A 2UUEA 2WQOA 5E8ZA 5ANDA 3RWQA 3E5AA 3ODZX 4L67A 5FEDA 4X21A 4EHEA 3E64A 2OJ9A 3W8QA 1WBWA 5JZNA 1W8CA 3SOAA 3OT3A 4RJ3A 5TO8A 2UZOA 4F1OA 2C6IA 3R21A 3SOCA 3S4QA 5GIOE 5IUIA 4AXAA 2CKPA 4C7TA 2W05A 4KINA 3KEXA 5L8LA 1V0PA 4MNFA 2BTRA 1DI8A 3QKMA 4IC8A 3P5JC 2PMNX 5E8XA 3R7GA 3RP9A 3EYGA 3FSFA 5IQAA 3BLRA 4IB3A 3ZHPC 3L8VA 4BI1A 5A4LA 3SGCA 2JEDA 4B6LA 2XIXA 5DRBA 3V6SA 5JT2A 4FKIA 4L3JA 4XRLA 3UC4A 4FMQA 4IHPA 1R0EA 3ZS5A 2QD9A 4ANLA 5CU4A 3C4XA 2W1GA 3HV3A 4C34A 4QTCA 4EK6A 3TZ9A 4FEXA 5C4LA 1SNXA 4IACA 3CXWA 3SC1A 5K0XA 1XJDA 3GCQA 3KXGA 4KKGA 3G2FA 4ZZNA 1IAHA 3QU0A 3NGAA 3CJFA 5TKDA 1IA8A 1Z57A 2QO7A 2AYPA 2BAQA 3ZEWA 4U7ZA 3ZRLA 4EH8A 4NKAA 4EUUA 2F9GA 3NNUA 3NSZA 3NW7A 5J8IA 4OT5A 1REKA 2XJ1A 4BR3A 4WBOA 3FSKA 2XF0A 3MI9A 4P7EA 4MWHA 4L42A 3ZXTA 3R83A 3NPCA 4CFUA 4OTIA 4PDYA 4R7BA 5HX6A 2Q0BA 2VWBA 5FTOA 3NNVA 4F0GA 4NJ3A 2OH0E 3O71A 4AT4A 5CQUA 4Y5QA 3PTGA 4LV8A 1O6LA 2ETRA 3DTCA 5FLFA 3SLSA 4CXAA 5HX8A 3TYKA 1P14A 4BWPA 3W2SA 4FTOA 1R1WA 3I1AA 1WVWA 3FXXA 4I20A 1L8TA 4APCA 4GKHA 3W0MA 3OY3A 4YHJA 4ZY5A 2XAMA 4IWPA 2I6LA 2R3MA 4FKQA 4H1JA 2AC3A 3SD0A 4IXPA 3FMNA 2ZJWA 4J7BA 5FP5A 1ZOHA 3W2PA 3RNYA 3FY2A 4FIIA 3NUUA 4AZVA 2P2IA 2J0MB 1GZOA 3GC0A 1XR1A 2JGZA 1SYKA 1K3AA 1WAKA 5KNJA 2LAVA 5CEPA 5F9EA 4D58A 2A19B 4F6SA 4GG7A 2CDZA 2QOFA 3P7CA 3A60A 4V0GB 2CHLA 3FI2A 2ZV2A 4RLLA 1J91A 5A9UA 3DNDA 3TXOA 3QX2A 4DBXA 4MX9A 3KCFA 2JITA 3AC4A 3ACJA 2QHNA 4EHGA 5CSWA 5DEYA 5CEOA 4I21A 3R1QA 4QOXA 4CYJA 2W4JA 4U8ZA 4PPCA 3HKOA 4UZDA 2RF9A 4WOVA 4RMZA 1ZYJA 4NW6A 4XOYA 2C5XA 5IA0A 5IKWA 3OEFX 3A7HA 3RWPA 3EMGA 3UO6A 2PVMA 4ALVA 3BBTB 3AT2A 4OBQA 5KUPA 2C5VA 4ACGA 4HCTA 4IZ7A 2PHKA 4BDKA 3EB0A 4IMYA 5CSPA 4FV3A 2VTJA 4L7SA 3OOGA 4ANMA 3D7ZA 5AM7A 4C59A 3GP0A 5L8KA 3VUHA 1OL6A 1BX6A 1VJYA 2OZOA 5HG9A 4Y46A 1H1WA 5EDPA 2OJGA 5IQBA 5I4NA 3QWJA 3RZBA 2CNUA 4O7WA 4BTMA 4YJTA 4X3FC 4W9XA 1X8BA 4GL9A 4F6WA 1U54A 2P2HA 3LE6A 3LVPA 3I5NA 4ITHA 5AUWA 5FM2A 2NP8A 3IW4A 4MVFA 3FMHA 2V7AA 3MYGA 3P9JA 3F7ZA 3R28A 2XBAA 3Q4ZA 5DHJA 3R01A 4BJJB 5E90A 4LYNA 1UWHA 5DA3A 5HE1A 5BNJA 2R3RA 5AP5A 4ZTLA 5A6OA 3DY7A 1LP4A 2CNVA 5CQWA 4HVGA 3NW6A 5F94A 3EQIA 1I09A 5EYKA 4BCGA 1WBOA 3U8WA 3GC7A 4J97A 4C35A 2BMCA 3PIZA 1NVRA 1TQPA 4FSNA 5C01A 5IH6A 4ZK5A 1U4DA 4Z55A 5CALA 4ZSJA 4X2GA 3UDTA 4FV9A 1OPJA 4S32A 1W83A 3FMKA 4X3JA 3ZUVA 4BY9E 4R1VA 2CKQA 4GT3A 3PZEA 3R2YA 3DKOA 2YM3A 2RL5A 2HAKA 3OWPA 4GJ3A 1CKIA 1UKIA 1E1XA 2R3LA 2FUMA 4FG9A 4O96A 4YUQA 4KSPA 1B38A 4O1PA 1NVSA 1ATPE 3H9RA 5D12A 5AMNA 2WEIA 2C0IA 5CEIA 3THBA 2W1ZA 4CTBA 1BKXA 5AUUA 4FV5A 2GQGA 3R7VA 1KE7A 2JDSA 3PRIA 3QCQA 4GFGA 3CLYA 2QOQA 5CT7A 3TN8A 4YZDA 4WNPA 4QP7A 5D41A 4CKRA 3B8QA 4EKLA 4LGHA 4QYGA 3MY0A 4O2ZA 4CZTA 3TUDA 2G01A 5EM5A 4D4SA 5A46A 4KA3A 3KXZA 2C3JA 4L9IA 3KRLA 4IAFA 4YJVA 5CVFA 4BC6A 4O7ZA 1ZYLA 3RK7A 4ZSGA 3N4TA 4IX4A 1GIIA 3PIYA 4DINA 2J90A 2XP2A 3MVHA 4ZEGA 3HX4A 3KVWA 4YJQA 5AR4A 5HVJA 4QP8A 3FI8A 3IOKA 3VS6A 2V0DA 4X3FA 5LCJA 2W1DA 2YLFA 3MH1A 3RM6A 3LLTA 4BHZA 1ZYCA 5HEZA 2VTRA 5EM6A 3OHTA 4JR3A 1OGUA 1Q24A 1H1RA 4G9CA 2PVHA 3CY2A 2C6MA 3CTHA 4MTAA 1KSWA 5DWRA 5EDQA 3SDJA 4ZP5A 2WMAA 3EL8A 3FYKX 2RFSA 3LZBA 3R00A 3T3UA 2PZYA 3RZFA 4Z7GA 2BILB 3QHWA 1Q3DA 4DHFA 4TYGA 5K5XA 4FT9A 5BMMA 4LG4A 4HGLA 3ZUUA 3A2CA 1XBAA 1Y57A 4RFYA 3NAYA 3EQDA 1OPKA 3HEGA 3E8NA 5FXSA 5C8NA 4P2KA 3VW8A 5M06A 5HG8A 4WA9A 5EQEA 2IN6A 4WD5A 2PL0A 4WO5A 1OIUA 4YC8A 3O96A 4BIBA 3KRXA 2UVZA 1WBVA 5HVKA 4EOKA 4L52A 5I9YA 4W8DA 5DT4A 3S0OA 4K9YA 4BFMA 3WF7A 3Q6WA 1DM2A 5AV4A 2PWLA 3JR1A 5KMNA 3TDVA 2BZIB 4OTRA 3GEQA 4F7JA 3H0YA 3KCKA 3MY1A 4HYIA 3C4EA 1JKKA 4GUBA 4JBQA 4M69A 4DGGA 3ZSIA 1FVTA 2IEWA 3GC8A 3PVWA 5IMEA 2YFXA 3ZZEA 2NRUA 3K2LA 3Q53A 4XBUA 4FZDB 4G3EA 3PUPA 2XJ2A 3V3VA 2I1MA 4FE2A 2OIDA 3QRKA 4CCBA 3F3WA 4J98A 3LFBA 4M14A 4YSJA 5LJJA 1NA7A 4OT6A 4OTWA 2XM9A 3DXNA 4ZTQA 3UIUA 4DT9A 4B9DA 1BLXA 3SW4A 4ANBA 3DAJA 1GNGA 3IGOA 3NUYA 2ITPA 3A4PA 3OW3A 1DS5A 5JN2A 4FEUA 1QPEA 1FPUA 4LFIA 4ZS4A 3HDMA 2PTKA 3GXLA 4NK9A 3E7OA 4X2KA 2BZJA 3PWYA 3UO4A 1APME 3MTLA 5HE0A 2XIYA 3DZQA 3VN9A 2HZ4A 3HMNA 1Q5KA 2ITXA 2YA9A 2OXYA 4EKKA 4NU1A 4CFXA 3F82A 5AR5A 3Q2JA 3E92A 3MWUA 5EOLA 3L8PA 4F1MA 1H24A 3EHAA 4IVCA 3UP2A 5LCKA 2JKQA 4X2JA 3VUMA 4BTJA 4NTTA 3MBLA 3UIBA 5AA9A 3HNGA 3QX4A 2E9NA 5IMXA 3CQUA 1ZYDA 1G8JA 4DG2E 2IVTA 3VF8A 1Q8WA 5JGDA 1MUOA 4G6OA 3NZ0A 5EQYA 3JVRA 1XH4A 3MFRA 2C68A 4F6UA 3GNIB 2NYAA 2BZKB 4QQ5A 5KZIA 2H6DA 4EWQA 4FX3A 4XV2A 4D0XA 4EL9A 1DI9A 1R0PA 4YJRA 5BUEA 5JK3A 2C5NA 2V22A 3O8UA 4ZTNA 3ZONA 4Y8DA 3WZKA 1UV5A 1H1SA 4QMVA 4ZMEA 2QKWB 3VUKA 2WTWA 4ACHA 4U9AA 3NIEA 2QOKA 1OIYA 5FQDC 3CKXA 3ANRA 5FBNC 4XV3A 4H1MA 3TV7A 3W2RA 3VVHA 4F99A 3U54A 1F0QA 4FV6A 2RIOA 5CEKA 3CQWA 4AE9A 2C1BA 4MXCA 5AX3A 4OAVB 4G3FA 4G6NA 3V5JA 4F09A 3UOJA 5F4NA 4FJVA 4FSMA 4GFOA 4IJPA 2C30A 3W10A 5D9HA 4YZ9A 4GT4A 2X0QA 3DNEA 3FYJX 3FC2A 3R8LA 4FYNA 2WTIA 2R0UA 3OXTA 4O4EA 3U4WA 4DG0E 4EUTA 2OK1A 5K5NA 2H9VA 3BU5A 4UB7A 3CKWA 3O50A 2G2HA 2R5TA 5CAQA 3UODA 1XO2B 2PZRA 5BVKA 3V5TA 2F2CB 1CM8A 3QRJA 4GG5A 2EXCX 4U42A 3TTJA 4E5AX 3EN4A 2RFDA 2BALA 4G1WA 4JIKA 2OU7A 3GB2A 3QRIA 4KSQA 3EQFA 4GU9A 4X2FA 5CXHA 3SAYA 3TTIA 2VU3A 4NM0A 2RG5A 4QYFA 3RKBA 5JGBA 2WHBA 2X6EA 2WMTA 3FLQA 3GC9A 4D9UA 3V8WA 4BF2A 2QLUA 2R4BA 2B54A 2IVSA 3W0OA 4FICA 4YJUA 3I60A 1RQQA 3POZA 4IFGA 4NIFB 3RAWA 2IZTA 1UU9A 1PF8A 3TZ8A 3BL9A 4MXYA 3FMMA 3RAKA 3ORZA 2V55A 2E9PA 5I3OA 4AACA 4IQ6A 4RVTA 4MYGA 3CD8A 2BIKB 3QUDA 4QDEA 5CF8A 2E9VA 3RCDA 4DH1A 4D4RA 5IDPA 2IPXA 2GHGA 4FNWA 3DB8A 1JNKA 2ZFYA 4RZWA 4FVPA 4LV7A 1OKWA 4P4CA 5CI6A 4AA5A 4EH5A 5JKGA 4XX9A 4AOJA 4NL0A 2XH5A 3R1YA 2QKRA 3IOPA 2ZVAA 4IJ9A 1B39A 1R3CA 2C5OA 3GQIA 4FT7A 5IQEA 3FL4A 4FTMA 1PJKA 3GCSA 1XBCA 3TG1A 1SVEA 3R04A 3KREA 2JFMA 4OR5A 5DH3A 2B4SB 2WNTA 2X8EA 3P0MA 2PVRA 3D5VA 4U3ZA 1Q41A 4Y85A 3O7LB 3MJ2A 4IIRA 4I4FA 3G0EA 5HNIX 4JDHA 4TKSA 1QL6A 3GVUA 4CV9A 3R1NA 3BV2A 4JBPA 2XKFA 3UO5A 3EH9A 2XEZA 4CQGA 4ACCA 2C6EA 3OXZA 1CTPE 3GFEA 2WQNA 3C7QA 4CMOA 4WUNA 1YXVA 2QODA 3S95A 4ANQA 2B9FA 4PWNA 1LPUA 1IG1A 4EJ7A 4NCTC 4CFVA 4O81A 2YIQA 2C5YA 4FNXA 4BCMA 3ZLSA 3L8SA 4RVLA 1PW2A 1M7NA 2YABA 3IO7A 3WILA 4J96A 3ET7A 3FHIA 3UYSA 4LUDA 3S1HA 2BDFA 3I0QA 3QZIA 3KY2A 4JX7A 4YNEA 3DKFA 3MFUA 2QU6A 4EC8A 4ZLOA 3R30A 4NKSA 4RT7A 5HE2A 3R9NA 4DHIB 1W2DA 5FWKK 5L4QA 2BUJA 1IEPA 2BHHA 3O8TA 4WIHA 2XAOA 5D1JA 4H05A 4FVQA 4ZZOA 4MK0A 4OAUC 2W1HA 1WVYA 4DF3A 4I6QA 4L7FA 1Q99A 5H8EA 3DTWA 3NVKI 3L9MA 2XIKA 4BZDA 5DE2A 3TNHA 2WKMA 3EQGA 5EM7A 4IADA 5BX0A 3QKKA 2YCRA 2VTQA 1JLUE 3FC1X 3KRJA 2BCJA 2PE1A 5CI7A