4NTTA

Structure of the catalytic subunit of camp-dependent protein kinase bound to adp and one magnesium ion
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
341
structure length
339
Chain Sequence
SEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title Molecular Features of Product Release for the PKA Catalytic Cycle.
pubmed doi rcsb
source organism Mus musculus
total genus 79
structure length 339
sequence length 341
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4nttA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4nttA02
4J8MA 2ITYA 4MBLA 5D7AA 4ACMA 3VBQA 4WUNA 4KRDA 4OAUC 2VNWA 4O27B 5E8ZA 4KRCA 4YTIA 2PULA 4JQ7A 3PVUA 4FSRA 3FZRA 4TPTA 3ZUTA 4QQTA 4CKRA 5HG7A 3QC9A 2ZV7A 3ZRLA 4MNEB 5AP6A 2VN9A 1RJBA 4PPAA 1B6CB 2YDJA 2OIQA 4DCAA 5BVEA 1VEBA 4WOVA 4GVJA 2J0KA 5BVFA 5EI2A 4ONAA 2E9VA 3LFBA 5CAUA 3FQHA 4O6LA 2ERZE 4TY1A 3SQQA 1Q8YA 3QTXA 4PQNA 4IB3A 2GQGA 4RFYA 5HBJA 3BQRA 3EIDA 1PXOA 4GYGA 4OTGA 2YDKA 3Q4ZA 3UNKA 1A06A 1O6KA 1H8FA 4FGBA 4IX3A 4Q2AA 3TZ7A 4YZ9A 4F9AA 1ZOGA 3R9HA 4RJ4A 4R5YA 5ETAA 4NEUA 4EH7A 2B9JA 4EHVA 1XWSA 4ZMEA 3OW4A 1PHKA 3VJOA 4DAWA 3A8WA 5HCXA 3Q32A 2JITA 4FSUA 2E9PA 2F9GA 3LAUA 4O2ZA 4J1RA 4G3FA 4FZ7A 3HP2A 2IW9A 2R3OA 4MH7A 4JBVA 4Y5HA 2UZWE 3ZRKA 4YTCA 4DFZE 3VHEA 3H9FA 3HNGA 4G1WA 3KN5A 4GSBA 4L45A 4J99A 1STCE 4I3ZA 4P90A 3CLYA 3R8PA 3QBNA 5IMXA 2F2UA 3O17A 3L9MA 1W7HA 3QD4A 2F2CB 2PUUA 3DKCA 5HGIA 3PXKA 2ITTA 3UDBA 3A62A 4NTSA 3LCKA 5CF6A 4E5AX 1T45A 5CEKA 1O9UA 4R3PA 3ZZEA 3OUNB 4PTGA 4JG8A 4ANSA 3CQUA 2J0IA 3E64A 4D2TA 4BWXA 4O7TA 1SVGA 1CSNA 3Q9WA 2X7GA 4JXFA 1GY3A 3DKFA 1PW2A 3SXSA 3OWJA 4DGGA 3ERKA 1LUFA 5HG5A 3TIZA 1XR1A 2VU3A 3FLQA 2IO6A 2GNFA 4FKLA 1K2PA 2FSMX 2HCKA 3VVHA 3GEQA 4MAOA 4ZLYA 3BU3A 1Z57A 5HU9A 4O83A 5EQPA 2HXLA 4ACDA 2ITNA 4QNYA 3PVWA 3I6UA 5BVDA 3G9NA 3AD4A 3UZPA 3I4BA 3AG9A 1H24A 4UMPA 4U6RA 1M2QA 4HCTA 3SOCA 4ZY5A 2H34A 2JEDA 3E87A 1PY5A 3FLWA 4L52A 5E8TA 4AOIA 4H1MA 2H9VA 1W82A 4IAKA 4FL1A 5IEVA 3GXLA 3RP9A 1S9IA 4QQJA 3KRWA 3EKKA 4KBCA 4L7FA 5E8YA 4GFGA 4CEGA 3ATSA 3E93A 5AR3A 5BVNA 3DZOA 4LG4A 4UEUA 5HLPA 2FGIA 1TKIA 4FZFB 2R7BA 4FG7A 5FD2A 3QGYA 3TT0A 5L2QA 4HVGA 5CZIA 1MQBA 3DGKA 2OI4X 4FOBA 1KE5A 4IFGA 2EWAA 3C0IA 2QR7A 1BI7A 1FVVA 4IJ9A 3L8PA 3D94A 4WG5A 5AUXA 1J1CA 4IM2A 2PWLA 2W1HA 1OL5A 4CZYB 3VO3A 1VYZA 4QP8A 4U9AA 4RIYA 5T68A 3ORMA 3QF9A 4NCTC 5DA3A 5AM7A 4DHFA 4E4XA 4YO4A 3ET7A 4H39A 4BCGA 3VULA 2B9IA 2PSQA 1BX6A 4G3CA 5BQ0A 4PDSA 3EJ1A 3R63A 4IX6A 3OT8A 4I6HA 4TZRA 4C2WA 3UMWA 3JY9A 3E8EA 4MNFA 3I5ZA 4C4HA 3FYKX 4ENYA 4DFBA 2PE1A 5L6OA 3MTLA 3F2RA 5E1SA 4GMYA 4FODA 5CU2A 4A9YA 3TUDA 3C5IA 5HZNA 4CFVA 2X8IA 4ZTRA 3QZFA 1J7LA 4BZOA 5EQYA 4I5PA 4QRCA 3VS6A 4F6UA 5ANJA 3NZ0A 4L67A 4CMTA 1X8BA 4CCBA 3BV3A 3MIYA 4RWKA 2XNEA 3PLSA 3A99A 3RKBA 5A4EA 3GCVA 4UN0C 4LUEA 1SNXA 4YJSA 3SG8A 5CTPA 3WYXA 2QO2A 4ASEA 2CCHA 3NAXA 4BCIA 5LMAA 2YIXA 3FKOA 4OR5A 4W9WA 4HPTE 3R1SA 1ZLTA 3G0EA 5AR5A 2W1EA 3ZTXA 3SA0A 4F63A 3FMDA 4RQKA 4CYIA 4I5CA 4RFMA 4IZAA 4YNOA 3KMWA 2ESMA 4DLIA 3R02A 5IH6A 5BUJA 2FH9A 1QMZA 4X3FB 3QZIA 4MK0A 2YIYA 4BY9E 3W10A 2V0DA 1YDTE 3QRJA 5AAFA 2VWVA 5J8IA 1BLXA 3ORPA 3KK8A 4D58A 2OLCA 2CGWA 4EH4A 1U54A 3DV3A 1V0OA 3Q96A 3AOXA 3BLQA 3DZQA 3PA4A 4WNKA 2XRWA 2PUNA 2YITA 3F6XA 4U44A 3PP0A 4FIIA 5FQDC 5E91A 1PKGA 3M2WA 5AX9A 2OICA 2WTJA 3RPRA 5J9LA 5CQWA 3C50A 3DAKA 4QYFA 5DYJA 3QQGA 4LM5A 4E4MA 1BMKA 1BKXA 2JBOA 4BL1A 4GRBA 3TACA 5HBEA 4JX3A 2J5EA 4H3QA 2Z7QA 4IX4A 4N4SA 4PTEA 2QC6A 2J9MA 3NCZA 2X8DA 2Y0AA 3EOCA 2WMAA 3VS1A 4FBXA 1TQMA 4O0YA 2EXCX 2PL0A 4IZ5A 4M8TA 5AP5A 4HVIA 3NUAA 4ZZMA 3O7LD 5M44A 4BTJA 5IDPA 2RFDA 2XYUA 5CX9A 3DJ5A 3TKUA 3U6IA 3QCYA 4EK8A 5JFWA 1SMHA 3SW4A 4UZHA 4BVUA 2V7AA 3FQSA 5M4FA 4GG7A 2PMNX 4Y95A 3EQPA 3D5VA 1W8CA 2AYPA 3KCFA 3D5UA 1U4DA 5CWZA 5FTQA 5EKNA 4ZJIA 5DR6A 4NSTA 3RM7A 4PP7A 4FSNA 5BPYA 5L2WA 3MA3A 4WSYA 3TJDA 3KMMA 5IISA 4C37A 3ID6C 1LPUA 4ZY6A 2VTHA 2WB8A 5I9YA 3JR1A 4UZDA 1Y8YA 2QVSE 1BL6A 3QQKA 4BCHA 2J4ZA 1WBWA 3U9NA 4ANNA 1LEWA 4DF3A 5IQDA 3FDNA 4RVTA 2JKKA 4OW8A 2BAQA 1MQ4A 2C6IA 3S95A 4CRLA 3LFCA 3FUPA 2UZEA 2C3LA 4FV4A 4DA5A 4C02A 3D7ZA 3C4ZA 4LOOA 3MY0A 3QC4A 4QT1A 4ANQA 3UZRA 1H01A 4XOZA 1UU7A 1UU3A 3MDYA 4IB0A 4I23A 5E1EA 1ZOHA 3GT8A 4YC3A 5EDQA 4EH9A 3PLAE 3PG1A 4EBWA 3LJ1A 2WTVA 2IVTA 1XH4A 4WSQA 3VRZA 3CXWA 3OP5A 4M69B 3BHUA 4YZCA 3AC8A 3LZBA 4EYMA 4ZP5A 2RG6A 1PF8A 4L00A 1L8TA 3FAAA 4FIGA 2WTDA 4XG6A 1Y6AA 3KXMA 4QYHA 5KBRA 3K5VA 3BRBA 3V3VA 2B0QA 3F3VA 3QLGA 4B7TA 1YRPA 2Z7LA 5EOLA 3R30A 3BGZA 3QD0A 5D10A 2Y9QA 2REIA 3UZTA 4RVKA 2WMBA 4PNKA 4LL5A 4G31A 3EQDA 4X2FA 5J79A 4DC2A 2Z60A 4JRVA 3DBQA 2X0GA 3RALA 3SAYA 3TZMA 2X6DA 3UP7A 1XBBA 4UY9A 4PP9A 5DRBA 3C4WA 1DI8A 4USDA 2ITZA 3P0MA 5DWRA 3F2NA 2BDFA 4DCEA 3P7BA 3WBLA 4UMQA 5LVMA 5D41A 5E9EA 1R1WA 2C6OA 3QCSA 5LMBA 3TV7A 2BRMA 4U40A 2OIBA 2BKKA 4IXPA 1GNGA 3PXFA 3R28A 4UMTA 5JGBA 2GTMA 2YFXA 5C4KA 1ZYLA 3G6GA 3KU2A 1FINA 2OW3A 5ANOA 2YM3A 4D5KA 3UNZA 2X2LA 4WIHA 3VBWA 3TI1A 5LOHA 3N4VA 5IQGA 3IGGA 3KF7A 3NNVA 5LMKC 2BTSA 2OSCA 2HK5A 3PIYA 4FTOA 4K9YA 4X2GA 4X3FC 3LOKA 3AXWA 4BDKA 3TTIA 4H3PA 5F95A 3FY2A 3FKNA 4D55A 2Q0BA 4I0RA 5CNNA 4OTPA 3V8WA 3VJNA 4L53A 4IVCA 2YM6A 4YLJA 3ZSHA 3RPYA 5CF8A 1H0WA 1UWHA 4I92A 1Q8WA 2V22A 4RX7A 3UODA 3SG9A 4O0UA 4G6OA 4NM5A 2W5BA 3D5WA 4M0YA 4CRSA 2ZB1A 2CLXA 1HOWA 3EH9A 3V6SA 3U54A 3PSCA 2BIKB 3Q4TA 2C6TA 3UNJA 3EWHA 3PJ3A 3R2YA 2QOFA 3ZO2A 4RWIA 4N70A 4O82A 5EM7A 4RA4A 3GUBA 1ZMUA 2Y6MA 3ORNA 3GC9A 2WHBA 2YDIA 5HG9A 4DYMA 4UWYA 4RX9A 5KZIA 1JQHA 3GQIA 2UW4A 3UVQA 5E4HA 3O71A 5DN3A 3DXQA 2VO0A 4ASZA 2VTSA 4N0SA 4OT5A 4FKPA 3POZA 3G6HA 5KX8A 4NFNA 2BHHA 4AZSA 2OJ9A 4BZDA 3MTFA 2FSLX 5M51A 2V62A 3GCPA 3RZBA 5C8MA 3WOWA 4CNHA 2HY81 3L9LA 3NAYA 3V5TA 5AMNA 4LRKA 4C4JA 3WZDA 1VJYA 5FBOA 1FBNA 4O7SA 2JDSA 3A61A 3FV8A 4OBQA 4FT7A 4FZDB 4BYJA 5CEPA 5CF5A 5GNKA 1FGIA 5M55A 4DEBA 4YURA 5K3YA 1Y6BA 1Z5MA 2ETKA 3W2PA 4EQUA 4PMPA 5EM8A 4V04A 4I0SA 3P86A 5L2TA 1IR3A 2QOQA 2PZIA 1UWJA 5FBNC 2HZ0A 2PVYA 4MF0A 2RSVA 2GDOA 2XJ0A 3I0OA 3K5UA 3DK3A 3PE1A 4FT3A 1UA2A 4ACCA 3CSVA 5B0XA 3BKBA 5CSHA 4D4SA 1GZ8A 2UZBA 2XIRA 3S4QA 2J6MA 4M13A 3KL8A 2NNWB 2XZSA 4CQGA 4IE9A 4QMNA 4YSMA 1IAHA 4O7ZA 3FXWA 5C03A 3MA6A 3LQ3A 3E8DA 3W2QA 2GPHA 3TNIA 4YU2A 4U80A 2IG7A 4ZMFA 3A60A 5DEWA 2OJJA 4JI9A 2YAAA 5IUGA 4OTFA 4RWJA 2BTRA 4MD8E 4TWOA 4HVSA 3SXRA 1QCFA 2QNJA 4IIRA 4AXAA 1OVEA 3WYYA 5HU3A 4L44A 4PPCA 2QOKA 2B54A 3OWPA 4DINA 1Q97A 4HCVA 3ZONA 5IZFA 3CP9A 3D7TA 4OBOA 4HNIA 5IQBA 2VX1A 1Q8TA 3R1YA 2BUJA 3PZHA 4LOPA 3F3TA 5J7HA 4GUEA 4JDKA 3LCDA 4ACHA 4XV2A 4D1ZA 1NA7A 2JKOA 3H3CA 4G17A 4CZUA 3GVUA 2WMTA 1H4LA 2XK9A 5FXSA 4YZDA 4DFNA 5EM6A 2XIZA 1P4FA 3DBFA 3VAPA 4JBOA 4IW0A 3EMGA 3PVBA 2I0EA 4O1PA 3RCJA 4EOKA 1ZY5A 4EHZA 4TYHB 1H0VA 2O5KA 2RFSA 2O64A 4I41A 2ZV9A 3LKMA 3BI6A 5A14A 2OZAB 2OZOA 2VTJA 3PRIA 4W4XA 3GBZA 2XBJA 1PXIA 3A4OX 2X2KA 3Q4CA 4C3RA 4C4EA 3COMA 3EL7A 4IEBA 3WE4A 4D4YA 3QX2A 4RJ5A 3OC1A 4WBOA 5AWMA 5JSMA 3FLYA 2F49A 5HI2A 1GZNA 1OMWA 3QUEA 4BHZA 5IEXA 3V8TA 5CU3A 3UG1A 5A4QA 2EXMA 1M2RA 4IVBA 1KE9A 3I5NA 5H3QA 3Q9ZA 4EKKA 4PMSA 3ZEPA 2ONLC 3HAVA 3IOPA 5GHVA 5AX3A 4GYIA 3ULIA 4AZWA 2JIIA 2OFVA 3R7VA 3RHKA 3R8MA 4CFUA 5AAGA 3HA6A 3SW7A 3KVXA 3FEGA 2HWPA 3PYYA 4F9WA 2XNGA 1XJDA 3WF6A 3IECA 5DT4A 1YI4A 4MXAA 5E92A 5M06A 3L8VA 5A3XA 4FV2A 2R3LA 4R6VA 2PYWA 3QWKA 2WOTA 4F99A 5A46A 2R0IA 2WO6A 4P4CA 1H25A 3FQEA 4GT3A 3UOLA 2J90A 3BHVA 1DS5A 3FZTA 3DPKA 1O6LA 3VUGA 5M07A 4PDPA 1CTPE 5ETFA 4ZK5A 2UZUE 5AV0A 2IW8A 2Q0NA 5CT0A 4S31A 1A48A 4A4XA 2YABA 5IUHA 5FRIA 4BRXA 3KRXA 1UU8A 1XH8A 4D2SA 4CG8A 4QTCA 2Z2WA 5FEQA 4FKSA 3O50A 5KUPA 2F7ZE 2QKRA 3EQHA 4PMMA 4C8BA 5KMIA 5L2SA 3BYUA 3KB7A 3FPQA 3V5WA 3ZS5A 4GU9A 4QP3A 4O81A 4BB4A 5BUIA 4QMMA 1WVXA 5EYKA 3DFAA 3IW5A 4IADA 3R9DA 5CEOA 5JT2A 3LPBA 2FSOX 4ZTQA 4PPBA 2J5FA 5L6PA 4HNFA 1YXSA 2E2BA 4XG9A 3W16A 4E3CA 4A4OA 3KRLA 4YJQA 3C0GA 4D1XA 3NYXA 5CLPA 3ZU7A 5IQIA 4V0GA 2CMWA 3IDBA 4MBIA 4OTIA 4OTRA 3QX4A 3G90X 4EOLA 5AR2A 2VWZA 2Y6OA 5GZAA 2C5VA 5E8SA 4AGDA 5IA1A 3LFEA 4D2PA 4M12A 3EFWA 2BDWA 4KS7A 2LAVA 5F4NA 4RC3A 4HGEA 5HE2A 4WNOA 3R7UA 1PJKA 5KHWA 4F1OA 2BAJA 4FKQA 5BX0A 4A9RA 3FI8A 1U46A 2WMWA 4ZZNA 4O2PA 2ITVA 4KAOA 3NW6A 4GK4A 4LGDA 3OXTA 5G6VA 5LWMA 4GU6A 2J2IB 2ETMA 1CKPA 2HWOA 2RG5A 2VUWA 2W99B 3C51A 4K11A 3DNDA 4S30A 5CEIA 1IEPA 3BGPA 2CKQA 1NVQA 2HAKA 2X4ZA 5ACKA 3E7VA 2ZB0A 3LHJA 4FEVA 5HCZA 5CAOA 4BICA 4ALUA 5CZHA 1QL6A 3Q5IA 4KIKB 4IM0A 3OT3A 3PIXA 1KOAA 3ZFYA 4QMYA 3HMMA 3OCSA 4FK3A 2HELA 2OG8A 4FNYA 4UV0A 4O91A 1OKVA 2GNLA 2IZRA 5EK7A 3EN6A 4YLKA 5LJJA 3PDTA 3R9RA 3ENHA 5JK3A 4AA4A 3ENMA 1OBDA 1O6YA 4HCUA 5BUEA 4BTKA 2ACXA 3HUCA 3LFAA 5EH0A 4TL0A 5FP6A 5CAVA 2WPAA 3FZSA 4UWCA 3IG7A 3IQ7A 3NUXA 4CV8A 1MP8A 2ZDTA 4Z3VA 4FKOA 4FT5A 4JQ8A 3VBYA 2PZYA 3GC8A 4OT6A 1FGKA 2HZ4A 2UV2A 3U55A 4RIXA 4M68A 1BUHA 3HL7A 4C4GA 5BYLA 3RWQA 5HICA 4L46A 4DG0E 1V1KA 3IW7A 2CSNA 5FWKK 5GIOE 2VTTA 3CEKA 4XUFA 3R7IA 3M1SA 4DT9A 5EYCA 4MXYA 3F5UA 4WG4A 4R7IA 4HW7A 1TQPA 3JPVA 3PUPA 4TN6A 3I81A 4U5JA 4BDHA 4TRLA 2C6LA 4TWCA 5M53A 4UXLA 5A4CA 4QMOA 3OOMA 3AQVA 4OGRA 5AV1A 4NL0A 2YHVA 5TF9A 4V01A 4BDFA 5IPJA 3KXGA 3HDMA 2I7QA 3QQFA 2FO0A 1Q5KA 3KA0A 2C5YA 2PVHA 5E8XA 3BZ3A 3D14A 4JRNA 5CANA 3FMNA 4QTDA 3A7HA 1BYGA 4RX8A 1VYWA 4ANBA 2W4KA 4GK3A 4F1MA 2W1CA 3AC2A 3AD5A 1W98A 2JGZA 1ATPE 2BHEA 4BCQA 5IQHA 4YJOA 3G2FA 3MH3A 3WARA 4BCJA 3DCVA 3NYNA 4FYNA 5L2IA 2HXQA 2OXDA 3CIKA 4RQVA 4B8LA 1J7IA 3C0HA 3DQXA 4LQMA 1V0PA 1WBNA 3DLSA 1WAKA 2ITXA 2CGXA 2JFLA 5D11A 3KXXA 4K2RA 5DI1A 2IZSA 3DBEA 3W32A 2PUIA 4FZAB 1PMVA 4BCKA 2QQ7A 4YJNA 4C36A 3LXPA 2R2PA 2W1IA 4NM3A 5F1ZA 2H96A 3QWJA 4MXOA 1WBPA 2PVNA 1ZYDA 2W1ZA 3KKVA 1M2PA 3GCSA 1HCKA 3CKWA 3TZ9A 2RFNA 4UYNA 4K18A 1U5QA 4ZTHA 3UP2A 3IGOA 4F6WA 4XX9A 4B9DA 4YZNA 3VS7A 2XNMA 3PXQA 3ZBXA 4ANMA 4BCOA 3LFDA 2CKPA 4LGHA 4X2NA 1LP4A 4C3PA 4FZ6A 3ZHPC 3HGKA 1QPCA 3JYAA 4L3LA 3R8ZA 3HZTA 3GNIB 3UIUA 4ZSAA 1IASA 4ZOGA 4BBEA 4MXXA 5BYZA 3ZM9A 3FZPA 1E9HA 1REKA 4FSWA 2OWBA 1BI8A 4WKQA 4FKTA 3BEAA 5J95A 4CG9A 4EH5A 2PVMA 2YM8A 3CJGA 3O96A 5BMSA 1JKTA 1XBCA 2OH4A 3HMPA 3Q53A 4XG8A 4DEIA 5I3OA 5J5SA 2VWBA 3SKCA 4GG5A 4TNDA 5M4CA 1PYXA 5L6WL 4AA0A 4RBLA 3LMGA 2VO7A 4QPMA 1G8SA 3KN6A 4HGSA 5AV2A 4EJ7A 4OUCA 4O21A 4DBXA 3F82A 3GCQA 3LMHA 5ICPA 3HRCA 3ORTA 1Q3WA 4MHAA 4JNWA 4TTHB 5C9CA 5GIPE 4QYGA 5CT7A 1LR4A 4ZIMA 2HENA 3EN5A 1CKJA 2CNQA 4I1ZA 4R7BA 1QPJA 3HV5A 4AW1A 1FVTA 3F2AA 2R3PA 1B38A 2V5QA 2FUMA 3ANQA 2HOGA 3NPCA 4YJVA 4GL9A 3ZH8A 4E26A 4F9YA 3OTUA 2WTWA 3RAHA 5KMOA 1OZ1A 3L8SA 3DXNA 3V01A 3LFSA 4OTQA 3PXRA 2J50A 4HPUE 5BNJA 2JKQA 3U4WA 2F4JA 4NIFB 3P79A 4XEYA 1LEZA 3ZLSA 5JFXA 1BL7A 2VX0A 3NEWA 4HOKA 3ORIA 5I9UA 3ULZA 1SYKA 5EM5A 4F0GA 3A7GA 4FTJA 2PZ5A 2B9HA 4CKJA 3SX9A 3FMJA 4QQ5A 4HZRA 2BKZA 4U43A 3HRFA 2PMLX 3PE2A 4EOQA 4G2FA 4AT5A 5K0XA 3NVMB 2WQMA 5HTBA 4AAAA 5ANGA 3MW1A 1JSTA 3ETAA 3VS5A 4J97A 3A8XA 3T8OA 2AC5A 5BVWA 3NR9A 3NX8A 4GVAA 3DJ6A 4S34A 3MESA 4ZS4A 2BALA 5M56A 4PY1A 2YCSA 2VV9A 4GK2A 5BVKA 4G5JA 1WBSA 3AGMA 4WNMA 3LIJA 4IWQA 4WUAA 3D2KA 4FIFA 4J53A 3RAIA 3ZM4A 2WMSA 3DBCA 3HX4A 4QP2A 4QOXA 3R8VA 4C2VA 4E5WA 4O22A 2G01A 2G1TA 2Y4IC 3G51A 3ANRA 5EHYA 3HLLA 1YOJA 5C4LA 4AS0A 1GIIA 4FF8A 5FUTA 5AR4A 1M7QA 1PMEA 4FV5A 2B9FA 2W1FA 5TKDA 3JUHA 3LFQA 5E8WA 1ZYCA 3H4JA 5HD7A 3FZ1A 4BKZA 4NH1A 4E6CA 3DBDA 4TT7A 3FYJX 4USFA 4FX3A 3SV0A 1TVOA 4AOTA 4D2RA 1IG1A 2OH0E 5J87A 2XIYA 3KULB 3QQJA 1XH5A 4NT4A 4I5HA 4TYIA 3NRMA 4KBKA 3F5PA 4M67A 4NCTA 5FDPA 4ITJA 2X8EA 3QTZA 3II5A 2EXEA 4AN9A 2VTMA 3SRVB 3ZRMA 4BKYA 4ZLZA 5AUWA 5GJFA 3B8RA 4Z9LA 4GW8A 4FUXA 4XLVA 5G1XA 4IWDA 5JMSA 4XMOA 3LCTA 3CTHA 5DNRA 5HVJA 3UO5A 5C8NA 3WE8A 3KRRA 3NUPA 4ZTSA 1NY3A 1J3HA 4IDVA 1U59A 2AC3A 2PVFA 4FUYA 5AV3A 2P3GX 5FP5A 1MRUA 3V5LA 5HIEA 5T6KA 2GS2A 1NW1A 5IDNA 1Q8UA 2XBAA 4YJPA 4DEGA 4WD5A 3CC6A 3MPMA 4AT3A 4Y5QA 4U45A 5H8BA 4L6QA 4QPSA 1AD5A 4IANA 4U7ZA 3SVVA 3ZEWA 3I7BA 4MNEA 3BLHA 4A9SA 1FPUA 4TXCA 1VR2A 3WIGA 3MB6A 4EUTA 5JQ5A 4DH8A 5JFVA 2XKEA 3GFEA 1YXTA 4I6BA 5C01A 3ZXTA 4FV8A 4BDDA 5HE3A 2C6EA 4EUUA 2X1NA 4L3PA 5K5NA 1JSVA 3R22A 4MYGA 2C1BA 3EFLA 4DGOA 4Y72A 3QCXA 4A4LA 3DB6A 3MJ2A 3HVCA 3ZC5A 4CT2A 3W2SA 4NW6A 4DFYA 3MYGA 3UVRA 5L8LA 4K1BA 3P78A 1ZY4A 2HW7A 3H30A 4S32A 4LUDA 4GKIA 3I0QA 2X81A 4EK6A 4I24A 4TNBA 4JVGA 4F9CA 2VGOA 2DYLA 2XJ1A 3HUBA 4M97A 2WNTA 5TE0A 4IB5A 4XP2A 2OFUA 4LV5A 5FLFA 4EC8A 4F08A 4FICA 3KREA 2W4OA 5JN2A 3VS4A 3CD3A 4C38A 2W06A 4ZJVA 3OBGA 5HORA 4Z55A 4V05A 3H0YA 1Q41A 2R7IA 2WU6A 2C68A 2XK8A 3EN7A 4QNAA 5C1QB 2ERKA 3OOGA 3Q52A 1XKKA 5CASA 1GIJA 1OUKA 3EN9A 5CU4A 5FEDA 3BGQA 2JAMA 2J7TA 3UIBA 5A4LA 1Q99A 5EFQA 2R64A 4ZEGA 3CTQA 4ZSJA 3B2TA 3HMIA 4RG0A 4CXAA 4QP4A 3ORZA 4KKEA 4UB7A 2X6EA 2DQ7X 3FJQE 3UQFA 4KINA 5DR9A 3FC1X 4Y83A 4GS6A 5AJQA 1OIUA 3TIYA 5JEBA 3UC4A 3OF0A 3UO4A 4FSMA 4IB1A 4R7HA 3FLSA 3ZLXA 2BZHB 2R9SA 4J95A 4EOSA 2WMXA 3LCOA 5J7BA 4H05A 4FIEA 5CYIA 3UE4A 4W8EA 1URWA 2WQNA 4YGAA 1UNGA 1AGWA 1G5SA 2O3PA 3QD3A 4HGLA 4O0VA 4EKLA 5H8GA 2ZM1A 3E8CA 5LWNA 2JIUA 1F3MC 4KD1A 2I40A 3BBTB 4O6EA 3OWLA 3OWKA 1PXJA 2QU5A 4DH3A 3Q3BA 3D15A 4BCPA 4AZEA 4X2JA 3CBLA 3DDPA 3E62A 4ALWA 4FTQA 5IMEA 1YI6A 3KXNA 3S3IA 3DFCB 3DTCA 2W96B 3HEGA 4I93A 3MB7A 4A7CA 5JQ8A 3BELA 4I0TA 3ELJA 4D0XA 2CN5A 2ZDUA 5IA3A 1UV5A 3A7JA 4OTHA 2I1MA 4QD6A 4ORKA 2PMIA 3Q4UA 2B55A 4JDJA 1OIQA 5AFVA 3AC5A 3BV2A 2HZNA 5EW8A 5HVYA 2P4IA 4IAAA 2GMXA 3PSBA 4AFJA 4BWPA 3DS6A 4EH6A 5GZ8A 3CKXA 1JKLA 2J0MB 3FXZA 4B4LA 4UYAA 2BRNA 1OI9A 3MWUA 1M52A 4BC6A 5AEPA 5CI6A 1WVYA 4OTDA 5EKOA 5CU0A 4DGMA 4R77A 3VWAA 3RHXA 3QCQA 2WGJA 4W4VA 3VIDA 4BTMA 2CNUA 5AADA 5D9HA 2OJFE 4DGLC 5IF1A 2P33A 3ZO1A 4R8QA 5I0BA 2KULA 2YIWA 2R3KA 4FKWA 2XKFA 3FL5A 5AP7A 3VN9A 1YW2A 3ZDIA 4F4PA 4IDTA 5IEYA 4ERKA 1EH4A 3OUKA 2PY3A 3QQLA 4WRGA 4W4WA 3AC3A 3I7CA 4LL0A 1URCA 4E4LA 1JKKA 2QG5A 3BBWA 4O0TA 2UVXA 3TNWA 4FEUA 4L42A 4KNBA 4DEAA 3NDMA 4QYYA 4X2KA 2XK3A 4GFMA 2FVDA 1E1VA 3W1FA 1G8AA 3UBDA 3FZOA 5IH4A 3TZ8A 3QTWA 4PDOA 5AUTA 4FNXA 5IQFA 3JVRA 4JX7A 4L9IA 5IQCA 1WVWA 4GJ3A 1GZKA 4C62A 5B2LA 4XH6A 1ND4A 5LVLA 4QMLA 4ZXTA 3VUMA 4A06A 3U6HA 3HP5A 5CXZA 1DAYA 2JC6A 2IW6A 5HTCA 4YBKA 3V51A 4GIIA 4MBJA 2OBJA 4K33A 4FL2A 5DG5A 4IVDA 2W0JA 4RIWB 3GOKA 5AP3A 4CSVA 2Y8OA 4IJPA 5LMKA 3PZEA 4X3FA 3I60A 3FE3A 4PWNA 4RRVA 4R1VA 3VUHA 4AW0A 4JBPA 2ZMDA 4NZWB 3EYGA 4KABA 4AT4A 3R1NA 5ANDA 4BHNA 2Y7JA 3GOPA 3F3ZA 2R0UA 3RK7A 3KCKA 5LVPA 3LLAA 4DFUA 1ZYJA 4BGGA 3A7IA 4JAJA 4YJUA 2O63A 3FPMA 1ZZ2A 4X3JA 2I0HA 5CXHA 4EZ3A 4TWNA 5AP0A 3QYWA 3WZKA 4ZJJA 5JKGA 4EZ7A 2BFXA 2W5HA 1T46A 4RJ3A 3RK5A 3C13A 5CF4A 3E5AA 2AUHA 1YDSE 2OIDA 4ZSLA 1YWRA 4F9BA 4IHPA 2CGVA 4BDBA 1F0QA 4K77A 4KKGA 4BDJA 4C7TA 3NCGA 3QKKA 5AR8A 4C3FA 4RC4A 2VWIA 5HO7A 2OGVA 2XMYA 3QRKA 2W9FB 1K9AA 4QMSA 4KBAA 1OPLA 3QKMA 1JVPP 1UVRA 4RJ6A 4AZTA 5FXRA 2QLQA 4BI0A 2R3GA 3ORLA 4NU1A 2HY0A 5EI6A 1YOLA 4F70A 5L4QA 3ZLWA 3P5KA 3Q2JA 3OEFX 3WZUA 4CYJA 4ZTMA 2W17A 2YCFA 5DRDA 4U3ZA 4AGCA 4EONA 5KMLA 3GFWA 2R3MA 2YM5A 4FV7A 4FL3A 4F09A 3ODZX 4G3GA 4O7WA 2C3JA 4BDEA 4BZNA 3HA8A 4ARKA 5K4JA 2VD5A 3KFAA 5CU6A 4FKIA 3BX5A 4PL3A 5HHWA 4E6DA 5GZ9A 3BHHA 5C26A 4GFOA 4Z7GA 3SC1A 2WQOA 4AF3A 1W0XC 1UKHA 4RVLA 5KMKA 1KE7A 3ROYA 4MEDA 4CTBA 5KMJA 1PXLA 3R21A 3W33A 1P4OA 3FMHA 4EOMA 5AUUA 3BQCA 2QCSA 4FEQA 4QYEA 1ZYSA 5DBXA 4C33A 3P23A 4C61A 4L7SA 2GQSA 5AP2A 3UJGA 2YJSA 3E92A 2PHKA 4IBMA 1M14A 2C6MA 4BTFA 2C5NA 2WXVA 3ORXA 4EC9A 2P55A 3VUIA 4L68A 3QZHA 1FMKA 3OBJA 3MY5A 4GCJA 4CCUA 1H1SA 4EORA 3QRTA 4BCFA 2GS7A 3T9TA 1YWVA 1YQJA 2XNPA 2PU8A 4RFZA 4X7QA 4HVDA 2QOLA 4JS8A 4C4FA 3HV3A 5EDRA 4D1SA 4HYUA 4E1ZA 3NLBA 3EFJA 3TWJA 4M69A 1MRYA 5GJDA 5E8VA 1Q4LA 3DB8A 4DH1A 1KSWA 2OJGA 4EK5A 3HV7A 4J98A 1ZXEA 2I0VA 3N4UA 4IC7A 3S1HA 3B8QA 4D4VA 2EB3A 2XRUA 1R0EA 3OCBA 4G3DA 3EB0A 3MVHA 3HKOA 1Q24A 2CLQA 4DH7A 2DWBA 3AMAA 3TDVA 4M7IA 2GHGA 3TL8A 2FB8A 4FT0A 3UC3A 2WIPA 4KA3A 3ZO3A 4LI5A 3T3VA 5IH5A 1YVJA 3MVJA 2VZ6A 3AGLA 4GT4A 4FNZA 3UQGA 2W4JA 3OXIA 2XF0A 2WU7A 3W2RA 3RVGA 5HNGA 3FHIA 3CE3A 3VF8A 2CKOA 4DTAA 3KXZA 3RJCA 4S33A 4NJ3A 2R3JA 2NRUA 3RAKA 3O0GA 2FSTX 2XK7A 3WF9A 4D9UA 5I9VA 3GCUA 4RZWA 4C4IA 2YIRA 3O8TA 5KBQA 5AA8A 3HDNA 5FG8A 4M15A 4F65A 3QYZA 4H36A 5KMMA 4RGJA 4NWMA 2XS0A 2UZVA 5EHOA 4AZFA 5EG3A 3PG3A 4H1JA 1QPEA 4AP7A 3MFTA 5LVNA 4XJ0A 5AM6A 2UUEA 1OKYA 2H6DA 2NPQA 4AQCA 4BYIA 3QKLA 4PDYA 3BIZA 4U79A 3ZUVA 1OITA 1Y8GA 3EZRA 2ONLA 4ALVA 3LW0A 5AIRA 3RPSA 3G33A 4M84A 4MXCA 4E5BA 4O0RA 3GC7A 1KE8A 4PX6A 3BYVA 2P2HA 2C69A 5F9EA 4KS8A 3C1XA 4JIKA 1NVRA 4FTRA 3T3UA 1FOTA 5GINE 4JBQA 1R39A 3IS5A 3IKAA 2SRCA 4RPVA 2XCHA 3A2CA 3D2IA 3WZEA 5DH3A 3O51A 1XH9A 1Y57A 5HE0A 3GQLA 3OCGA 3ZXZA 2IJMA 5B2MA 5HX6A 1J91A 3O8UA 2GNGA 1OM1A 5ETIA 3C9WA 3HV6A 3K3JA 2YZAA 4FV1A 2WKMA 1MRVA 4PMTA 4XOYA 1UKIA 3V04A 3LQ8A 2C6KA 3NUNA 4FSYA 4LGGA 4PRJA 4D5HA 5L8KA 4B99A 5IA2A 2BZKB 4GEOA 4HVHA 3LMIA 4D9TA 3CD8A 3F88A 3QL8A 4EOPA 4QMQA 4KIPA 3CPBA 3SDJA 4CGAA 2YJRA 2YCRA 5JZNA 3PVGA 3OCTA 4ZS0A 2IZTA 4DN5A 3LVPA 3NNXA 4FV6A 3ZBFA 2WQEA 2YM7A 3D0EA 4C58A 4AW2A 2Z8CA 3C4XA 4CFWA 1FVRA 2XH5A 3BYOA 3FBVA 2PVKA 3HYHA 2J51A 3MJ1A 5FGKA 4U3YA 5EDPA 4BCNA 1RW8A 4P5QA 3UPZA 2BPMA 3QHRA 1JAMA 2UW0A 4P7EA 5AAEA 4KUJA 3FMEA 4YP8A 4RIYB 2X7OA 1XO2B 2J0LA 2B1PA 4IMYA 4BIEA 4MKCA 3HAMA 2GNJA 4O0WA 4FE2A 3L1SA 4ZY4A 4NFMA 4NM7A 1OB3A 4NTTA 1L3RE 2EVAA 3QRUA 4IZ7A 3DQWA 5K4IA 2ZVAA 4BR3A 3KEXA 3KVWA 5C8KA 1H1WA 2G2HA 4E7WA 5FTOA 3FLNC 2PZPA 3RBWA 1H00A 4IZYA 3SHEA 1YDRE 4M66A 4NKAA 3VUKA 4BDGA 2G15A 4AUAA 3G15A 2R3HA 3ZSIA 3KK9A 4BDIA 2XKDA 4Y8DA 3FWQA 3QTQA 4FTAA 4ITHA 4G6NA 4ACGA 3PXZA 4YLLA 2WAJA 3NIZA 2UW9A 2X4FA 3TM0A 2PK9A 2VX3A 3OFMA 4EEVA 3Q5ZA 2A1AB 4ASXA 3NWWA 2V7OA 1H08A 4LYNA 2WTKB 2QI8A 2Y4IB 1ZRZA 3LJ2A 3VNTA 3QQUA 2RGPA 4KIOA 5TOZA 1OIRA 5CVGA 3WF7A 4DEEA 4RMZA 3UQCA 4F7LA 2GNIA 2GCDA 4R5SA 3TEIA 4HYIA 3U4UA 4NW5A 4YTHA 3E3PA 4F7NA 3CJFA 5KNJA 3S00A 4DEHA 3JS2A 4CD0A 5HIBA 3RM6A 1OUYA 1IA8A 4XS2A 3GU5A 1ZWSA 4LRJA 2WFYA 3F66A 3D9VA 2XA4A 3BU6A 3VBXA 3TUBA 3L9PA 3QQHA 2QHMA 2ITOA 2WEIA 2X2MA 5DMZA 5CSPA 1U54B 1UU9A 5CAPA 3WZJA 1JOWB 2QKWB 5JH6A 3PY1A 2PVLA 4R3RA 1PXNA 1ZARA 2XM9A 3R9OA 3CS9A 4FG9A 4TYHA 3DJ7A 5T3QA 2X9EA 2Y4PA 2OZAA 3DAEA 2NP8A 2ITWA 4K6ZA 4NUSA 3TKHA 2RFEA 3QTSA 4KWPA 3EQFA 3QTUA 4W8DA 4IAZA 2R5TA 1OECA 4RWLA 1IA9A 2R4BA 4R78A 3L9NA 5L8JA 3ZZWA 5BVOA 4KB8A 2IVVA 4FKJA 2JLDA 4JOAA 4FNWA 3NVKI 3OY3A 4QMZA 2UZNA 4DFLA 4GIHA 3W55A 4ZSEA 4DG3E 4FTIA 1H1RA 3BPRA 3RMFA 5HTIA 2VWXA 2OF2A 4RJ8A 4ZLOA 4O7LA 4M0ZA 4B6LA 4IAYA 1R78A 4GH2A 1OBGA 4FIJA 3LE6A 4CFNA 1YXVA 3SD0A 1H26A 4YBJA 4QQCA 3CCNA 2XYNA 4MWIA 3A4PA 1XBAA 1E1XA 5HD4A 1SVHA 3OROA 3AC1A 1JNKA 2GU8A 3C4FA 4I22A 4L01A 5AUZA 5ANEA 3ROCA 5HCYA 5J1VA 3ZOSA 3TJCA 5JRSA 4O7VA 1M7NA 5CSWA 4AACA 4N57A 1V0BA 2E9UA 1U5RA 3QAME 3REPA 3TTJA 5JRQA 2X39A 3TUCA 3SLSA 1J1BA 3U6JA 4HGTA 5DGZA 4D2VA 4ANOA 5TT7A 3G5DA 4XG2A 3WF5A 1CDKA 1UNLA 3DKGA 5IA0A 2HYYA 3V5PA 5BMMA 3QA0A 1MUOA 5TR6A 4B8MA 2ZOQA 3ZYAA 4RVMA 4PL4A 1XHAA 3H9RA 3FSKA 3W8QA 3ZMMA 2YA9A 3EKNA 3IPHA 2XIXA 4RX5A 5HLWA 5CEQA 3QGWA 4EOIA 2HW6A 3COIA 3NNWA 4M3QA 3FI3A 2XEYA 4BKJA 4BDAA 4DTBA 2YISA 5CVHA 4ZTNA 5DPVA 2O65A 3IONA 5BYYA 2I0YA 3MY1A 2QOIA 4MF1A 4E8AA 2KTYA 5A9UA 2Q83A 3MPTA 4CKIA 5H2UA 4W9XA 3ALOA 3GU7A 3WILA 2RIOA 3TV4A 4DTKA 2C0OA 3PJCA 4G6LA 4GKHA 4A9UA 3PY3A 2DUVA 4FTNA 3DDQA 3NYVA 4Z7HA 3NMUF 1GJOA 3O2MA 1Q61A 4QTBA 4I21A 2Z7SA 4D0WA 4WO5A 1B39A 4JT3A 3NS9A 4YHTA 4FKGA 2VTIA 4QMUA 5FTGA 4FTLA 2W5AA 1RDQE 3OG7A 5ITAA 3OY1A 2RL5A 4QTEA 3PP1A 4XP3A 3NGAA 3UMXA 3RGFA 1WZYA 4C35A 3TCPA 4F7SA 1G3NA 2CCIA 1I44A 4XV1A 4U41A 2UZTA 5EHLA 1JKSA 4R1YA 5IQEA 4EYJA 2G9XA 3MN3A 4DFXE 3SGCA 3EQRA 3G0FA 4G3EA 4IC8A 3CQEA 5ETCA 4XLIA 3F3WA 3LJ0A 2WTKC 1W84A 3MH1A 5KKRB 4KIKA 3TDWA 1KV2A 3COHA 2W1DA 2XUUA 4I5MA 4ITIA 4EBVA 3PA3A 5FM3A 2YACA 4QMPA 5AA9A 4KKHA 2VTRA 4F7JA 5A6OA 5J9YA 4PV0A 3BE9A 4A9TA 2R3IA 2YIQA 5KCVA 2BRHA 1YWNA 2R3RA 2A2AA 2BRBA 4MCVA 3VC4A 4FMQA 3CY3A 3EYHA 4FTKA 4QMXA 1PXMA 4I4FA 3C7QA 3TXOA 3E88A 3R6XA 4ENXA 1JBPE 3AMBA 3QTRA 4EH8A 3FMLA 2VWWA 1QPDA 5CNOA 4I6QA 5DT0A 4RT7A 5KE0A 4O7NA 3ACKA 5CQUA 1H27A 5CI7A 4AGWA 1ZZLA 3RNIA 1HCLA 4X21A 3F7WA 4IH8A 3F61A 4XG7A 3DY7A 3O7LB 2BDJA 3FMKA 4R3CA 4RA5A 4FVRA 5FM2A 4WBBB 3V5JA 5HQ0A 2UW5A 4EOJA 2JFMA 5HNBA 3Q9YA 3W2CA 4OTWA 3FI4A 4UBAA 4W4YA 4YHFA 2XM8A 4CFFA 5I9XA 4YC8A 4KSQA 3W18A 5IA4A 1AQ1A 2A0CX 3GI3A 3DT1A 3MV5A 4OLIA 5HG8A 4AZVA 3RAWA 4XCUA 5LQFA 4FSZA 3R01A 3LXNA 4YR8A 2JKMA 4Q9ZA 2XK6A 2I6LA 1CMKE 2QLUA 1ZOEA 5EW3A 3R1QA 4JG7A 5DEYA 5A54A 1Y91A 3Q60A 5HX8A 5A4TA 4PL5A 4IQ6A 2YWVA 3RPVA 2BVAA 4TYEA 2JIVA 4HJOA 1SM2A 3HECA 2FYSA 2C5OA 3DKOA 3O8PA 3OMVA 2A19B 3SXFA 3TNHA 3UVPA 4EJNA 4X6QC 2ZMCA 2ITQA 2VNYA 3NUSA 3P9JA 4EH2A 4EZ5A 5L3AA 3F5GA 3MSSA 4WNPA 4CLIA 4J71A 1GZOA 2VWYA 5AP1A 3C5UA 2CN8A 4IFCA 4EK3A 4TWPA 3BWFA 3IOKA 4O38A 2JAVA 2EB2A 2ZAZA 3MI9A 4J52A 2YCQA 4UMUA 5D7VA 3NW5A 4L43A 4NK9A 2P2IA 4RIOA 1WBTA 3FC2A 4YUQA 1ERKA 4IAFA 5H9BA 4RSSA 5KZ0A 4LMUA 3COKA 4QPAA 2WMRA 2XNBA 4U97A 5AV4A 3I1AA 4WG3A 4E4NA 4E6AA 4UWBA 1OL2A 3NSZA 5JFSA 3AC4A 4EWQA 3P1AA 2B52A 1YHSA 3AMYA 3R8UA 4I6FA 3ZUUA 4RLKA 2ETRA 3EFKA 4JIAA 1PRYA 1Q3DA 4JL9A 2UW8A 1OPKA 2OO8X 2YLEA 4QTAA 4YNEA 3UOHA 3ZCLA 4CFMA 4CLJA 4IWOA 3GU6A 1KV1A 3K3IA 5DOSA 3H9OA 1YXXA 4NKSA 1ZMVA 3FL4A 4L8MA 4XRJA 3E8NA 2C0IA 3PTGA 1DM2A 3FY0A 3NNUA 3FMMA 3KY2A 1Q8ZA 1PMUA 2GHMA 2PZRA 5CY3A 4AA5A 4AWIA 4EOOA 4IAIA 2YM4A 4XV3A 3D7TB 5I9ZA 3S0OA 5JGAA 3VUTA 3OD6X 3RI1A 4BBFA 4JJRA 2QURA 4D4RA 4YJTA 4U0IA 4YZMA 3Q04A 2ZJWA 3W2OA 3LLTA 3R0TA 3LM0A 3OXZA 4ERWA 3OHTA 3M11A 5IUIA 3PFQA 3QA8A 2XB7A 4H3BA 2CPKE 3ZFMA 2OKRA 4AOJA 3UOJA 2Z7RA 3TN8A 2BAKA 4C34A 2WTCA 5F20A 1CM8A 2OXXA 2VTNA 4FK6A 2GTNA 1OPJA 2C5XA 3CTJA 2JD5A 2QHNA 4QP6A 1UNHA 4Y85A 5DLSA 2A4LA 5IKWA 3WIKA 4DGNA 2CGUA 5HEZA 4QP1A 1IRKA 3DK7A 4CMUA 5J9ZA 1PXPA 3QU0A 3R04A 2IN6A 3R7YA 4IM3A 2V55A 5A6NA 4MWHA 4O1OA 4FEXA 3G9LX 3UYSA 3Q9XA 2BRGA 2QOBA 2VTOA 3PPZA 4YMJA 1Z9XA 4E93A 3UPXA 4DT8A 3DLZA 4OBPA 3DNEA 4FGRA 3R2BA 3UTOA 2C4GA 3AD6A 3Q2MA 2W9ZB 2WOUA 3OTVA 3R8LA 4RLLA 5KKRC 2YLFA 3LCSA 1YHVA 2WMVA 4BGHA 1WFCA 1CKIA 5FEEA 3NYOA 2C1AA 4NIFA 2QONA 4YJRA 5B7VA 3BE2A 4MQ2A 3C4CA 4FYOA 2QODA 3RCDA 3TV6A 5E7RA 3NUUA 5EW9A 5F94A 3CQWA 4RC2A 5LVOA 1OIYA 3EQCA 4F64A 3BLRA 1KUTA 4GUBA 5EQEA 4P5ZA 3FXXA 4BIBA 4HYHA 1H07A 4N6ZA 4APPA 3VS2A 3EZVA 4EH3A 4WT6A 5IQAA 1WBOA 3BYMA 2GS6A 5CAQA 1XH6A 3U9CA 2OXYA 3K2LA 4JDHA 5EYDA 5DIAA 5AUYA 2QOOA 4FV9A 3PRFA 5M09A 2R3NA 5KHXA 1GAGA 2R3FA 4AE6A 4D28A 4FTUA 4KSPA 3GGFA 2XKCA 4S2ZA 4USEA 4HZSA 3JVSA 4F1TA 4DITA 4A07A 5K9IA 1JPAA 3PA5A 3UYTA 3JY0A 3ODYX 1R0PA 2BR1A 2G2FA 2ZV2A 4U8ZA 2BMCA 3AT3A 2RF9A 3O23A 4BDCA 4I20A 2C6DA 2YWPA 3E7OA 3R83A 2UW3A 4FTTA 5CVFA 4EQCA 3KMUA 3A7FA 3GU4A 4FSTA 5B2KA 5AP4A 5TO8A 4C57A 4FTMA 3R9NA 4ASDA 2H8HA 5EYMA 4XG4A 3OEZA 5IA5A 5IU2A 1PKDA 1SVEA 4IX5A 4NM0A 3KULA 4LV8A 4QP7A 4XYFA 5HE1A 2IZUA 3LXKA 4RJ7A 3F7ZA 4J8NA 1RE8A 2E9OA 5GJGA 1I09A 1F5QA 2BZJA 3KRJA 1M17A 1W83A 4JQEA 4ZAUA 3FHRA 2BIYA 3OZ6A 3QTIA 2PE2A 2UZOA 5LARA 4EQMA 4MQ1A 3UIMA 3SRVA 4PF4A 4U81A 4FV0A 4EK4A 1YHWA 4QMVA 2C30A 2OK1A 3IDPA 1JLUE 2UW6A 4EI4A 3C4EA 3P7CA 3QXOA 2XIKA 2ZYBA 3E63A 4V0GB 2HIWA 3EQIA 5DHJA 2G2IA 4CV9A 1YKRA 2DS1A 2X9FA 3ITZA 1R3CA 4EHGA 5HLNA 4BI1A 2Z02A 3PWYA 2B7AA 3CGFA 2IVSA 5J1WA 3N9XA 5HKMA 3TKIA 4J7BA 3RZFA 2ITUA 2VTAA 3CPCA 3QALE 2C0TA 1RQQA 2CJMA 2FA2A 3VS0A 1NVSA 3CY2A 4NYEA 2VO3A 5EI8A 4D2WA 1KOBA 2B53A 4GJ2A 2WZJA 2VGPA 2XCKA 3DAJA 4XBUA 1A9UA 2BZIB 3QZGA 4FEWA 4FR4A 3D83A 3PPKA 5M57A 4B0GA 3P4KA 2F57A 3BHYA 4MXZA 5JGDA 3NIEA 4K0YA 5CALA 3QUDA 4FSQA 1OKWA 3H10A 5J5TA 2VTLA 5E8UA 3DTWA 3R00A 2UVZA 3E3BX 4MTAA 4AGUA 2WMUA 4QMTA 2WD1A 3S2PA 3PJ1A 3KGAA 3UGCA 4Y46A 2OU7A 2GFSA 3GP0A 4Q5EA 3D5XA 3JXWA 3V6RA 3GU8A 5ACBC 2PMOX 3PWDA 2ITPA 1REJA 3WI6A 1H1QA 4JAIA 4FV3A 2OJIA 4UMRA 4AN3A 1P2AA 4QMWA 2VWUA 2C3IB 5DE2A 3PIZA 2QG7A 4HYSA 4J96A 3MH0A 2JDTA 3B2WA 3EHAA 2XNNA 3EL8A 3Q6WA 3VBTA 4OAVB 2IWIA 4RIXB 3QHWA 4BIDA 3OW3A 2ZM3A 4C0TA 1YXUA 4AG8A 3BYSA 2QO7A 3IW6A 4LRMA 2JBPA 2W1GA 3BU5A 1YOMA 2WIHA 2XK4A 4MVFA 4BWKA 3BCEA 3LXLA 4JLCA 3RK9A 2UZLA 4ID7A 1P5EA 5CSVA 4BBMA 2F7XE 4CMOA 2X7FA 5K5XA 4KIQA 3IW4A 2W05A 1H1PA 3KF4A 3ORKA 4Q9SA 4DH5A 5I4NA 3DXPA 3U87A 2PE0A 2EU9A 2VRXA 5CS6A 5KMNA 2UVYA 3GB2A 4F0FA 3LFFA 3OVVA 2B4SB 5K0KA 1WBVA 3ZO4A 3F3UA 4UALA 1KE6A 3AT2A 4ZSGA 3VW6A 4YO6A 1S9JA 4Z16A 3MS9A 3NW7A 4FOCA 5LXMA 4U42A 4IVAA 4DG2E 2EUFB 1WMKA 3HV4A 4P2KA 4IACA 3TNQB 4BGQA 3N4TA 2BFYA 4FKRA 4YZBA 4GT5A 3MIAA 3VS3A 4EHEA 5LCJA 4FC0A 3EQGA 3GC0A 1SZMA 3V8SA 4I4EA 4YSJA 3I79A 2CHLA 5I9WA 4TYJA 3GENA 4H58A 3CR0A 1JSUA 4YPSA 2GQRA 4TW9A 3SOAA 1GIHA 3HMNA 1J7UA 3RWPA 5HO8A 3QRIA 2VO6A 3PXYA 2PUPA 2XJ2A 3FLZA 2UZDA 4MD7E 5HESA 4DLJA 3F69A 3ZSGA 4FA2A 4AFEA 5CEMA 2RKUA 5HBHA 5AUVA 3IK3A 3VQUA 3K54A 1IAJA 3R7EA 3ACJA 4G9RA 1DAWA 4ZZOA 3U8WA 4FVQA 2P0CA 3BEGA 4JR7A 2WTIA 1XH7A 1ZAOA 2HZIA 4XG3A 5C27A 3RPOA 4AU8A 4FG8A 4LMNA 5CSXA 2A27A 2NRYA 4L3JA 4TKSA 3POOA 4O0XA 5I3RA 2BROA 4NJDA 2VTQA 3LFNA 4EL9A 2VTPA 1OGUA 3Q6UA 5DVRA 2C3KA 5EOBA 1TQIA 4JR3A 3QFVA 1SNUA 4CT1A 3I6WA 4CFXA 2E9NA 2PPQA 2QO9A 1XQZA 4K8AA 3ZDUA 4F6SA 3BWJA 3IO7A 4UX9A 2F7EE 3M42A 2VAGA 5H8EA 3P08A 4DE4A 3R7OA 4Q5HA 4XRLA 4E73A 4PNIA 3MFRA 3V5QA 3MPAA 3BHTA 2BILB 2QOHA 4XV9A 4AE9A 4GV1A 2NO3A 2LGCA 3PJ8A 3VUDA 3LQ5A 2C47A 4AW5A 4WHZA 4CQEA 4G34A 2XVDA 5HIDA 1Q62A 1NT2A 1YI3A 2O8YA 2CDZA 3KQ7A 4O86A 3WF8A 2ZM4A 5FXQA 2YEXA 1KWPA 3MBLA 1OL6A 5DT3A 5D1JA 3H0ZA 1H28A 4YC6A 3VBVA 3VRYA 3IW8A 2QU6A 3DA6A 4X6RA 4WRSA 4APCA 2XP2A 2QOCA 3ALNA 2CKEA 5HO6A 4JDIA 1OKZA 4FT9A 4PUZA 4CZTA 3FI2A 3VF9A 4G16A 5E90A 1ZMWA 5JZJA 4BF2A 2YERA 3DU8A 3MVLA 4O96A 4F0IA 3T9IA 4E6QA 4O84A 3FSFA 4DBNA 4RIWA 3D4QA 3ZLYA 3MH2A 3AT4A 1PYEA 1OL7A 2UW7A 4AX8A 4ZTLA 3UOKA 5CENA 2GHLA 2O2UA 2WEVA 4II5A 4MD9E 3UO6A 4MX9A 3UIXA 3ZFXA 3QUPA 3VHKA 3KXHA 3NUYA 5IG1A 2YN8A 2YAKA 3TG1A 3F9NA 2GSFA 2PVRA 5DFPA 4O7YA 4FKUA 2O0UA 2QR8A 4CVAA 5KO1A 3RTPA 5HNIX 4YTFA 3PSDA 2WMQA 4G9CA 4XBRA 5LCKA 3THBA 3F5XA 1FQ1B 4QO9A 1FMOE 2ZV8A 4C59A 1OL1A 5HVKA 4FVPA 3DK6A 4PTCA 3DOGA 5HOAA 2JDOA 5FDXA 1PMNA 3QD2B 2IVUA 4TYGA 3ZC6A 1NXKA 5ANKA 3HMOA 3FKLA 3IDCA 2XNOA 3MVMA 4E20A 4N6YA 2GNHA 4FI1A 4BFMA 3TNPC 2BCJA 3VQHA 4JG6A 3KC3A 5I5ZA 4DEDA 4XNEA 5M4UA 1JWHA 2XEZA 5DR2A 3MGYA 2CNVA 1K3AA 2PVJA 4G5PA 4X0MA 4M14A 2JDVA 5M4IA 3VW8A 3ATTA 5D12A 3U51A 3L8XA 3PJ2A 5ANIA 3W8LA 2J0JA 3R73A 2OF4A 3R71A 3MFSA 1P14A 2YZLA 4O0SA 4YHJA 3RINA 3PPJA 3R7GA 4I94A 4O7RA 3EQBA 3N51A 3QXPA 1PXKA 2IPXA 3PY0A 1DI9A 4FIHA 2PTKA 4LOQA 4XHKB 5AR7A 3CGOA 4XP0A 1GOLA 4AN2A 3LM5A 4FTCA 3UG2A 2GFCA 2WQBA 2R3QA 3MFUA 4BN1A 4LFIA 4FKVA 4CTCA 4UXQA 3HRBA 4IWPA 1APME 2W7XA 4WA9A 4EWHA 1VZOA 1WCCA 3P7AA 3EN4A 4RZVA 4BCMA 3QLFA 4YPDA 4Y73A 4BI2A 5AIKA 4ANLA 5M08A 2WELA 3OS3A 3RNYA 2JDRA 4QP9A 2QD9A
chains in the Genus database with same CATH superfamily
4J8MA 2ITYA 4MBLA 5D7AA 4ACMA 3VBQA 4WUNA 4KRDA 4OAUC 2VNWA 4O27B 5E8ZA 4KRCA 4YTIA 2PULA 4JQ7A 3PVUA 4FSRA 3FZRA 4TPTA 3ZUTA 4QQTA 4CKRA 5HG7A 3QC9A 1TFFA 2ZV7A 3ZRLA 4MNEB 5AP6A 2VN9A 1RJBA 4PPAA 1B6CB 2YDJA 2OIQA 1G8KA 4DCAA 5BVEA 1VEBA 4WOVA 4GVJA 2J0KA 5BVFA 5EI2A 4ONAA 2E9VA 3LFBA 5CAUA 3FQHA 4O6LA 2ERZE 4TY1A 3SQQA 1Q8YA 3QTXA 4PQNA 4IB3A 2GQGA 4RFYA 5HBJA 3BQRA 3EIDA 1PXOA 4GYGA 4OTGA 2YDKA 3Q4ZA 3UNKA 1A06A 1O6KA 1H8FA 4FGBA 4IX3A 4Q2AA 3TZ7A 4YZ9A 4F9AA 1ZOGA 3R9HA 4RJ4A 4R5YA 5ETAA 4NEUA 4EH7A 2B9JA 4EHVA 1XWSA 4ZMEA 3OW4A 1PHKA 3VJOA 4DAWA 3A8WA 5HCXA 3Q32A 2JITA 4FSUA 2E9PA 2F9GA 3LAUA 4O2ZA 4J1RA 4G3FA 4FZ7A 3HP2A 2IW9A 2AQXA 2R3OA 4MH7A 4JBVA 4Y5HA 2UZWE 3ZRKA 4YTCA 4DFZE 3VHEA 3H9FA 3HNGA 4G1WA 3KN5A 4GSBA 4L45A 4J99A 1STCE 4I3ZA 4P90A 3CLYA 3R8PA 3QBNA 5IMXA 2F2UA 3O17A 3L9MA 1W7HA 3QD4A 2F2CB 2PUUA 3DKCA 5HGIA 3PXKA 2ITTA 3UDBA 3A62A 4NTSA 3LCKA 5CF6A 4E5AX 1T45A 5CEKA 1O9UA 4R3PA 3ZZEA 3OUNB 4PTGA 4JG8A 4ANSA 3CQUA 2J0IA 3E64A 4D2TA 4BWXA 4O7TA 1SVGA 1CSNA 3Q9WA 2X7GA 4JXFA 1GY3A 3DKFA 1PW2A 3SXSA 3OWJA 4DGGA 3ERKA 1LUFA 5HG5A 3TIZA 1XR1A 2VU3A 3FLQA 2IO6A 2GNFA 4FKLA 1K2PA 2FSMX 2XAMA 2HCKA 3VVHA 3GEQA 4MAOA 4ZLYA 3BU3A 1Z57A 5HU9A 4O83A 5EQPA 2HXLA 4ACDA 2ITNA 4QNYA 3PVWA 3I6UA 5BVDA 3G9NA 3AD4A 3UZPA 3I4BA 3AG9A 1H24A 4UMPA 4U6RA 1M2QA 4HCTA 3SOCA 4ZY5A 2H34A 2JEDA 3E87A 1PY5A 3FLWA 4L52A 2X0QA 5E8TA 4AOIA 4H1MA 3ML1A 2H9VA 1W82A 4IAKA 4FL1A 5IEVA 3GXLA 3RP9A 1S9IA 4QQJA 3KRWA 1TZDA 3EKKA 4KBCA 4L7FA 5E8YA 4GFGA 4CEGA 3ATSA 3E93A 5AR3A 5BVNA 3DZOA 4LG4A 4UEUA 5HLPA 2FGIA 1TKIA 4FZFB 2R7BA 4FG7A 5FD2A 3QGYA 3TT0A 5L2QA 4HVGA 5CZIA 1MQBA 3DGKA 2OI4X 4FOBA 1KE5A 4IFGA 2EWAA 3C0IA 2QR7A 1BI7A 1FVVA 4IJ9A 3L8PA 3D94A 4WG5A 5AUXA 1J1CA 4IM2A 2PWLA 2W1HA 1OL5A 4CZYB 3VO3A 1VYZA 4QP8A 4U9AA 4RIYA 5T68A 3ORMA 3QF9A 4NCTC 5DA3A 5AM7A 4DHFA 4E4XA 4QEBA 4YO4A 3ET7A 4H39A 4BCGA 3VULA 2B9IA 2PSQA 1BX6A 4G3CA 5BQ0A 4PDSA 3EJ1A 3R63A 4IX6A 3OT8A 4I6HA 4TZRA 4C2WA 3UMWA 3JY9A 3E8EA 4MNFA 3I5ZA 4C4HA 3FYKX 4ENYA 4DFBA 2PE1A 5L6OA 3MTLA 3F2RA 5E1SA 4GMYA 4FODA 5CU2A 4A9YA 3TUDA 3C5IA 5HZNA 4CFVA 2X8IA 4ZTRA 3QZFA 1J7LA 4BZOA 5EQYA 4I5PA 4QRCA 3VS6A 4F6UA 5ANJA 3NZ0A 4L67A 4CMTA 1X8BA 4CCBA 3BV3A 3MIYA 4RWKA 2XNEA 3PLSA 3A99A 3RKBA 5A4EA 3GCVA 4UN0C 4LUEA 1SNXA 4YJSA 3SG8A 5CTPA 3WYXA 2QO2A 4ASEA 2CCHA 3NAXA 4BCIA 5LMAA 2YIXA 3FKOA 4OR5A 4W9WA 4HPTE 3R1SA 1ZLTA 3G0EA 5AR5A 2W1EA 3ZTXA 3SA0A 4F63A 3FMDA 4RQKA 4CYIA 4I5CA 4RFMA 4IZAA 4YNOA 3KMWA 2ESMA 4DLIA 3R02A 5IH6A 5BUJA 2FH9A 1QMZA 4X3FB 3QZIA 4MK0A 2YIYA 4BY9E 3W10A 2V0DA 1YDTE 3QRJA 5AAFA 2VWVA 5J8IA 1BLXA 3ORPA 3KK8A 4D58A 2OLCA 2CGWA 4EH4A 1U54A 3DV3A 1V0OA 3Q96A 3AOXA 3BLQA 3DZQA 3PA4A 4WNKA 1VLRA 2XRWA 2PUNA 2YITA 3F6XA 4U44A 3PP0A 4FIIA 5FQDC 5E91A 1PKGA 3M2WA 5AX9A 2OICA 2WTJA 3RPRA 5J9LA 5CQWA 3C50A 3DAKA 4QYFA 5DYJA 3QQGA 4LM5A 4E4MA 1BMKA 4DHJA 1BKXA 2JBOA 4BL1A 4GRBA 3TACA 5HBEA 4JX3A 2J5EA 4H3QA 2Z7QA 4IX4A 4N4SA 4PTEA 2QC6A 2J9MA 3NCZA 2X8DA 2Y0AA 1XMLA 3EOCA 2WMAA 3VS1A 4FBXA 1TQMA 4O0YA 2EXCX 2PL0A 4IZ5A 4M8TA 5AP5A 4HVIA 3NUAA 4ZZMA 3O7LD 5M44A 4BTJA 5IDPA 2RFDA 2XYUA 5CX9A 3DJ5A 3TKUA 3U6IA 3QCYA 4EK8A 5JFWA 1SMHA 3SW4A 4UZHA 4BVUA 2V7AA 3FQSA 5M4FA 4GG7A 2PMNX 4Y95A 3EQPA 3D5VA 1W8CA 2AYPA 3KCFA 3D5UA 1U4DA 5CWZA 5FTQA 5EKNA 4ZJIA 5DR6A 4NSTA 3RM7A 4PP7A 4FSNA 5BPYA 5L2WA 3MA3A 4WSYA 3TJDA 3KMMA 5IISA 4C37A 3ID6C 4QDEA 1LPUA 4ZY6A 2VTHA 2WB8A 5I9YA 3JR1A 4UZDA 1Y8YA 2QVSE 1BL6A 3QQKA 4BCHA 2J4ZA 1WBWA 3U9NA 4DDIA 4ANNA 1LEWA 4DF3A 5IQDA 3FDNA 4RVTA 2JKKA 4OW8A 2BAQA 1MQ4A 2C6IA 3S95A 4CRLA 3LFCA 3FUPA 2UZEA 2C3LA 4FV4A 4DA5A 4C02A 3D7ZA 3C4ZA 4LOOA 3MY0A 3QC4A 4QT1A 4ANQA 1G8JA 3UZRA 1H01A 4XOZA 1UU7A 1UU3A 3MDYA 4IB0A 4I23A 5E1EA 1ZOHA 3GT8A 4YC3A 5EDQA 4EH9A 3PLAE 3PG1A 4EBWA 3LJ1A 2WTVA 2IVTA 1XH4A 4WSQA 3VRZA 3CXWA 3OP5A 4M69B 3BHUA 4YZCA 3AC8A 3LZBA 4EYMA 4ZP5A 2RG6A 1PF8A 4L00A 1L8TA 3FAAA 4FIGA 2WTDA 4XG6A 1Y6AA 3KXMA 4QYHA 5KBRA 3K5VA 3BRBA 3V3VA 2B0QA 3F3VA 3QLGA 4B7TA 1YRPA 2Z7LA 5EOLA 3R30A 3BGZA 3QD0A 5D10A 2Y9QA 2REIA 3UZTA 4RVKA 2WMBA 4PNKA 3BL7A 4LL5A 4G31A 3EQDA 4X2FA 5J79A 4DC2A 2Z60A 4JRVA 3DBQA 2X0GA 3RALA 3SAYA 3TZMA 2X6DA 3UP7A 1XBBA 4UY9A 4PP9A 5DRBA 3C4WA 1DI8A 4USDA 2ITZA 3P0MA 5DWRA 3F2NA 2BDFA 4DCEA 3P7BA 3WBLA 4UMQA 5LVMA 5D41A 5E9EA 1R1WA 2C6OA 3QCSA 5LMBA 3TV7A 2BRMA 4U40A 2OIBA 2BKKA 4IXPA 1GNGA 3PXFA 3R28A 4UMTA 5JGBA 2GTMA 2YFXA 5C4KA 1ZYLA 3G6GA 3KU2A 1FINA 2OW3A 5ANOA 2YM3A 2IF8A 4D5KA 3UNZA 2X2LA 4WIHA 3VBWA 3W0RA 3TI1A 5LOHA 3N4VA 5IQGA 3IGGA 3KF7A 3NNVA 5LMKC 2BTSA 2OSCA 2HK5A 3PIYA 4FTOA 4K9YA 4X2GA 4X3FC 3LOKA 3AXWA 4BDKA 3TTIA 4H3PA 5F95A 3FY2A 3FKNA 4D55A 2Q0BA 4I0RA 5CNNA 4OTPA 3V8WA 3VJNA 4L53A 1W2CA 2YM6A 4IVCA 4YLJA 3ZSHA 3RPYA 5CF8A 1H0WA 1UWHA 4I92A 1Q8WA 2V22A 4RX7A 3UODA 3SG9A 4O0UA 4G6OA 4NM5A 2W5BA 3D5WA 4M0YA 4CRSA 2ZB1A 2CLXA 1HOWA 3EH9A 3V6SA 3U54A 3PSCA 2BIKB 3Q4TA 2C6TA 3UNJA 3EWHA 3PJ3A 3R2YA 2QOFA 3ZO2A 4RWIA 2XARA 4AQKA 4N70A 4O82A 5EM7A 4RA4A 3GUBA 1ZMUA 2Y6MA 3ORNA 3GC9A 2WHBA 2YDIA 5HG9A 4DYMA 4UWYA 4RX9A 5KZIA 1JQHA 3GQIA 2UW4A 3UVQA 5E4HA 3O71A 5DN3A 3DXQA 2VO0A 4ASZA 2VTSA 4N0SA 4OT5A 4FKPA 3POZA 3G6HA 5KX8A 4NFNA 2BHHA 4AZSA 2OJ9A 4BZDA 3MTFA 2FSLX 5M51A 2V62A 3GCPA 3RZBA 5C8MA 3WOWA 4CNHA 2HY81 4O4DA 3L9LA 3NAYA 3V5TA 5AMNA 4LRKA 4C4JA 3WZDA 1VJYA 5FBOA 1FBNA 4O7SA 2JDSA 3A61A 3FV8A 4OBQA 4FT7A 4FZDB 4BYJA 5CEPA 5CF5A 5GNKA 1FGIA 5M55A 4DEBA 4YURA 5K3YA 1Y6BA 1Z5MA 2ETKA 3W2PA 4EQUA 4PMPA 5EM8A 4V04A 4I0SA 3P86A 5L2TA 1IR3A 2QOQA 2PZIA 1UWJA 5FBNC 2HZ0A 2PVYA 4MF0A 2RSVA 2GDOA 2XJ0A 3I0OA 3K5UA 3DK3A 3PE1A 4FT3A 1UA2A 4ACCA 3CSVA 5B0XA 3BKBA 5CSHA 4D4SA 1GZ8A 2UZBA 2XIRA 3S4QA 2J6MA 4M13A 3KL8A 2NNWB 2XZSA 4CQGA 4IE9A 4QMNA 4YSMA 1IAHA 4O7ZA 3FXWA 5C03A 3MA6A 3LQ3A 3E8DA 3W2QA 2GPHA 3TNIA 4YU2A 4U80A 2IG7A 4ZMFA 3A60A 5DEWA 2OJJA 4JI9A 2YAAA 5IUGA 4OTFA 4RWJA 2XALA 2BTRA 4MD8E 4TWOA 4HVSA 3SXRA 1QCFA 2QNJA 4IIRA 4AXAA 1OVEA 3WYYA 5HU3A 4L44A 4PPCA 2QOKA 2B54A 3OWPA 4DINA 1Q97A 4HCVA 3ZONA 5IZFA 3CP9A 3D7TA 4OBOA 4HNIA 5IQBA 2VX1A 1Q8TA 3R1YA 2BUJA 3PZHA 4LOPA 3F3TA 5J7HA 4GUEA 4JDKA 3LCDA 4ACHA 4XV2A 4D1ZA 1NA7A 2JKOA 3H3CA 4G17A 4CZUA 3GVUA 2WMTA 1H4LA 2XK9A 5FXSA 4YZDA 4DFNA 5EM6A 4LDTA 2XIZA 1P4FA 3DBFA 3VAPA 4JBOA 4IW0A 3EMGA 3PVBA 2I0EA 4O1PA 3RCJA 4EOKA 1ZY5A 4EHZA 4TYHB 1H0VA 2O5KA 2RFSA 2O64A 4I41A 2ZV9A 3LKMA 3BI6A 5A14A 2OZAB 2OZOA 4DHZA 2VTJA 3PRIA 4W4XA 3GBZA 2XBJA 1PXIA 3A4OX 2X2KA 3Q4CA 4C3RA 4C4EA 3COMA 3EL7A 4IEBA 3WE4A 4D4YA 3QX2A 4RJ5A 3OC1A 4WBOA 5AWMA 5JSMA 3FLYA 2F49A 5HI2A 1GZNA 1OMWA 3QUEA 4BHZA 5IEXA 3V8TA 5CU3A 3UG1A 5A4QA 2EXMA 1M2RA 4IVBA 1KE9A 3I5NA 5H3QA 3Q9ZA 4EKKA 4PMSA 3ZEPA 2ONLC 3HAVA 3IOPA 5GHVA 5AX3A 4GYIA 3ULIA 4AZWA 2JIIA 2OFVA 3R7VA 3RHKA 3R8MA 4CFUA 5AAGA 3HA6A 3SW7A 3KVXA 3FEGA 2HWPA 3PYYA 4F9WA 2XNGA 1XJDA 3WF6A 3IECA 5DT4A 1YI4A 4MXAA 5E92A 5M06A 3L8VA 5A3XA 4FV2A 2R3LA 4R6VA 2PYWA 3QWKA 2WOTA 4F99A 5A46A 2R0IA 2WO6A 4P4CA 1H25A 3FQEA 4GT3A 3UOLA 2J90A 3BHVA 1DS5A 3FZTA 3DPKA 1O6LA 3VUGA 5M07A 4PDPA 1CTPE 5ETFA 4ZK5A 2UZUE 5AV0A 2IW8A 2Q0NA 5CT0A 4S31A 1A48A 4A4XA 4BJJA 2YABA 5IUHA 5FRIA 4BRXA 3KRXA 1UU8A 1XH8A 4D2SA 4CG8A 3O5AA 4QTCA 2Z2WA 5FEQA 4O4EA 4FKSA 3O50A 5KUPA 2F7ZE 2QKRA 3EQHA 4PMMA 4C8BA 5KMIA 5L2SA 3BYUA 3KB7A 3FPQA 3V5WA 3ZS5A 4GU9A 4QP3A 4O81A 4BB4A 5BUIA 4QMMA 1WVXA 5EYKA 3AKKA 3DFAA 3IW5A 4IADA 3R9DA 5CEOA 5JT2A 3LPBA 2FSOX 4ZTQA 4PPBA 2J5FA 5L6PA 4HNFA 1YXSA 2E2BA 4XG9A 3W16A 4E3CA 4A4OA 3KRLA 4YJQA 3C0GA 4D1XA 3NYXA 5CLPA 3ZU7A 5IQIA 4V0GA 2CMWA 3IDBA 4MBIA 4OTIA 4OTRA 3QX4A 3G90X 4EOLA 5AR2A 2VWZA 2Y6OA 5GZAA 2C5VA 5E8SA 4AGDA 5IA1A 3LFEA 4D2PA 4M12A 3EFWA 2BDWA 4KS7A 2LAVA 5F4NA 4RC3A 4HGEA 5HE2A 4WNOA 3R7UA 1PJKA 5KHWA 4F1OA 2BAJA 4FKQA 5BX0A 4A9RA 3FI8A 1U46A 2WMWA 4ZZNA 4O2PA 2ITVA 4KAOA 3NW6A 4GK4A 4LGDA 3OXTA 5G6VA 5LWMA 4GU6A 2J2IB 2ETMA 1CKPA 2HWOA 2RG5A 2VUWA 2W99B 3C51A 4K11A 3DNDA 4S30A 5CEIA 1IEPA 3BGPA 2CKQA 1NVQA 2HAKA 2X4ZA 5ACKA 3E7VA 2ZB0A 3LHJA 4FEVA 5HCZA 5CAOA 4BICA 4ALUA 5CZHA 1QL6A 3Q5IA 4KIKB 4IM0A 3OT3A 3PIXA 1KOAA 3ZFYA 4QMYA 3HMMA 3OCSA 4FK3A 4AXFA 2HELA 2OG8A 4FNYA 4UV0A 4O91A 1OKVA 2GNLA 2IZRA 5EK7A 3EN6A 4YLKA 5LJJA 3PDTA 3R9RA 3ENHA 5JK3A 4AA4A 3ENMA 1OBDA 1O6YA 4HCUA 5BUEA 4BTKA 2ACXA 3HUCA 3LFAA 5EH0A 4TL0A 5FP6A 5CAVA 2WPAA 3FZSA 4UWCA 3IG7A 3IQ7A 3NUXA 4CV8A 4AAYA 1MP8A 2ZDTA 4Z3VA 4FKOA 4FT5A 4JQ8A 3VBYA 2PZYA 3GC8A 4OT6A 1FGKA 2HZ4A 2UV2A 3U55A 4RIXA 4M68A 1BUHA 3HL7A 4C4GA 5BYLA 3RWQA 5HICA 4L46A 4DG0E 1V1KA 3IW7A 2CSNA 5FWKK 5GIOE 2VTTA 3CEKA 4XUFA 3R7IA 3M1SA 1ST4A 5EYCA 4DT9A 4MXYA 3F5UA 4WG4A 4R7IA 4HW7A 1TQPA 3JPVA 3PUPA 4TN6A 3I81A 4U5JA 4BDHA 4TRLA 2C6LA 4TWCA 5M53A 4UXLA 5A4CA 4QMOA 3OOMA 3AQVA 4OGRA 5AV1A 4NL0A 2YHVA 5TF9A 4V01A 4BDFA 5IPJA 3KXGA 3HDMA 2I7QA 3QQFA 2FO0A 1Q5KA 3KA0A 2C5YA 2PVHA 5E8XA 3BZ3A 3D14A 4JRNA 5CANA 3FMNA 4QTDA 3A7HA 1BYGA 4RX8A 1VYWA 4ANBA 2W4KA 4GK3A 4F1MA 2W1CA 3AC2A 3AD5A 1W98A 2JGZA 1ATPE 2BHEA 4BCQA 5IQHA 4YJOA 3G2FA 3MH3A 3WARA 4BCJA 3DCVA 3NYNA 4FYNA 5L2IA 2HXQA 2OXDA 3CIKA 4RQVA 4B8LA 1J7IA 3C0HA 4F78A 3DQXA 4LQMA 1V0PA 1WBNA 3DLSA 1WAKA 2ITXA 2CGXA 2JFLA 5D11A 3KXXA 4K2RA 5DI1A 2IZSA 3DBEA 3W32A 2PUIA 4FZAB 1PMVA 4BCKA 2QQ7A 4YJNA 4C36A 3LXPA 2R2PA 2W1IA 4NM3A 5F1ZA 2H96A 3QWJA 4MXOA 1WBPA 2PVNA 1ZYDA 2W1ZA 3KKVA 1M2PA 3GCSA 1HCKA 3CKWA 3TZ9A 2RFNA 4UYNA 4K18A 1U5QA 4ZTHA 3UP2A 3IGOA 4F6WA 4XX9A 4B9DA 4YZNA 3VS7A 2XNMA 3PXQA 3ZBXA 4ANMA 4BCOA 3LFDA 2CKPA 4LGHA 4X2NA 1LP4A 4C3PA 4FZ6A 3ZHPC 3HGKA 1QPCA 3JYAA 4L3LA 3R8ZA 3HZTA 3GNIB 3UIUA 4ZSAA 1IASA 4ZOGA 4BBEA 4MXXA 5BYZA 3ZM9A 3FZPA 1E9HA 1REKA 4FSWA 2OWBA 1BI8A 4WKQA 4FKTA 3BEAA 5J95A 4CG9A 4EH5A 2PVMA 2YM8A 3CJGA 3O96A 5BMSA 1JKTA 1XBCA 2OH4A 3HMPA 3Q53A 4XG8A 4DEIA 5I3OA 5J5SA 2VWBA 3SKCA 4GG5A 4TNDA 5M4CA 1PYXA 5L6WL 4AA0A 3UDTA 4RBLA 3LMGA 3UDZA 2VO7A 4QPMA 1G8SA 3KN6A 4HGSA 5AV2A 4EJ7A 4OUCA 4O21A 4DBXA 3F82A 3GCQA 3LMHA 5ICPA 3HRCA 3ORTA 1Q3WA 4MHAA 4JNWA 4TTHB 5C9CA 5GIPE 4QYGA 5CT7A 1LR4A 4ZIMA 2HENA 3EN5A 1CKJA 2CNQA 4I1ZA 4R7BA 1QPJA 3HV5A 4AW1A 1FVTA 3F2AA 2R3PA 1B38A 2V5QA 2FUMA 3ANQA 2HOGA 3NPCA 4YJVA 4GL9A 3ZH8A 4E26A 4F9YA 3OTUA 2WTWA 3RAHA 5KMOA 1OZ1A 3L8SA 3DXNA 3V01A 3LFSA 4OTQA 3PXRA 2J50A 4HPUE 5BNJA 4O4CA 2JKQA 3U4WA 2F4JA 4NIFB 3P79A 4XEYA 1LEZA 3ZLSA 5JFXA 1BL7A 2VX0A 3NEWA 4HOKA 3ORIA 5I9UA 3ULZA 1SYKA 5EM5A 4F0GA 3A7GA 4FTJA 2PZ5A 2B9HA 4CKJA 3SX9A 3FMJA 4QQ5A 4HZRA 2BKZA 4U43A 3HRFA 2PMLX 3PE2A 4EOQA 4G2FA 4AT5A 5K0XA 3NVMB 2WQMA 5HTBA 4AAAA 5ANGA 3MW1A 1JSTA 3ETAA 3VS5A 4J97A 3A8XA 3T8OA 2AC5A 5BVWA 3NR9A 3NX8A 4GVAA 3DJ6A 4S34A 3MESA 4ZS4A 2BALA 5M56A 4PY1A 2YCSA 2VV9A 4GK2A 5BVKA 4G5JA 1WBSA 3AGMA 4WNMA 3LIJA 4IWQA 4WUAA 3D2KA 4FIFA 4J53A 3RAIA 3ZM4A 2WMSA 3DBCA 3HX4A 4QP2A 4QOXA 3R8VA 4C2VA 4E5WA 4O22A 2G01A 2G1TA 2Y4IC 3G51A 3ANRA 5EHYA 3HLLA 1YOJA 5C4LA 4AS0A 1GIIA 4FF8A 5FUTA 5AR4A 1M7QA 1PMEA 4FV5A 2B9FA 2W1FA 5TKDA 3JUHA 3LFQA 5E8WA 1ZYCA 3H4JA 5HD7A 3W0QA 3FZ1A 4BKZA 4NH1A 4E6CA 3DBDA 4TT7A 3FYJX 4USFA 4FX3A 3SV0A 1TVOA 4AOTA 4D2RA 1IG1A 2OH0E 5J87A 2XIYA 3KULB 3QQJA 1XH5A 4NT4A 4I5HA 4TYIA 3NRMA 4KBKA 3F5PA 4M67A 4NCTA 5FDPA 4ITJA 2X8EA 3QTZA 3II5A 2EXEA 4AN9A 2VTMA 3SRVB 3ZRMA 4BKYA 4ZLZA 5AUWA 5GJFA 3B8RA 4Z9LA 4GW8A 4FUXA 4XLVA 5G1XA 4IWDA 5JMSA 4XMOA 3LCTA 3CTHA 5DNRA 5HVJA 3UO5A 5C8NA 3NFFB 3WE8A 3KRRA 3NUPA 4ZTSA 1NY3A 1J3HA 4IDVA 1U59A 2AC3A 2PVFA 4FUYA 5AV3A 2P3GX 5FP5A 1MRUA 3V5LA 5HIEA 5T6KA 2GS2A 1NW1A 5IDNA 1Q8UA 2XBAA 4YJPA 4DEGA 4WD5A 3CC6A 3MPMA 4AT3A 4Y5QA 4U45A 5H8BA 4L6QA 4QPSA 1AD5A 4IANA 4U7ZA 3SVVA 3ZEWA 3I7BA 4MNEA 3BLHA 4A9SA 1FPUA 4TXCA 1VR2A 3WIGA 3MB6A 4EUTA 5JQ5A 4DH8A 5JFVA 2XKEA 3GFEA 1YXTA 4I6BA 5C01A 3ZXTA 4FV8A 4BDDA 5HE3A 2C6EA 4EUUA 2X1NA 4L3PA 5K5NA 1JSVA 3R22A 4MYGA 2C1BA 3EFLA 4DGOA 4Y72A 3QCXA 4A4LA 3DB6A 3MJ2A 3HVCA 3ZC5A 4CT2A 3W2SA 4NW6A 4DFYA 3MYGA 3UVRA 5L8LA 4K1BA 3P78A 1ZY4A 2HW7A 3H30A 4S32A 4LUDA 4GKIA 3I0QA 2X81A 4EK6A 4I24A 4TNBA 4JVGA 4F9CA 2VGOA 2DYLA 2XJ1A 3HUBA 4M97A 2WNTA 5TE0A 4IB5A 4XP2A 2OFUA 4LV5A 5FLFA 4EC8A 4F08A 4FICA 3KREA 2W4OA 5JN2A 3VS4A 3CD3A 4C38A 2W06A 4ZJVA 3OBGA 5HORA 4Z55A 4V05A 3H0YA 1Q41A 2R7IA 2WU6A 2C68A 2XK8A 3EN7A 4QNAA 5C1QB 2ERKA 3OOGA 3Q52A 1XKKA 5CASA 1GIJA 1OUKA 3EN9A 5CU4A 5FEDA 3BGQA 2JAMA 2J7TA 3UIBA 5A4LA 1Q99A 5EFQA 2R64A 4ZEGA 3CTQA 4ZSJA 3B2TA 3HMIA 4RG0A 4CXAA 4QP4A 3ORZA 4KKEA 4UB7A 2X6EA 2DQ7X 3FJQE 3UQFA 4KINA 5DR9A 3FC1X 4Y83A 4GS6A 5AJQA 1OIUA 3TIYA 5JEBA 1OGYA 3UC4A 3OF0A 3UO4A 4FSMA 4IB1A 4R7HA 3FLSA 3ZLXA 2BZHB 2R9SA 4J95A 4EOSA 2WMXA 3LCOA 5J7BA 4H05A 4FIEA 5CYIA 3UE4A 4W8EA 1URWA 2WQNA 4YGAA 1UNGA 1AGWA 1G5SA 2O3PA 3QD3A 4HGLA 4O0VA 4EKLA 5H8GA 2ZM1A 3E8CA 5LWNA 2JIUA 1F3MC 4KD1A 1W2FA 2I40A 3BBTB 4O6EA 3OWLA 3OWKA 1PXJA 2QU5A 4DH3A 3Q3BA 3D15A 4BCPA 4AZEA 4X2JA 3CBLA 3DDPA 3E62A 4ALWA 4FTQA 5IMEA 1YI6A 3KXNA 4MUQA 3S3IA 3DFCB 3DTCA 2W96B 3HEGA 4I93A 3MB7A 4A7CA 5JQ8A 3BELA 4I0TA 3ELJA 4D0XA 2CN5A 2ZDUA 5IA3A 1UV5A 3A7JA 4OTHA 2I1MA 4QD6A 4ORKA 2PMIA 3Q4UA 2B55A 4JDJA 1OIQA 5AFVA 3AC5A 3BV2A 2HZNA 5EW8A 5HVYA 2P4IA 4IAAA 2GMXA 3PSBA 4AFJA 4BWPA 3DS6A 4EH6A 5GZ8A 3CKXA 1JKLA 2J0MB 3FXZA 4B4LA 4UYAA 2BRNA 1OI9A 3MWUA 1M52A 4BC6A 5AEPA 5CI6A 1WVYA 2XAOA 4OTDA 5EKOA 5CU0A 4DGMA 4R77A 3VWAA 3RHXA 3QCQA 2WGJA 4W4VA 3VIDA 4BTMA 2CNUA 5AADA 5D9HA 2OJFE 4DGLC 5IF1A 2P33A 3ZO1A 4R8QA 5I0BA 2KULA 2YIWA 2R3KA 4FKWA 2XKFA 3FL5A 5AP7A 3VN9A 1YW2A 3ZDIA 4F4PA 4IDTA 5IEYA 4ERKA 1EH4A 3OUKA 2PY3A 3QQLA 4WRGA 4W4WA 3AC3A 3I7CA 4LL0A 1URCA 4E4LA 1JKKA 2QG5A 3BBWA 3P5JC 4O0TA 2UVXA 3TNWA 4FEUA 4L42A 4KNBA 4DEAA 3TMOA 3NDMA 4QYYA 4X2KA 2XK3A