4NTTA

Structure of the catalytic subunit of camp-dependent protein kinase bound to adp and one magnesium ion
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
341
structure length
339
Chain Sequence
SEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTGSFGRVMLVKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVAGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFTEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Features of Product Release for the PKA Catalytic Cycle.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
total genus 79
structure length 339
sequence length 341
chains with identical sequence B
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2013-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4nttA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4nttA02
1OL5A 5L8JA 2HOGA 1CM8A 2IVSA 2BZJA 4U43A 5LVNA 3OTVA 4YC6A 4FSMA 4Y73A 3LW0A 3MYGA 5IDPA 2QO9A 4X3FB 4QP7A 4BCHA 2W5HA 3OWLA 5JMSA 3PPJA 4XV9A 4YU2A 4FT5A 2IVTA 4TXCA 4O38A 2I0EA 1OB3A 1CKJA 4MAOA 4PDOA 4JRNA 4FNYA 4BIEA 4KSPA 4DEHA 4WSYA 4DLIA 2XYNA 4XV2A 5F9EA 1JNKA 2VNWA 3P7AA 4DG0E 4GCJA 3OUKA 4DLJA 3G9LX 4XUFA 1UU9A 4DAWA 3QA8A 4XV3A 3AG9A 3NCGA 3O8PA 4XG3A 1K9AA 3RMFA 1REJA 5CLPA 3KK9A 4KNBA 4FL1A 2A1AB 5CSWA 2XZSA 4EK6A 2XP2A 3OTUA 5BYZA 2OZOA 3W32A 2HIWA 3JS2A 3K5UA 5ICPA 3ENHA 3R7VA 3DBQA 3R00A 5KMLA 4ITHA 3ATTA 2CLQA 3E8EA 4FG8A 5GNKA 4ZSLA 5M4UA 3KVXA 4BY9E 4GFOA 3OOGA 5DLSA 1EH4A 4PL5A 3KXZA 3VUTA 1Y8GA 5KMKA 3DA6A 4II5A 3N4UA 1H27A 2XJ1A 4GU6A 4F9BA 4O83A 3BHVA 2GNHA 4LL0A 3LMGA 2BTRA 4RZWA 4D4VA 3V5WA 4YO4A 3BWJA 3GENA 4P5ZA 2CKEA 2QQ7A 1Q8UA 2UVYA 4AA4A 4M66A 3QRKA 3OXIA 3G15A 2YM3A 4QT1A 3PYYA 3OWKA 4X21A 2VTPA 5M51A 3L8VA 3LCTA 1KE8A 5J5SA 3V51A 4OTRA 5CNOA 3IK3A 3U87A 2ITWA 3A4PA 4IAYA 2Z8CA 5AUVA 3I7CA 2HW7A 4IH8A 4MQ2A 3AOXA 3R0TA 2QURA 4MX9A 3TZ8A 3MB7A 2VTSA 3LFBA 2YABA 4ZY5A 4GVJA 1GNGA 2GNFA 4AN9A 4LM5A 3VS1A 3EYGA 4K1BA 4EJNA 4AQCA 5I9YA 1FVRA 5I9VA 5IQFA 3MN3A 3CE3A 3F88A 2PULA 2ZVAA 2C5NA 2ITXA 3PJCA 5EYKA 4FV9A 3CPCA 5CI7A 5IQBA 2R3HA 3W1FA 2W1ZA 3DTCA 1WMKA 4U3YA 3FMHA 3EMGA 4GT4A 3EQRA 1Z9XA 2P3GX 3SGCA 2C5OA 2P2IA 3DXNA 3C4CA 3O17A 4QYHA 5ACBC 1TQPA 4XMOA 4IIRA 3OXZA 1J7IA 1ZZ2A 3CBLA 4X2JA 3U9NA 4DF3A 5J87A 4QTCA 3BV2A 3M42A 3R9OA 3MH2A 1GZ8A 3QLGA 4JR7A 1WBNA 2OU7A 1PMVA 1SNUA 3HYHA 1KE9A 1OGUA 4LI5A 2ZJWA 3OFMA 4FT3A 3DU8A 3RI1A 5GHVA 3R7OA 4E6DA 1VYWA 4EZ7A 2QC6A 3RAIA 3QQGA 4X3FC 3QD4A 4ERKA 2XRWA 5LCJA 2RFDA 4ZJIA 1UWJA 4X3FA 2WB8A 2QLQA 2X6EA 3CJFA 1JBPE 1XBAA 4R7HA 1NY3A 3VW8A 5IMXA 4OTQA 3LKMA 4PY1A 3OW3A 1CTPE 4QMYA 5ETCA 5HG9A 3TV4A 3SOCA 1NT2A 4EK8A 2C5XA 3N51A 3AGLA 4F63A 5JH6A 1Q3WA 4BGQA 4D0XA 2WMXA 3HA8A 5DBXA 3PVWA 3TZMA 2Y4PA 3PG3A 3UO6A 4E20A 2OXYA 4O7RA 3DB8A 4PTEA 2ZV9A 3FLNC 4YC3A 1OIYA 2O63A 4EK3A 4L68A 5GZ8A 2CNUA 1KOAA 3E8DA 3ALNA 5HU9A 3A7FA 4NCTA 2VTTA 3P7CA 5J8IA 2Y9QA 3PTGA 1FVTA 3LIJA 1U54A 4AGDA 4RFZA 3E87A 5EKOA 4WRSA 2GNLA 2KULA 2PVLA 4RQVA 3RPYA 3VVHA 5K5XA 3NW7A 1QCFA 1CSNA 3MFUA 2J0JA 2NO3A 4FNZA 4ZY4A 3RWQA 2PVFA 4BDDA 2EUFB 5CF4A 4CRLA 2VX3A 4BRXA 4F9CA 4D2TA 4OT6A 2OSCA 2GS2A 4WUAA 4MD7E 1URWA 2XK7A 3MSSA 3FXZA 3ZM4A 5AA8A 3O2MA 4AX8A 4I3ZA 3TACA 4EI4A 3LLAA 5D1JA 4HNIA 4LGDA 5DWRA 3HDMA 1Y6BA 4M15A 1ND4A 4O0VA 4YUQA 1YXUA 1P5EA 1BUHA 3P86A 4L3JA 4KKGA 3TKIA 2W1FA 4BWPA 2C3KA 2PUNA 1H24A 5IEXA 3PY0A 3EN7A 5E8UA 5G1XA 5L6WL 2JKOA 1ZAOA 3B2WA 3S00A 2GNIA 3VS4A 4Y95A 2BCJA 2FH9A 2VGPA 4BBEA 4BKZA 2JEDA 3HV4A 3MGYA 2UZDA 4CFXA 4EHZA 1OBGA 1R78A 3IPHA 4FEVA 3RVGA 1H1SA 4DEEA 4FKTA 3POZA 3BCEA 5TT7A 3VS5A 4AN3A 2VO3A 5CAOA 4JG6A 3GFEA 3QLFA 3DPKA 3NAXA 2W9ZB 4YJPA 2QCSA 3RPSA 5A4CA 2V55A 5DT0A 4YJRA 3QZGA 2AC5A 5IQAA 4CV8A 3KL8A 4L3LA 3NWWA 4TY1A 5EI6A 2ETKA 3R9DA 4S2ZA 4WG5A 3VS2A 3O8TA 4BKJA 1ZYDA 1M2PA 2YM7A 1GY3A 5LMKA 4FIIA 5AEPA 4EBWA 2OO8X 1JWHA 1A9UA 2I0YA 3ROCA 3OW4A 4AW5A 4DEDA 3UVQA 3NIZA 4LMNA 3QGYA 4N70A 5FM2A 4LUEA 2YAKA 3CC6A 3OCTA 3H0YA 4TWCA 3V6RA 4C33A 2GS6A 4G3DA 4CFFA 4DTBA 2B1PA 3PLSA 4B6LA 4F09A 2FO0A 2W4KA 4CD0A 5L8KA 5GZ9A 4ZK5A 1M14A 3Q9XA 3QUDA 2WQMA 3H4JA 4R3CA 2F57A 2XNPA 5CAVA 4YR8A 1APME 4F0GA 5I9WA 5C26A 2UW7A 4OLIA 4BDIA 3QALE 3D5WA 2WTWA 4ASZA 3PA5A 4RX7A 2PY3A 3W18A 4DEGA 4O86A 4JLCA 1OM1A 3QBNA 2BRNA 4L46A 1HOWA 3GU6A 4FTKA 5CF5A 3FXXA 5CXZA 2CLXA 3ZS5A 1E1XA 1KUTA 3HKOA 5J7BA 4MYGA 3H9RA 3C4EA 3ORNA 2X7FA 2A0CX 4PP7A 3QQJA 3OD6X 5FRIA 3Q5IA 1Y8YA 3BIZA 1F0QA 4ENYA 4ZMFA 4G6OA 3TL8A 4C02A 4EZ3A 3KREA 3W2SA 3R8VA 3WF9A 3Q53A 3EQHA 5I3OA 5E9EA 3HEGA 4GFGA 2BILB 2Y8OA 2ITUA 4E4XA 4QOXA 4AWIA 3N4TA 2G2IA 5AP3A 5BVEA 5JEBA 4ALUA 3NX8A 3GP0A 2QOHA 3QRIA 5LARA 4R8QA 3PPZA 5ANEA 3QRJA 3ZRLA 4BDKA 3O0GA 3ZSIA 2CKQA 3I1AA 5KMOA 4V0GB 4BTJA 4PDPA 1JSUA 4APCA 2IZRA 4RVMA 2CGVA 1P4FA 5FP5A 4E5AX 2HZ4A 4AA5A 3PXYA 3HAVA 4DH5A 4K9YA 3EIDA 2QOQA 1Q61A 1W98A 3CEKA 3UP2A 3BHHA 4DG2E 1OKYA 5AAGA 5IU2A 2NP8A 1O6KA 3I0QA 3SQQA 2BKKA 3K54A 4ALWA 5D7AA 4F9YA 5IG1A 2YDJA 2WQBA 3BLRA 4L7FA 3MVHA 3KQ7A 1IRKA 4RLLA 1UU8A 2QODA 4FL2A 4QP9A 3UOKA 4ZIMA 3NNVA 1TQMA 3E93A 3OT8A 3UOHA 3VF9A 4W4VA 3H3CA 4MXXA 1JLUE 5A46A 3FI8A 5B2MA 4JG7A 3R8PA 4O1OA 4FEUA 3F5XA 3LFCA 3FKOA 2XK8A 5DR2A 3EQDA 2XNMA 3DBFA 4JVGA 3BU6A 4FKPA 2XM9A 3A8WA 1V0PA 3ORMA 3DK7A 4U79A 3O7LB 3QTQA 3PRFA 3LQ5A 2B54A 3D2KA 3Q6WA 4ANNA 4IXPA 5TKDA 4GYGA 3UG1A 3MIAA 5HD4A 4I6QA 5C27A 3F2RA 3TKUA 4FSZA 4R3PA 4HYHA 5DH3A 4OTWA 5HX6A 4XX9A 1OZ1A 2PVMA 2XVDA 4CT2A 4YPSA 3LMHA 2C3LA 3LXNA 3VS0A 4TYJA 3PIYA 4G34A 3KXMA 3RM7A 3II5A 4L67A 2WMQA 4AUAA 3FMLA 1OPKA 5CEPA 3TG1A 4EQMA 4YNEA 3S95A 4F64A 3UNJA 4NWMA 4OAUC 2X2KA 3BYVA 4GUEA 4RSSA 1HCLA 1XBCA 3HV7A 3TUBA 1XBBA 4YPDA 5EYMA 5I9UA 1YDRE 3JY0A 4MH7A 1ZYSA 3SAYA 1VJYA 1OMWA 3MY5A 3U9CA 3ZCLA 4F6UA 5FUTA 2VWZA 3AXWA 3EQFA 4QP4A 4X6RA 4X2FA 3E88A 5JGDA 3PPKA 1ATPE 2WMTA 2R2PA 4AXAA 2JLDA 4PP9A 2Q83A 2JIIA 4NIFB 4A07A 3BV3A 3GU8A 3IDPA 3ZEWA 5AAFA 2J7TA 3RALA 2O65A 3FBVA 2XMYA 4IWOA 2JC6A 5CQWA 3KMWA 4UMUA 4JDJA 1L8TA 5DPVA 2ZOQA 1XH9A 3I7BA 3IGOA 3LFEA 2X39A 3Q9ZA 2BROA 5LOHA 4L52A 2XBAA 4QMVA 1H00A 2QU6A 4EOMA 4FEQA 4O7NA 3LQ8A 1MRYA 4FKVA 3BX5A 3DZOA 4FKIA 4XCUA 5AWMA 2I1MA 3PXKA 4FUYA 3QHRA 3LXPA 3EZVA 2WQOA 3SXRA 1PXLA 4QPSA 3Q60A 4GUBA 4Q2AA 5TE0A 2IPXA 2BMCA 4J95A 4RWLA 5C9CA 4YSJA 3C5IA 4CG8A 3I5NA 4FF8A 3SV0A 4FTUA 5FBOA 3DAJA 1PYXA 2WEVA 3G5DA 3JXWA 4IVDA 2QVSE 4IEBA 4JG8A 2EWAA 2ITQA 2XKDA 1ZY4A 3RPOA 3T9TA 4D1ZA 1WBWA 4FV5A 3VRZA 4CFVA 4IDTA 3FV8A 3FHRA 1DI8A 3MTFA 3UC3A 1U4DA 4BCKA 5H2UA 3A99A 1V0BA 3K3IA 1IASA 3SXSA 2I40A 3CSVA 3KRJA 3TNQB 1I44A 2ETMA 4OTDA 1NA7A 3I6UA 4I5HA 2GNJA 4QTAA 4RX5A 4ZSGA 2C0TA 4GRBA 3K3JA 3C4WA 3IKAA 4L01A 3EQIA 3F6XA 3FZPA 4BI2A 2QO7A 3C5UA 4Z3VA 5K9IA 4W4XA 1E1VA 3R63A 1W8CA 1ZMVA 1J7LA 2YN8A 3S4QA 4J8MA 4M67A 3PXFA 5EDPA 5M55A 2X9FA 3R28A 3QTRA 4AW2A 4KIQA 3VF8A 4ZMEA 2JDSA 3SKCA 5EW9A 4JBQA 4O0RA 3UPXA 2CSNA 5LQFA 1P14A 1KOBA 2R3OA 4E93A 4M97A 3BI6A 4IC7A 3PVUA 2PVYA 4UV0A 1J91A 4BFMA 5HX8A 3V8TA 4RQKA 5AV0A 2X0GA 1KV2A 5FXRA 3SRVA 3R9NA 3UOLA 4EJ7A 3E92A 2A2AA 3SXFA 4Y46A 3UO5A 4YSMA 2W4JA 3BGZA 4CV9A 4I5CA 3RPVA 2FSTX 4RIXB 5E8TA 3EZRA 4I5MA 4RGJA 4BBMA 2QKWB 4FNWA 4L8MA 2PUIA 1SM2A 5AX3A 5IDNA 3BYOA 3D7ZA 3RAKA 4JQEA 5AM7A 2H34A 2ITOA 4ZSEA 4IZAA 4L42A 2G2FA 1H28A 4D1XA 3HMOA 2QI8A 3MTLA 4ZLOA 5E8SA 4E73A 5K4IA 3HMPA 2C1AA 4JOAA 2PZYA 4LMUA 4KUJA 3NW6A 3BGQA 4Y8DA 3SHEA 4FKWA 2B7AA 3AD5A 3GC7A 3DQWA 4HVSA 3QA0A 2PVRA 4KBKA 4DFXE 4L43A 3DLSA 2HW6A 3PZEA 2XM8A 2XK9A 2GHMA 2WU7A 4C62A 5CU3A 4AOTA 3HMIA 4LGHA 3PXRA 4IVBA 4MQ1A 4RFMA 4RJ6A 4BDCA 5IUHA 5KKRB 5AV3A 1RE8A 4P4CA 3OROA 4C4GA 3I4BA 3PXQA 3BYSA 5J95A 3ERKA 4QMOA 4AW1A 1Y6AA 1YI4A 3VS6A 3WF5A 4BYJA 1FPUA 4KINA 4G31A 4IWQA 4CZUA 4I41A 3GCQA 4IACA 3G0EA 4QPMA 4YHFA 5HZNA 3S2PA 1OVEA 1MQ4A 4IB0A 4XV1A 2FB8A 4FKUA 2VGOA 4ITJA 1WAKA 3SLSA 3FZ1A 4GJ2A 2IZSA 4G5JA 5BQ0A 5DE2A 2FSOX 2W17A 4S34A 3DBCA 3QQKA 4OBPA 4UY9A 5M53A 3LCSA 3QTZA 4P2KA 3D5XA 1XWSA 5ANKA 2OFVA 3A2CA 4WBBB 2RG6A 3QKMA 2IWIA 2Q0BA 2GMXA 1OPLA 3H10A 5CANA 2DQ7X 3TM0A 5A14A 4MNFA 3E3BX 3QD0A 2GQSA 2C6EA 3ZSHA 1H01A 1Q4LA 3IONA 3T9IA 4YNOA 5L2IA 1UU7A 5EDRA 3UQGA 1ZWSA 1YI6A 3CCNA 2X9EA 4YJOA 5JSMA 5HTIA 4ASXA 2ZM4A 2BZKB 3QXOA 3QZFA 4J52A 3ULZA 5IQIA 2FSMX 2RIOA 2EXEA 2PTKA 3R73A 4U6RA 2BZHB 4R5SA 3A7JA 3NCZA 4HPTE 5CX9A 1QL6A 5BMSA 2VV9A 2XNEA 4QMLA 2XKCA 4V01A 3IW6A 1MRUA 3TTIA 1PYEA 2P55A 3GOKA 4F7LA 5C4KA 2CPKE 3LOKA 5AP6A 4S30A 3C4ZA 4X3JA 3VRYA 2BTSA 2W1EA 4R7IA 3CY3A 2NNWB 2P2HA 2Y7JA 4FZAB 1B39A 2HELA 2W1GA 3A62A 3AC8A 4CVAA 4DBXA 3U6HA 3MDYA 4JAJA 4RMZA 2JD5A 3PIZA 3JR1A 3BLHA 4PTCA 5DI1A 2C3JA 1W82A 1YHWA 3GC9A 4AAAA 3BBTB 4R6VA 4RVKA 3HMMA 4Y5HA 5GJDA 4CEGA 1U59A 3I79A 3WYXA 5LVLA 1WBSA 1SZMA 2XCKA 3KY2A 3R8MA 4EOJA 1OIRA 4DE4A 3NUSA 3COIA 2X81A 4I94A 4RC3A 1WCCA 2ITZA 2Y0AA 4QYYA 3FKLA 1PMNA 4FTTA 2JDVA 5TF9A 3RNIA 2V22A 1Z57A 5HNGA 4BCQA 4PMPA 5CAPA 3C4FA 4R78A 2OWBA 5GIOE 2UZUE 2PWLA 3AMYA 4A4OA 4YLLA 4E7WA 3S0OA 2R7IA 5BPYA 1ZYLA 4ZP5A 2UZWE 4PNKA 3RGFA 3D15A 2PSQA 4F0FA 1CKIA 5BYYA 4DFLA 4FZ6A 4E5WA 2R3KA 3ZZWA 5IKWA 3OBJA 2Z7LA 1G3NA 1OL1A 4RFYA 5EYDA 3U6IA 4L9IA 4B8MA 3BGPA 3E62A 5B0XA 4RA4A 3DFAA 4O7YA 2UZNA 4DFUA 4ZTRA 4BDGA 4FKSA 4AGUA 2YHVA 4AZTA 5EI8A 4DG3E 3KU2A 2E9VA 2QOIA 4DTKA 5ANOA 4MXOA 3QTUA 4ZTLA 3SOAA 4GFMA 1O9UA 3LFSA 4I6HA 4BDHA 4H3QA 3RZFA 4AS0A 3FMDA 1OUKA 1PXKA 2PZIA 3AC3A 4HZRA 4M3QA 4TRLA 4RJ8A 5AR7A 1LEZA 3C0GA 4DYMA 5EI2A 4D9TA 3Q4ZA 4DFNA 5KKRC 4D58A 2ZAZA 1XO2B 3WF6A 2UZEA 2RG5A 4MWIA 1KV1A 1PJKA 1STCE 4L45A 1Y57A 1FGKA 5HOAA 4DH1A 4PPBA 3DQXA 4QTBA 2YCRA 2ZMDA 4ANQA 2VTLA 3LQ3A 3FZOA 5H3QA 2H9VA 3GU5A 5HE0A 3OWPA 2OXDA 3WARA 4CGAA 2VWBA 3QWJA 3C7QA 4G17A 3RKBA 5GJFA 4MD9E 5A6OA 3ZM9A 4FG7A 4E4MA 5KNJA 3UODA 3F66A 4MF1A 2YIXA 2ITYA 4PWNA 4ANOA 5IUGA 5JQ5A 3RK7A 2ITNA 2OH0E 4M84A 4IHPA 3G9NA 3P78A 3CD8A 4IBMA 4IJ9A 4L7SA 4M0YA 4O96A 3QCQA 5CXHA 2UVZA 5DR9A 3TIYA 2VZ6A 3COMA 3F7WA 5EQPA 2YJRA 2BRGA 3KF4A 3KRXA 4Q5HA 4WD5A 3EKKA 5HE1A 3Q52A 3UIUA 3VUKA 4YTFA 2PUPA 5AFVA 2OF2A 3DY7A 4MXZA 4E4NA 4EUTA 5ACKA 4QMPA 2GFSA 5L8LA 2UW4A 3PFQA 1HCKA 4JIKA 3EHAA 4M7IA 3LM0A 3FXWA 3ANQA 3PY1A 4FTRA 1Q3DA 5ETFA 2X2LA 3D94A 4D4RA 3W8QA 5GZAA 4FX3A 4AF3A 1JSTA 1V1KA 2CDZA 4ZY6A 3UP7A 1G8SA 4XG8A 2X4ZA 4FKRA 4O27B 4FOBA 1K2PA 1XQZA 1XH7A 1FQ1B 1XH4A 4FSYA 4O0WA 5J7HA 4L53A 4FC0A 3EQPA 1XJDA 3CY2A 4PNIA 1QMZA 4AFJA 4IB1A 3LJ0A 3FUPA 1JVPP 2Z60A 4FNXA 4Q5EA 2X8IA 4WA9A 3E63A 3BU3A 3HRFA 3E3PA 3IW8A 3QQHA 5EOBA 5BUEA 2Z02A 5HD7A 5L6OA 5J9LA 3BQRA 5IPJA 3R8ZA 1DI9A 3KKVA 5FQDC 3TJCA 4C2VA 3OWJA 2F7ZE 3SA0A 4DT9A 2OI4X 4PMMA 5D7VA 4AE9A 3MPTA 4O81A 4K11A 4FT7A 1U54B 4NU1A 3R2YA 3HLLA 2RSVA 4K77A 3ZLWA 2R5TA 3NUAA 1ZLTA 2NPQA 3OHTA 4CMTA 4QMTA 4E26A 3ZRKA 4OGRA 3V5QA 3GC0A 4BN1A 4APPA 4D2RA 4EK4A 2J0LA 5E91A 4L44A 1WFCA 3VUIA 4A4LA 2V7AA 1BX6A 2B9HA 4NM5A 3NMUF 4FI1A 2YAAA 1Q8YA 3VHKA 3FI4A 2PPQA 2J90A 4JRVA 4XLIA 4A9SA 5FLFA 5CYIA 3CTHA 4C57A 5KZ0A 3GT8A 5KMIA 4FZFB 5ANJA 3U4WA 5LVMA 4BHZA 5BNJA 4EQCA 3PZHA 4U41A 4HCTA 4IM3A 4D2WA 1OIUA 5T6KA 1YHSA 3CKWA 3VBWA 1NVSA 1YWRA 3FYJX 3P08A 3P7BA 5M07A 4NIFA 1SYKA 2IO6A 2WOTA 4LRKA 4PV0A 2C69A 4NUSA 5M4IA 1XH5A 4G3GA 2JBOA 5CSVA 3ZFXA 1QPJA 4FVPA 5C8MA 3MBLA 3EN9A 2UW5A 4BF2A 5D12A 4IZ7A 3Q2JA 1LUFA 5HVKA 4EUUA 4C4HA 5LJJA 1YWVA 2G2HA 3FKNA 1ZOGA 4RRVA 3NGAA 3L1SA 3OY3A 3ZXZA 2CKOA 4FTAA 4EKLA 5JZJA 3JVSA 3DK3A 5KO1A 4FIEA 4GK4A 4CYIA 4DT8A 3RM6A 3A61A 3R2BA 4G2FA 4JAIA 4M12A 3A60A 1IR3A 2PVNA 2W4OA 2X7OA 3IGGA 4WUNA 5HCZA 3H30A 5DRBA 4HYUA 3FPMA 5FM3A 4ERWA 4A9RA 3PJ3A 4GKIA 4YZBA 4WNPA 3AMBA 5E1SA 3CLYA 4EONA 4MXAA 3GCUA 4LL5A 3R04A 4TT7A 5H8GA 5HO7A 1BL7A 5J9ZA 1KWPA 4IB3A 3TNHA 4AG8A 2PE2A 2BFXA 3BE9A 5AUXA 3GI3A 3V3VA 2YM4A 3K5VA 1H1PA 5ETIA 4BYIA 2JDOA 4M8TA 5A6NA 3IQ7A 4A06A 2XEZA 4FYOA 3NSZA 3NAYA 4CFWA 2WQNA 2FUMA 1FINA 3QC4A 3QF9A 4GG7A 2WELA 3FMNA 4YBKA 5CNNA 3QU0A 1G5SA 3VNTA 4UN0C 2UUEA 4FBXA 1BKXA 2IVVA 5FP6A 4XBUA 4FV0A 4KABA 1JSVA 5H9BA 2WMAA 3MH3A 4C0TA 2YM5A 2R3IA 2CMWA 4C61A 3FL4A 5CSHA 5EHLA 3R9HA 3U4UA 4WOVA 2ZM3A 5CENA 2PL0A 3DBDA 3TJDA 3KXHA 4ACCA 1M17A 4W9WA 5T3QA 4ZJVA 3EFLA 4HVIA 2C30A 4CKRA 3WBLA 4O0TA 3JPVA 3F2AA 1MP8A 1H07A 4YZCA 5I9XA 4I20A 1FGIA 3FMJA 3GB2A 2JFMA 3G51A 4FKGA 1OECA 4KD1A 3LZBA 4IZ5A 5IA3A 3EH9A 4GS6A 2XEYA 2PMNX 3MFTA 4ID7A 3VIDA 5K4JA 1KSWA 4MNEA 3S3IA 4PPAA 3G0FA 3L9LA 4U3ZA 4PF4A 5HIBA 5IA1A 3PJ8A 4JQ8A 3D2IA 3IW5A 4IAFA 4M69B 3DKGA 4BC6A 3HP2A 1IAJA 4EC8A 1QPCA 4DBNA 4LGGA 3TIZA 4F7SA 3PSBA 4NT4A 4NW6A 4FTCA 4O91A 5J5TA 5IA0A 5AUZA 5C4LA 4I0RA 1ZYJA 1WVYA 4BIDA 4GSBA 4FTLA 4KIKA 5FG8A 4YTIA 3TWJA 2IZUA 2QOOA 4ZXTA 3L8SA 2PE1A 4DH8A 1FMOE 4QYGA 5KBRA 1PKGA 4EOIA 3OS3A 2YEXA 4Z16A 4RC2A 4UYAA 3E7VA 1BI8A 4S33A 4BHNA 2VO6A 3VS3A 1JPAA 4BTFA 4OR5A 4CNHA 4W9XA 4I24A 2XF0A 4N0SA 3U6JA 4C3PA 5BUJA 3JVRA 1J7UA 3ACKA 4M0ZA 4RWJA 5CU0A 2OICA 2YFXA 4U7ZA 3C4XA 4YO6A 4PL3A 5LXMA 4PDYA 4MCVA 4H1JA 4DEIA 4E6QA 4BCIA 5CVFA 2UZOA 3QCSA 3QX2A 5EW3A 2ZM1A 3NNUA 5HCXA 4DH3A 4DFBA 5FWKK 3RPRA 3UE4A 3P23A 2V5QA 5E1EA 4IWDA 2GQGA 3WZEA 4C4EA 4Z9LA 4TKSA 2QKRA 3EN4A 4HGSA 4DITA 3A4OX 4DGNA 4DEAA 4Z7HA 3NUXA 2R3GA 2B9FA 4R1VA 3RJCA 4I1ZA 3BU5A 1S9IA 3NYOA 4FYNA 3LFDA 3NS9A 5DRDA 4DA5A 2W99B 3O96A 3B8QA 2UZLA 1CMKE 3UG2A 1R0PA 2CCHA 3CGFA 3DDPA 2C47A 2IN6A 3C50A 3LFFA 3VBVA 3OP5A 4E6CA 4ASEA 3FHIA 4O0XA 4CLJA 1H1RA 3VJOA 1XR1A 1PMUA 4O82A 4R3RA 3BE2A 4MNEB 4U9AA 4UZDA 1QPEA 2ZDTA 3WZUA 1WBOA 3G6HA 5IA4A 2OGVA 4XP3A 5BVFA 3KXXA 5DIAA 3VS7A 3V8WA 3C9WA 3ZDUA 3AGMA 2NRUA 4JI9A 3KRLA 5GIPE 5E8WA 2CN5A 4UWYA 2IW6A 2JAVA 5HCYA 4GIHA 4NM0A 5AIRA 3GCVA 2YLEA 3KN5A 4FV4A 2AUHA 2DWBA 3ZOSA 3KGAA 5AADA 1SMHA 4ANMA 5LMKC 3V5TA 3VAPA 1Y91A 4NFMA 4D9UA 4HZSA 3CXWA 3LFNA 3NVMB 4XRJA 5HESA 5HTBA 3AT2A 4X7QA 5HHWA 4CMOA 4QRCA 1M2RA 5BX0A 2X8EA 3SD0A 5K3YA 4F6WA 2F9GA 3F5PA 3HV6A 3R83A 5T68A 3D9VA 5EK7A 4DH7A 4NZWB 4FMQA 4YHJA 1U5QA 4CT1A 2V62A 3SRVB 3OEZA 3WZDA 4IJPA 3TUDA 1VYZA 4FVQA 4TZRA 5LWMA 3EWHA 1OI9A 3F69A 4OTIA 4XP2A 5A3XA 5M57A 4XEYA 2VWVA 3ALOA 2F7XE 3BZ3A 3MVJA 3QL8A 4MWHA 4OW8A 3PJ1A 4O1PA 4BDFA 2OFUA 3QX4A 4BCJA 2ITPA 4Z7GA 2R7BA 4HCVA 3DJ5A 4EOKA 4F99A 5A9UA 4EH8A 4EBVA 4C3RA 3BPRA 2R3JA 5CF6A 5E8VA 2J0IA 1JAMA 1GJOA 2UW3A 1PKDA 3BELA 3GFWA 4RIYB 4YTCA 4Q9ZA 5E7RA 3VBYA 2XIZA 5J1VA 2XNGA 3FLWA 4FODA 4Y83A 3T3UA 3D7TA 3ELJA 3LPBA 5KBQA 4IC8A 5AV2A 2QD9A 2P0CA 3QYZA 3ZRMA 2R3PA 2VTOA 4FT9A 2PZRA 3BRBA 4K6ZA 3ZTXA 4N57A 4O7VA 3R71A 2P33A 3R8UA 4HVDA 4C7TA 4D4SA 2VUWA 4UMTA 3TI1A 3WIKA 1BL6A 3EL8A 1H26A 1W0XC 2VWIA 2H8HA 4ZTNA 5A54A 4FV2A 2BPMA 4OTFA 5CEOA 3GCPA 5FDPA 5EYCA 2ETRA 2G1TA 1W7HA 2WTKC 4AGCA 4QPAA 4B9DA 2OG8A 4NH1A 4H36A 3FI2A 5I4NA 2NRYA 3F3WA 3V5PA 3ZU7A 4DGMA 3OCGA 4IANA 4DGOA 1CDKA 2BR1A 1B6CB 2B55A 2XK6A 2WAJA 4CLIA 5F95A 4IX6A 4ZLZA 3GXLA 4FKJA 1U5RA 5AV1A 4FV1A 3OOMA 1TKIA 3MA6A 3OUNB 5L6PA 4YHTA 5IEYA 3UNZA 3ZEPA 2VO0A 5BVWA 2HXQA 3UIMA 3GGFA 4WG3A 3ETAA 3D4QA 4S32A 4AFEA 1BI7A 3G90X 3NYXA 5KX8A 1ZOHA 2X6DA 4PMSA 3VUMA 1H8FA 3TV6A 3FWQA 4TWPA 4D5HA 4UX9A 2SRCA 3BBWA 3QZHA 3DV3A 1W84A 3UTOA 4QMWA 4B4LA 3R01A 1YOJA 4G3FA 1K3AA 3FSKA 3AC4A 4X6QC 5EM7A 4G6NA 2R3QA 5D41A 1GZKA 1VEBA 3MY1A 5ANDA 4AT3A 4AGWA 5HE2A 3HECA 4EZ5A 5CEQA 3UOJA 3GVUA 3H9FA 3UVRA 2WQEA 4FGRA 5CEKA 2VTHA 4XG2A 3EYHA 3ZONA 1PXIA 5I0BA 2UW8A 4Y72A 5CSPA 3Q4UA 1XH8A 5HBJA 2OZAB 3AT3A 3PA4A 3HDNA 4ZTHA 2AC3A 5AP4A 4DN5A 2J9MA 4RVLA 1YQJA 3ZO4A 3R7IA 3MIYA 5HVYA 4EHGA 4H58A 4U5JA 4IZYA 2OJIA 2WIPA 2F49A 2Y4IC 1O6YA 4EH3A 5KE0A 1OL2A 2ZB0A 5AIKA 4B0GA 4BTMA 4RJ7A 3NEWA 3ZH8A 1OKZA 2IJMA 3NRMA 4JDHA 1UA2A 3KN6A 4KS8A 4BZOA 2JGZA 4QMNA 4CZTA 3QHWA 2QHMA 4ZAUA 4JDIA 4G1WA 2HAKA 3ZBFA 1J3HA 4BCFA 1YOMA 4JX3A 4NKSA 5HG7A 3LFAA 2VTAA 3DAKA 3DDQA 4M14A 1F5QA 5L2TA 2JKMA 3OG7A 3P5KA 4G16A 2CGXA 4KAOA 3KMUA 4P90A 4QYEA 4DFYA 5JGBA 2WTDA 5IQCA 3R22A 4HOKA 3S1HA 4CQEA 3BKBA 3UPZA 1J1CA 2C0OA 4AW0A 3HA6A 4W4YA 3V01A 4FL3A 4H3BA 2BVAA 3R7UA 3REPA 4EOPA 5DHJA 3RINA 4UMPA 2WFYA 3PIXA 2RKUA 4JX7A 1ZZLA 3D5UA 3FI3A 2JBPA 2BHEA 5EW8A 4NM3A 3QAME 4UWBA 3UMXA 2QG5A 3WILA 1H08A 1JQHA 3E7OA 4EC9A 4P5QA 4RJ5A 2J5EA 3ZO2A 3RK9A 3N9XA 1H25A 1YKRA 3DKOA 4I5PA 2W1DA 3VHEA 4B99A 2I0VA 3CTQA 4ONAA 2VX1A 5LCKA 3NPCA 4C4FA 4DC2A 2WZJA 4I4FA 4ENXA 3V5LA 4ACDA 4IADA 5DG5A 2CJMA 4G9RA 5DGZA 5HQ0A 2HXLA 2DUVA 4XJ0A 1JKTA 5CALA 2CGUA 2QHNA 5HLNA 3LJ2A 3UBDA 3KFAA 4UBAA 4TYGA 4RIXA 4YJSA 4D1SA 5EHYA 2CKPA 3MJ2A 4XG4A 3MH1A 2VNYA 3VBTA 1M7QA 2OXXA 1H1QA 3OXTA 4GV1A 4CSVA 2AYPA 5HORA 5D10A 5AP0A 4FTQA 4DCEA 3EJ1A 4ZS4A 4FK6A 2B9JA 4TYEA 5CS6A 5BVKA 3BEAA 4BWKA 3TEIA 4QMQA 4A9TA 4PUZA 3RZBA 2E9UA 4YJUA 3WZKA 4XBRA 4YURA 3WIGA 1GIIA 4HW7A 3PDTA 4F7JA 4J99A 4BB4A 5JK3A 2C68A 4H3PA 3LCOA 1OKWA 4TYHB 4IW0A 3Q9WA 2OIDA 4ORKA 1WVXA 1YDTE 1IEPA 3L8PA 2XK3A 4ZSAA 4NYEA 4K33A 1DS5A 4EWHA 3I60A 2HYYA 3GQIA 3O7LD 1YXXA 2GSFA 5FD2A 2J0MB 3VUGA 4I93A 4RJ4A 4GK2A 4H1MA 1H0WA 4FV8A 2R3MA 3U55A 3NLBA 4RIYA 4TYIA 4BZDA 2IW9A 4UEUA 4ACMA 3Q9YA 2HCKA 3FYKX 3T8OA 4BCPA 3VN9A 4J1RA 4JL9A 5JRSA 3TT0A 4BVUA 5JFSA 2O0UA 3FQEA 4NKAA 3W8LA 2A4LA 3AD4A 1GZNA 4TYHA 4ZLYA 4I21A 5BVDA 1XHAA 4EH7A 3QQUA 4UYNA 4FSUA 4F0IA 1UKHA 3KVWA 4I6BA 2WMVA 4NTSA 4AE6A 4EOQA 2XYUA 4JJRA 4NW5A 4J8NA 5FEDA 1OL6A 2W1CA 2ERZE 1ZY5A 3SVVA 4JR3A 4GT5A 1JKSA 4BKYA 5EG3A 5IQHA 4AOIA 3OCBA 4GEOA 2PK9A 3ITZA 2Y6MA 5C01A 4DEBA 3ZUVA 4QQTA 3F5GA 5EQEA 3JUHA 4O0YA 4KRDA 3ZMMA 3UQFA 3SG9A 1PHKA 5F94A 2FYSA 3ACJA 1ZMUA 3NZ0A 3ORKA 4FTNA 2BAQA 3PVGA 4K18A 4AP7A 2CGWA 3PE1A 1UWHA 2UVXA 4IM0A 4E1ZA 2EU9A 4ZZOA 1URCA 2Y6OA 3QZIA 4HGLA 2X4FA 2XRUA 2RGPA 3IW4A 5CZIA 4BCOA 4YGAA 4HVGA 5E92A 4FKQA 4XG9A 2PUUA 2FA2A 1RDQE 4JS8A 2GHGA 2O3PA 5IA5A 3ZUUA 3IECA 4IMYA 1YRPA 3DOGA 1BMKA 2XIRA 4I6FA 4MBLA 5I5ZA 2PVHA 5FEEA 5DR6A 4JT3A 3MESA 5A4LA 1OPJA 4EWQA 3CKXA 4NSTA 4O0UA 2YZAA 2ONLA 2QG7A 4V04A 3RAHA 5GJGA 4FIGA 5AP1A 1GZOA 1SVEA 4DGGA 5FTOA 1M7NA 3LFQA 2I6LA 3TXOA 4A4XA 3H0ZA 3SX9A 3VBXA 3FJQE 3B8RA 4GT3A 3PA3A 4FA2A 4I0TA 3HP5A 4JBOA 2C6KA 1UNLA 4AT5A 3MV5A 2JDTA 3GOPA 2Z7RA 3FAAA 4O7ZA 3ODYX 5IA2A 2HZ0A 2O2UA 4IVCA 4NL0A 4NFNA 2UZBA 5AUYA 2GS7A 2J51A 4GG5A 2F4JA 4OTPA 3TV7A 3JYAA 4XYFA 2YM8A 4EL9A 5A4QA 4YC8A 2UW0A 2WXVA 3KK8A 2XKFA 1FOTA 1F3MC 3O50A 5CF8A 2YDKA 2PVKA 3KA0A 3QC9A 4KWPA 2GCDA 2JIVA 4CRSA 3DXQA 5DMZA 3W2PA 2OJGA 2PZPA 3DLZA 3KCKA 3MB6A 4YLJA 4TPTA 4ANLA 3V04A 2BZIB 3LVPA 3ZHPC 5L3AA 4KIPA 4U40A 1BYGA 2B53A 2XJ0A 3F9NA 3ORXA 2UW9A 5CEMA 4CG9A 3W2QA 2QOKA 1R0EA 2XIYA 5JFVA 3K2LA 4O22A 3JY9A 3MJ1A 4O7LA 3NIEA 4XH6A 4MXYA 5AAEA 3UJGA 2W7XA 4DFZE 3DCVA 1T46A 3RCJA 3R7GA 5IUIA 4PQNA 4ACGA 2JIUA 4USDA 1P2AA 5JT2A 2GFCA 3EKNA 4JNWA 2CN8A 4WBOA 1NW1A 5J79A 2E9PA 5FTQA 5CTPA 3TUCA 2BKZA 2C6IA 4EH2A 1TQIA 2XNNA 2WMSA 1LR4A 2QOFA 4FSQA 5M4CA 4MXCA 4WHZA 3TNIA 4EHEA 4C4IA 2PYWA 2BUJA 3NYVA 5K0XA 4YJQA 5TO8A 2QR7A 2PHKA 3MPMA 5HGIA 3QXPA 4ZTMA 4LQMA 2J5FA 2C5YA 4GK3A 3D7TB 4W8DA 3EQGA 4FTMA 3COHA 4GIIA 2OJJA 3ZSGA 4GH2A 3CD3A 3ZO3A 5IQDA 4YZMA 1Q24A 4S31A 3FMMA 3IS5A 2PU8A 3IG7A 3ORPA 4Q9SA 5HEZA 3UVPA 4QP3A 3FQSA 4E3CA 1ZXEA 4MBJA 5TR6A 5HLWA 3W2RA 5IZFA 2EXMA 3QTSA 4PMTA 3OMVA 4TW9A 4FSTA 5D9HA 3UZTA 1IAHA 1LP4A 2QO2A 2C6MA 2VWYA 3IDBA 3ENMA 3R7YA 4MBIA 1J1BA 1Q8ZA 2V0DA 3PY3A 4IX3A 2XNBA 4JXFA 4O2ZA 4YLKA 3RTPA 3UMWA 4LOPA 4C34A 3DAEA 1REKA 4R77A 3G6GA 4J53A 3M2WA 3ORTA 4ASDA 2XB7A 3HZTA 2P4IA 5LWNA 4WO5A 5EHOA 3PP0A 4GW8A 2E9NA 4J7BA 5CU2A 4YP8A 3AC2A 1R39A 2OF4A 3EN6A 3FMKA 2YWPA 4F65A 3CP9A 2GNGA 3DBEA 2CNQA 3EFKA 4F9WA 2PMOX 3DTWA 4OTHA 5CU4A 1MQBA 3NNXA 4RG0A 4D55A 3D83A 4F08A 3DFCB 3FL5A 5AR4A 4NTTA 4R7BA 5DEWA 3P1AA 5B2KA 3ID6C 3HUBA 4XOYA 4PTGA 3QQLA 4IB5A 4C3FA 5AUWA 2XIXA 2WMRA 2XCHA 3GQLA 5DN3A 4D5KA 2QONA 4FV3A 3UC4A 1UV5A 4GU9A 2W5BA 3IW7A 4E5BA 2XJ2A 2R4BA 3KF7A 2C6LA 2Z7SA 2X1NA 4WKQA 5HU3A 5EFQA 4USFA 4FEWA 4RA5A 2H6DA 3MI9A 4WG4A 4MF0A 4A9YA 2HY81 1YW2A 2XIKA 3PRIA 4M69A 2ZMCA 4N6ZA 4KKEA 5LVPA 4XRLA 2C3IB 4MK0A 2C6OA 5DNRA 5I3RA 4E6AA 4FVRA 3R1SA 4F1TA 2A19B 4V05A 4Y85A 1DAWA 3U8WA 3LXLA 5L2QA 4EORA 2C4GA 4N4SA 3CR0A 5CAUA 4QMUA 3DNEA 3UO4A 3MWUA 3HNGA 5AA9A 3LCDA 3BYUA 3POOA 1PF8A 4FOCA 1QPDA 1YVJA 4MKCA 5FEQA 1M52A 4XOZA 3LCKA 5HTCA 3QRTA 4TTHB 2BFYA 4FK3A 4C2WA 2QOCA 3DK6A 3C13A 4MHAA 1ERKA 3WE4A 3VQHA 1G8AA 2XKEA 3FZSA 4HYIA 4NCTC 4O6EA 4HJOA 4QYFA 4ZTQA 3QCXA 5AR3A 2V7OA 5EM6A 3AT4A 1E9HA 2G9XA 3V6SA 1O6LA 1ZYCA 4K0YA 4IWPA 1GAGA 3KRWA 2W06A 3DZQA 2XS0A 3FQHA 4BI1A 4WT6A 4QO9A 3MS9A 3COKA 3FY0A 1MRVA 3FLSA 4K2RA 1M2QA 3LE6A 4QNAA 4LRMA 3QQFA 1Q41A 1UU3A 4O7TA 3HX4A 1JKKA 4D4YA 3NDMA 4ZZNA 5C03A 2O5KA 3T3VA 4GKHA 4JDKA 4KIOA 1BLXA 2YWVA 1GOLA 3IO7A 2VD5A 3ANRA 1GIJA 3Q2MA 4D2PA 5LVOA 2WTIA 4NJDA 3GUBA 3GEQA 4BI0A 3F3UA 4J96A 1YI3A 4LOOA 1MUOA 5EH0A 2PZ5A 1FVVA 2VTQA 2WTJA 3EB0A 3QTWA 4KIKB 3FSFA 4RIOA 1YOLA 3TCPA 5CASA 3AC5A 3WYYA 4QP1A 5JFXA 2BAKA 4JQ7A 2R0UA 2WOUA 4CXAA 3O23A 3HUCA 3GBZA 3OF0A 2VTNA 2HZIA 5DVRA 4D28A 1DAYA 2C6DA 3WF8A 5KCVA 3ZBXA 3D5VA 3TN8A 2HK5A 5F1ZA 3ZFMA 3HMNA 4AACA 1JKLA 3ZC6A 3E8CA 4QP6A 1VZOA 5AM6A 5M08A 2WMBA 3AQVA 3BHYA 5FGKA 4FIFA 4LV5A 2LAVA 4PDSA 2BRBA 1OKVA 2WEIA 5JQ8A 5BVOA 3NNWA 2EB2A 3O8UA 3PLAE 4BDEA 1B38A 1Z5MA 3QUEA 4LG4A 5M56A 2PMIA 1A48A 3OZ6A 2OJ9A 3R8LA 5HIDA 4B7TA 3QTXA 4FTJA 2OIQA 3VWAA 3W2CA 2YA9A 5G6VA 2ONLC 4EOLA 4NJ3A 4DTAA 1AD5A 3MA3A 5J9YA 1T45A 2VTMA 1V0OA 4RBLA 3E5AA 3RNYA 2H96A 3F3VA 4BDAA 3ZLSA 1ZMWA 3BHUA 3RHKA 1PXPA 3HV3A 5JGAA 2YIWA 5HE3A 3TDWA 3NVKI 3R9RA 5CY3A 2OJFE 1R1WA 2G01A 4KS7A 3DT1A 4PPCA 4EHVA 1AQ1A 4C38A 4WIHA 3V8SA 3L9PA 4IM2A 1RJBA 2PE0A 3AD6A 3Q4CA 3LHJA 4XHKB 2YITA 4J71A 2YIRA 1KE6A 4RIWB 4BL1A 4IAZA 5AMNA 5A4TA 5HKMA 1YDSE 2C1BA 5ETAA 4FIHA 5CU6A 4NM7A 5E8YA 3AMAA 3UZRA 3L8XA 2ZV2A 4NEUA 3PP1A 4AN2A 3HRCA 2UZTA 3DXPA 4LRJA 3PUPA 3IOPA 3CQEA 3M1SA 5CI6A 5AX9A 5KMNA 4C35A 4V0GA 1UNGA 4IVAA 1XKKA 2QLUA 3BHTA 4C4JA 5E8XA 3B2TA 4FKLA 4EYMA 1YWNA 4UMRA 4ZJJA 5H8BA 3THBA 4DINA 1XH6A 3Q6UA 2LGCA 3CIKA 3A8XA 2HY0A 2OBJA 4L6QA 4RWIA 4USEA 4EOOA 2O64A 2Y4IB 5B7VA 2Z2WA 5CT0A 1FBNA 3QD3A 3ULIA 4ANBA 3V5JA 1SNXA 4PRJA 4PX6A 4W8EA 3O71A 5FDXA 4L3PA 2QNJA 4UZHA 2WTVA 3PE2A 2R9SA 5K0KA 1PW2A 3RAWA 5DYJA 4DCAA 4FZ7A 1WVWA 3FLQA 3CGOA 4I22A 4XG7A 4XLVA 1Q8TA 4OBOA 1WBTA 4BTKA 4I4EA 1PY5A 2FVDA 3KULB 5AR2A 4YMJA 3BEGA 3F61A 2RFSA 2OW3A 2VWXA 2WO6A 3ZO1A 4W4WA 4F9AA 1ZRZA 2VO7A 1PXMA 4WRGA 3KXNA 3R1NA 3OY1A 3W16A 3PG1A 3WZJA 4U45A 3IDCA 3W2OA 4Z55A 1S9JA 5BUIA 3SW7A 1LPUA 4RLKA 3EOCA 1LEWA 3P9JA 2IG7A 2CCIA 2B4SB 3ZLXA 4AZVA 4D0WA 2WD1A 5A4EA 5HVJA 4LYNA 4WNMA 5M4FA 3U54A 5HLPA 3KRRA 2J0KA 4JBPA 4MEDA 4EKKA 2ZDUA 4C58A 3CTJA 3ZLYA 5C8KA 5EM8A 3FC1X 4FG9A 3F5UA 4A7CA 2XA4A 2WTKB 4M68A 1L3RE 4LUDA 3C0IA 4BCGA 4R1YA 4K8AA 3HVCA 4C59A 3ZDIA 4D2VA 3CS9A 4FTIA 4F7NA 3UYTA 3Q32A 5HG8A 3ET7A 3WE8A 3UGCA 3FLYA 2XUUA 4LOQA 4FE2A 3QCYA 2QOLA 5DA3A 5DT4A 3GC8A 4OAVB 2REIA 1Q62A 3KMMA 5KHWA 5EM5A 3UDBA 5C1QB 4RX8A 3MH0A 3OVVA 3OCSA 4AOJA 3QKLA 4A9UA 1ZOEA 4ALVA 5IH6A 4LFIA 2F7EE 2IVUA 2ESMA 2VX0A 4TNDA 4EOSA 2IW8A 2B52A 2BIKB 3NUNA 4O6LA 3C1XA 3VBQA 3QKKA 2W9FB 4FEXA 3PXZA 2O8YA 1NVRA 5HG5A 3R7EA 1NXKA 2GQRA 3G2FA 4H05A 3TZ9A 2WIHA 2QU5A 4EH5A 2ITVA 3SG8A 3QUPA 4IFCA 4EH4A 4BDJA 3FDNA 4OTGA 4UXLA 3OEFX 2OK1A 5HIEA 2GTNA 5AP2A 2BHHA 4TWOA 4FUXA 4EQUA 3RBWA 1NVQA 4CCBA 2VAGA 5HBEA 3ZUTA 3EN5A 4CFUA 3MY0A 4BCNA 2VU3A 5CWZA 1WBPA 2UZVA 3MVLA 4FKOA 3E8NA 4BCMA 3R6XA 3HGKA 4PL4A 4BWXA 2WGJA 4AZSA 4FIJA 5IH5A 4IQ6A 2BIYA 2DS1A 4HGTA 3F82A 5GINE 3Q96A 2W1IA 2X8DA 5FBNC 2OH4A 2CNVA 2YISA 3OBGA 3SC1A 1PMEA 4YZ9A 5CQUA 4GVAA 4QQCA 5AP7A 3FZTA 4U42A 3BYMA 3F3ZA 2G15A 3QWKA 3UZPA 1P4OA 4IX4A 4KBCA 3VJNA 4KBAA 2ITTA 3HAMA 4N6YA 4ZOGA 1OBDA 4FSRA 2B9IA 3A7GA 5DT3A 3FMEA 2BDFA 4X2KA 2HZNA 1JOWB 3MFSA 1PXNA 2R3FA 3M11A 3EFJA 4QP8A 3ODZX 4OBQA 2A27A 5HO6A 3QRUA 5CSXA 3NUPA 2WMUA 4OUCA 2W5AA 5AR8A 3RWPA 3QD2B 3KULA 1PXOA 2C0IA 2XBJA 4M13A 4U97A 5EQYA 1OUYA 1WBVA 4BICA 3EL7A 5KMJA 2QOBA 4F1MA 4XG6A 4KB8A 4FR4A 3BLQA 4ITIA 2YCFA 2GU8A 3RCDA 4U0IA 4IDVA 3DNDA 3F7ZA 4U8ZA 5F4NA 3U51A 5HNIX 3TDVA 3MPAA 2J4ZA 2JKKA 4UB7A 3FZRA 4CTBA 4BDBA 4YJTA 2JDRA 3DJ6A 3CQUA 3TTJA 2KTYA 2RFEA 1FMKA 3NYNA 4KRCA 4BBFA 3TNWA 5B2LA 3FY2A 3GU4A 3VQUA 4YZDA 1DM2A 2RF9A 4LV8A 4CFNA 4DHFA 2GPHA 2VRXA 1IA8A 4ANSA 1KE7A 3WOWA 2HWPA 2QR8A 1H1WA 3MVMA 4EYJA 4O7SA 5IISA 3PSCA 2IZTA 2R0IA 2W0JA 4QQJA 2GDOA 3VUHA 5IEVA 2W05A 4G3EA 5AJQA 4E4LA 4XS2A 1YHVA 3MW1A 4U81A 2I7QA 1OITA 3KC3A 1YXSA 2EVAA 5AUUA 4C37A 5KZIA 2C6TA 4J98A 3A7HA 4BZNA 5CZHA 5E90A 4RVTA 3BQCA 4QNYA 4E8AA 4UALA 3I81A 5DFPA 3GCSA 3NUUA 4RC4A 4F6SA 2B0QA 4C8BA 4YZNA 4HYSA 3TNPC 5E8ZA 2YIQA 3E64A 5CVGA 3ZYAA 5HBHA 3O51A 5K5NA 5L2SA 4FTOA 4KSQA 4WNKA 4RX9A 4I0SA 3IOKA 1R3CA 1SVHA 3EFWA 2PVJA 2WPAA 1UNHA 3SDJA 3RHXA 5IF1A 4IAIA 4C36A 5I9ZA 1U46A 4CKJA 1W83A 4RIWA 3H9OA 2BRMA 3A7IA 4U44A 4EEVA 2YCQA 3L9NA 2OIBA 2VTRA 2EB3A 3D0EA 3D14A 3Q04A 4GYIA 4IAAA 4BGGA 3LAUA 5HO8A 2RL5A 4IE9A 4RZVA 3C0HA 3N4VA 5ANIA 4TWNA 2ZV8A 1WZYA 5M09A 3WF7A 3PJ2A 2WKMA 2R3RA 1Q5KA 4QMMA 4U80A 5AR5A 4ZZMA 4AZWA 1KE5A 2E2BA 2BALA 3DKCA 3QGWA 4Y5QA 5D11A 5AP5A 4ZSJA 4O7WA 4KKHA 3G33A 4GJ3A 1AGWA 2Q0NA 4O2PA 2EXCX 4TNBA 5F20A 2YACA 4EH9A 4D2SA 5E4HA 5BVNA 3NW5A 5JFWA 4QMXA 4H39A 2GHLA 3ORZA 3CPBA 3R21A 2F2CB 4QTEA 3DGKA 1I09A 4CKIA 2BAJA 3FC2A 3HV5A 2DYLA 5C8NA 1RW8A 1H0VA 1H4LA 3W10A 3R30A 5ITAA 3UNKA 5CEIA 2XK4A 3LM5A 4O21A 2VTJA 2WHBA 4QMSA 3EQBA 4G3CA 4JIAA 4CZYB 4HVHA 2XNOA 1A06A 2YERA 3LXKA 3R1YA 4FICA 3QFVA 2BRHA 3WI6A 4FSNA 2J6MA 4EH6A 5IQEA 2ZV7A 2W1HA 4UWCA 5DOSA 4DGLC 3CJGA 3C51A 4AA0A 2OLCA 2VTIA 3FE3A 3P4KA 4L00A 2OZAA 4QTDA 4RWKA 5BYLA 1Q8WA 5KHXA 3FLZA 2R3NA 2YM6A 3KXGA 3PVBA 3VW6A 5HI2A 5LMBA 4UXQA 1Q97A 4KA3A 4EK5A 3F2NA 3UIBA 2J50A 3I0OA 4G5PA 4R5YA 3LMIA 3KB7A 2ZB1A 2WMWA 4QD6A 3VO3A 2HWOA 3BWFA 3VUDA 3L9MA 4ARKA 2E9OA 2ERKA 5HNBA 4BGHA 5CAQA 4WNOA 1RQQA 3Q3BA 5DEYA 2X7GA 3I5ZA 3LJ1A 3TKHA 3QYWA 3PSDA 4O0SA 4CTCA 4AZEA 3UYSA 5KMMA 3Q4TA 3ZC5A 4HCUA 1X8BA 5EDQA 4GL9A 4IX5A 3ATSA 2VWUA 5TOZA 3NUYA 2VN9A 4IAKA 5AV4A 3UIXA 4ACHA 4B8LA 3RK5A 5JZNA 3ROYA 3P79A 4MTAA 4X0MA 4BR3A 3LLTA 2YJSA 4FZDB 2ACXA 4NK9A 4FGBA 4QP2A 3MFRA 4G9CA 4TN6A 3W55A 4FV7A 4WSQA 2W96B 4OT5A 5BMMA 5IQGA 5ANGA 4TL0A 4IFGA 2J2IB 4QQ5A 2F2UA 3DKFA 4YJNA 2WU6A 1CKPA 2ZYBA 3DB6A 2FGIA 2Z7QA 3Q5ZA 4HPUE 3UQCA 1IG1A 2YCSA 5IH4A 5JN2A 4UMQA 4ZTSA 4CMUA 3PWDA 3DS6A 3NR9A 4XNEA 4CQGA 4RT7A 3OC1A 4CCUA 4O84A 3AC1A 4FV6A 3ZFYA 3ZXTA 2C5VA 2R3LA 4J97A 2FSLX 5HICA 2YDIA 1GIHA 5EOLA 4F70A 2RFNA 4AU8A 4CFMA 4GMYA 4F4PA 5M06A 1VR2A 3CQWA 5LMAA 5IMEA 4RJ3A 2PMLX 5H8EA 3QTIA 5CVHA 2BDWA 3VULA 2OKRA 4I92A 3FPQA 2XH5A 4MD8E 1PRYA 4G6LA 3FEGA 4ZEGA 3DJ7A 4X2NA 4BIBA 4FSWA 3KCFA 1SVGA 4F1OA 5JRQA 5L2WA 2BDJA 4AZFA 3PWYA 4HNFA 4MVFA 3W33A 3R1QA 4XP0A 3R02A 5JKGA 4RPVA 3GNIB 1OL7A 2CHLA 3RP9A 4HGEA 5EKNA 4I23A 3HL7A 5L4QA 5FTGA 2UW6A 2I0HA 3ORLA 5FXSA 2GTMA 2VWWA 4FT0A 2YZLA 1PXJA 1OIQA 1ZARA 4ZS0A 1IA9A 4P7EA 5CT7A 3VC4A 2JFLA 2UV2A 3I6WA 2WTCA 5KUPA 4YBJA 2JITA 2JAMA 1UKIA 2JKQA 3EQCA 2WNTA 3HRBA 3OT3A 2YLFA 4YTHA 5FXQA 1YXVA 3TZ7A 4CYJA 5AUTA 4QMZA 1UVRA 2X2MA 3GU7A 2YIYA 3KEXA 4AT4A 3F3TA 5M44A 4YJVA 3ORIA 4X2GA 3ZZEA 5J1WA 4JBVA 1YXTA 2HENA 3P0MA 1Q99A 1TVOA 3SW4A 2R64A
chains in the Genus database with same CATH superfamily
1OL5A 5L8JA 2HOGA 1CM8A 2IVSA 2BZJA 4U43A 5IQCA 5LVNA 3OTVA 4YC6A 4FSMA 4Y73A 3LW0A 3MYGA 5IDPA 2QO9A 4X3FB 4QP7A 4BCHA 2W5HA 3OWLA 5JMSA 3PPJA 4XV9A 4LV7A 4YU2A 4FT5A 2IVTA 4TXCA 4O38A 2I0EA 1OB3A 1CKJA 4MAOA 4PDOA 4JRNA 4FNYA 4BIEA 4KSPA 4DEHA 4WSYA 4DLIA 2XYNA 4XV2A 5F9EA 1JNKA 2VNWA 3P7AA 4DG0E 4GCJA 3OUKA 4DLJA 3G9LX 4XUFA 1UU9A 4DAWA 3QA8A 4XV3A 3AG9A 3NCGA 3O8PA 4XG3A 1K9AA 3RMFA 5BV3A 1REJA 4QDVA 3W0PA 5CLPA 3KK9A 4KNBA 4FL1A 2A1AB 5CSWA 2XZSA 4EK6A 2XP2A 3OTUA 5BYZA 2OZOA 3W32A 2HIWA 3JS2A 3K5UA 5ICPA 3ENHA 3R7VA 3O5AA 3DBQA 3R00A 5KMLA 4ITHA 3ATTA 2CLQA 3E8EA 4FG8A 5GNKA 4ZSLA 5M4UA 3KVXA 4BY9E 4GFOA 3OOGA 5DLSA 1EH4A 4PL5A 3KXZA 3VUTA 1Y8GA 5KMKA 3DA6A 4II5A 3N4UA 1H27A 2XJ1A 4GU6A 4F9BA 4LDTA 3BHVA 2GNHA 4LL0A 3NFGB 4O83A 4O4CA 3LMGA 3BL7A 2BTRA 4RZWA 4D4VA 3V5WA 4YO4A 3BWJA 3GENA 4P5ZA 2CKEA 2QQ7A 1Q8UA 2UVYA 4AA4A 4M66A 3QRKA 3OXIA 3G15A 2YM3A 4QT1A 3PYYA 3OWKA 4X21A 2VTPA 5M51A 3L8VA 3LCTA 1KE8A 5J5SA 3V51A 4OTRA 5CNOA 3IK3A 3U87A 2ITWA 3A4PA 4IAYA 2Z8CA 5AUVA 3I7CA 2HW7A 4IH8A 4MQ2A 3AOXA 3R0TA 2QURA 4MX9A 3TZ8A 3MB7A 2VTSA 3LFBA 2YABA 4ZY5A 4GVJA 1GNGA 2GNFA 4AN9A 4LM5A 3VS1A 3EYGA 4K1BA 4EJNA 4AQCA 5I9YA 1FVRA 5I9VA 5IQFA 3MN3A 3CE3A 3F88A 2PULA 2ZVAA 2C5NA 2ITXA 3PJCA 5EYKA 4FV9A 3CPCA 5CI7A 5IQBA 2R3HA 3W1FA 2W1ZA 3DTCA 1WMKA 4U3YA 3FMHA 3EMGA 4GT4A 3EQRA 1Z9XA 2P3GX 3SGCA 2NYAA 2C5OA 2P2IA 3DXNA 3C4CA 3O17A 4QYHA 5ACBC 1TQPA 1G8JA 4XMOA 4IIRA 3OXZA 1J7IA 1ZZ2A 3CBLA 4X2JA 3U9NA 4DF3A 5J87A 4QTCA 3BV2A 3M42A 3R9OA 3MH2A 1GZ8A 4O4DA 3QLGA 4JR7A 1WBNA 2OU7A 1PMVA 1SNUA 3HYHA 1KE9A 1OGUA 4LI5A 2ZJWA 3OFMA 4FT3A 3DU8A 3RI1A 5GHVA 3R7OA 4E6DA 1VYWA 4EZ7A 2QC6A 3RAIA 3QQGA 4X3FC 3QD4A 4ERKA 2XRWA 5LCJA 2RFDA 4ZJIA 1UWJA 4X3FA 2WB8A 2QLQA 2X6EA 3CJFA 1JBPE 1XBAA 4R7HA 1NY3A 3VW8A 5IMXA 4OTQA 3LKMA 4PY1A 3OW3A 1CTPE 4QMYA 5ETCA 5HG9A 3TV4A 3SOCA 1NT2A 4EK8A 2C5XA 3N51A 3AGLA 4F63A 5JH6A 1Q3WA 4BGQA 4O4EA 4D0XA 2WMXA 3HA8A 5DBXA 3PVWA 3TZMA 2Y4PA 3PG3A 3UO6A 4E20A 2OXYA 4O7RA 3DB8A 4PTEA 2ZV9A 3FLNC 4YC3A 1OIYA 2O63A 4EK3A 4L68A 5GZ8A 2CNUA 1KOAA 3E8DA 3ALNA 5HU9A 3A7FA 4NCTA 2VTTA 3P7CA 5J8IA 2Y9QA 3PTGA 1FVTA 3LIJA 1U54A 4AGDA 4RFZA 3E87A 5EKOA 4WRSA 2GNLA 2KULA 2PVLA 4RQVA 3RPYA 3VVHA 5K5XA 3NW7A 1QCFA 1CSNA 3MFUA 2J0JA 2NO3A 4FNZA 4ZY4A 3RWQA 2PVFA 4BDDA 2EUFB 5CF4A 4CRLA 2VX3A 4BRXA 4F9CA 4D2TA 4OT6A 2OSCA 2GS2A 4WUAA 4MD7E 1URWA 2XK7A 3MSSA 3FXZA 3ZM4A 5AA8A 3O2MA 4AX8A 4I3ZA 3TACA 4EI4A 3LLAA 5D1JA 4HNIA 4LGDA 5DWRA 3HDMA 1Y6BA 4M15A 1ND4A 4O0VA 4YUQA 1YXUA 3UDZA 1P5EA 1BUHA 3P86A 4L3JA 4KKGA 3TKIA 2W1FA 4BWPA 2C3KA 2PUNA 1H24A 5IEXA 3PY0A 3EN7A 5E8UA 5G1XA 5L6WL 2JKOA 4F78A 1ZAOA 3B2WA 3S00A 2GNIA 3VS4A 4Y95A 2BCJA 2FH9A 2VGPA 4BBEA 4BKZA 2JEDA 3HV4A 3MGYA 2UZDA 4CFXA 4EHZA 1OBGA 1R78A 3IPHA 4FEVA 3RVGA 1H1SA 4DEEA 4FKTA 3POZA 3BCEA 5TT7A 3VS5A 4AN3A 2VO3A 5CAOA 3TYKA 2A98A 4JG6A 3GFEA 3QLFA 3DPKA 3NAXA 2W9ZB 4YJPA 2QCSA 3RPSA 5A4CA 2V55A 5DT0A 4YJRA 3QZGA 2AC5A 5IQAA 4CV8A 3KL8A 4L3LA 3NWWA 4TY1A 5EI6A 2ETKA 3R9DA 4S2ZA 4WG5A 3VS2A 3O8TA 4BKJA 1ZYDA 1M2PA 2YM7A 1GY3A 5LMKA 4FIIA 5AEPA 4EBWA 2OO8X 1JWHA 1A9UA 2I0YA 3ROCA 3OW4A 4AW5A 4DEDA 3UVQA 3NIZA 4LMNA 3QGYA 4N70A 5FM2A 4LUEA 2YAKA 3CC6A 3OCTA 3H0YA 4TWCA 3V6RA 4C33A 2GS6A 4G3DA 4CFFA 4DTBA 2B1PA 3PLSA 4B6LA 4F09A 4DHJA 2FO0A 2W4KA 4CD0A 5L8KA 5GZ9A 4ZK5A 1M14A 3Q9XA 3QUDA 2WQMA 3H4JA 4R3CA 2F57A 2XNPA 5CAVA 4YR8A 1APME 4F0GA 5I9WA 5C26A 2UW7A 4OLIA 4BDIA 3QALE 3D5WA 2WTWA 4ASZA 3PA5A 4RX7A 2PY3A 3W18A 4DEGA 4O86A 4JLCA 1OM1A 3QBNA 2BRNA 4L46A 1HOWA 3GU6A 4FTKA 5CF5A 3FXXA 5CXZA 2CLXA 3ZS5A 1E1XA 1KUTA 3HKOA 5J7BA 3UDTA 4MYGA 3H9RA 3C4EA 3ORNA 2X7FA 2A0CX 4PP7A 3QQJA 3OD6X 5FRIA 3Q5IA 1Y8YA 3BIZA 1F0QA 4ENYA 4ZMFA 4G6OA 3TL8A 4C02A 4EZ3A 3KREA 3W2SA 3R8VA 3WF9A 3Q53A 3EQHA 5I3OA 5E9EA 3HEGA 4GFGA 2BILB 2Y8OA 2ITUA 4E4XA 4QOXA 4AWIA 3N4TA 2G2IA 5AP3A 5BVEA 5JEBA 4ALUA 3NX8A 3GP0A 2QOHA 3QRIA 5LARA 4R8QA 3PPZA 5ANEA 3QRJA 3ZRLA 4BDKA 3O0GA 3ZSIA 2CKQA 3I1AA 5KMOA 4V0GB 4BTJA 4PDPA 1JSUA 4APCA 2IZRA 4RVMA 2CGVA 1P4FA 5FP5A 4E5AX 2HZ4A 4AA5A 3PXYA 3HAVA 4DH5A 4K9YA 3EIDA 2QOQA 1Q61A 1W98A 3CEKA 3UP2A 3BHHA 4DG2E 1OKYA 5AAGA 5IU2A 2NP8A 1O6KA 3I0QA 3SQQA 2BKKA 3K54A 4ALWA 5D7AA 4F9YA 5IG1A 2YDJA 2WQBA 3BLRA 4L7FA 3MVHA 3KQ7A 1IRKA 4RLLA 1UU8A 2QODA 4FL2A 4QP9A 3UOKA 3AKLA 4ZIMA 3NNVA 1TQMA 3E93A 3OT8A 3UOHA 3VF9A 4W4VA 3H3CA 4MXXA 1JLUE 5A46A 3FI8A 5B2MA 4JG7A 3R8PA 4O1OA 4FEUA 3F5XA 3LFCA 3FKOA 2XK8A 5DR2A 3EQDA 2XNMA 3DBFA 4JVGA 3BU6A 4FKPA 2XM9A 3A8WA 1V0PA 3ORMA 3DK7A 4U79A 3O7LB 3QTQA 3PRFA 3LQ5A 2B54A 3D2KA 3Q6WA 4ANNA 4IXPA 5TKDA 4GYGA 3UG1A 3MIAA 5HD4A 4I6QA 5C27A 3F2RA 3TKUA 4FSZA 4R3PA 4HYHA 5DH3A 4OTWA 5HX6A 4XX9A 1OZ1A 2PVMA 2XVDA 4CT2A 4YPSA 3LMHA 2C3LA 3LXNA 3VS0A 4TYJA 3PIYA 4G34A 3KXMA 3RM7A 3II5A 4L67A 2WMQA 4AUAA 3FMLA 3W0SA 1OPKA 5CEPA 3TG1A 4EQMA 4YNEA 3S95A 4F64A 3UNJA 4NWMA 4OAUC 2X2KA 3BYVA 4GUEA 4RSSA 1HCLA 1XBCA 3HV7A 3TUBA 1XBBA 4YPDA 5EYMA 5I9UA 1YDRE 3JY0A 4MH7A 1ZYSA 3SAYA 1VJYA 1OMWA 3MY5A 3U9CA 3ZCLA 4F6UA 5FUTA 2VWZA 3AXWA 3EQFA 4QP4A 4X6RA 4X2FA 3E88A 5JGDA 3PPKA 1ATPE 2WMTA 2R2PA 4AXAA 2JLDA 4PP9A 2Q83A 2JIIA 4NIFB 4A07A 3BV3A 3GU8A 3IDPA 3ZEWA 5AAFA 2J7TA 3RALA 2O65A 3FBVA 2XMYA 4IWOA 2JC6A 5CQWA 3KMWA 4UMUA 4JDJA 1L8TA 5DPVA 2ZOQA 1XH9A 3I7BA 3IGOA 3LFEA 2X39A 3Q9ZA 2BROA 5LOHA 4L52A 2XBAA 4QMVA 1H00A 2QU6A 4EOMA 4FEQA 4O7NA 3LQ8A 1MRYA 4FKVA 3BX5A 3DZOA 4FKIA 4XCUA 5AWMA 4FJVA 2I1MA 3PXKA 4FUYA 3QHRA 3LXPA 3EZVA 2WQOA 3SXRA 4JMQA 1PXLA 4QPSA 3Q60A 4GUBA 4Q2AA 5TE0A 2IPXA 2BMCA 4J95A 4RWLA 5C9CA 4YSJA 3C5IA 4CG8A 3I5NA 4FF8A 3SV0A 4FTUA 5FBOA 3DAJA 1PYXA 2WEVA 3G5DA 3JXWA 4IVDA 2QVSE 4IEBA 4JG8A 2EWAA 2ITQA 2XKDA 1ZY4A 3RPOA 3T9TA 4D1ZA 1WBWA 4FV5A 3VRZA 4CFVA 4IDTA 3FV8A 3FHRA 1DI8A 3MTFA 3UC3A 1U4DA 4BCKA 5H2UA 3A99A 1V0BA 3K3IA 1IASA 3SXSA 2I40A 3CSVA 3KRJA 3TNQB 1I44A 2ETMA 4OTDA 1NA7A 3I6UA 4I5HA 2GNJA 4QTAA 4RX5A 4ZSGA 2C0TA 4GRBA 3K3JA 3C4WA 3IKAA 4L01A 3EQIA 3F6XA 3FZPA 4BI2A 2QO7A 3C5UA 4Z3VA 5K9IA 4W4XA 1E1VA 3R63A 1W8CA 1ZMVA 1J7LA 2YN8A 3S4QA 4J8MA 4M67A 3PXFA 5EDPA 5M55A 2X9FA 3R28A 3QTRA 4AW2A 4KIQA 3VF8A 4ZMEA 2JDSA 3SKCA 5EW9A 4JBQA 3W0QA 4O0RA 3UPXA 2CSNA 5LQFA 1P14A 1KOBA 2R3OA 4E93A 3UDSA 4M97A 3BI6A 4IC7A 3PVUA 2PVYA 4UV0A 1J91A 2XALA 4BFMA 5HX8A 3V8TA 4RQKA 5AV0A 2X0GA 1KV2A 5FXRA 3SRVA 3R9NA 3UOLA 4EJ7A 3E92A 2A2AA 3SXFA 4Y46A 3UO5A 4YSMA 2W4JA 3BGZA 4CV9A 4I5CA 3RPVA 2FSTX 4RIXB 5E8TA 3EZRA 4I5MA 4RGJA 4AP7A 4BBMA 2QKWB 4FNWA 4L8MA 2PUIA 1SM2A 5AX3A 5IDNA 3BYOA 3D7ZA 3RAKA 4JQEA 5AM7A 2H34A 2ITOA 4ZSEA 4IZAA 4L42A 2G2FA 1H28A 4D1XA 3HMOA 2QI8A 3MTLA 4ZLOA 5E8SA 4E73A 5K4IA 3HMPA 2C1AA 4JOAA 2PZYA 4LMUA 4KUJA 3NW6A 3BGQA 4Y8DA 3SHEA 4FKWA 2B7AA 3AD5A 3GC7A 3DQWA 4HVSA 3QA0A 2PVRA 4KBKA 4DFXE 4L43A 3DLSA 2HW6A 3PZEA 2XM8A 2XK9A 2GHMA 2WU7A 4C62A 5CU3A 4AOTA 3HMIA 4LGHA 3PXRA 4IVBA 4MQ1A 4RFMA 4RJ6A 4BDCA 5IUHA 5KKRB 5AV3A 1RE8A 4BJJB 4P4CA 3OROA 4C4GA 3I4BA 3PXQA 3BYSA 5J95A 3ERKA 4QMOA 4AW1A 1Y6AA 1YI4A 3VS6A 3WF5A 4BYJA 1FPUA 4KINA 4G31A 4IWQA 4CZUA 4I41A 3GCQA 4IACA 3G0EA 1W2DA 4QPMA 4YHFA 5HZNA 3S2PA 1OVEA 1MQ4A 4IB0A 4XV1A 2FB8A 4FKUA 2VGOA 4ITJA 1WAKA 3SLSA 3FZ1A 4GJ2A 2IZSA 4G5JA 5BQ0A 5DE2A 2FSOX 2W17A 4S34A 3DBCA 3QQKA 4OBPA 4UY9A 5M53A 3LCSA 3QTZA 4P2KA 3D5XA 1XWSA 5ANKA 2OFVA 3A2CA 4WBBB 2RG6A 3QKMA 2IWIA 2Q0BA 2GMXA 1OPLA 3H10A 5CANA 2DQ7X 3TM0A 5A14A 4MNFA 3E3BX 3QD0A 2GQSA 2C6EA 3ZSHA 1H01A 1Q4LA 3IONA 3T9IA 4YNOA 5L2IA 1UU7A 5EDRA 3UQGA 1ZWSA 1YI6A 3CCNA 2X9EA 4YJOA 5JSMA 5HTIA 4ASXA 2ZM4A 2BZKB 3QXOA 3QZFA 4J52A 3ULZA 5IQIA 2FSMX 2RIOA 2EXEA 2PTKA 3R73A 4U6RA 2BZHB 4R5SA 3A7JA 3NCZA 4HPTE 5CX9A 1QL6A 5BMSA 2VV9A 2XNEA 4QMLA 2XKCA 4V01A 3IW6A 1MRUA 3TTIA 1PYEA 2P55A 3GOKA 4F7LA 5C4KA 2CPKE 3LOKA 5AP6A 4S30A 3C4ZA 4X3JA 3VRYA 2BTSA 2W1EA 4R7IA 3CY3A 2NNWB 2P2HA 2Y7JA 4FZAB 1B39A 2HELA 2W1GA 3A62A 3AC8A 4CVAA 4DBXA 3U6HA 3MDYA 4JAJA 4RMZA 2JD5A 3PIZA 3JR1A 3BLHA 4PTCA 1W2CA 5DI1A 2C3JA 1W82A 1YHWA 3GC9A 4AAAA 3BBTB 4R6VA 4RVKA 3HMMA 4Y5HA 5GJDA 4CEGA 1U59A 3I79A 3WYXA 5LVLA 1WBSA 1SZMA 2XCKA 3KY2A 3R8MA 4EOJA 1OIRA 4DE4A 3NUSA 3COIA 2X81A 4I94A 4RC3A 1WCCA 2ITZA 2Y0AA 4QYYA 3FKLA 1PMNA 4FTTA 2JDVA 5TF9A 3RNIA 2V22A 1Z57A 5HNGA 4BCQA 4PMPA 5CAPA 3C4FA 4R78A 2OWBA 5GIOE 2UZUE 2PWLA 3AMYA 4A4OA 4YLLA 4E7WA 3S0OA 2R7IA 5BPYA 1ZYLA 4ZP5A 2UZWE 4PNKA 3RGFA 3D15A 2PSQA 4F0FA 1CKIA 5BYYA 4DFLA 4FZ6A 4E5WA 2R3KA 3ZZWA 5IKWA 3OBJA 2Z7LA 1G3NA 1OL1A 4RFYA 5EYDA 3U6IA 4L9IA 4B8MA 3BGPA 3E62A 5B0XA 4RA4A 3DFAA 4O7YA 2UZNA 4DFUA 4ZTRA 4BDGA 4FKSA 4AGUA 2YHVA 4AZTA 5EI8A 4DG3E 3KU2A 2E9VA 2QOIA 4DTKA 5ANOA 4MXOA 3QTUA 4ZTLA 3SOAA 4GFMA 1O9UA 3LFSA 4I6HA 4BDHA 4H3QA 3RZFA 4AS0A 3FMDA 1OUKA 1PXKA 2PZIA 3AC3A 4HZRA 4M3QA 4TRLA 4RJ8A 5AR7A 1LEZA 3C0GA 4DYMA 5EI2A 4D9TA 3Q4ZA 4DFNA 4AAYA 5KKRC 4D58A 2ZAZA 1XO2B 3WF6A 2UZEA 2RG5A 4MWIA 1KV1A 1PJKA 1STCE 4L45A 1Y57A 1FGKA 5HOAA 4DH1A 4PPBA 3DQXA 4QTBA 2YCRA 2ZMDA 4ANQA 2VTLA 3LQ3A 3FZOA 5H3QA 2H9VA 3GU5A 5HE0A 3OWPA 2OXDA 3WARA 4CGAA 2VWBA 3QWJA 3C7QA 4G17A 3RKBA 5GJFA 4MD9E 5A6OA 3ZM9A 4AQKA 4FG7A 4E4MA 5KNJA 3UODA 3F66A 4MF1A 2YIXA 2ITYA 4PWNA 4ANOA 5IUGA 5JQ5A 3RK7A 2ITNA 2OH0E 4M84A 4IHPA 3G9NA 3P78A 3CD8A 4IBMA 4IJ9A 4L7SA 4M0YA 4O96A 3QCQA 5CXHA 2UVZA 5DR9A 3TIYA 2VZ6A 3COMA 3F7WA 5EQPA 2YJRA 2BRGA 3KF4A 3KRXA 4Q5HA 4WD5A 3EKKA 5HE1A 3Q52A 3UIUA 3VUKA 4YTFA 2PUPA 5AFVA 2OF2A 3DY7A 4MXZA 4E4NA 4EUTA 5ACKA 4QMPA 2GFSA 5L8LA 2UW4A 3PFQA 1HCKA 4JIKA 3EHAA 4M7IA 3LM0A 3FXWA 3ANQA 3PY1A 4FTRA 1Q3DA 5ETFA 2X2LA 3D94A 4D4RA 3W8QA 5GZAA 4FX3A 4AF3A 1JSTA 1V1KA 2CDZA 4ZY6A 3UP7A 1G8SA 4XG8A 2X4ZA 4FKRA 4O27B 4FOBA 1K2PA 1XQZA 1XH7A 1FQ1B 1XH4A 4FSYA 4QEBA 4O0WA 5J7HA 4L53A 4FC0A 3EQPA 1XJDA 3CY2A 4PNIA 1QMZA 4AFJA 4IB1A 3LJ0A 3FUPA 1JVPP 2Z60A 4FNXA 4Q5EA 2X8IA 4WA9A 3E63A 3BU3A 3HRFA 3E3PA 3IW8A 3QQHA 5EOBA 5BUEA 2Z02A 5HD7A 5L6OA 5J9LA 3BQRA 5IPJA 3R8ZA 4MUQA 1DI9A 3KKVA 5FQDC 3TJCA 4C2VA 2XANA 3OWJA 2F7ZE 3SA0A 4DT9A 2OI4X 4PMMA 5D7VA 4AE9A 3MPTA 4O81A 4K11A 4FT7A 1U54B 4NU1A 3R2YA 3HLLA 2RSVA 4K77A 3ZLWA 2R5TA 3NUAA 1ZLTA 2NPQA 3OHTA 4CMTA 4QMTA 4E26A 3ZRKA 4OGRA 3V5QA 3GC0A 4BN1A 4APPA 4D2RA 4EK4A 2J0LA 5E91A 4L44A 1WFCA 3VUIA 4A4LA 2V7AA 1BX6A 2B9HA 4NM5A 3NMUF 4FI1A 3PUFC 2YAAA 1Q8YA 3VHKA 3FI4A 2PPQA 2J90A 4JRVA 4XLIA 4A9SA 5FLFA 5CYIA 3CTHA 4C57A 5KZ0A 3GT8A 5KMIA 4FZFB 5ANJA 3U4WA 5LVMA 4BHZA 5BNJA 4EQCA 3PZHA 4U41A 4HCTA 4IM3A 4D2WA 4DDGA 1OIUA 5T6KA 1YHSA 1TZDA 3CKWA 3VBWA 1NVSA 1YWRA 3FYJX 3P08A 3P7BA 5M07A 4NIFA 1SYKA 2IO6A 2WOTA 4LRKA 4PV0A 2C69A 4NUSA 5M4IA 1XH5A 4G3GA 2JBOA 5CSVA 3ZFXA 1QPJA 4FVPA 5C8MA 3MBLA 3EN9A 2UW5A 4BF2A 5D12A 4IZ7A 3Q2JA 1LUFA 5HVKA 4EUUA 4C4HA 5LJJA 1YWVA 2G2HA 3FKNA 1ZOGA 4RRVA 3NGAA 3L1SA 3OY3A 3ZXZA 2CKOA 4FTAA 4EKLA 5JZJA 3JVSA 3DK3A 5KO1A 4FIEA 4GK4A 4CYIA 4DT8A 3RM6A 3A61A 3R2BA 4G2FA 4JAIA 4M12A 3A60A 1IR3A 2PVNA 2W4OA 2X7OA 3IGGA 4WUNA 5HCZA 3H30A 5DRBA 4HYUA 3FPMA 5FM3A 4ERWA 4A9RA 3PJ3A 4GKIA 4YZBA 4WNPA 3AMBA 5E1SA 3CLYA 4EONA 4MXAA 3GCUA 4LL5A 3R04A 4TT7A 5H8GA 5HO7A 1BL7A 5J9ZA 1KWPA 4IB3A 3TNHA 4AG8A 2PE2A 2BFXA 3BE9A 5AUXA 3GI3A 3V3VA 2YM4A 3K5VA 1H1PA 5ETIA 3W0NA 4BYIA 2JDOA 4M8TA 5A6NA 3IQ7A 4A06A 2XEZA 4FYOA 3NSZA 3NAYA 4CFWA 2WQNA 2FUMA 1FINA 3QC4A 3QF9A 4GG7A 2WELA 3FMNA 4YBKA 5CNNA 3QU0A 1G5SA 3VNTA 4UN0C 2UUEA 4FBXA 1BKXA 2IVVA 5FP6A 4XBUA 4FV0A 4KABA 1JSVA 5H9BA 2WMAA 3MH3A 4C0TA 2YM5A 2R3IA 2CMWA 4C61A 3FL4A 5CSHA 5EHLA 3R9HA 3U4UA 4WOVA 2ZM3A 5CENA 2PL0A 3DBDA 3TJDA 3KXHA 4ACCA 1M17A 4W9WA 5T3QA 4ZJVA 3EFLA 4AXCA 4HVIA 2C30A 4CKRA 3WBLA 4O0TA 3JPVA 3F2AA 1MP8A 1H07A 4YZCA 5I9XA 4I20A 1FGIA 3FMJA 3GB2A 2JFMA 3G51A 4FKGA 1OECA 4KD1A 3LZBA 4IZ5A 5IA3A 3EH9A 4GS6A 2XEYA 2PMNX 3MFTA 4ID7A 3VIDA 5K4JA 1KSWA 4MNEA 3S3IA 4PPAA 3G0FA 3L9LA 4U3ZA 4PF4A 5HIBA 4QDEA 5IA1A 3PJ8A 4JQ8A 4BJJA 3D2IA 3IW5A 4IAFA 4M69B 3DKGA 4BC6A 3HP2A 1IAJA 4EC8A 1QPCA 4DBNA 4LGGA 3TIZA 4F7SA 3PSBA 4NT4A 4NW6A 4FTCA 4O91A 5J5TA 5IA0A 5AUZA 5C4LA 4I0RA 1ZYJA 1WVYA 4BIDA 4GSBA 4FTLA 4KIKA 5FG8A 4YTIA 3TWJA 2IZUA 2QOOA 4ZXTA 3L8SA 2PE1A 4DH8A 1FMOE 4QYGA 5KBRA 1PKGA 3AKJA 4EOIA 3OS3A 2YEXA 4Z16A 4RC2A 4UYAA 3E7VA 1BI8A 4S33A 4BHNA 2VO6A 3VS3A 1JPAA 4BTFA 4OR5A 4CNHA 4W9XA 4I24A 2XF0A 4N0SA 3U6JA 4C3PA 5BUJA 3JVRA 1J7UA 3ACKA 4M0ZA 4RWJA 5CU0A 2OICA 2YFXA 4U7ZA 3C4XA 4YO6A 4PL3A 5LXMA 4PDYA 4MCVA 4H1JA 4DEIA 4E6QA 4BCIA 5CVFA 2UZOA 3QCSA 3QX2A 5EW3A 2ZM1A 3NNUA 5HCXA 4DH3A 4DFBA 5FWKK 3RPRA 3UE4A 3P23A 4I6LA 2V5QA 5E1EA 4IWDA 2GQGA 3WZEA 4C4EA 4Z9LA 4TKSA 2QKRA 3EN4A 4HGSA 4DITA 3A4OX 4DGNA 4DEAA 4Z7HA 3NUXA 2R3GA 2B9FA 4R1VA 3RJCA 4I1ZA 3BU5A 1S9IA 3NYOA 4FYNA 3LFDA 3NS9A 5DRDA 4DA5A 2W99B 3O96A 3B8QA 2UZLA 1CMKE 3UG2A 1R0PA 2CCHA 3CGFA 3DDPA 2C47A 2IN6A 3C50A 3LFFA 3VBVA 3OP5A 4E6CA 4ASEA 3FHIA 4O0XA 4CLJA 1H1RA 3VJOA 1XR1A 1PMUA 4O82A 4R3RA 3BE2A 4MNEB 4U9AA 4UZDA 1QPEA 2AEGA 1W2FA 2ZDTA 3WZUA 1WBOA 3G6HA 5IA4A 2OGVA 4XP3A 5BVFA 3KXXA 5DIAA 3VS7A 3V8WA 3C9WA 3ZDUA 3AGMA 2NRUA 4JI9A 3KRLA 5GIPE 5E8WA 2CN5A 4UWYA 2IW6A 2JAVA 5HCYA 4GIHA 4NM0A 5AIRA 3GCVA 2YLEA 3KN5A 4FV4A 2AUHA 2DWBA 3ZOSA 3KGAA 5AADA 1SMHA 4ANMA 5LMKC 3V5TA 3VAPA 1Y91A 4NFMA 4D9UA 4HZSA 3CXWA 3LFNA 3NVMB 4XRJA 5HESA 5HTBA 3AT2A 4X7QA 5HHWA 4CMOA 4QRCA 1M2RA 5BX0A 2X8EA 3SD0A 5K3YA 4F6WA 2F9GA 3F5PA 3HV6A 3R83A 5T68A 3D9VA 5EK7A 4DH7A 4NZWB 4FMQA 4YHJA 1U5QA 4CT1A 2V62A 3SRVB 3OEZA 3WZDA 4IJPA 3TUDA 1VYZA 4FVQA 4TZRA 5LWMA 3EWHA 1OI9A 3F69A 4OTIA 4XP2A 5A3XA 5M57A 4XEYA 2VWVA 3ALOA 2F7XE 3BZ3A 3MVJA 3QL8A 4MWHA 4OW8A 3PJ1A 4O1PA 4BDFA 2OFUA 3QX4A 4BCJA 2ITPA 4Z7GA 2R7BA 4HCVA 3DJ5A 4EOKA 4F99A 5A9UA 4EH8A 4EBVA 4C3RA 3BPRA 2R3JA 5CF6