3HEGA

P38 in complex with sorafenib
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
348
structure length
333
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Analysis of imatinib and sorafenib binding to p38alpha compared with c-Abl and b-Raf provides structural insights for understanding the selectivity of inhibitors targeting the DFG-out form of protein kinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 99
structure length 333
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3hegA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3hegA01
3VNTA 3EMGA 3OG7A 3FMDA 3WYYA 1Q4LA 4JS8A 2C6MA 5AEPA 4F9CA 4C34A 4RRVA 2X7GA 3VS3A 3W33A 1YHVA 2W4OA 2X2KA 4YO6A 3M11A 3DJ7A 5HIDA 2OIDA 4FEUA 2X8EA 3ALOA 3Q04A 4IWDA 3G51A 2X7FA 4J8MA 4ZTLA 3TZ7A 3DZOA 4LUDA 4PRJA 3UBDA 3S1HA 4Y8DA 3UODA 3LCTA 5JZJA 5BYZA 2J5EA 1U54B 2CPKE 2J2IB 3OEZA 4EH7A 3O7LB 5AJQA 4ANLA 3Q3BA 2UZVA 4O0VA 2XIRA 4DEIA 2PMNX 2QI8A 3DLSA 3MVLA 1H27A 3R83A 3ZSGA 4QTEA 2VTNA 3R2BA 1KE7A 1EH4A 1HCLA 4L7FA 3FMEA 3QLFA 4F1MA 2BR1A 3EQCA 3W2SA 1PXJA 3L8XA 4BCHA 1OL6A 3OCBA 4C3RA 4MBJA 3SAYA 5EDRA 4BBMA 5AWMA 4O0XA 2WKMA 1OBGA 3AMYA 3UQCA 3OC1A 4O7SA 4R7IA 1OKYA 2WTWA 2EVAA 4KIQA 2PUNA 3R63A 3N51A 5BVKA 3TG1A 4AZVA 5M08A 5J9ZA 4CZTA 3R02A 5H2UA 3VHEA 4BTMA 4BDGA 5HKMA 1OPLA 4EYMA 4YJPA 2FUMA 4HGSA 3DB8A 4ZSLA 3WYXA 2YCRA 2FSMX 3NUNA 3HMMA 5C9CA 4NFNA 4F7NA 4TT7A 3F3WA 4L7SA 3H10A 2CGWA 5LARA 4WHZA 4BDBA 5AIKA 1PYXA 5IEYA 4G3FA 3AOXA 3TZMA 4M97A 3WF9A 4D9TA 2X9EA 4TYEA 1JLUE 4FGBA 4AZWA 1O6LA 3K2LA 3Q52A 3LAUA 4GSBA 5K4IA 1YXSA 4EK8A 3N9XA 2Y4IC 5IG1A 3VBYA 2WMBA 5IQBA 4OTWA 2ZMDA 3BLHA 4HPUE 3LXKA 4IVDA 4FGRA 4H3BA 4TXCA 4CLIA 4AFEA 3HMNA 4FV8A 3QA8A 3QQKA 4E5WA 2C5VA 3NVMB 4XS2A 3KA0A 3FI8A 1XJDA 2I0HA 1PXOA 2JD5A 2O3PA 3MJ2A 5M4FA 4RFZA 4M69B 4AT4A 2A27A 2WMRA 4QP9A 4XHKB 5CSHA 3RM6A 4ALVA 4UMPA 3BBTB 4WG3A 5DYJA 4E4XA 3OXTA 2YIYA 2R9SA 1URCA 4IB3A 5FLFA 2QG7A 1R78A 4LL5A 3UMXA 3QTUA 4AOIA 1YXVA 4MQ2A 5CEOA 1Q5KA 3KEXA 3AD4A 3R71A 3UPZA 3CPCA 3TV7A 2FB8A 4KAOA 3QRIA 5E8ZA 5C4KA 2C0TA 5HICA 2Q0BA 5IEXA 2GHMA 4KRDA 3GP0A 4BCKA 5JGDA 3Q96A 4AOTA 3MSSA 4NL0A 1W8CA 4MD9E 3RTPA 3PA4A 5GJDA 1IG1A 2BZHB 4V0GB 1OGUA 3Q9WA 1WBWA 4UY9A 4XG9A 4G2FA 3SV0A 4DFBA 3R2YA 1KWPA 3OF0A 4XX9A 5CENA 3RZFA 5FP6A 3V5LA 5DR6A 4PPBA 3FMMA 5J5TA 2QR7A 3WIKA 3FEGA 3EFJA 4RJ4A 1AD5A 3QRTA 3ZC6A 4RLKA 3C9WA 4AE9A 3RWQA 1FBNA 4HYUA 4J7BA 4JX7A 5AM6A 3EQBA 3ET7A 4IWQA 3CD3A 3P08A 4P5QA 4EI4A 2G1TA 4ZLOA 4H3QA 4FTIA 1OIYA 5IH4A 4W4XA 4ASZA 5J9LA 5C8MA 3R7IA 2Z7QA 3RAKA 5DN3A 4YLLA 3DT1A 3I1AA 4MKCA 3KFAA 4BDAA 2ITNA 3DA6A 4WSYA 4AW0A 3LFBA 5H9BA 3R9RA 4L68A 4TW9A 4B0GA 4BF2A 2ZM3A 3KKVA 5JQ8A 3COKA 4F9WA 4Y85A 2PVYA 3BYUA 4HCVA 3PJ8A 3IECA 2YM8A 3HZTA 4ANBA 2RG6A 2R64A 1PJKA 3FC2A 5BVEA 1H1SA 4D2WA 3AC5A 5CXHA 1WBOA 3PVWA 5LMAA 3A7FA 2XYNA 3TWJA 2VTIA 3CJFA 2QNJA 3MWUA 4YTFA 1YDSE 4IC8A 1PXKA 3RAHA 4RA4A 4NM3A 4K33A 2C5NA 2YA9A 4O7LA 2OIQA 2QU5A 4W8DA 3SRVB 3AGMA 4PWNA 4KS8A 3O96A 2SRCA 3QTWA 4A9TA 4UYAA 4DGOA 3WF5A 1IA9A 4IM0A 1H01A 4QMTA 3EYHA 1PXNA 2Y6OA 3U51A 2YHVA 1GZNA 1JVPP 3A99A 2IVSA 2UW4A 4P7EA 4R6VA 4RVMA 4ANMA 4BCGA 5HNIX 1GNGA 4C38A 4B8LA 1CKJA 4RZWA 3KMWA 1ZYSA 1Y8YA 4FG7A 3BEAA 5IQEA 2W9ZB 5ETCA 4G31A 4CV9A 3Q2JA 3FLZA 4QQ5A 3ETAA 3QQGA 5F9EA 4YPDA 5AA8A 4ZSGA 4GJ3A 4YMJA 3ZLXA 4DC2A 2J0JA 5I0BA 1R0PA 2VWXA 3KK9A 2BKZA 3RNYA 5L6PA 4LOPA 2WB8A 5KNJA 4PL5A 1Q3DA 4UEUA 3W2QA 2W96B 1UU7A 5GZ9A 5C4LA 3AQVA 5IH6A 4FUXA 4LI5A 5CX9A 3PSBA 2E9UA 1RQQA 4BC6A 3C51A 3GCSA 1F0QA 4D28A 4D4SA 3TI1A 2ZV9A 2UW7A 3QC9A 4QMLA 1FMKA 1O9UA 1UWJA 3FZ1A 3HV4A 5BUEA 1YHSA 2B1PA 3DZQA 4Z55A 4QP7A 3I79A 4O0YA 3TZ8A 4RIOA 4DYMA 4PMPA 3IW8A 1XR1A 5J95A 4IJPA 4DEGA 4E4LA 4YR8A 1BYGA 4XV3A 5E8YA 3F5PA 2X2LA 3R7GA 4TPTA 3IQ7A 4Y83A 4S31A 3VW6A 3F88A 4BHNA 4NIFA 4HW7A 3QCYA 3BV3A 3EL8A 3NUPA 5HX8A 2O5KA 3NUXA 4NW6A 2Z2WA 5AFVA 4KIKA 2JLDA 2V7OA 5CSWA 4HYHA 3VVHA 4MF1A 4XCUA 2EUFB 3WZEA 3E7OA 4TY1A 3U6IA 3F5UA 1OUYA 3F7WA 3EWHA 4IFCA 5L8JA 1REKA 3NCGA 4EHEA 4CMUA 2QOLA 2YM5A 2QOFA 1UU3A 4E26A 3HVCA 3I5ZA 4FKIA 5HTIA 3RINA 4QQTA 3SA0A 4RWJA 3EFWA 3MH3A 4GT3A 5LVOA 4X2JA 3UOJA 4YBJA 2AYPA 2VU3A 3KU2A 2H9VA 4FOCA 5A6OA 3GEQA 2X8DA 3L8PA 4OT6A 1Y6BA 4MWHA 5GNKA 1YWVA 4F1TA 4FIEA 4BWXA 4RLLA 1PRYA 3SGCA 1PHKA 2ITTA 2YABA 2RFNA 3Q2MA 1J7IA 5HO7A 3P5KA 5F95A 2BRGA 4X3FC 5CAOA 4ERWA 4C58A 4RJ8A 3KVWA 2CGVA 4UX9A 4JR7A 4MTAA 3JS2A 4XRJA 3DXPA 2C6TA 2JEDA 1MRYA 1KV1A 3DK7A 3R7YA 3H0YA 4EOKA 5LVMA 4ARKA 4KWPA 2YLFA 4S34A 3DXQA 3NUUA 3O0GA 1H0VA 4PMSA 3FZRA 3SKCA 3D2IA 4J97A 4G6LA 1FQ1B 1OIQA 5A4EA 5HU9A 4Y5QA 3R9NA 3UE4A 2JBOA 3ZUVA 4CVAA 1UV5A 2RKUA 5B2KA 4CD0A 4W8EA 2QG5A 2ZVAA 2VN9A 3SG8A 1OL2A 3OCTA 3LIJA 5GZ8A 3VS5A 3ZXZA 3ORTA 4ZZNA 4MNEA 2CKEA 2RF9A 4BBEA 1W84A 4FIGA 3ZO4A 3VF9A 3COHA 5L2SA 4PPAA 4NKSA 3DV3A 4BDFA 3CGFA 4FL3A 4O38A 3DDQA 3EH9A 3PA3A 1ZZLA 5CU6A 4OGRA 5L2QA 5A9UA 2X4FA 5FD2A 4G34A 2J0IA 2FA2A 3AG9A 4YTHA 4BBFA 4FZ6A 4XP2A 2B52A 3K3JA 1UNLA 3MI9A 2X1NA 4IADA 4X6QC 5HHWA 4U6RA 4YLKA 2XNBA 3CEKA 4I6BA 2PVLA 3VBQA 3DQXA 3MFUA 4FKTA 3HA6A 4I5CA 1B6CB 1GOLA 3BHTA 4LV8A 5F94A 3U9NA 3EFLA 3NNXA 3HEGA 3DBDA 3O8TA 4F6WA 1RJBA 1Q41A 2XEYA 3V51A 3VS2A 5IEVA 4JAIA 3BIZA 3RMFA 5I9UA 1BX6A 4JBVA 3QTQA 3U55A 1JQHA 5LOHA 4J96A 4K0YA 4FKQA 4HVSA 4IE9A 4IAYA 4FSZA 2YM6A 3KK8A 3D5VA 3QF9A 2C5YA 5IUIA 2Y8OA 1ZZ2A 4RVLA 3OCSA 3LXLA 4CYJA 3QD2B 4FE2A 4FVQA 4M84A 4OLIA 5DEYA 3QWJA 4EOOA 3QHRA 5B2MA 5DT3A 3PPJA 5DLSA 1BKXA 4D2RA 3R9DA 1Q61A 3H30A 5CTPA 5EYDA 4AAAA 3FI4A 5ETIA 2XP2A 3NIZA 3NAXA 4IX3A 4WRSA 5A46A 2G2IA 5FDXA 5AV0A 2ITWA 3CY3A 1ND4A 1QPDA 3QYZA 3LFDA 4GV1A 4KINA 4AA4A 4C59A 4I92A 4ZLZA 2WEIA 3LM5A 1YOMA 4FC0A 1ZYLA 4NH1A 1ZYCA 4WIHA 1UU9A 5D7VA 3ZRKA 2G15A 1GZ8A 5JGAA 4J95A 4I93A 5A6NA 1J1CA 3FAAA 3RPYA 2H6DA 4FZAB 4X21A 3UIUA 4C4EA 4RJ6A 3A8WA 3R7OA 4AWIA 4RX8A 2G2HA 4EC9A 4EOIA 3AT3A 2UW0A 3R00A 3TJDA 5IQAA 1UWHA 2W1CA 2XVDA 4TN6A 2OU7A 2W1ZA 3E62A 3R0TA 3NMUF 1BI8A 4GL9A 3E3PA 2YISA 4OBPA 4O0SA 4CKIA 5FG8A 3PY1A 4WG5A 3HV7A 2Q83A 2OH4A 3O23A 2WTDA 4LRMA 4N6ZA 3OZ6A 4IDTA 2ZYBA 3QCSA 4RWKA 4M13A 5AP5A 4ANSA 3LQ3A 4DFYA 3LHJA 4MVFA 2W1FA 5CANA 4ASXA 4C2VA 4PP7A 1GY3A 1U59A 2VTHA 3BPRA 4LRJA 4NSTA 2PVFA 5CXZA 4GYIA 4BWPA 2J9MA 3M2WA 4BKZA 5IMEA 5FTGA 3P86A 5L8KA 3QRJA 1CSNA 4R1YA 3IW4A 3LW0A 4O7RA 4O1OA 4Z3VA 4NEUA 3FLNC 5ICPA 4OAUC 3QTRA 3DBQA 4FKVA 3PXKA 3NUSA 2GS7A 2O63A 2Y9QA 1DI8A 2GPHA 2R3NA 4WNPA 4F0IA 4CFUA 4I0RA 3CBLA 5CU3A 5ETFA 2XKDA 2JKKA 4EH5A 2REIA 1IAHA 1LEZA 2HENA 3UPXA 5L8LA 3QL8A 3DJ5A 2WAJA 3A4OX 3GT8A 4FYNA 1GZOA 4DT9A 2XM8A 4PTGA 1JKKA 1YRPA 2WU6A 3UNJA 3AC8A 1OL1A 1IA8A 5CEKA 5DH3A 3ROYA 3EN9A 3UZRA 3UOHA 4BI2A 4TYHB 4FMQA 2P0CA 3GI3A 3QQLA 2XJ0A 4XUFA 5ANIA 3SQQA 4D0XA 1ZYJA 4QYGA 3JUHA 4AZEA 3F3ZA 4PNKA 4CGAA 2UZNA 2A19B 2ZB1A 5DA3A 3RPVA 5JFWA 4C4JA 2XRWA 4HPTE 2Y4IB 3UC3A 2RFEA 3FXWA 3Q9XA 4FVPA 4XJ0A 5CSVA 4O2ZA 3WE8A 3UP2A 4XRLA 4XP3A 5I9YA 3RPSA 4NM7A 3MH0A 4GT4A 4X0MA 3RP9A 1M2PA 3IO7A 2ITZA 3ENMA 3HMOA 4K9YA 4P90A 4D4YA 5E8WA 2W1IA 4WKQA 3D7ZA 5DWRA 2JIUA 5HBHA 4F1OA 3HAVA 4DG2E 3QTXA 2W0JA 2BPMA 3BHYA 2PE1A 3JVSA 3KRLA 1ATPE 3F2AA 1WBTA 4MWIA 4QMXA 4S33A 4IVAA 2CJMA 4LOOA 4OBOA 4PV0A 2JC6A 2O65A 2Y4PA 5CWZA 2JKOA 2ONLC 3OWPA 4FL2A 3TL8A 2BHEA 4DTBA 1J3HA 2YCSA 4MF0A 5JT2A 3QRUA 4QMNA 5IH5A 4DLJA 3LFCA 4RA5A 4F6UA 4XNEA 5LCJA 1GAGA 2ITPA 2V62A 2VTOA 5A54A 4OAVB 5LVLA 2CCHA 4GMYA 4C4GA 5KMNA 2OZAA 3ACKA 3PLAE 1PMVA 3LCSA 4TNDA 2NRUA 3MVMA 4NWMA 3LFSA 5CVFA 5FXSA 5AP2A 2WO6A 3QQUA 4QRCA 5HTCA 1G8AA 2F2UA 4DE4A 3WZDA 3WARA 1P5EA 2BROA 2UW3A 2VNYA 4NYEA 2HXLA 2BAJA 3LMHA 3ACJA 3GCUA 1FGKA 2GTMA 3FY0A 1E9HA 1PXMA 3CQEA 5M07A 1OIRA 3A2CA 1GIIA 3TT0A 4O7WA 1LEWA 4CCUA 3DS6A 1B39A 4R77A 2G9XA 2XJ2A 2HCKA 3HRFA 3IW6A 3O71A 2VGPA 3CJGA 4GG5A 3V5QA 5A4QA 2GNHA 5IDNA 4AGDA 4DEDA 3RK5A 2JDVA 2VTPA 4NIFB 5C26A 1WBSA 3AD6A 3NR9A 1MRUA 4K11A 1ERKA 2VV9A 4ZJVA 3PUPA 1GIJA 5M4UA 3GUBA 4IX4A 4MYGA 2J50A 4F08A 5LQFA 4GVAA 3FL5A 2CN8A 4KIOA 1RW8A 1YWRA 4ZZOA 3UO6A 1WVWA 5HD4A 5K9IA 3OBJA 5AUZA 2CLQA 2YCFA 2CN5A 3PZHA 4M0ZA 4MH7A 3CR0A 4TYGA 4BGGA 4E3CA 1R39A 4DH1A 2GCDA 4UWBA 4EBWA 1FPUA 3GCPA 2WTVA 2C6IA 3BHUA 4FV7A 4O0TA 4USDA 3ORIA 1E1VA 5M4CA 3TCPA 4N0SA 3UQFA 3MH1A 3QZHA 3CPBA 3VHKA 5HTBA 4GUBA 4ZSJA 4EOPA 3PYYA 3VUHA 2ERKA 4FKOA 3VUIA 4C4FA 5H8BA 3DAJA 4PPCA 3VS7A 3MA6A 2BAKA 3BKBA 4RIWA 4W9XA 1JOWB 1K9AA 2HY81 5AR4A 4MXYA 4EK6A 2P33A 3EN6A 5HEZA 5KE0A 3PP0A 5HVKA 3QZFA 4BCNA 4LUEA 3NPCA 3DQWA 4O22A 4LMUA 4DEHA 5CVHA 3TEIA 2ONLA 5EFQA 2VTQA 2HZ0A 3BGZA 4FR4A 4EBVA 3D14A 2KULA 3NCZA 3ORZA 3TNIA 2BZJA 3B8QA 2E9OA 4AE6A 5FXRA 4FEWA 4DLIA 4UMUA 1R1WA 3BQRA 1FVVA 1T45A 2XUUA 3A8XA 1M17A 4BDDA 5D1JA 2BILB 1IASA 1ZMWA 5J87A 5K4JA 4H58A 3E87A 1MQBA 3AC2A 3VIDA 4F6SA 3H4JA 3MY1A 3L1SA 4CFMA 4MNEB 4R78A 4FNWA 4FEXA 3PJCA 2YN8A 3NVKI 3ORPA 5AV2A 2FSOX 5DE2A 1H28A 4BCQA 1IAJA 5IQDA 4JRNA 3QC4A 4M12A 4NW5A 3DK6A 3KRRA 2IZRA 4IW0A 4BRXA 4EZ3A 4QTBA 4J52A 4ZEGA 4PX6A 3WF6A 3CP9A 4RC2A 1T46A 2GNIA 3LE6A 4QYFA 4FIJA 1ZMUA 2ITXA 5DIAA 3JYAA 4USFA 4DEEA 2X0GA 3R8VA 2W5BA 3NW7A 4E4MA 2UZDA 4GH2A 3V6RA 3VWAA 3EL7A 3P23A 4FK6A 4RVKA 5TR6A 2QOCA 2YITA 1SVHA 4AQCA 2WTKC 3W1FA 4BYIA 4BIEA 4LGHA 4ACDA 3BEGA 4JBPA 3EQFA 2WOUA 1OL7A 3WF8A 4DFZE 1H07A 2I0VA 5CZHA 3F2RA 1KE6A 3UIMA 5A14A 3ITZA 3HYHA 3OMVA 2PVJA 4PDYA 3TM0A 3E8NA 1SNUA 3OY1A 5CS6A 2R3LA 3H3CA 4EHGA 3CQUA 3QA0A 4AZFA 4FKWA 4L46A 5AX9A 3W2PA 2QOOA 2PMOX 3C4XA 3KULB 2XBAA 4CFXA 4HOKA 1S9JA 3FMKA 3VUKA 4LV5A 5AP1A 1UNGA 4FT7A 2XNEA 4B99A 5HLPA 5HG9A 5KHWA 2UZWE 4MD8E 5EHYA 4L00A 4FF8A 4YP8A 3UYTA 3NSZA 2R0IA 5TT7A 5EQPA 1Y57A 3CTHA 3UZPA 5HCYA 4JR3A 3KMMA 2F4JA 2W4KA 4KKGA 4YJOA 4D2VA 1Q99A 5KZIA 4FA2A 4D5KA 3G6HA 5E9EA 2YM3A 4X3FB 5IQIA 1OIUA 3IK3A 4QMPA 4FNXA 4YLJA 5D10A 4CG8A 3OS3A 2QCSA 1PMEA 1YXUA 4RC4A 4O7YA 1YDRE 4YBKA 3LFFA 2IPXA 5ANJA 4YJTA 2ZB0A 3R1QA 4AG8A 4DH7A 4E7WA 3ZXTA 1F5QA 5DHJA 2JFMA 3KB7A 2HZIA 3UIBA 3ZBXA 3SVVA 3PDTA 4ZJIA 4I94A 3OUKA 2YDJA 5AP0A 4ZMFA 2GS2A 4W4WA 3E8EA 4IH8A 2X39A 3ZFYA 3UMWA 3R7EA 4X2NA 4XOYA 4F70A 3FSFA 3OTVA 3Q6UA 4DH8A 5E1EA 5BMSA 2IN6A 2C4GA 2OXDA 1UU8A 2VTSA 3ZFXA 1P14A 4CRLA 4WD5A 3M42A 5JMSA 2HZ4A 3PJ1A 2GHLA 4FX3A 1L8TA 4P5ZA 1VYWA 2QO9A 2UZUE 2F2CB 3CD8A 4BKJA 4O81A 5DRBA 4QMYA 3W55A 1TKIA 3T9TA 2XRUA 3Q4CA 4AA5A 4GK3A 1OM1A 3JVRA 3QU0A 1JSVA 2C5XA 3OROA 2OK1A 4FTMA 1JWHA 5BVFA 4EH3A 1J1BA 4UXQA 4RWIA 5FUTA 1H8FA 5JEBA 2XNOA 3LVPA 3QQFA 5BVWA 3UYSA 3VW8A 2PU8A 2NPQA 4TKSA 5E92A 3OXIA 2B55A 3F3VA 5BMMA 4LMNA 5EOBA 1RE8A 2DYLA 5M56A 4G1WA 1SVGA 4L3JA 4NZWB 3UOKA 2QODA 3CXWA 3VUMA 3NLBA 4RIXA 2FYSA 3FKLA 4QYHA 4TZRA 4BDCA 4YURA 4O21A 3FHIA 5GZAA 4IZ7A 4CKJA 3S00A 3FKOA 3FY2A 2IZSA 3TACA 1H1QA 4ITIA 5DGZA 3UG1A 2W9FB 3SXFA 2OZOA 2GNJA 3GOKA 3KN6A 3T8OA 3TNPC 5DG5A 1BMKA 4AN2A 4EK3A 4YO4A 5KBRA 4EOSA 3VUTA 4ITJA 1WBPA 4HGEA 3TNHA 3BE2A 1Q62A 5BYLA 3QZGA 2GS6A 2OF2A 2BRHA 2VWBA 4I41A 3V5JA 4D0WA 5CAUA 1H00A 1UA2A 2C6LA 5IA3A 1A48A 3BRBA 4B6LA 3MH2A 1OZ1A 5EM5A 4BVUA 3IGGA 4FNYA 2B54A 3WBLA 3AT2A 3SLSA 2XEZA 1QPJA 3U54A 3PXRA 3C13A 2OBJA 4FIHA 4M15A 3BWFA 3BHVA 3PP1A 3VBWA 2YAAA 5HG8A 3S3IA 1Z57A 1V0PA 2UZLA 4PDOA 2YLEA 3PXQA 2PTKA 2XCHA 4YGAA 4JG8A 2VD5A 3EQPA 4FTRA 3PIYA 4FUYA 1F3MC 4HCUA 4M0YA 4R3PA 2QLQA 4TNBA 3FLSA 2V7AA 3BLQA 3C0HA 3ORNA 4OTHA 4QTAA 2ZAZA 3RCDA 2PMLX 2OLCA 3FV8A 3MPAA 3OXZA 3DTCA 4XLVA 4OTDA 4ZOGA 4EUTA 3S0OA 4KBKA 1ZOGA 4FKJA 4ID7A 1BI7A 3H0ZA 2WD1A 3L9NA 2OZAB 4JOAA 3UVQA 1Q8ZA 4C2WA 2B4SB 3ZO2A 2BUJA 5EKNA 2GQRA 3NS9A 3VS1A 5M51A 5TE0A 2VWIA 4BI0A 3HECA 5LVNA 5T68A 4O83A 4D1XA 3PG1A 4QMMA 4GCJA 3BYOA 2X6DA 5LVPA 3O2MA 4XBUA 5I9WA 3R1NA 4O91A 3JXWA 4KS7A 4NTTA 2AUHA 3R28A 2PSQA 2BFYA 2GSFA 5F1ZA 5FTOA 3CIKA 4HVDA 3W2OA 5DVRA 1PXPA 5J9YA 1K2PA 2CMWA 5AUWA 3NEWA 4AN9A 2WMVA 4EWHA 5J8IA 2FVDA 3TTIA 4IQ6A 2B9HA 1YI3A 4NCTC 4OTGA 3SC1A 4AW5A 1BL7A 5IU2A 2UW6A 2VRXA 3AD5A 4U3ZA 4IDVA 5B0XA 4TTHB 2W17A 3EN5A 4II5A 3C4CA 3HDMA 3WZUA 4ENYA 4ERKA 1JKSA 4YJSA 3TKIA 5CI7A 3F9NA 3F3UA 4S32A 2VTMA 1H1PA 5JGBA 3CKXA 3E3BX 4GEOA 3VULA 4KUJA 2RFSA 2XYUA 1XKKA 3DLZA 4FBXA 2IVVA 2P55A 1URWA 5G1XA 4BCPA 3SXSA 2ESMA 3BELA 4AA0A 4YPSA 2HAKA 4NUSA 1VYZA 2UVXA 3O8PA 4BGHA 4L43A 3DB6A 4KNBA 3CLYA 2YAKA 2ZMCA 3WI6A 4BIDA 4QPSA 3OT3A 4V05A 3R8MA 2XB7A 4DF3A 1ZARA 2WMTA 4C57A 3VBVA 3LJ1A 4O7TA 3EIDA 3TUBA 4HZRA 3B8RA 4ZY6A 3ZDUA 1Y6AA 4RIWB 3NNWA 4E20A 5CF6A 2EB2A 1OI9A 4OT5A 5JFVA 3TDWA 4C35A 3VN9A 2R3KA 3D94A 3BYVA 4FV5A 4FV2A 2PE0A 3L8VA 4FKGA 4ZIMA 4DBNA 2JKMA 4EH2A 4YC6A 2IVTA 4YSMA 5K3YA 1KOAA 3MY0A 2ZV7A 3DGKA 4JT3A 2XF0A 2GMXA 4FT5A 2C6EA 4H1JA 1TVOA 2UW8A 3CGOA 4U0IA 3MW1A 3LCDA 2RSVA 3MGYA 3VJNA 4CFFA 2YIWA 4UB7A 3I6WA 5T6KA 3IOKA 4FTTA 4IEBA 4USEA 4QP8A 2VWZA 2HW7A 4G6NA 3K3IA 3UQGA 5CT7A 3N4TA 4ZZMA 1OECA 3L9MA 3MFTA 3HRCA 4GFOA 5DR9A 2BVAA 4AU8A 2GHGA 4FT0A 2CNUA 3D7TA 3FXZA 3FKNA 2V55A 4XG7A 3LZBA 4DH3A 4E93A 2QO2A 4IZ5A 4MBIA 5BNJA 2YIRA 3H9RA 3BV2A 3AC4A 2J7TA 4QQCA 4EOQA 3C1XA 4ANNA 4ZP5A 4R8QA 2QD9A 4NCTA 2DUVA 4HNFA 4N6YA 4G16A 5KKRC 4YNOA 1NVQA 4O6LA 5H8EA 2CLXA 3R8ZA 2OIBA 3P4KA 4ACCA 4GVJA 5AP3A 4BHZA 4JDHA 5HESA 3LKMA 3OBGA 4XG2A 5BVOA 1BL6A 3Q4TA 4FL1A 3NW5A 3FQHA 4ZSEA 5TF9A 4U44A 2C0OA 5AR2A 2RG5A 2WQEA 2EXEA 2VO3A 4F99A 3HDNA 1Z9XA 3OFMA 3UO5A 4EL9A 2VWWA 3WF7A 3RAIA 4AXAA 4YU2A 4XV2A 4G9CA 2X9FA 2J0LA 1PF8A 2JBPA 3F6XA 3GOPA 4JIKA 4M68A 4A07A 3O51A 4C33A 4DITA 2BDJA 4QTDA 4J53A 4ACGA 2CSNA 3R22A 5KBQA 2OICA 3I5NA 3D5WA 1YOJA 5HQ0A 2P4IA 2BCJA 2WNTA 5KMJA 4DFNA 5DI1A 2XKFA 4FZFB 1V1KA 4I24A 4BCIA 5FP5A 4EQUA 1Q8YA 3IDPA 4C37A 4AP7A 4NU1A 1U46A 2WMXA 2PULA 2WQBA 4H1MA 2W5AA 4WO5A 3PXYA 4X6RA 2ZDTA 4H05A 1XBAA 2A1AB 1UKIA 5KZ0A 3GBZA 5FBOA 3KC3A 4IAZA 3VRZA 2YWVA 5DOSA 3NUAA 1ZOHA 4QP2A 4BDHA 2WU7A 4Q2AA 1V0OA 5AR8A 3QTSA 3ID6C 1XBBA 4PQNA 2F57A 2FSTX 2YDIA 4I6FA 5D12A 3DNDA 4YJVA 5CEPA 3OWKA 2I6LA 3BZ3A 4NKAA 4ANQA 3TXOA 4XMOA 4G5PA 2UZEA 4U80A 5HNGA 4FTCA 3DFCB 2YZAA 3DKOA 4CQGA 3Q9ZA 4IZAA 3ALNA 4OBQA 4QO9A 1DAWA 3GQLA 2OSCA 4G3GA 3B2WA 4JX3A 2WTCA 4WUAA 4WNKA 1NVSA 5HOAA 3LCKA 4E6AA 4FTLA 4EWQA 3Q5IA 2DQ7X 4MHAA 4RMZA 5A4LA 1Q3WA 4XV9A 2PK9A 5HE2A 4PDPA 4L52A 5GIPE 2XK3A 2WTKB 4U3YA 5E1SA 3U8WA 2RIOA 3GENA 4FKRA 5CAPA 1Q8UA 3FZPA 4N4SA 2P2IA 4GKIA 1XH9A 2ITUA 2OJJA 3DKCA 4O6EA 4FTQA 3R8PA 5IDPA 3H9OA 3R30A 5EDPA 2QO7A 3U6HA 2OFVA 3P7CA 3KF4A 4RVTA 1IEPA 4NJDA 4JQ7A 1J7LA 2VWUA 2VZ6A 2JIVA 4JIAA 4DN5A 5DR2A 2B9IA 1I44A 2OFUA 3IS5A 4R7HA 3FL4A 2ACXA 3W2CA 3GC9A 2YACA 2PMIA 3QUDA 3BU3A 3WZKA 5ANEA 4GJ2A 2E2BA 2CHLA 2HXQA 2QR8A 3TZ9A 4D1SA 2R7BA 4GG7A 4RIXB 4DHFA 2R3IA 3V3VA 4AZTA 4YZDA 3LFEA 3G9NA 4BZDA 5IA2A 4QMWA 5M06A 1ZXEA 3SX9A 4QMOA 5EYCA 1WBNA 3A7JA 1M2QA 4C3PA 1OVEA 4I0TA 4FSTA 5C8NA 4UYNA 5I5ZA 3R6XA 5DPVA 3HMIA 3HL7A 5HE0A 5HI2A 3MA3A 2XKEA 4YC3A 3Q60A 1GIHA 2UZTA 4A7CA 3MJ1A 1H1WA 4ZK5A 2VX3A 3FSKA 2X81A 3QGYA 3RCJA 3SXRA 3GU5A 2IWIA 3BBWA 1YKRA 4LG4A 3KXXA 5TOZA 2XNNA 5FBNC 3V8WA 3ZUTA 5J79A 2NO3A 2YCQA 1PW2A 1AGWA 3ZYAA 5L2TA 5HO8A 3MPMA 3F61A 1CTPE 4M66A 3KCKA 4FTNA 4NM0A 4MBLA 4Y95A 5CY3A 5E8TA 2NNWB 3KVXA 4RFMA 3EN4A 5IA1A 5F20A 4HGLA 4S2ZA 4KSQA 2B53A 3PZEA 4F4PA 3RBWA 3MVHA 3CQWA 4E5AX 4E5BA 4ZY5A 2BDWA 3QQJA 5EI6A 2OXXA 3I6UA 4IXPA 2Q0NA 3OY3A 4R5SA 3D5UA 3ZSHA 3MIAA 4M67A 5E4HA 4LM5A 3WOWA 3OWJA 2QKWB 4MNFA 4DT8A 3ZMMA 3F2NA 2BALA 4RX7A 5GIOE 1QCFA 1CKPA 3D2KA 4FTKA 3DCVA 2Z60A 4WG4A 5C27A 1TQPA 3LQ5A 4H3PA 3DKGA 4QP1A 1JKTA 4GYGA 3CE3A 2CDZA 3KRJA 4I5HA 4MCVA 3ZOSA 3VAPA 3TN8A 4ZY4A 3AC1A 3OHTA 4AGUA 4UWYA 5AMNA 3LJ2A 2C30A 5CU4A 1G8SA 2ITQA 2XK8A 3MYGA 4ZTNA 3QBNA 4IM2A 4ZTHA 2J90A 4XG4A 4XYFA 4RBLA 4ZTSA 3G2FA 2VUWA 4UZDA 5AUXA 1YHWA 3UP7A 4OR5A 2ITYA 5EM7A 3UJGA 3F5XA 4TWOA 5HCXA 4V0GA 5A4CA 3WZJA 4HCTA 5HBEA 4ORKA 4U41A 4GKHA 2I0EA 5AIRA 3FPMA 1XWSA 5FEQA 1YOLA 2PUUA 2WFYA 3V01A 1KOBA 2X2MA 3VQUA 3V5WA 5EI2A 4BR3A 2O0UA 1YQJA 4U43A 3V04A 3POZA 2XCKA 3AGLA 5EG3A 4DG0E 5JN2A 3LOKA 4X2FA 1OB3A 2G01A 2V0DA 4XEYA 3P7AA 4AGWA 3ZZEA 4F7LA 4C7TA 1H25A 4MX9A 3MESA 1H08A 5M44A 4KB8A 1JBPE 3HV6A 3PPKA 5IQCA 3ULIA 3TV6A 3DNEA 4FYOA 4YZNA 3D5XA 4Z9LA 4PNIA 4U8ZA 5F4NA 4O0RA 4KABA 5A4TA 1AQ1A 4JI9A 4IZYA 3C7QA 4MK0A 3ZLSA 5LXMA 4NM5A 1H1RA 4HYIA 2YFXA 2ZDUA 4I4FA 3VUGA 5JFSA 3F7ZA 4DEBA 4JDKA 2F7XE 2AC3A 2XJ1A 3Q53A 3QHWA 3ZH8A 3CTJA 4C0TA 3M1SA 4K18A 5IA4A 3AT4A 1ZWSA 1MRVA 3A7GA 4IC7A 3SDJA 4TWPA 5BPYA 3P1AA 5CVGA 1H24A 2Z7RA 2WMQA 4J98A 4KIKB 4RPVA 4FV6A 5FXQA 3UZTA 4BY9E 3D83A 4LGDA 2VAGA 2WEVA 1JKLA 4D9UA 4JLCA 4OTIA 1S9IA 4NFMA 4G9RA 4LGGA 4M3QA 4X2KA 5EM8A 5AUUA 5FGKA 1DS5A 4L3PA 5HNBA 3QQHA 3QXOA 3ZDIA 2PYWA 2BIKB 3DBFA 3GNIB 2B9FA 3I7CA 2IZUA 4FNZA 2R4BA 2OG8A 2A0CX 4PL4A 2XM9A 1YVJA 3W16A 3PPZA 4QQJA 2OO8X 4RC3A 3QD3A 1PY5A 3D9VA 2OJFE 4R5YA 2IG7A 2R2PA 2OJ9A 4G3EA 5BVNA 1QPCA 4M7IA 3OD6X 3FYKX 1YWNA 5CEIA 3DJ6A 4PDSA 3TDVA 2FGIA 3P7BA 5ANDA 2QQ7A 2IZTA 5D9HA 5DEWA 3TKUA 3QFVA 3ATTA 5M09A 2VO6A 3UG2A 3OP5A 3LLAA 3FE3A 4QMVA 4IIRA 2W4JA 4OTRA 4HJOA 5M55A 5IQGA 1ZY4A 3MTFA 1MUOA 4L9IA 5AADA 1NT2A 1JNKA 4W4VA 4TRLA 3TJCA 5BUJA 3GQIA 4EQCA 4QYEA 4EUUA 2PZRA 1YW2A 3C0IA 5KO1A 2BTRA 3EQDA 2LAVA 3ZM4A 4XG6A 4P4CA 5AAEA 4FV4A 3NW6A 4EH9A 5KMIA 3UGCA 3BHHA 5CNOA 1Y91A 1QL6A 1SZMA 2XH5A 5DMZA 5FM2A 3MS9A 2WTIA 1XHAA 3L9LA 2Z02A 4CYIA 3LXPA 4FIFA 3S95A 3P0MA 2W05A 5KMMA 3PSCA 4YC8A 1M14A 3UDBA 2JDTA 3NNVA 4FTUA 4DA5A 3NUYA 3TNWA 2F9GA 5BUIA 3NX8A 1XH7A 5IKWA 2QC6A 4FEQA 2BRMA 3ZO1A 2WIPA 4CZUA 4EJ7A 2BMCA 5CT0A 3QKLA 4EC8A 2DS1A 4ANOA 3U4UA 3PFQA 2KTYA 3P79A 3CSVA 3MV5A 4NTSA 4BDEA 1TQMA 4EH4A 3HGKA 2XA4A 3GXLA 2PVMA 2PZPA 1APME 3UNKA 2YERA 5CEMA 4YJUA 5HE3A 2C1BA 1GJOA 5EH0A 5I9ZA 4F0FA 3K5UA 1J7UA 2ZV8A 4RJ7A 4CMOA 3AMBA 3MFRA 5K5NA 4CG9A 2R3JA 3LCOA 4L8MA 4CT2A 3G0EA 2A4LA 4FIIA 4FTOA 5M4IA 3Q6WA 4FTAA 4Y73A 4YZBA 5FDPA 4UALA 1ZAOA 5E91A 5EKOA 4C62A 5BX0A 3DBEA 4BIBA 2CKQA 2IVUA 4C4IA 3QTIA 3RVGA 2ZOQA 2O64A 3R7UA 4IX5A 5IA0A 2CCIA 3ERKA 2QOHA 5EHLA 4DTAA 3NYVA 4YZ9A 5J5SA 4QMSA 3ZFMA 4IACA 3ZRMA 1YI4A 4QPMA 4PUZA 5D11A 2G2FA 2CKOA 1DI9A 3GGFA 2C3JA 4TWNA 3DXNA 4FV9A 2I7QA 3EQHA 5JRQA 4CKRA 2WELA 2CNVA 2PZIA 3EZRA 3GU8A 3UVPA 4EOJA 3MIYA 2GU8A 3ZSIA 4A4XA 4C02A 1U5RA 3CCNA 4IJ9A 2HK5A 5BVDA 4DGNA 3PXZA 2PVRA 5FTQA 1OL5A 2H8HA 3BGPA 2C3LA 1CM8A 3L9PA 3LPBA 4CFNA 5J7BA 3C4WA 3G9LX 2UZOA 4A06A 4BZNA 5E90A 1Q24A 3C50A 2B9JA 3EQGA 3BI6A 3QALE 1U5QA 4FT3A 5C03A 3ZTXA 5H8GA 4AX8A 3E7VA 4O0WA 4F0GA 4DGMA 1OBDA 1M52A 2WMSA 3K5VA 4CFWA 3LM0A 2EU9A 4J8NA 3HV3A 2WMWA 3GCQA 4AACA 1VEBA 4K1BA 5HG7A 1X8BA 3TTJA 4FEVA 4JXFA 3PVUA 3RK7A 4U7ZA 5CSPA 3C4FA 1VJYA 1WZYA 3DAKA 4RJ3A 1H0WA 3COMA 1H26A 5B2LA 3PVBA 4GW8A 2NP8A 3D0EA 4D2TA 1P4FA 1JPAA 2X7OA 3PJ3A 1SVEA 4PTCA 4XP0A 4U45A 3PWYA 2GNGA 3R8LA 4UV0A 3Q9YA 4QMQA 3LFQA 1WVXA 4CSVA 2VTTA 2FO0A 4FKLA 2XBJA 2PZ5A 4FKPA 2H96A 1RDQE 1Y8GA 5LMBA 2HIWA 3CY2A 3IPHA 2R3QA 4N70A 3BU5A 2WIHA 2QKRA 4HYSA 2VO0A 3A62A 3KRXA 3A4PA 3HUCA 5B7VA 2E9NA 3NYOA 2Z8CA 5CASA 5HBJA 3GC0A 1K3AA 4MXOA 3T9IA 5L6WL 5ANGA 1XH6A 1FINA 4FSNA 3R8UA 4MXCA 4I20A 4AZSA 3KXMA 2VWYA 4GUEA 3EKKA 3OUNB 4EKKA 3LFAA 3N4VA 4L3LA 4DINA 4F65A 3FWQA 5I9VA 2V5QA 3UC4A 5FRIA 5J7HA 4QOXA 4E1ZA 3FZTA 4QMUA 1LPUA 4DEAA 4EJNA 4O7ZA 5DNRA 4XLIA 3F5GA 3KF7A 2OJGA 3COIA 4HVHA 4UMTA 3GFEA 2C3IB 3FBVA 1W82A 2PVKA 3DOGA 3MDYA 3NGAA 3QGWA 2RL5A 4D2SA 3HKOA 2VWVA 3DPKA 3VC4A 5LMKC 2ZM1A 3GVUA 1ZRZA 4YJNA 4BYJA 4QP6A 5HD7A 2PZYA 4BZOA 2O8YA 5GJGA 2ERZE 2PPQA 3FLYA 4G6OA 3QX4A 4FICA 2X8IA 3HMPA 4I22A 4F9YA 4U5JA 5KX8A 4CT1A 4BFMA 3KL8A 3U87A 4JVGA 3HNGA 4CV8A 3NDMA 1G3NA 5IUHA 5LWNA 3FQEA 4LQMA 3PRFA 2QOKA 3BX5A 4OTFA 2C68A 4JNWA 4EZ7A 1V0BA 3IDBA 4I21A 5ACKA 4WNMA 4BDJA 5M53A 5HORA 2LGCA 4A9YA 4AGCA 3O8UA 3ODYX 4BCOA 2XNPA 4YNEA 3R9HA 4D4VA 4U79A 2YDKA 3KXZA 4ZSAA 3FMJA 1M7NA 4Y5HA 4QPAA 2BAQA 4YTCA 3AXWA 3W32A 3JY9A 4WSQA 4RX9A 2QOIA 4ACMA 5JSMA 3ULZA 3EB0A 3ZBFA 2OI4X 3MTLA 3CKWA 4IAFA 4FK3A 1IRKA 2E9PA 4ASDA 2R3OA 4BCMA 3MBLA 3OTUA 2WZJA 4QMZA 2R0UA 1WBVA 3OOGA 5GJFA 3VBTA 3I0OA 2RFDA 3G15A 3OWLA 3G33A 1PXIA 3GFWA 4X3JA 2JIIA 3O17A 2GDOA 3I81A 4KBAA 4BKYA 4C36A 3UIXA 3BQCA 3R21A 2I1MA 5EM6A 4XH6A 4K2RA 3REPA 2YZLA 1CMKE 3ZM9A 3EJ1A 4LFIA 4OTQA 4TYHA 4ALWA 4FSRA 3SW7A 5EQYA 2XK7A 5ITAA 4IANA 3RPOA 2J0KA 4NK9A 4TYJA 5A3XA 3F69A 3PRIA 5E8UA 4I5MA 5TO8A 4EOLA 4H39A 1OKWA 3ROCA 5CAQA 2F49A 4RGJA 4DH5A 2BRNA 3NNUA 3A61A 4G3CA 4U40A 2BHHA 1J91A 3P78A 5EYKA 4LYNA 4BI1A 3QUEA 2X4ZA 4ZTQA 3U9CA 4XV1A 3V8SA 4JBOA 5BQ0A 3FI3A 5D7AA 4AF3A 4WA9A 2DWBA 3MB6A 3ENHA 2GNLA 2CNQA 2ZV2A 4GFGA 1NY3A 1P2AA 2W7XA 1MQ4A 3GU4A 4IB0A 5EI8A 1Q97A 5CU2A 3SG9A 4EEVA 4XOZA 5LMKA 3R1SA 3KQ7A 4V01A 2CKPA 4K6ZA 4RFYA 5CF5A 4JQEA 3RI1A 3MPTA 3PG3A 4RQVA 1CDKA 3IW5A 4I6HA 3SHEA 2R7IA 4R3RA 5CEQA 4ASEA 4KBCA 3FZSA 4CTBA 4DTKA 3LMIA 4D4RA 4FSQA 5CLPA 2YM4A 4E6CA 4F63A 3G6GA 4ZJJA 3IDCA 2VNWA 1SYKA 3HAMA 4UN0C 3VUDA 2BKKA 4AT5A 3IONA 4JJRA 1R3CA 4PL3A 4RIYA 4QNAA 5IMXA 4YSJA 3NYNA 4U42A 3LQ8A 2PVNA 2QHMA 5AP4A 2W99B 3ODZX 4I6QA 1XH5A 3HV5A 2QURA 2QVSE 2VTLA 3PE2A 3ATSA 3V5TA 3PXFA 2WQNA 3KXHA 2GNFA 3PE1A 4UBAA 3U4WA 4O82A 5JQ5A 4BDKA 4WOVA 4RZVA 3E93A 3QRKA 4CQEA 2EWAA 4EOMA 1VR2A 1H4LA 1SMHA 4IVCA 4TWCA 3PY3A 2XMYA 5D41A 5EW3A 5HE1A 4Y46A 4C3FA 2GQSA 4D55A 1YXXA 2C3KA 2V22A 2Z7SA 5AAGA 2R3PA 3KCFA 3ANRA 4S30A 3OCGA 4CLJA 5HVYA 1YDTE 1ZLTA 2R3MA 2UVZA 3NZ0A 3SOCA 5C1QB 4I5PA 5K0XA 1REJA 3E64A 1SM2A 2VX0A 4EHVA 1R0EA 3I4BA 1PMNA 4YJRA 4ZLYA 2HELA 4FVRA 5ETAA 3GCVA 3HP2A 3BYMA 3LJ0A 2B0QA 3MN3A 4GK4A 4RWLA 2R5TA 3KY2A 1W98A 2BZKB 4MXXA 5JH6A 4L44A 4CNHA 2VX1A 3ANQA 1LR4A 3CS9A 3ORXA 4FT9A 4K77A 3FLWA 4O0UA 2C1AA 2O2UA 3E88A 3DDPA 4FKUA 3IG7A 3TIYA 4EYJA 3OEFX 4X2GA 4WRGA 4GIIA 3EOCA 4IMYA 4AFJA 4F9BA 3RALA 5EYMA 2OJIA 2YIXA 2R3FA 3PWDA 5JRSA 3UOLA 1WCCA 3BWJA 3IKAA 2Y7JA 4DCEA 2GFSA 2QU6A 4O96A 3SOAA 3NWWA 5IUGA 5L2WA 2ITVA 2YIQA 5CI6A 3HA8A 4Q5EA 2C47A 5FEDA 3B2TA 3A7IA 4GK2A 2WGJA 3RM7A 3KXNA 4JG7A 3UVRA 5CQUA 2XIYA 4DCAA 5GINE 2W1EA 3PA5A 3QX2A 3F66A 1FMOE 3R1YA 5AUYA 3S2PA 3DTWA 3WE4A 4W9WA 4EK5A 4U9AA 2WQMA 5AP7A 4PMTA 1E1XA 5KMOA 2VO7A 3QTZA 4JDIA 3JPVA 4R1VA 4APPA 4E4NA 4FI1A 4RX5A 4DFUA 2VTRA 4FSYA 2ETKA 3KXGA 4KRCA 5ANKA 4A9RA 3PIZA 2HZNA 4CCBA 4D1ZA 4U81A 3E5AA 3OVVA 3RZBA 3RHKA 2W1GA 4TL0A 5DBXA 2BZIB 5HZNA 3VQHA 5KKRB 3PY0A 4FV1A 1W83A 3C4ZA 3OW3A 4ZTRA 2IW6A 4KIPA 3FZOA 3RKBA 4GS6A 3JY0A 3PSDA 3OOMA 3S4QA 3QLGA 4BN1A 5ANOA 3T3VA 5E8VA 2HYYA 3Q4UA 4BICA 1NA7A 3T3UA 1P4OA 4LOQA 4F7JA 2GQGA 4I1ZA 5CSXA 2BFXA 4EH8A 4IM3A 2QHNA 4PY1A 2WHBA 4KD1A 3DKFA 2UW5A 2AC5A 4B8MA 3TUDA 2PUIA 3VO3A 4YTIA 2FH9A 3ZHPC 3VRYA 1NVRA 4IWOA 3FI2A 4BB4A 2J51A 4RT7A 5HIBA 5AR3A 2ZJWA 3AC3A 2UV2A 1ZMVA 4IAIA 3O50A 3RNIA 3V5PA 2F7ZE 5AUVA 5LWMA 4EZ5A 3FUPA 4C8BA 4N57A 3E63A 4RJ5A 3ZLWA 3DU8A 4FSMA 3RWPA 2X6EA 4D5HA 4AOJA 1FVRA 3Q5ZA 4FV0A 1JAMA 2CGXA 3F3TA 5J1VA 4YZMA 1OPJA 3FMNA 2JKQA 4AN3A 3ZEWA 3KULA 1FGIA 2OKRA 3CTQA 3LFNA 5EOLA 4JL9A 3VS6A 1PXLA 4FG9A 5T3QA 4E8AA 4E6QA 2P3GX 4IAKA 4U97A 5E8SA 5AV4A 2ZM4A 4AT3A 4ENXA 4O27B 4HZSA 4IB1A 1A06A 2JFLA 2QOBA 4IWPA 1U54A 4KKEA 3R01A 4C61A 3POOA 4ONAA 4L45A 3EQIA 1OUKA 4ALUA 4CRSA 4Z7HA 1Q8TA 3BLRA 4TYIA 5IA5A 2WMAA 2WOTA 4EHZA 4X3FA 4GU6A 4IHPA 1L3RE 4R3CA 4XBRA 4B7TA 5HLWA 4FSUA 4V04A 3EN7A 4EONA 2YM7A 1FVTA 4RSSA 1PMUA 4EH6A 1OPKA 2C6DA 2HW6A 2C6OA 4YZCA 1QMZA 3QAME 3HUBA 3ZCLA 4FZDB 5IZFA 3ZO3A 4ACHA 1KE8A 2OWBA 4G3DA 4H36A 1FOTA 5FWKK 1YI6A 3DAEA 4NJ3A 4K8AA 2J6MA 3IGOA 2OGVA 5LCKA 2H34A 3D15A 2EB3A 3W2RA 3JR1A 2XNMA 3VJOA 2JAMA 4GT5A 2PL0A 2C69A 3DBCA 5DFPA 3PJ2A 3RK9A 2HOGA 1ZY5A 2ITOA 2JDRA 4DGGA 5AP6A 5FQDC 4UWCA 4PP9A 4G5JA 5CZIA 4B9DA 2VTAA 5I3OA 2OW3A 4OUCA 3UTOA 3QCQA 1XBCA 1JSUA 4ZS0A 4O84A 4Q9ZA 2E9VA 1Q8WA 4MAOA 2ETRA 4D58A 1Z5MA 5G6VA 1W7HA 2HY0A 4AW1A 1HCKA 5DRDA 4A9SA 3O7LD 3ZUUA 3KRWA 3ZONA 2PE2A 5AUTA 1I09A 3L8SA 1SNXA 3ZC5A 3LLTA 1XH4A 3RGFA 1O6YA 2J0MB 5EK7A 2J5FA 2PHKA 4QYYA 3ORLA 4WBOA 3VF8A 4EQMA 3EZVA 4R7BA 5CYIA 1KUTA 4O86A 4FOBA 4IAAA 2XK4A 5AR5A 5KHXA 3NYXA 5HG5A 2WQOA 3TIZA 4M69A 5CALA 5KMKA 2J4ZA 3IOPA 3NRMA 3R7VA 4UMRA 5CF4A 5M57A 3U6JA 2GFCA 4L53A 3BCEA 4CEGA 3G5DA 3RPRA 2Z7LA 3A7HA 3FC1X 3II5A 2XK9A 4M14A 5H3QA 4D2PA 4BTKA 2C0IA 3GC8A 4MQ1A 4JBQA 2EXCX 4APCA 4AS0A 4O7NA 1G5SA 4IVBA 4ZXTA 5KCVA 2JDSA 3Q4ZA 1NXKA 3HLLA 2IW9A 5J1WA 2HWOA 5TKDA 5AR7A 4I23A 3FQSA 3GU6A 4JAJA 4L42A 2Y6MA 4HVGA 3CC6A 4GRBA 4QP3A 1CKIA 4C4HA 4GU9A 4F9AA 2UW9A 3QD4A 5HU3A 4UZHA 2XKCA 3RHXA 3F82A 2P2HA 3TV4A 3IW7A 4Z16A 5JZNA 3C5IA 5AX3A 2WXVA 5C01A 2JGZA 2VGOA 4UMQA 5CAVA 4FZ7A 3EKNA 3QYWA 4BWKA 5CF8A 1XQZA 3BYSA 4YHTA 2OXYA 2BIYA 3HX4A 5L2IA 1PKDA 4BDIA 4ITHA 1OKVA 2W5HA 2YJSA 2YJRA 3I7BA 1NW1A 4XG3A 3WIGA 3ORKA 5K0KA 4EKLA 2UZBA 4A4OA 5GHVA 4YHJA 1KE9A 3PTGA 4J1RA 3HRBA 1LP4A 3D4QA 3FPQA 4BCJA 4CXAA 3EQRA 3PIXA 1XH8A 3EHAA 4XG8A 1M2RA 2IW8A 5IF1A 4W4YA 3QKKA 3NAYA 4E6DA 4DFLA 4G17A 1UKHA 2WTJA 4HVIA 5L6OA 1IR3A 4MXZA 4QP4A 4OTPA 4PF4A 5K5XA 4Q5HA 3KREA 2UVYA 3G0FA 3HP5A 1KE5A 1STCE 4IBMA 4L67A 4IFGA 4MEDA 3FDNA 3MB7A 4QT1A 3FMLA 4YJQA 5EDQA 3PVGA 5AV1A 3OW4A 2XIKA 3ELJA 1OITA 1OMWA 3VS4A 5L3AA 4F7SA 3QD0A 4RIYB 2PVHA 3TKHA 5AV3A 2C5OA 3SRVA 1GZKA 2R3RA 4PMMA 4BTFA 3H9FA 4J71A 1WVYA 2WPAA 4EORA 4LRKA 5L4QA 4WT6A 5JKGA 1BUHA 2UUEA 3QUPA 3E8DA 4AUAA 3LMGA 4P2KA 3THBA 3NIEA 5BYYA 3EYGA 4RQKA 5IQHA 1W0XC 2XIZA 4ZTMA 1KSWA 3QXPA 3GB2A 2XK6A 2Y0AA 3I60A 5HGIA 4EK4A 2XIXA 3FJQE 5C8KA 3QKMA 3PLSA 5AM7A 3WILA 3C4EA 5I3RA 4CZYB 5JK3A 3KMUA 5EQEA 1B38A 5CQWA 1BLXA 3BE9A 4KKHA 2RGPA 3RAWA 4ZMEA 5HCZA 3D7TB 4FODA 3DK3A 2YWPA 4JRVA 3ORMA 4Q9SA 4DFXE 2XZSA 1OKZA 3GC7A 5EHOA 5JFXA 4KA3A 1A9UA 4CTCA 5HLNA 4FV3A 3C5UA 5DT4A 1XO2B 5HVJA 2C6KA 4QTCA 5DT0A 4YUQA 2I40A 1M7QA 2JAVA 3DFAA 3FXXA 3BGQA 1ZYDA 4GFMA 3R9OA 3SD0A 1UVRA 2QONA 5KMLA 2OF4A 4FTJA 3V6SA 3TUCA 4X7QA 4Y72A 3E92A 5E7RA 3W10A 4RG0A 4UXLA 2XNGA 4F09A 3G90X 3ZU7A 4WBBB 5FEEA 5LJJA 4IB5A 5I4NA 4JG6A 3N4UA 4B4LA 1JSTA 2JDOA 5ACBC 3RJCA 1WMKA 4KSPA 4BTJA 4ZAUA 3TNQB 4IX6A 2QOQA 4M8TA 1QPEA 2QLUA 5AAFA 2R3GA 4QNYA 1TQIA 3KGAA 4I0SA 2EXMA 5CU0A 1HOWA 4BCFA 3Q32A 3P9JA 4NT4A 2IO6A 4L6QA 4OW8A 1LUFA 2WMUA 3FLQA 5EW9A 5EW8A 3AMAA 2W1HA 5FM3A 3ZEPA 4DAWA 1MP8A 3DY7A 5HX6A 3MY5A 1YXTA 4J99A 2ETMA 3SW4A 5CNNA 2XS0A 2W1DA 3FYJX 4ZS4A 4CMTA 3ZS5A 1VZOA 2BRBA 3A60A 5E8XA 3R73A 2I0YA 1PKGA 4GIHA 4L01A 1UNHA 4I3ZA 2BDFA 4FKSA 4FG8A 4MXAA 3UO4A 3FMHA 3E8CA 4AW2A 4A9UA 2PY3A 2NRYA 3QZIA 5HO6A 3C0GA 1DAYA 4A4LA 1KV2A 1DM2A 4LL0A 4I4EA 4CFVA 3BU6A 3LXNA 3QCXA 3ZZWA 5KUPA 3UNZA 3ZLYA 5HIEA 5IQFA 5IISA 4E73A 2FSLX 4F64A 3W8QA 2F7EE 5AA9A 4MD7E 3VS0A 4WUNA 3MVJA 4QD6A 4O1PA 2A2AA 2JITA 4Z7GA 4PTEA 3K54A 3OT8A 4WNOA 4DGLC 3QWKA 1ZOEA 2B7AA 2GTNA 2IJMA 3R04A 3I0QA 2CGUA 4DG3E 4YHFA 4O7VA 2BTSA 3V8TA 3VBXA 4JDJA 1PYEA 3W8LA 4O2PA 4FSWA 3KN5A 2W06A 3MFSA 1WFCA 4HGTA 3EFKA 4HNIA 3ZRLA 5I9XA 3FHRA 2VTJA 2PWLA 3GU7A 2PUPA 4DBXA 3W18A 5IPJA 1O6KA 2YEXA 1WAKA 4BL1A 1U4DA 2OH0E 2HWPA 2R3HA 4JQ8A 4BGQA
chains in the Genus database with same CATH superfamily
3VNTA 3EMGA 3OG7A 3FMDA 3WYYA 1Q4LA 4JS8A 2C6MA 2X0OA 4F9CA 4C34A 5AEPA 4RRVA 2X7GA 3VS3A 3W33A 1YHVA 2W4OA 2X2KA 4YO6A 3M11A 3DJ7A 5HIDA 2OIDA 4FEUA 2X8EA 3ALOA 3Q04A 4IWDA 3G51A 2X7FA 4J8MA 4ZTLA 3TZ7A 3DZOA 4LUDA 4PRJA 3UBDA 3S1HA 4Y8DA 3UODA 3LCTA 5JZJA 5BYZA 2J5EA 1U54B 2CPKE 2J2IB 3OEZA 4EH7A 3O7LB 5AJQA 4ANLA 3Q3BA 2UZVA 4O0VA 2XIRA 4DEIA 2PMNX 2QI8A 3DLSA 3MVLA 1H27A 3R83A 3ZSGA 4QTEA 2VTNA 3R2BA 1KE7A 1EH4A 1HCLA 4L7FA 3FMEA 3QLFA 4F1MA 4DHZA 2BR1A 3EQCA 3W2SA 1PXJA 3L8XA 4BCHA 1OL6A 3OCBA 4C3RA 4MBJA 3SAYA 5EDRA 4BBMA 5AWMA 4O0XA 2WKMA 1OBGA 3AMYA 3UQCA 3OC1A 4O7SA 4R7IA 1OKYA 2WTWA 2EVAA 4KIQA 4AXDA 2PUNA 3R63A 3N51A 5BVKA 3TG1A 4AZVA 5M08A 5J9ZA 4CZTA 3R02A 5H2UA 3VHEA 4BTMA 4BDGA 5HKMA 1OPLA 4EYMA 4YJPA 2FUMA 4HGSA 3DB8A 4ZSLA 3WYXA 2YCRA 2FSMX 3NUNA 3HMMA 5C9CA 4NFNA 4F7NA 4TT7A 4O4CA 3F3WA 4L7SA 3H10A 2CGWA 5LARA 4WHZA 4BDBA 5AIKA 1XMLA 1PYXA 5IEYA 4G3FA 3AOXA 3TZMA 4M97A 3WF9A 4D9TA 2X9EA 4TYEA 1JLUE 4FGBA 4AZWA 1O6LA 3K2LA 3Q52A 3LAUA 4GSBA 5K4IA 1YXSA 4EK8A 3N9XA 2Y4IC 5IG1A 3VBYA 2WMBA 5IQBA 4OTWA 2ZMDA 3BLHA 4HPUE 3LXKA 4IVDA 4FGRA 4H3BA 4TXCA 4CLIA 4AFEA 3HMNA 4FV8A 3QA8A 3QQKA 4E5WA 2C5VA 3NVMB 4XS2A 3KA0A 3FI8A 1XJDA 2I0HA 1PXOA 2JD5A 2O3PA 3MJ2A 5M4FA 4RFZA 4M69B 4AT4A 2A27A 2WMRA 4QP9A 4XHKB 5CSHA 3RM6A 4ALVA 4UMPA 3BBTB 4WG3A 5DYJA 4E4XA 3OXTA 2YIYA 2R9SA 1URCA 4IB3A 5FLFA 2QG7A 1R78A 4LL5A 3UMXA 3QTUA 4AOIA 1YXVA 4MQ2A 5CEOA 1Q5KA 3KEXA 3AD4A 3R71A 3UPZA 3CPCA 3TV7A 2FB8A 4KAOA 3QRIA 5E8ZA 5C4KA 2C0TA 5HICA 2Q0BA 5IEXA 2GHMA 4KRDA 3GP0A 4BCKA 5JGDA 3Q96A 4AOTA 3MSSA 4NL0A 1W8CA 4MD9E 3RTPA 3PA4A 5GJDA 1IG1A 2BZHB 4V0GB 3AKJA 1OGUA 3Q9WA 1WBWA 4UY9A 4XG9A 4G2FA 3SV0A 4DFBA 1G8JA 3R2YA 1KWPA 3OF0A 4XX9A 5CENA 3RZFA 5FP6A 3V5LA 5DR6A 4PPBA 3FMMA 5J5TA 2QR7A 3WIKA 3FEGA 3EFJA 4RJ4A 1AD5A 3QRTA 3ZC6A 4RLKA 3C9WA 4AE9A 3RWQA 1FBNA 4HYUA 4J7BA 4JX7A 5AM6A 3EQBA 3ET7A 4IWQA 3CD3A 3P08A 4P5QA 4EI4A 2G1TA 4ZLOA 4H3QA 4FTIA 1OIYA 5IH4A 4W4XA 4ASZA 5J9LA 5C8MA 3R7IA 2Z7QA 3RAKA 5DN3A 4YLLA 3DT1A 3I1AA 4MKCA 3KFAA 4BDAA 2ITNA 3DA6A 4WSYA 4AW0A 3LFBA 5H9BA 3R9RA 4L68A 4TW9A 4B0GA 4BF2A 2ZM3A 3KKVA 5JQ8A 3COKA 4F9WA 4Y85A 2PVYA 3BYUA 4HCVA 3PJ8A 3IECA 2YM8A 3HZTA 4ANBA 2RG6A 2R64A 1PJKA 3FC2A 5BVEA 1H1SA 4D2WA 3AC5A 5CXHA 1WBOA 3PVWA 5LMAA 3A7FA 2XYNA 3TWJA 2VTIA 3CJFA 2QNJA 3MWUA 4YTFA 1YDSE 4IC8A 1PXKA 3RAHA 4RA4A 4NM3A 4K33A 2C5NA 2YA9A 4O7LA 2OIQA 2QU5A 4W8DA 3SRVB 3AGMA 4PWNA 4KS8A 3O96A 2SRCA 3QTWA 4A9TA 4UYAA 4DGOA 3WF5A 1IA9A 4IM0A 1H01A 4QMTA 3EYHA 1PXNA 2Y6OA 3U51A 2YHVA 1GZNA 1JVPP 3A99A 2IVSA 2UW4A 4P7EA 4R6VA 4RVMA 4ANMA 4BCGA 5HNIX 1GNGA 4C38A 4B8LA 1CKJA 4RZWA 3KMWA 1ZYSA 1Y8YA 4FG7A 3BEAA 5IQEA 2W9ZB 5ETCA 4G31A 2NYAA 4CV9A 3Q2JA 3FLZA 4QQ5A 3ETAA 3QQGA 5F9EA 4YPDA 5AA8A 4ZSGA 3W0OA 4GJ3A 4YMJA 3ZLXA 4DC2A 2J0JA 5I0BA 1R0PA 2VWXA 3KK9A 2BKZA 3RNYA 5L6PA 4LOPA 2WB8A 5KNJA 4PL5A 1Q3DA 4UEUA 3W2QA 2W96B 1UU7A 5GZ9A 5C4LA 3AQVA 5IH6A 4FUXA 4LI5A 5CX9A 3PSBA 2E9UA 1RQQA 4BC6A 3C51A 3GCSA 1F0QA 4D28A 4D4SA 3TI1A 2ZV9A 2UW7A 3QC9A 4QMLA 1FMKA 1O9UA 1UWJA 3FZ1A 3HV4A 5BUEA 1YHSA 2B1PA 3DZQA 4Z55A 4QP7A 3I79A 4O0YA 3TZ8A 4RIOA 4DYMA 4PMPA 3IW8A 1XR1A 5J95A 4IJPA 4DEGA 4E4LA 4YR8A 1BYGA 4XV3A 5E8YA 3F5PA 2X2LA 3R7GA 4TPTA 3IQ7A 4Y83A 4S31A 3VW6A 3F88A 4BHNA 4NIFA 4HW7A 3QCYA 3BV3A 3EL8A 3NUPA 5HX8A 2O5KA 3NUXA 4NW6A 2Z2WA 5AFVA 4KIKA 2JLDA 2V7OA 5CSWA 4HYHA 4F78A 3VVHA 4MF1A 4XCUA 2EUFB 3WZEA 3E7OA 4TY1A 3U6IA 3F5UA 1OUYA 3F7WA 3EWHA 4IFCA 5L8JA 1REKA 3NCGA 4EHEA 4CMUA 2QOLA 2YM5A 2QOFA 1UU3A 4E26A 3HVCA 3I5ZA 4FKIA 5HTIA 3RINA 4QQTA 3SA0A 4RWJA 3EFWA 3MH3A 4GT3A 5LVOA 4X2JA 3UOJA 4YBJA 4DHIB 2AYPA 2VU3A 3KU2A 3PFYA 2H9VA 4FOCA 5A6OA 3GEQA 2X8DA 3L8PA 4OT6A 1Y6BA 4MWHA 5GNKA 1YWVA 4F1TA 4FIEA 4BWXA 4RLLA 1PRYA 3SGCA 1PHKA 2ITTA 2YABA 2RFNA 3Q2MA 1J7IA 5HO7A 3P5KA 5F95A 2BRGA 4X3FC 5CAOA 4FJVA 4ERWA 4C58A 4RJ8A 3KVWA 2CGVA 4UX9A 4JR7A 4MTAA 3JS2A 4XRJA 3DXPA 4DDIA 2C6TA 2JEDA 1MRYA 1KV1A 3DK7A 3R7YA 3H0YA 4EOKA 5LVMA 4ARKA 4KWPA 2YLFA 4S34A 3DXQA 3NUUA 3O0GA 1H0VA 4PMSA 3FZRA 3SKCA 3D2IA 4J97A 4G6LA 3BL9A 1FQ1B 1OIQA 5A4EA 5HU9A 4Y5QA 3R9NA 3UE4A 2JBOA 3ZUVA 4CVAA 1UV5A 2RKUA 5B2KA 4CD0A 4W8EA 2QG5A 2ZVAA 2VN9A 3SG8A 1OL2A 3OCTA 3LIJA 5GZ8A 3VS5A 3ZXZA 3ORTA 4ZZNA 4MNEA 2CKEA 2RF9A 4BBEA 1W84A 4FIGA 3ZO4A 3VF9A 3COHA 5L2SA 4PPAA 4NKSA 3DV3A 4BDFA 3CGFA 4FL3A 4O38A 3DDQA 3EH9A 3PA3A 1ZZLA 5CU6A 4OGRA 5L2QA 5A9UA 2X4FA 5FD2A 4G34A 2J0IA 2FA2A 3AG9A 4YTHA 4BBFA 4FZ6A 4XP2A 2B52A 3K3JA 1UNLA 3MI9A 2X1NA 4IADA 4X6QC 5HHWA 4U6RA 4YLKA 2XNBA 3CEKA 4I6BA 2PVLA 3VBQA 3DQXA 3MFUA 4FKTA 3HA6A 4I5CA 1B6CB 1GOLA 3BHTA 4LV8A 5F94A 3U9NA 3EFLA 3NNXA 3HEGA 3DBDA 3O8TA 4F6WA 1RJBA 1Q41A 2XEYA 3V51A 3VS2A 5IEVA 4JAIA 3BIZA 3RMFA 5I9UA 1BX6A 4JBVA 3QTQA 3U55A 1JQHA 5LOHA 4J96A 4K0YA 4FKQA 4HVSA 4IE9A 4IAYA 4FSZA 2YM6A 3KK8A 3D5VA 3QF9A 2C5YA 5IUIA 2Y8OA 1ZZ2A 4RVLA 3OCSA 3LXLA 4CYJA 3QD2B 4FE2A 4FVQA 4M84A 4OLIA 5DEYA 3QWJA 4EOOA 3QHRA 5B2MA 5DT3A 3PPJA 5DLSA 1BKXA 4D2RA 3R9DA 1Q61A 3H30A 5CTPA 5EYDA 4AAAA 3FI4A 5ETIA 2XP2A 3NIZA 3NAXA 4IX3A 4WRSA 5A46A 2G2IA 5FDXA 5AV0A 2ITWA 3CY3A 1ND4A 1QPDA 3QYZA 3LFDA 4GV1A 4KINA 4AA4A 4C59A 4I92A 4ZLZA 2WEIA 3LM5A 1YOMA 4FC0A 1ZYLA 4NH1A 1ZYCA 4WIHA 1UU9A 5D7VA 3ZRKA 2G15A 1GZ8A 5JGAA 4J95A 4I93A 5A6NA 1J1CA 3FAAA 3RPYA 2H6DA 4FZAB 4X21A 3UIUA 4C4EA 4RJ6A 3A8WA 3R7OA 4AWIA 4RX8A 2G2HA 4EC9A 4EOIA 3AT3A 2UW0A 3R00A 3TJDA 5IQAA 1UWHA 2W1CA 2XVDA 4TN6A 2OU7A 2W1ZA 3E62A 3R0TA 3NMUF 1BI8A 4GL9A 3E3PA 2YISA 4OBPA 4O0SA 4LV7A 4CKIA 5FG8A 3PY1A 4WG5A 3HV7A 2Q83A 2OH4A 3O23A 2WTDA 4LRMA 4N6ZA 3OZ6A 4IDTA 2ZYBA 3QCSA 4RWKA 4M13A 5AP5A 4ANSA 3LQ3A 4DFYA 3LHJA 4MVFA 2W1FA 5CANA 4ASXA 4C2VA 2XAMA 4O4DA 4PP7A 1GY3A 1U59A 2VTHA 3BPRA 4LRJA 4NSTA 2PVFA 5CXZA 4GYIA 4BWPA 2J9MA 3M2WA 4BKZA 5IMEA 5FTGA 3P86A 5L8KA 3QRJA 1CSNA 4R1YA 3IW4A 3LW0A 4O7RA 4O1OA 4Z3VA 4NEUA 3FLNC 5ICPA 4OAUC 3QTRA 3DBQA 4FKVA 3PXKA 3NUSA 2GS7A 2O63A 2Y9QA 1DI8A 2GPHA 2R3NA 4WNPA 4F0IA 4CFUA 4I0RA 3CBLA 5CU3A 5ETFA 2XKDA 2JKKA 4EH5A 2REIA 1IAHA 1LEZA 2HENA 3UPXA 1ST4A 5L8LA 3QL8A 3DJ5A 2WAJA 3A4OX 3GT8A 4FYNA 1GZOA 4DT9A 2XM8A 4PTGA 1JKKA 1YRPA 2WU6A 3UNJA 3AC8A 1OL1A 1IA8A 5CEKA 5DH3A 3ROYA 3EN9A 3UZRA 3UOHA 4BI2A 4TYHB 4FMQA 2P0CA 3GI3A 3QQLA 2XJ0A 4XUFA 5ANIA 3SQQA 4D0XA 1ZYJA 4QYGA 3JUHA 4AZEA 3F3ZA 4PNKA 4CGAA 2UZNA 2A19B 2ZB1A 5DA3A 3RPVA 5JFWA 4C4JA 2XRWA 4HPTE 2Y4IB 3UC3A 2RFEA 3FXWA 3Q9XA 4FVPA 4XJ0A 5CSVA 4O2ZA 3WE8A 3UP2A 4XRLA 4XP3A 5I9YA 3RPSA 4NM7A 3MH0A 4GT4A 3AKKA 4X0MA 3RP9A 1M2PA 3IO7A 2ITZA 3ENMA 3HMOA 4K9YA 4P90A 4D4YA 5E8WA 2W1IA 4WKQA 3D7ZA 5DWRA 2JIUA 5HBHA 4F1OA 3HAVA 4DG2E 3QTXA 2W0JA 2BPMA 3BHYA 4O4BB 2PE1A 3JVSA 3KRLA 1ATPE 3F2AA 1WBTA 4MWIA 4QMXA 4S33A 4IVAA 2CJMA 4LOOA 4OBOA 4PV0A 2JC6A 2O65A 2Y4PA 5CWZA 2JKOA 2ONLC 3OWPA 4FL2A 3TL8A 2BHEA 4DTBA 1J3HA 2YCSA 4MF0A 5JT2A 3QRUA 4QMNA 5IH5A 4DLJA 3LFCA 4RA5A 4F6UA 4XNEA 5LCJA 1GAGA 2ITPA 2V62A 2VTOA 5A54A 4OAVB 5LVLA 2CCHA 4GMYA 4C4GA 5KMNA 2OZAA 3ACKA 3PLAE 1PMVA 3LCSA 4TNDA 2NRUA 3MVMA 4NWMA 3LFSA 5CVFA 5FXSA 5AP2A 2WO6A 3QQUA 4QRCA 5HTCA 1G8AA 2F2UA 4DE4A 3WZDA 3WARA 1P5EA 2BROA 2UW3A 2VNYA 4NYEA 4QDVA 2HXLA 2BAJA 3LMHA 3ACJA 3GCUA 1FGKA 2GTMA 3FY0A 1E9HA 1PXMA 3CQEA 3AKLA 1OIRA 5M07A 3A2CA 1GIIA 3TT0A 4O7WA 1LEWA 4CCUA 3DS6A 1B39A 4R77A 2G9XA 2XJ2A 2HCKA 3HRFA 3IW6A 3O71A 2VGPA 3CJGA 4GG5A 3V5QA 5A4QA 2GNHA 5IDNA 4AGDA 4DEDA 3RK5A 2JDVA 2VTPA 4NIFB 5C26A 1WBSA 3AD6A 3NR9A 1MRUA 4K11A 1ERKA 2VV9A 4ZJVA 3PUPA 1GIJA 5M4UA 3GUBA 4IX4A 4MYGA 2J50A 4F08A 5LQFA 4GVAA 3FL5A 2CN8A 4KIOA 1RW8A 1YWRA 4ZZOA 3UO6A 1WVWA 5HD4A 5K9IA 3OBJA 5AUZA 2CLQA 2YCFA 2CN5A 3PZHA 4M0ZA 4MH7A 3CR0A 4TYGA 4BGGA 4E3CA 1R39A 4DH1A 2GCDA 4UWBA 4EBWA 1FPUA 3GCPA 2WTVA 2C6IA 3BHUA 4FV7A 4O0TA 4USDA 3ORIA 1E1VA 5M4CA 3TCPA 4N0SA 3UQFA 3MH1A 3QZHA 3CPBA 3VHKA 5HTBA 4GUBA 4ZSJA 4EOPA 3PYYA 3VUHA 2ERKA 4FKOA 3VUIA 4C4FA 5H8BA 3DAJA 4PPCA 4AQKA 3VS7A 3MA6A 2BAKA 3BKBA 4RIWA 4W9XA 1JOWB 1K9AA 2HY81 5AR4A 4MXYA 4EK6A 2P33A 3EN6A 5HEZA 5KE0A 3PP0A 5HVKA 3QZFA 4BCNA 4LUEA 3NPCA 3DQWA 4O22A 4LMUA 4DEHA 5CVHA 3TEIA 2ONLA 5EFQA 2VTQA 2HZ0A 3BGZA 4FR4A 4EBVA 3D14A 2KULA 3NCZA 3ORZA 3TNIA 2BZJA 3B8QA 2E9OA 4AE6A 5FXRA 4FEWA 4DLIA 4UMUA 1R1WA 3BQRA 1FVVA 1T45A 2XUUA 3A8XA 1M17A 4BDDA 5D1JA 2BILB 1IASA 1ZMWA 5J87A 5K4JA 4H58A 3E87A 1MQBA 3AC2A 3VIDA 4F6SA 3H4JA 3MY1A 3L1SA 4CFMA 4MNEB 4R78A 4FNWA 4FEXA 3PJCA 2YN8A 3NVKI 3ORPA 5AV2A 2FSOX 5DE2A 1H28A 4BCQA 1IAJA 5IQDA 4JRNA 3QC4A 4M12A 4NW5A 3DK6A 3KRRA 2IZRA 4IW0A 4BRXA 4EZ3A 4QTBA 4J52A 4ZEGA 4PX6A 3WF6A 3CP9A 4RC2A 1T46A 1TZDA 2GNIA 3LE6A 4QYFA 4FIJA 1ZMUA 2ITXA 5DIAA 3JYAA 4USFA 4DEEA 2X0GA 3R8VA 2W5BA 3NW7A 4E4MA 2UZDA 4GH2A 3V6RA 3VWAA 3EL7A 3P23A 4FK6A 4RVKA 5TR6A 2QOCA 2YITA 1SVHA 4AQCA 2WTKC 3W1FA 4BYIA 4BIEA 4LGHA 4ACDA 3BEGA 4JBPA 3EQFA 2WOUA 1OL7A 3WF8A 4DFZE 1H07A 2I0VA 5CZHA 3F2RA 1KE6A 3UIMA 5A14A 3ITZA 3HYHA 3OMVA 2PVJA 4PDYA 3TM0A 3E8NA 1SNUA 3OY1A 5CS6A 2R3LA 3H3CA 4EHGA 3CQUA 3QA0A 4AZFA 4FKWA 4L46A 5AX9A 3W2PA 2QOOA 2PMOX 3C4XA 3KULB 2XBAA 4CFXA 4HOKA 1S9JA 3FMKA 3VUKA 4LV5A 5AP1A 1UNGA 4FT7A 2XNEA 4B99A 5HLPA 5HG9A 5KHWA 2UZWE 4MD8E 5EHYA 4L00A 4FF8A 4YP8A 3UYTA 3NSZA 2R0IA 5TT7A 5EQPA 1Y57A 3CTHA 3UZPA 5HCYA 4JR3A 3KMMA 2F4JA 2W4KA 4KKGA 4YJOA 4D2VA 1Q99A 5KZIA 4FA2A 4D5KA 3G6HA 5E9EA 2YM3A 4X3FB 5IQIA 1OIUA 3IK3A 4QMPA 4FNXA 4YLJA 5D10A 4CG8A 3OS3A 2QCSA 1PMEA 1YXUA 4RC4A 3W0SA 4FRFA 4O7YA 1YDRE 4YBKA 4AXEA 3LFFA 2IPXA 5ANJA 4YJTA 2ZB0A 3R1QA 4AG8A 4DH7A 4E7WA 3ZXTA 1F5QA 5DHJA 2JFMA 3KB7A 2HZIA 3UIBA 3ZBXA 3SVVA 3PDTA 4ZJIA 4I94A 3OUKA 2YDJA 5AP0A 4ZMFA 2GS2A 4W4WA 3E8EA 4IH8A 2X39A 3ZFYA 3UMWA 3R7EA 4X2NA 4XOYA 4F70A 3FSFA 3OTVA 3Q6UA 4DH8A 5E1EA 5BMSA 2IN6A 2C4GA 2OXDA 1UU8A 2VTSA 3ZFXA 1P14A 4CRLA 4WD5A 3M42A 5JMSA 2HZ4A 3PJ1A 2GHLA 4FX3A 1L8TA 4P5ZA 1VYWA 2QO9A 2UZUE 2F2CB 3CD8A 4BKJA 4O81A 5DRBA 4QMYA 3W55A 1TKIA 3T9TA 2XRUA 3Q4CA 4AA5A 4GK3A 1OM1A 3JVRA 3QU0A 1JSVA 2C5XA 3OROA 2OK1A 4FTMA 1JWHA 5BVFA 4EH3A 1J1BA 4UXQA 4RWIA 5FUTA 1H8FA 5JEBA 2XNOA 3LVPA 3QQFA 5BVWA 3UYSA 3VW8A 2PU8A 2NPQA 4TKSA 5E92A 3OXIA 2B55A 3F3VA 5BMMA 4LMNA 5EOBA 1RE8A 2DYLA 5M56A 4MUQA 4G1WA 1SVGA 4L3JA 4NZWB 3UOKA 2QODA 3CXWA 3VUMA 3NLBA 4RIXA 2FYSA 3FKLA 4QYHA 4TZRA 4BDCA 4YURA 4O21A 3FHIA 5GZAA 4IZ7A 4CKJA 3S00A 3FKOA 3FY2A 2IZSA 3TACA 1H1QA 4ITIA 5DGZA 3UG1A 2W9FB 3SXFA 2OZOA 2GNJA 3GOKA 3KN6A 3T8OA 3TNPC 5DG5A 1BMKA 4AN2A 4EK3A 4YO4A 5KBRA 4EOSA 3VUTA 4ITJA 1WBPA 4HGEA 3TNHA 3BE2A 1Q62A 5BYLA 3QZGA 2GS6A 2OF2A 2BRHA 2VWBA 4I41A 3V5JA 4D0WA 5CAUA 1TFFA 1H00A 1UA2A 2C6LA 5IA3A 1A48A 3BRBA 4B6LA 3MH2A 1OZ1A 5EM5A 4BVUA 3IGGA 4FNYA 2B54A 3WBLA 3AT2A 3SLSA 2XEZA 1QPJA 3U54A 3PXRA 3C13A 2OBJA 4FIHA 4M15A 3BWFA 3BHVA 3PP1A 3VBWA 2YAAA 5HG8A 3S3IA 1Z57A 3UDTA 1V0PA 2UZLA 4PDOA 2YLEA 3PXQA 3PUFC 2PTKA 2XCHA 4YGAA 4JG8A 2VD5A 3EQPA 4FTRA 3PIYA 4FUYA 1F3MC 4HCUA 4M0YA 4R3PA 2QLQA 4TNBA 3FLSA 2V7AA 3BLQA 3C0HA 3ORNA 4OTHA 4QTAA 2ZAZA 3RCDA 2PMLX 2OLCA 3FV8A 3MPAA 3OXZA 3DTCA 4XLVA 4OTDA 4ZOGA 4EUTA 3S0OA 4KBKA 1ZOGA 4FKJA 4ID7A 1BI7A 3H0ZA 2WD1A 3L9NA 2OZAB 4JOAA 3UVQA 1Q8ZA 4C2WA 2B4SB 3ZO2A 2BUJA 5EKNA 2GQRA 3NS9A 3VS1A 5M51A 5TE0A 2VWIA 4BI0A 3HECA 5LVNA 5T68A 4O83A 4D1XA 3PG1A 4QMMA 4GCJA 3BYOA 2X6DA 5LVPA 3O2MA 4XBUA 5I9WA 3R1NA 4O91A 3JXWA 4KS7A 4NTTA 2AUHA 3R28A 2PSQA 2BFYA 2GSFA 5F1ZA 5FTOA 3CIKA 4HVDA 3W2OA 5DVRA 1PXPA 5J9YA 1K2PA 2CMWA 5AUWA 3NEWA 4AN9A 2WMVA 4EWHA 5J8IA 2FVDA 3TTIA 4IQ6A 2B9HA 1YI3A 4NCTC 4OTGA 3SC1A 4AW5A 1BL7A 5IU2A 2UW6A 2VRXA 3AD5A 4U3ZA 4IDVA 5B0XA 4TTHB 2W17A 3EN5A 4II5A 3C4CA 3HDMA 3WZUA 4ENYA 4ERKA 1JKSA 4YJSA 3TKIA 5CI7A 3F9NA 3F3UA 4S32A 2VTMA 1H1PA 5JGBA 3CKXA 3E3BX 4GEOA 3VULA 4KUJA 2RFSA 2XYUA 1XKKA 3DLZA 4FBXA 2IVVA 2P55A 1URWA 5G1XA 4BCPA 3SXSA 2ESMA 3BELA 4AA0A 4YPSA 2HAKA 4NUSA 1VYZA 2UVXA 3O8PA 4BGHA 4L43A 3DB6A 4KNBA 3CLYA 2YAKA 2ZMCA 3WI6A 4BIDA 4QPSA 3OT3A 4V05A 3R8MA 2XB7A 4DF3A 1ZARA 2WMTA 4C57A 3VBVA 3LJ1A 4O7TA 3EIDA 3TUBA 4HZRA 3B8RA 4ZY6A 3ZDUA 1Y6AA 4RIWB 3NNWA 4E20A 5CF6A 2EB2A 1OI9A 4OT5A 5JFVA 3TDWA 4C35A 3VN9A 2R3KA 3D94A 3BYVA 4FV5A 4FV2A 2PE0A 3L8VA 4FKGA 4ZIMA 4DBNA 2ZFYA 2JKMA 4EH2A 4YC6A 2IVTA 4YSMA 5K3YA 1KOAA 3MY0A 2ZV7A 3DGKA 4JT3A 2XF0A 2GMXA 4FT5A 2C6EA 4H1JA 1TVOA 2UW8A 3CGOA 4U0IA 3MW1A 3LCDA 2RSVA 3MGYA 3VJNA 4CFFA 3W0MA 2YIWA 4UB7A 3I6WA 5T6KA 3IOKA 4FTTA 4IEBA 4USEA 4QP8A 2VWZA 2HW7A 4G6NA 3K3IA 3UQGA 5CT7A 3N4TA 4ZZMA 1OECA 3L9MA 3MFTA 3HRCA 4GFOA 5DR9A 2BVAA 4AU8A 2GHGA 4FT0A 2CNUA 3D7TA 3FXZA 3FKNA 2V55A 4XG7A 3LZBA 4DH3A 4E93A 2QO2A 4IZ5A 4MBIA 5BNJA 2YIRA 3H9RA 3BV2A 3AC4A 2J7TA 4QQCA 4EOQA 3C1XA 4ANNA 4ZP5A 4R8QA 2QD9A 4NCTA 2DUVA 4HNFA 4N6YA 4G16A 5KKRC 4YNOA 1NVQA 4O6LA 5H8EA 2CLXA 3R8ZA 2OIBA 3P4KA 4ACCA 4GVJA 5AP3A 4BHZA 4JDHA 5HESA 3LKMA 3OBGA 4XG2A 5BVOA 1BL6A 3Q4TA 4FL1A 3NW5A 3FQHA 4ZSEA 5TF9A 4U44A 2C0OA 5AR2A 2RG5A 2WQEA 2EXEA 2VO3A 4F99A 3HDNA 1Z9XA 3OFMA 3UO5A 4EL9A 2VWWA 3WF7A 3RAIA 4AXAA 4YU2A 4XV2A 4G9CA 2X9FA 2J0LA 1PF8A 2JBPA 3F6XA 3GOPA 4JIKA 4M68A 4A07A 3O51A 4C33A 4DITA 2BDJA 4QTDA 4J53A 4ACGA 2CSNA 3R22A 4DHJA 5KBQA 2OICA 3I5NA 3D5WA 1YOJA 5HQ0A 2P4IA 2BCJA 2WNTA 5KMJA 4DFNA 5DI1A 2XKFA 4FZFB 1V1KA 4I24A 4BCIA 5FP5A 4EQUA 1Q8YA 3IDPA 4C37A 4AP7A 4NU1A 1U46A 2WMXA 2PULA 2WQBA 4H1MA 2W5AA 4WO5A 3PXYA 4X6RA 2ZDTA 4H05A 1XBAA 2A1AB 1UKIA 5KZ0A 3GBZA 5FBOA 3KC3A 4IAZA 3VRZA 2YWVA 5DOSA 3NUAA 1ZOHA 4QP2A 4BDHA 2WU7A 4Q2AA 1V0OA 5AR8A 3QTSA 3ID6C 1XBBA 4PQNA 2F57A 2FSTX 2YDIA 4I6FA 5D12A 3DNDA 4YJVA 5CEPA 3OWKA 2I6LA 3BZ3A 4NKAA 4ANQA 3TXOA 4XMOA 4BJJA 4G5PA 2UZEA 4U80A 5HNGA 4FTCA 3DFCB 2YZAA 3DKOA 4CQGA 3Q9ZA 4IZAA 3ALNA 3BL7A 4OBQA 4QO9A