2JDSA

Structure of camp-dependent protein kinase complexed with a-443654
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE
publication title A Structural Comparison of Inhibitor Binding to Pkb, Pka and Pka-Pkb Chimera
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 109
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jdsA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jdsA02
4B9DA 3LOKA 1MQ4A 2YJSA 4W9XA 3RZFA 3SD0A 3VVHA 2XNEA 4I5CA 3TN8A 4FKIA 4GIHA 3D5WA 3QCQA 1H8FA 3C4ZA 3OC1A 4EEVA 3D9VA 3IK3A 3SXRA 4FEVA 3NUUA 4FZFB 4YPDA 3IGOA 3WF8A 5C01A 5LARA 4E6AA 4LGGA 2CN5A 5HKMA 3V5LA 4DFZE 3BLQA 3G15A 2VX3A 2W7XA 2WAJA 1OL2A 4EWQA 2O0UA 4X2GA 1IR3A 3KQ7A 4JRVA 3ZC5A 3L9NA 3I7CA 4TRLA 4E4LA 2BZKB 3BRBA 4P5ZA 4WUNA 4S33A 3ZSIA 1YQJA 2PY3A 3CGOA 2B1PA 3HMNA 3ZLXA 2QOCA 2XKCA 4D2VA 2OH0E 3LVPA 4QTDA 4WO5A 1LEZA 3BCEA 2HENA 2XRWA 4EH9A 3MI9A 2QOHA 3RPOA 2IPXA 5J9YA 2E9NA 5EYCA 4UMTA 1G3NA 5AUYA 4GUEA 5EDRA 4S31A 4GT3A 3RCDA 4PWNA 5JQ5A 5IEYA 5EW3A 3NRMA 4CT2A 2X7OA 1U4DA 3L9MA 1BL6A 4QP3A 5IQBA 1GZKA 3HP5A 1H4LA 2YIRA 4MD7E 5HCZA 3DT1A 3GC7A 2C1BA 4YTIA 2VV9A 4R1YA 2H8HA 3ZOSA 5M57A 4I6FA 2ZAZA 2V55A 3ROCA 3F9NA 2WQEA 5HE1A 2OF2A 1M2RA 4G6LA 3W18A 1GZNA 4FKRA 4QQTA 2UZLA 3ULZA 4ARKA 5CF8A 1ZARA 5M51A 4I3ZA 1YW2A 4L01A 3CC6A 5AUZA 4BDGA 4BBMA 3HMIA 4MNEA 4AWIA 3FZSA 1UU9A 4BTJA 5M55A 3FZOA 3LFSA 3V5PA 3HKOA 5DH3A 3OCSA 4BI2A 2ITNA 4GKIA 2RFNA 3GU4A 4U79A 5CZIA 4TWCA 3S1HA 2OBJA 1PMEA 3TZMA 5HD4A 4HYUA 4EOPA 3ORIA 3QU0A 3KK9A 4YHFA 4EOQA 2X39A 3RPVA 4NYEA 4FTAA 4O83A 2A4LA 2LGCA 5HE0A 4FTKA 2C47A 3ENHA 4YC6A 5JH6A 4LV5A 2XEZA 2PVKA 1CKPA 3RVGA 5LVPA 3FMHA 4FI1A 5C8NA 5IQFA 2BAQA 2GS2A 2ITPA 2QU5A 4HPTE 5I9ZA 3C5IA 2E2BA 4ASDA 3DOGA 4L9IA 3S4QA 4FV0A 1JPAA 4TYHB 3D7TB 3MIYA 5H2UA 5E8VA 4MKCA 5HNIX 3SRVA 3NGAA 4H1MA 3WI6A 2XK7A 2YAKA 1YI3A 2W5AA 1IG1A 4QMNA 3F61A 3EMGA 5CU3A 3TNIA 3LM5A 2IN6A 4NFNA 5GZAA 4HPUE 3KF7A 3DBCA 3NUNA 3LFCA 5ANIA 1OL5A 4BICA 5FBNC 3PY0A 2PE1A 3O7LD 5HESA 5ANKA 3EIDA 3LXNA 4QP9A 4QRCA 2CLQA 3KY2A 3BU3A 4EK5A 1NA7A 5CAQA 3W8QA 4M69A 2XP2A 4LGHA 5J9LA 4G2FA 4RFMA 4R7BA 5KMLA 4FTMA 2HXQA 4I5HA 5I9VA 4P5QA 2VWVA 3KEXA 1ZXEA 3LQ5A 5AJQA 1IASA 4R3CA 4F7JA 2FSTX 3B8QA 3P7CA 3EQRA 4QNYA 2A0CX 4ANOA 5J9ZA 3DXQA 3W8LA 4LUDA 3TNPC 4ZS4A 1ZLTA 1B39A 3MJ2A 4J52A 2YCSA 4EBVA 4OLIA 5E91A 3MH2A 4JDJA 5BUEA 4DTKA 2WOTA 4XP0A 3GFWA 4PTCA 2BMCA 5AP2A 4IJ9A 2XIYA 1BI7A 1T45A 1URCA 4X3FA 3PG1A 4CFXA 4Z7HA 5LMKC 2ZV2A 3VJOA 4NL0A 2O63A 3Q9ZA 1FMKA 1U54B 4BGQA 1KE5A 1JBPE 3LFDA 3OOGA 3HECA 3WE4A 5HI2A 3I6WA 2HWOA 4NM0A 2C68A 5F95A 5LVLA 3KVXA 4XV9A 4PMTA 1Q8UA 4BCPA 2WZJA 4YTHA 1Z9XA 3KFAA 3UMXA 5DN3A 3L9LA 1Q99A 5A6OA 5B2LA 3DPKA 2AUHA 4OTGA 2F49A 5AAFA 4FGBA 5CWZA 2QI8A 1ZMWA 2OF4A 3HMMA 4HZSA 5GJGA 4BDBA 1E1XA 4CZTA 5DA3A 5BX0A 2C0OA 1XH6A 2VTRA 2GQGA 2UW9A 2JKKA 3QTRA 4GU6A 4BZDA 3D14A 4XG6A 3VRYA 2W1GA 3T9IA 1KSWA 2WELA 4QMPA 4H58A 3VRZA 2VTOA 1PXMA 3UZRA 4IM3A 5AAGA 5HBHA 3NEWA 3PLAE 1SVHA 2ZM1A 3GUBA 4JOAA 4BCKA 4K6ZA 3K5UA 2J9MA 2V22A 3RCJA 4NUSA 4FNWA 3V6SA 2R3NA 4DF3A 4XG9A 3VS3A 3S00A 4BN1A 4JS8A 3MS9A 4QPAA 3PLSA 3FQEA 4FOBA 5K3YA 4DHFA 5GZ8A 2C3JA 1JOWB 4TN6A 4L53A 4O7RA 3P86A 4E20A 5E1SA 2PZRA 4ZY4A 3G9NA 5C03A 4G6NA 3UODA 5AA9A 2J5EA 4JQ7A 2YEXA 4O0RA 1IAHA 4E3CA 3BGQA 3E88A 5HVYA 4BCIA 4HGSA 3R8PA 2WQNA 1WBTA 3FPMA 4RRVA 4WG4A 3R7EA 5JFXA 2AC5A 3ZFXA 4MNFA 3G0FA 2G2IA 3FZTA 3ZO2A 4Z55A 3EOCA 3AD6A 3KVWA 5A3XA 4MWIA 3KA0A 3KXZA 2XRUA 2WFYA 3R04A 2CHLA 1UWHA 4LOPA 4EJ7A 4G17A 2ZOQA 4RWIA 3D2KA 4UXLA 3SW4A 5IUGA 3W2QA 2RG6A 4DFBA 4HGLA 2R7BA 4BGHA 3L8PA 1PXLA 4O0TA 5L2TA 5E8XA 3IO7A 1ND4A 1O6LA 3BV2A 3PG3A 2P3GX 2Z7LA 5EOBA 5EQPA 5IU2A 1R3CA 3VUGA 2O5KA 2VWWA 4I4FA 3UOKA 2CKOA 2PMOX 4YZBA 4E6DA 3BELA 3FWQA 4GJ3A 4DG0E 1OKZA 3VBXA 2X2KA 3ULIA 3QQLA 2BUJA 4CV8A 5FXQA 2C3LA 3UPXA 3U6IA 2PUUA 4FSNA 4MXAA 3C1XA 3QD3A 2YACA 3CGFA 3PRFA 2IZUA 1VR2A 4F7SA 3EQGA 5E90A 4J97A 4KKEA 3RHXA 1RQQA 3EQHA 3IG7A 3RK9A 3MWUA 2RF9A 3NUXA 4RSSA 4TKSA 3PE1A 5DE2A 2W1CA 1H0VA 5DT0A 5BVKA 4RIWA 4IXPA 1WBNA 3RWPA 4E5AX 3K3JA 5JT2A 5CT0A 5AUUA 1W82A 1J91A 3BPRA 3DJ6A 4FV3A 2OXDA 3TEIA 3TV4A 4DEGA 3R21A 4KUJA 3FLSA 4PDYA 4UMRA 3MIAA 4BDEA 4JJRA 4EH7A 5AR5A 5DR6A 5HE3A 3PRIA 1FVRA 4O0SA 4CZYB 4JRNA 5BVDA 1GIJA 4OTIA 1XBCA 3JUHA 2WTKB 4CRSA 1LEWA 4DG3E 2HK5A 3FEGA 5FGKA 2UZDA 3LFEA 1YDSE 4CQGA 5DLSA 2C0IA 2ERKA 2EWAA 5FTGA 3VS5A 1ZZLA 2UW4A 1K9AA 3CKXA 3HL7A 3VUKA 4OT5A 4XCUA 1FQ1B 1SM2A 5AR4A 5F20A 2XJ0A 4AOIA 3PJ2A 2PL0A 3PSBA 5E8WA 5E8ZA 4JAIA 1SZMA 2V7OA 3KULB 2BZIB 5LMAA 3GP0A 2CGWA 2P2HA 3TKUA 5EDQA 4FKQA 1Z57A 5IDNA 3DFAA 1P5EA 3QCXA 3ACJA 2BKZA 3H30A 2PULA 3C13A 4ZZNA 1XH7A 2GTMA 2QO9A 3EZRA 4F9CA 2ZDTA 3TNWA 5CF6A 2YCQA 4QPMA 2XIKA 1PXOA 4GT4A 2IW6A 3ZCLA 3ELJA 4IE9A 4IAYA 4FG9A 4EKKA 3FBVA 5JZJA 3NNVA 5EYKA 5KMNA 3UP2A 3PP0A 2HELA 3VBVA 2O2UA 3UOHA 1Q3DA 3PWYA 3R28A 4ASXA 2C6TA 4YLJA 1TQMA 4O7WA 3OXZA 5AP3A 4GH2A 4M15A 4GL9A 2YZLA 1R0PA 3ACKA 3DAJA 1CM8A 4YNOA 3AD5A 1NVRA 3W32A 5I9WA 3DCVA 2J0LA 2HZ0A 2VO6A 3VUIA 4KS7A 2JDTA 2YLEA 2YN8A 4TWOA 3AC2A 5GZ9A 1GZOA 2OO8X 3G5DA 3HVCA 3NNUA 1MP8A 4L68A 2O8YA 2OJGA 4EK6A 2VNYA 1R1WA 3PJ3A 4NIFA 4WNPA 5T6KA 4E8AA 2ZMDA 4IH8A 5DI1A 4CYIA 3EN4A 1V1KA 1JSTA 4C33A 3FYJX 3LJ0A 4OW8A 3F3UA 4UV0A 4ZLOA 1ZMVA 3DKGA 4H05A 4AGUA 5HIBA 2PE0A 5CEKA 3Q04A 4FF8A 4EJNA 2QOBA 3EFKA 2ZB0A 2GCDA 1UNGA 1SVEA 2NNWB 1OITA 5ETFA 4U41A 4WG3A 2JDOA 2X9EA 4AGWA 4DEBA 1REKA 2WU7A 3E8DA 4AACA 4CCUA 5AX3A 4BKJA 5IH4A 5KO1A 4Y72A 3OXIA 2HIWA 3SOCA 5CANA 3ZUVA 3AQVA 4OT6A 3R9HA 4UN0C 2W4JA 3R22A 4RMZA 4IB5A 5LVNA 2CN8A 3O96A 4W9WA 5EI8A 4OTQA 2F7XE 3FY2A 1UKHA 4FT9A 3TZ8A 2XM8A 5ANJA 2QLUA 4R78A 4AS0A 2BRHA 2BRBA 3ANQA 4E6CA 4HW7A 5A54A 2UW6A 2OJFE 5FXSA 4LG4A 2J0IA 5KMKA 3CY2A 3KREA 5EQYA 3NDMA 4IADA 4A9UA 4RJ7A 2PHKA 3PXKA 4DN5A 1PXKA 5EHOA 5M08A 3VWAA 4LRKA 3MTFA 3ORTA 3DK7A 5K5NA 5M53A 3Q3BA 4FSWA 1SVGA 1K2PA 3E64A 4JR3A 3KXNA 4ERWA 1XH8A 4AOTA 3ITZA 2YITA 4YJTA 2BALA 2UZWE 5AV1A 4FKUA 3O0GA 4OTWA 1BLXA 1AD5A 3KMWA 2B52A 2UZBA 2X2LA 4FNYA 3GBZA 3TV7A 1STCE 4MCVA 3P4KA 3FSKA 4JIAA 5E9EA 2CKEA 4G16A 2PVNA 3H9OA 4GFMA 3ZM4A 4BWPA 1P4FA 4TYIA 4I0TA 3HRBA 4FL2A 3BGZA 1RW8A 4WSYA 3HV5A 3TTIA 5B2KA 4QTEA 2V62A 3F5XA 2VO3A 4F7LA 2YJRA 3F66A 3A61A 4FKWA 2GNHA 4GV1A 4TYEA 1GZ8A 3RHKA 1OBDA 4OGRA 5D7AA 2IJMA 2W1DA 5CNOA 5KKRB 2J51A 1XWSA 3DXNA 3QHWA 4MNEB 3IDBA 5AR8A 5HG7A 4DAWA 3R0TA 4EK3A 3FMKA 3NAXA 2G1TA 3QZHA 1CKIA 2X4ZA 5CT7A 1H1WA 2WIPA 1Y6BA 4FTTA 4J53A 1J7UA 5AR3A 4YHTA 1IEPA 3CPBA 1WVYA 2OICA 4HYHA 1OZ1A 1YOJA 5E4HA 3R2BA 4NKSA 2QO2A 3KRXA 2IZSA 4YJSA 5LVOA 3PA4A 1I44A 2WMUA 3ZRMA 3UZTA 3GENA 3KK8A 4C36A 2X6DA 2FO0A 5FEEA 1L8TA 2ONLC 4HCUA 2QHNA 3QQHA 4YO6A 3MY0A 4FL1A 4F6WA 5ITAA 4O86A 1PJKA 2CKQA 3DAEA 4RVLA 3WIKA 1FMOE 3TACA 2XF0A 2XK8A 2ZVAA 3EQPA 4EOOA 4KD1A 2XK3A 2FSMX 4M12A 5DPVA 3EH9A 3DZQA 3RNIA 2G9XA 3PXYA 2VWUA 5CENA 4JIKA 3GU8A 3NW6A 4QP4A 4ACHA 3QRTA 4FICA 4FTQA 3SRVB 2KTYA 2NRUA 4BCFA 4HVHA 4JXFA 5EI2A 4YPSA 4FBXA 5AEPA 5L8KA 4R6VA 3P79A 1KOAA 4X2NA 4D2TA 5HU3A 3QQUA 3HAVA 2PVLA 2XZSA 5HU9A 2VAGA 4FV9A 3FE3A 4DC2A 2R64A 4OTFA 5DG5A 3U51A 4LYNA 2GS6A 3AC8A 3DQXA 4BFMA 2BDJA 3V8TA 2R0UA 5LQFA 3TZ7A 2YIXA 4O2ZA 1H08A 4IHPA 4L44A 2QKWB 5K9IA 2W99B 3E7OA 3EJ1A 1O6YA 4X3JA 4M69B 3L9PA 4C3FA 3R7VA 4C58A 4A9TA 2BVAA 3W2OA 2PZYA 3RPYA 2RG5A 3C51A 4EHEA 3MFTA 3LCSA 3AT2A 5FD2A 5K0KA 1A48A 4N6YA 4F4PA 2BTRA 3MPTA 3F2RA 4KIOA 2JIIA 5HQ0A 4PL5A 1Q5KA 2CLXA 3PP1A 5CNNA 4WBOA 4PF4A 4D4YA 4DH3A 3E93A 3QKLA 4MK0A 5J7HA 1PYXA 3NPCA 3DBQA 2X0GA 3VHKA 4BB4A 1IRKA 3ENMA 3NWWA 4HGTA 3WOWA 3DXPA 3VF8A 1UU8A 2GNIA 4O38A 4M68A 5BVOA 3MVMA 4Y5HA 4X3FB 3UC3A 2JKQA 1Y8YA 4JX7A 4C3RA 4BYIA 3BLHA 4RX9A 4PV0A 4BBFA 1H28A 5CSVA 4ZMEA 1YDRE 3ZRLA 4BL1A 5A6NA 5L4QA 2R5TA 3ZYAA 2XH5A 5HTIA 5K4JA 5AP1A 3LMIA 4TTHB 5DR2A 4IB1A 4NW6A 3E7VA 5B0XA 4MXXA 3U9CA 4BDAA 2VZ6A 4CFVA 2B9JA 4FT3A 5JN2A 1VYZA 4DLJA 2W1EA 3BU5A 4RFZA 2JGZA 2CNQA 3PYYA 1W7HA 3HP2A 3EZVA 1QCFA 4AT3A 2ZM3A 3F88A 4PNKA 3DAKA 3VUHA 4Z3VA 2HW7A 2WNTA 1UV5A 2RIOA 3O51A 3QL8A 4USFA 2XCKA 3QZIA 2UZNA 5HVJA 5JSMA 2R9SA 3MVLA 3SKCA 4BTMA 5IQIA 5BYLA 3LKMA 4AA5A 4DT8A 2WHBA 3FJQE 4JBQA 4O1OA 4RBLA 3D83A 3B8RA 4D1XA 5CF5A 2WMSA 4G6OA 2X6EA 2C6DA 3KULA 4BTFA 3HV6A 3G2FA 5DIAA 4FOCA 1SMHA 4GKHA 3D5VA 4FKGA 2X8EA 3DK6A 3F5GA 1E1VA 2UZOA 3MPAA 4FTJA 4S30A 5CAUA 4D58A 2PVHA 4J8MA 4C4JA 3FL5A 4D2WA 3ZTXA 2BFYA 4U9AA 3KF4A 4NCTA 5ACKA 2Q83A 3FQSA 3R1QA 5EYMA 1P2AA 5EH0A 4WNMA 2FSLX 5HO8A 3V04A 3QLGA 4IVCA 3AMYA 4CGAA 4O81A 4FEWA 4D2PA 2F7ZE 3KRLA 3AXWA 3GCPA 4DEDA 2WQOA 3COHA 3FZRA 4IIRA 5HGIA 3UOLA 3PJ1A 1V0BA 4LI5A 3GC0A 4OTPA 5J79A 3O8UA 4XYFA 2PSQA 1QL6A 5JZNA 4ACCA 4FKSA 2QONA 4GEOA 4BBEA 4O7LA 3UYSA 4PUZA 4GK4A 3PY3A 4GSBA 5FG8A 3UC4A 2BZHB 4LM5A 4H1JA 1CTPE 3HUBA 4BIBA 4FVPA 2YM8A 4UBAA 3JR1A 1ZOHA 3KB7A 3OWJA 2E9VA 3CQWA 1QPEA 3HRFA 4U97A 3VBQA 4EK8A 4CFUA 3L8SA 4IJPA 4FV6A 3KMUA 3IPHA 4WBBB 4IFGA 4FUYA 5CEMA 4QO9A 4NZWB 3QTIA 4XLVA 4FSQA 1OL7A 4AG8A 5J1WA 5GIOE 4G3GA 4M0ZA 3TNHA 4ZS0A 4DFXE 2P4IA 3BV3A 2ZV9A 3NYOA 2ZDUA 3BYOA 5AR7A 4HVGA 2UW7A 3DBDA 1DAYA 3O50A 4MWHA 3DZOA 4QMOA 2RFEA 2OZAB 2VN9A 4EUTA 2EB3A 3QA8A 5AUTA 3Q4UA 4I6HA 1BYGA 3RGFA 3EHAA 3W33A 3E3PA 4FKLA 3IW6A 3MH3A 1DI8A 4FEXA 2Y6MA 4YUQA 4R7HA 4LUEA 5HD7A 4MD8E 1H27A 4AF3A 4EOLA 4XG3A 3W2PA 3IECA 3UQFA 4KAOA 4AN2A 1H1SA 2WKMA 3KGAA 2OWBA 3QX4A 3FI2A 1YHVA 3PY1A 3RM7A 3KN6A 3KCKA 5K0XA 1V0OA 1F0QA 3ALNA 3QRKA 3A7GA 4RC2A 5EW9A 4RIWB 2UZTA 4JBPA 3PVGA 4IC7A 3IKAA 4NM7A 5KE0A 4BHZA 3ETAA 3BWJA 3O8TA 3GVUA 1ZYSA 2GDOA 4YNEA 4F9WA 3FZPA 4YJPA 5CI6A 4HZRA 3BEAA 4MHAA 3IGGA 4ANNA 2UW0A 1PW2A 3AC1A 3SXFA 4OAVB 2ZV8A 2QG5A 3F3VA 1GJOA 2EVAA 2QO7A 4FZ7A 5E7RA 5F94A 2XEYA 3P78A 4E1ZA 3UO4A 2GHMA 4YJUA 5IUHA 2OGVA 5M56A 3G51A 2WTKC 3VS2A 4C4IA 4QMLA 3HDMA 2QR7A 3OBJA 1LR4A 3OT3A 4AFJA 4CMTA 4QP7A 5EM5A 2PK9A 1APME 4GFOA 5JRQA 2XCHA 1WVWA 1OB3A 3DKFA 3N4UA 1E9HA 2XBAA 4FSUA 2VO0A 4IQ6A 1Z5MA 3WYXA 2C5VA 4FZ6A 3F69A 5JFVA 5EHLA 3U6JA 5A4EA 5FUTA 2JAMA 3R71A 4BI0A 1NXKA 1HCLA 2YA9A 3QQKA 4K33A 3FDNA 5FLFA 5BVEA 4W4YA 5EG3A 4ITIA 2IO6A 1BKXA 4QNAA 4QTCA 3AG9A 5J8IA 4XG7A 5BMSA 4N4SA 5AV4A 1H1PA 4LMNA 3FI3A 3PZHA 2RL5A 5HNGA 5IMEA 4RVMA 3HZTA 4LRJA 2VX1A 3NIEA 5C4KA 3R9DA 3BLRA 3HLLA 3QZGA 5FDXA 2AC3A 4BWKA 1XR1A 5CEOA 4UYAA 3Q4ZA 2WMBA 4FV2A 4FC0A 2C1AA 3A2CA 1OIQA 4PMSA 3TTJA 4G3DA 3OW3A 1M2PA 3QGWA 4DCEA 3JVRA 4K18A 3DLZA 3ZBXA 4BYJA 4CQEA 5BPYA 4GYIA 5HZNA 3UIMA 5I5ZA 4WA9A 4QYEA 5C8KA 3UVPA 4ALUA 5D12A 3PPZA 4TWPA 4C34A 5AUVA 4P4CA 2B9HA 4D4SA 3BQRA 4KSQA 4NIFB 2XIXA 3QTWA 4XH6A 2JIUA 5IPJA 2ZM4A 4L7SA 3FLQA 3QTQA 4JLCA 2C5OA 4V05A 4FIFA 3Q2MA 3Q52A 3IW8A 2UVZA 4FE2A 2ETKA 3PXRA 2QODA 4KA3A 3RKBA 4IW0A 3SW7A 5DR9A 4JQEA 5DGZA 5FM3A 1MQBA 5F9EA 2XYNA 2ZJWA 2J7TA 1QMZA 4GK3A 1OPLA 3K2LA 4XV1A 2VTLA 4LOQA 4QD6A 5EQEA 2QCSA 2CCIA 2J4ZA 5ETIA 5HIEA 3ORPA 4RVKA 5D41A 4U43A 3FC1X 3MW1A 5IISA 3TUBA 3W2CA 5E8YA 4NM5A 3R63A 4OTRA 3BX5A 5H9BA 3EL7A 3OXTA 3KXXA 4BCMA 4X2FA 1YXTA 2OIBA 3HDNA 3IONA 3QF9A 2PZPA 2GHLA 2C6OA 2VTSA 4KINA 4QMWA 3LMHA 5LXMA 1KV1A 3QWJA 4KNBA 3VIDA 1FPUA 1J7IA 1M14A 1RJBA 2IWIA 4FG8A 2I40A 5FBOA 1YHSA 4BCGA 4FEUA 3BHVA 3PA3A 1U5QA 2ITYA 4I4EA 2XNGA 5E8TA 2XNOA 3ZSGA 2Y6OA 4YTFA 4I1ZA 4QMQA 2UZUE 1OI9A 4ZXTA 5C26A 2W05A 1M7QA 1JSUA 5IA1A 4RJ3A 2CKPA 3LW0A 4OBOA 4QMTA 4D0XA 5C4LA 5KUPA 3QC4A 3DTCA 2BAKA 2J5FA 2OG8A 2QQ7A 3JYAA 3EYHA 4MYGA 3DNEA 4DFLA 3LXLA 1Y57A 4RJ6A 4QYYA 2WIHA 4FL3A 3TXOA 4TL0A 4YZDA 3VULA 3VS0A 4QMZA 1HOWA 2DS1A 4IB0A 2Y0AA 2IVSA 5AAEA 3MJ1A 5IA0A 3LFQA 5HBJA 3QBNA 4WKQA 4PY1A 2DWBA 2ITTA 5CU4A 4E5WA 3VF9A 3QQGA 2RFDA 3PJ8A 5DEYA 4V0GB 3S95A 4NH1A 4DFYA 1XJDA 5KHXA 4OAUC 1OL6A 4RZVA 4ACMA 4UEUA 3LCTA 4ONAA 1DS5A 1MRUA 3LPBA 3BE2A 5CAVA 5L6OA 3VN9A 3O2MA 2W9ZB 3R8UA 4GVAA 4TYGA 4ZJJA 4H3BA 2XNPA 3F2NA 3Q53A 3BEGA 4A06A 4EK4A 2BRGA 4IX3A 4FT0A 2XVDA 2FA2A 1O9UA 2ETMA 5IA3A 3R1NA 4PL4A 5KKRC 4O0YA 1H01A 5HORA 1NVSA 1OIRA 3KKVA 5ANGA 3DNDA 4RIXB 4CKRA 4W8EA 2IG7A 3BBWA 3MB7A 4ORKA 4H36A 2C3KA 2HAKA 2NO3A 3FUPA 3HA6A 4I23A 4RWLA 1PYEA 2WTIA 3F82A 4PPBA 3UIUA 4GYGA 2C5NA 4NM3A 2I0EA 3CPCA 3FMMA 1PMUA 4BDFA 2PVFA 5TR6A 5HTCA 3DA6A 4R77A 2VWBA 2QR8A 5FQDC 4LL0A 2BIYA 2C6EA 4V01A 4ZEGA 3UQCA 3OCGA 3OCBA 3ZH8A 5LMBA 1KUTA 5LWMA 4NJDA 3R8MA 3GNIB 3F5UA 3ODZX 2PYWA 4FT5A 3R7UA 3V5QA 4F65A 4DTBA 4FR4A 1W84A 2B53A 3WZJA 5EDPA 2V5QA 3ZM9A 1LPUA 3U9NA 2X8DA 4YZCA 4A4XA 3NVMB 4M0YA 1WBOA 2VWIA 3NX8A 3RAIA 4FV5A 4ZZMA 4BCJA 5ANDA 2R0IA 4D2RA 1PY5A 4MH7A 1QPJA 3U8WA 2PVMA 4RA4A 3T3UA 4UY9A 3UBDA 5IQDA 3M11A 3SHEA 5JFSA 4U44A 3G90X 1OKVA 2OIDA 4IAIA 1ATPE 2R3LA 4O91A 1GNGA 5JQ8A 3DDQA 2GFSA 3MPMA 4KIKA 2EB2A 3II5A 1BI8A 2Q0NA 2W1ZA 3OD6X 4EH2A 4XOYA 4A07A 4AZSA 4PMMA 2QOQA 2R3IA 3SGCA 4EH8A 5HO6A 5IKWA 2OZAA 1NVQA 4IZ5A 2BROA 4KIPA 4FYNA 1G5SA 3TNQB 2PPQA 3LJ1A 3OG7A 1MRVA 2QOLA 3M42A 2YDKA 1XH5A 1XBAA 3COKA 1TKIA 2OFUA 2XNBA 3DBEA 1OM1A 3LFBA 4BTKA 4KIQA 1JKTA 4IM0A 3UVQA 1OBGA 5M4CA 2PZ5A 3ID6C 4DBNA 4ANLA 1TVOA 4ZSAA 4BIEA 1QPCA 1OMWA 1REJA 2VTAA 3FMDA 4FK6A 4QMYA 4QYGA 4C4FA 2NRYA 2XIRA 3R73A 4G5JA 4X3FC 3R8ZA 1K3AA 3MVJA 4LFIA 4A4LA 4BWXA 4BDDA 3WZDA 2FB8A 1G8SA 2J50A 4RJ5A 1ZOGA 4JI9A 5IA5A 3U87A 1KE7A 3BQCA 3ODYX 4O6EA 3HMPA 3U4WA 3ZFMA 3ZEPA 4C61A 1OGUA 1YVJA 3OTVA 1SNUA 4FSMA 4X0MA 5DRBA 4EOIA 4G5PA 2XK9A 5AV2A 3VJNA 4PMPA 4I93A 3ET7A 4I0RA 2FYSA 4ZSGA 2R7IA 5JGBA 4DINA 3EFLA 3BYUA 3OEZA 1FVVA 3K3IA 2IVTA 4J98A 3DB6A 1FGIA 4TZRA 5H8EA 3D15A 4C2WA 3DK3A 3ZFYA 4UMUA 5CSXA 2JBOA 3MVHA 3U6HA 3Q9WA 2OFVA 3ZDIA 4DFNA 2HOGA 5CSPA 4XG4A 1TQPA 2W5HA 1YXXA 3MFUA 4LL5A 5FTOA 3VAPA 3R1YA 2VNWA 1S9IA 3QRJA 4O0VA 3LIJA 4USDA 3WF6A 4BF2A 3VS1A 4I6BA 4PDSA 2WMWA 3LLAA 3EFWA 5TO8A 5GIPE 2OJJA 4AE9A 3PXQA 5TOZA 3NR9A 4PDPA 4PP7A 2C4GA 2YM4A 3R8LA 4QMSA 2A2AA 4O7SA 2WMRA 3DQWA 4IWPA 4IDVA 2BHHA 3Q9XA 3NIZA 1R0EA 4N6ZA 3QXPA 4TNDA 4YBKA 2Z02A 3H0YA 3H3CA 4FNXA 3TKHA 4EQCA 2WMAA 4R5SA 2PMLX 3D2IA 5HG9A 5CAPA 4RWKA 3RTPA 4XRJA 3LXKA 5F1ZA 3A8WA 1QPDA 2XNNA 1ZAOA 3CLYA 3FMEA 1WVXA 3IQ7A 3MN3A 3OBGA 3QLFA 4AW2A 2W06A 4AN3A 4DGNA 2V7AA 4AX8A 5AM7A 4O7VA 3NLBA 4RJ8A 3EQIA 3NMUF 3I4BA 3FHRA 5LJJA 3PFQA 5KZIA 3FXZA 1KOBA 3VNTA 2X81A 3COMA 3ZO1A 1JSVA 4IVAA 2F9GA 4WRGA 3VS6A 3PJCA 2C6LA 3ZLSA 4BRXA 4JG6A 4FTUA 4RLLA 3SC1A 4CKJA 2EU9A 3LE6A 4IVBA 4GG7A 2X7FA 3DBFA 3Q32A 5J5TA 4ZMFA 2JD5A 3FLZA 4UWBA 3M2WA 3CSVA 5J5SA 3BE9A 2J0JA 4O84A 1YXUA 3IOPA 5AWMA 3D0EA 4FTIA 4LGDA 4AU8A 2WXVA 1GIHA 1W83A 4EC8A 3BI6A 4IWQA 2YFXA 2F7EE 2RFSA 4FKVA 3V01A 2OW3A 4L67A 5EM6A 4BCHA 2OLCA 4ERKA 5HLWA 5G6VA 3DTWA 3FXXA 2GSFA 5L2QA 4YURA 2VTIA 3CY3A 4TW9A 2HWPA 4HCVA 4H3QA 4U3YA 4W4WA 3VO3A 1JWHA 2WTDA 3CTQA 4XV3A 3QQJA 1VEBA 4EI4A 4D1ZA 4CTBA 4D9TA 3NS9A 3OUKA 4U42A 2YHVA 2W96B 3BHYA 3H0ZA 1PXPA 4L3LA 4NEUA 3ZO3A 2B9FA 4XLIA 4L8MA 1CMKE 4HNIA 1WBWA 1NY3A 3L1SA 3HGKA 3PPJA 4I6QA 4WT6A 4AAAA 2QLQA 2I7QA 2H9VA 2HW6A 3C4FA 3ORNA 1YKRA 2QURA 3TWJA 3OY1A 5TT7A 2YDJA 4DEAA 3UNKA 3VBYA 1ZY4A 4BZNA 2XB7A 4G9CA 4ZOGA 3ZXTA 2VTQA 5KBRA 3LXPA 2OU7A 2GQRA 2V0DA 1IAJA 5HO7A 4QP1A 4DLIA 2FH9A 3LFFA 4O7NA 4EH3A 4QMVA 1LUFA 3DS6A 5HG5A 3FLYA 3TIZA 2FVDA 4N70A 5AM6A 5IZFA 1XO2B 4ANQA 2XK6A 2EUFB 4AW0A 3JS2A 3LFNA 4JDHA 3EQCA 3CJFA 3W55A 4RGJA 4GFGA 2Y9QA 4USEA 3IW4A 2GNFA 1OL1A 3PSDA 3IDPA 3P23A 4YJRA 2JDSA 3P7BA 4QMUA 3F3ZA 5AR2A 2R3JA 3CQUA 5H3QA 5L8JA 4V0GA 1BUHA 3KXGA 3OHTA 3W2RA 4P90A 3MH0A 1W8CA 2G2HA 3FYKX 4G31A 4FT7A 3VUDA 1Q8ZA 4ZY6A 5LWNA 2PTKA 3D7ZA 2ETRA 3CTHA 2JEDA 4RT7A 1UU7A 4L46A 2E9UA 3HEGA 2P33A 2Z7SA 1Y6AA 3QALE 4F99A 5CVGA 2HY81 3LMGA 2I1MA 3UIBA 1Q8WA 1YOLA 2YLFA 4O96A 4RC4A 2RSVA 4PPAA 4DCAA 3LQ3A 4FIIA 2C6MA 2CJMA 1O6KA 2VWZA 4JVGA 4HVDA 4L7FA 4ZTRA 4IMYA 4RIXA 1PKDA 2BCJA 3T9TA 2C3IB 4QYHA 3PXFA 2GFCA 5D10A 4DEHA 3GCVA 2VUWA 3OWKA 2JBPA 4QPSA 4ZP5A 5AP6A 3I1AA 5HG8A 3MA6A 4GG5A 1BMKA 3FLNC 5A4LA 3S2PA 5LVMA 4Q2AA 5AP7A 1Q61A 3BYVA 5C8MA 4HVSA 4XP2A 3R2YA 4Z7GA 3PVBA 4EONA 4AA4A 4TT7A 1X8BA 3R7OA 2VO7A 3ATSA 3LCOA 3E92A 4OBPA 2UV2A 2EXEA 4WSQA 5A9UA 4RX8A 4EL9A 4M67A 2XK4A 4TWNA 5GNKA 4X6RA 3AT4A 2CSNA 3H9FA 4XHKB 3UG1A 1Q8YA 4CXAA 4XX9A 4RX7A 5EM7A 3VBWA 5M4FA 4ZTQA 4Z9LA 4O22A 5DVRA 1JKLA 3GXLA 5IEVA 3F7WA 2NP8A 1T46A 2W4OA 3UNZA 4UZHA 1OPJA 4C62A 1WMKA 2YDIA 4D28A 3CXWA 4YBJA 5CQWA 1P14A 1PMVA 4YP8A 3W2SA 1OECA 2UW5A 3OS3A 4RFYA 2BR1A 2KULA 4WOVA 3VQUA 3B2WA 3VW8A 3PTGA 4YLKA 3ORKA 3DB8A 4ZTHA 2JKOA 3NW7A 5JEBA 1A06A 3GU7A 2E9OA 3E62A 2FSOX 3QTZA 4II5A 4MF0A 4XMOA 5DFPA 4ZZOA 5AP5A 2Z60A 2CMWA 4G3EA 4LQMA 3UO6A 4DGGA 1I09A 3MGYA 5CSHA 4E7WA 4XV2A 4IVDA 3C7QA 4F09A 3AT3A 1H26A 4QYFA 4A9RA 4Y73A 3QA0A 1M7NA 3VBTA 3NAYA 5CU6A 2XNMA 4U80A 1MUOA 3S0OA 4L3PA 3A62A 4XEYA 3R9NA 1YHWA 5L8LA 2ITQA 1BX6A 4D5HA 1NT2A 4EH4A 4M84A 3E5AA 3I5NA 3AC3A 3REPA 5IG1A 5IDPA 3FV8A 3NCZA 2WU6A 4OTHA 5AX9A 4MAOA 4JBOA 1H1QA 3NNWA 4BVUA 1UA2A 4I20A 2EXCX 2O3PA 2QVSE 3IS5A 1LP4A 1JQHA 4AGCA 1JAMA 1ERKA 2B54A 3KXHA 3OUNB 4EKLA 5DBXA 3F5PA 4ANBA 3UVRA 2F2CB 3EQFA 3LAUA 1OVEA 3NZ0A 3RK7A 2R3QA 3N51A 5EKNA 3MY1A 3R6XA 4IX4A 4RA5A 3W16A 5M06A 4MVFA 4DITA 4UB7A 4FTCA 5IF1A 2W0JA 2WGJA 5AMNA 5KNJA 4ID7A 3R9OA 4AA0A 2X4FA 3BHHA 1URWA 1IA8A 3EN6A 4JX3A 1FGKA 3NYNA 4IWDA 4Y85A 3BHUA 1XHAA 4U81A 3RI1A 4BDKA 5DOSA 3SVVA 4AFEA 3O8PA 5LOHA 2P0CA 5FP5A 3FZ1A 3WARA 2YIYA 4NFMA 5BUJA 3QKKA 4EOMA 2BILB 4O7YA 3I7BA 3I81A 2OJ9A 4UMPA 2CCHA 4EYMA 5CXZA 4F6SA 4NSTA 5L2WA 5GHVA 5KHWA 4DH7A 4F08A 4WNOA 3OEFX 2OZOA 5B7VA 4J7BA 1SYKA 2JDVA 3QYZA 3KMMA 3HAMA 2C5YA 3G0EA 3WF9A 2JC6A 4L00A 3BYMA 3EQBA 5H8GA 4YC8A 3FXWA 3R01A 5I9XA 2GPHA 3BZ3A 4FVRA 4UMQA 4YJNA 4F9YA 3TCPA 4UZDA 3AGLA 3KRRA 4OBQA 5DRDA 1YI6A 1Y91A 5AP4A 1KE9A 2WMVA 4C02A 4R1VA 5AV0A 4KB8A 3FL4A 4FV4A 4NWMA 2PUNA 1FVTA 3CTJA 3E8CA 4RJ4A 5FP6A 2OKRA 3RWQA 4YO4A 1MRYA 2W4KA 4MXZA 2WB8A 2A27A 3TT0A 4E4XA 3EFJA 3MDYA 4FSZA 2R4BA 4A7CA 2WEIA 4YZNA 3OVVA 2XMYA 5JFWA 4N57A 2OH4A 2PVYA 4IM2A 4AT4A 4ENXA 3O7LB 4IEBA 1ZY5A 1J1CA 4G34A 5FEDA 4D9UA 3HV4A 4O7TA 3C4WA 2PMIA 2ITUA 2Y4IB 3HV7A 4J1RA 4QP8A 5TF9A 5A46A 2E9PA 4MEDA 5FEQA 4L6QA 5EYDA 3L8VA 5FRIA 4EHVA 2H96A 2WTJA 2R3FA 4IAZA 3RPSA 1PXNA 4EOSA 4DH5A 4KIKB 2W1HA 4FKJA 5DEWA 2GNGA 4B4LA 3SG8A 3UIXA 4UWCA 4ZJIA 2XKEA 4AT5A 4U3ZA 4QT1A 4M66A 4RIYA 5HICA 4FIEA 2R3MA 1Q4LA 5DWRA 3P1AA 5GJDA 4CKIA 4AUAA 1P4OA 5AIRA 4F1OA 1Q41A 2XBJA 4YZMA 4QP2A 3POZA 3FKNA 4KKHA 4CG9A 5HE2A 4WRSA 4ENYA 1ZYCA 4D4RA 4NW5A 1AGWA 4I24A 4KS8A 4MBLA 3KN5A 3DKCA 4GU9A 3RAHA 3TDWA 4K8AA 3ZUUA 4IX6A 2B4SB 5FM2A 4B7TA 3UQGA 3A7HA 3BGPA 1Y8GA 3TM0A 4NK9A 4IZ7A 4AZVA 5IH6A 4TXCA 2XJ2A 4DFUA 3RK5A 5EK7A 2PWLA 5IMXA 5HNBA 2VD5A 2R2PA 5IH5A 2J0MB 1KWPA 3DJ7A 3FAAA 5IQAA 1HCKA 1ZYLA 5IQCA 4EQMA 2W1FA 4QTBA 4K0YA 3UMWA 5JGDA 4PL3A 5DNRA 3LCDA 1ZYJA 4W4XA 1W0XC 1OUYA 2IVVA 4FEQA 3UP7A 1KE8A 1V0PA 3GEQA 4ZSJA 5KMJA 2VTNA 4PTEA 1OKWA 4L43A 3KRWA 4MBIA 4Z16A 5CEQA 1YXSA 5T68A 4PP9A 4FIJA 3SLSA 4AQCA 3UNJA 3D4QA 4EZ3A 3ZS5A 4C4GA 4F9AA 4D55A 3MFSA 1PXJA 4N0SA 1OIUA 4JBVA 5CXHA 3RJCA 4GJ2A 1PF8A 2GNLA 3N4TA 2B7AA 4CT1A 4ACDA 2WMTA 2BHEA 5LMKA 4ZAUA 4LMUA 4CYJA 2W5BA 4NCTC 5BQ0A 1WBSA 5I0BA 5A4QA 5AIKA 3Q2JA 1YXVA 4C37A 2VTMA 4Q5EA 3AC5A 3SA0A 2B55A 3OWPA 4GCJA 2H34A 3E63A 5EM8A 5FWKK 2PE2A 4QMXA 5BNJA 4YSMA 2O64A 3ZC6A 4ITHA 2YAAA 3GU6A 1JVPP 4M7IA 2YM7A 4PDOA 5HEZA 3WE8A 2OJIA 3EL8A 5EFQA 3BHTA 3FMLA 4E73A 4J95A 4JG8A 4HOKA 4JT3A 4YR8A 3LZBA 4JDKA 2YM3A 2C5XA 3V5JA 4FV7A 2QC6A 3F3WA 4K1BA 4ALWA 2ESMA 2ITVA 5ANOA 3MESA 2OIQA 4FV1A 2R3HA 3M1SA 4XJ0A 4CCBA 2GNJA 2YM6A 4F64A 2C6KA 4QP6A 3ZLYA 3FHIA 4X2JA 2Y4PA 3V5WA 4UXQA 4H3PA 4MF1A 4X6QC 4EYJA 4BC6A 4EH5A 4GVJA 2X1NA 4WIHA 1R39A 4UWYA 4WHZA 5L6WL 1A9UA 1ZZ2A 3WF5A 4DTAA 3ZSHA 4QOXA 4NTSA 3TZ9A 4XG8A 4EOJA 2PU8A 3PVWA 4FTLA 4TNBA 4JAJA 3GOPA 3ZEWA 3PUPA 3CKWA 2WEVA 1DM2A 1GOLA 4L3JA 4AGDA 2VX0A 4I21A 4HNFA 3CEKA 5CU2A 2C6IA 2BRNA 3CCNA 3TKIA 5KX8A 4P7EA 2YWVA 3KCFA 5I3RA 4YTCA 4BDCA 3A7IA 4EUUA 3I60A 3OOMA 4KBCA 5KZ0A 5GINE 3IOKA 3FSFA 4RG0A 2WD1A 4RC3A 5CU0A 4FTRA 2PUIA 4D5KA 4UYNA 2YWPA 4TPTA 3CIKA 3VC4A 4E5BA 5BYYA 2Z7RA 3H9RA 2IW8A 3MH1A 3VS4A 5AV3A 4IACA 4OUCA 1ZOEA 4CRLA 2BKKA 2Y8OA 2BZJA 2ITWA 2JIVA 2ITOA 3TJDA 2R3PA 3L8XA 4O27B 4HVIA 2Z2WA 4XUFA 3VUTA 2G01A 5HVKA 3HYHA 4WNKA 4GW8A 4C3PA 4IBMA 3KC3A 4FMQA 4LOOA 4NT4A 3NUSA 1RE8A 4K77A 4FZAB 4O82A 3ZO4A 1WAKA 4R7IA 2ZMCA 2ERZE 2WTWA 2HZNA 3C4EA 2LAVA 5LCJA 5K5XA 4O0UA 4WUAA 4I94A 2GHGA 4XG2A 1EH4A 3PDTA 5E1EA 4TY1A 2J2IB 4F6UA 4EBWA 4CVAA 3WZKA 4YGAA 5C27A 3V8WA 4PPCA 5J1VA 2PUPA 2R3GA 3AGMA 4U5JA 5EI6A 3P9JA 4FNZA 1WBPA 4BCOA 5CF4A 5L2SA 2YZAA 3EWHA 4FVQA 3RPRA 2DQ7X 4Q9SA 1OUKA 4ALVA 1AQ1A 1YDTE 4D4VA 4O6LA 2IZRA 4C2VA 1ZWSA 4M14A 1J7LA 3R7GA 4BZOA 5HX8A 4J8NA 2CNVA 3N4VA 5BVNA 4G3FA 4X2KA 1UNHA 3A8XA 4Y46A 3R8VA 3C0GA 2J90A 4O2PA 4FTNA 3NUAA 2BPMA 3FQHA 3QRUA 4YMJA 3QAME 2VRXA 3PSCA 5M44A 3C4XA 4KBKA 1VYWA 3NSZA 3UGCA 5HIDA 2XJ1A 4ZTMA 1G8AA 4BGGA 4C4EA 3Q4TA 3RAKA 3TL8A 2RGPA 2YM5A 4U45A 3H10A 1B38A 4AW5A 4IZYA 3DY7A 3EQDA 4Q9ZA 2R3OA 1CDKA 4YZ9A 5EKOA 3V6RA 1UU3A 2Y7JA 5I9YA 3G9LX 4YJVA 3K5VA 3HNGA 3PA5A 3ZZEA 3NW5A 2OSCA 3WF7A 4FIGA 4S34A 2GS7A 3LM0A 3WBLA 5DMZA 4APPA 3UDBA 5DT4A 2A1AB 1ZYDA 3S3IA 4ZJVA 5E8SA 4O0WA 3DJ5A 3OF0A 3GQLA 3MV5A 3FI8A 4RZWA 3ORLA 4RQKA 3QD4A 3C0HA 2JDRA 2GQSA 3OMVA 2WQMA 2AYPA 2P55A 2WMQA 3TJCA 4ZLZA 5KBQA 3PPKA 3A99A 1YOMA 3QGYA 4UX9A 3OROA 3A7FA 4KSPA 4CTCA 4DGLC 4ZIMA 4W8DA 4XRLA 3ZDUA 4DG2E 3H4JA 3QKMA 1KE6A 2F2UA 4IFCA 3RP9A 3WILA 2XUUA 3DV3A 1JNKA 3LCKA 1XBBA 3FMNA 3B2TA 5AADA 5EW8A 2CGUA 2J6MA 2XYUA 3ORXA 4DA5A 2W9FB 4AZEA 4C8BA 3GB2A 4FKTA 5IEXA 4C59A 3VW6A 1CKJA 3CD8A 4NU1A 3THBA 3AMBA 1KV2A 3O23A 3EN5A 4YU2A 3EKNA 3MBLA 5D9HA 2CPKE 4R3PA 3A7JA 1B6CB 4F0GA 4RQVA 2PMNX 4XBRA 4EC9A 3LHJA 4FA2A 4AZFA 2VGPA 3V51A 4A9YA 5A14A 3IW7A 3EKKA 2OXYA 4CMUA 2RKUA 3VUMA 2BRMA 3RAWA 3I5ZA 4FZDB 5FTQA 3ZZWA 4IAAA 1NW1A 3JY0A 3ZU7A 4HJOA 2UZVA 4B6LA 4PRJA 5CLPA 4JG7A 3MY5A 3UPZA 1M52A 2OXXA 3FY0A 3HV3A 3EN9A 4S2ZA 4BCNA 1SNXA 3R7IA 2JKMA 2ZB1A 3GI3A 4MBJA 3UG2A 2GU8A 3JPVA 2BFXA 4APCA 4CLJA 3DLSA 3TUCA 2CNUA 3TDVA 5BVWA 1PHKA 4AN9A 5CEIA 4S32A 1F5QA 3SX9A 3UJGA 5M4IA 4J99A 4NJ3A 1DI9A 3UTOA 4KABA 3OCTA 1YWRA 2JLDA 3E8NA 4PNIA 5CVFA 4KKGA 2Z8CA 3FPQA 5HCXA 4C7TA 1Q3WA 2B9IA 4BIDA 4FGRA 3BYSA 2IVUA 2EXMA 4MXCA 4BY9E 2UW8A 1UKIA 3G33A 3SDJA 1FINA 4F9BA 4FSYA 4BKZA 5C1QB 3GCUA 5KCVA 1FBNA 1H24A 1OKYA 4YHJA 3SOAA 2I0VA 4AOJA 4CLIA 4U0IA 4ASEA 4AZTA 3IDCA 1U46A 3I0OA 4FX3A 4X21A 5CQUA 2JFLA 3KU2A 3CR0A 3VHEA 4AZWA 3HRCA 4F1TA 1R78A 4Y5QA 5IA4A 4DGMA 5A4TA 4JNWA 4CZUA 3QTSA 2WQBA 4GMYA 4BI1A 2UW3A 3GQIA 3OFMA 5G1XA 3QUDA 1Q24A 2VTJA 3Q9YA 1YWNA 5E92A 4HYSA 5FXRA 3G6HA 3QTUA 4KRCA 3U4UA 2B0QA 2XKDA 5I9UA 3NNXA 5IA2A 2CGVA 5GJFA 3ATTA 3GOKA 3SG9A 3ZMMA 2Y4IC 3MFRA 4L42A 4NTTA 5DYJA 4FSRA 2CDZA 3MSSA 2QOIA 3UE4A 4YJOA 1Q97A 3MB6A 3QCSA 3VQHA 1OPKA 2QOKA 4Y8DA 2ACXA 1UVRA 2VU3A 2G15A 5CY3A 4BDIA 3CJGA 2IZTA 1UNLA 2VTHA 5D7VA 3CP9A 3SV0A 3T8OA 3ZONA 2BTSA 4TYJA 1WBVA 4RIYB 2I0HA 4JQ8A 4ZSEA 3A4OX 2VTTA 4O21A 4U40A 4YJQA 2ONLA 4GRBA 5JMSA 4U8ZA 2YERA 3OP5A 4DEIA 2O65A 4O7ZA 4DBXA 3Q5ZA 2I0YA 3G6GA 5I4NA 3PZEA 3R30A 5TE0A 4EZ7A 4H39A 4R8QA 5JRSA 3C4CA 3AMAA 5LCKA 3JY9A 4EH6A 4G3CA 1Q62A 1XKKA 3JXWA 5HLPA 5TKDA 2CGXA 2P2IA 4X7QA 5HCYA 3ZRKA 4EHGA 4TYHA 3TUDA 5CSWA 3D7TA 3ORZA 4LV8A 2XS0A 1GIIA 3RALA 3Q96A 3UZPA 2FGIA 4D2SA 3R00A 3Q6WA 3QC9A 5L2IA 3P7AA 4K9YA 3DKOA 4ZTLA 4C4HA 5JGAA 2UZEA 4HGEA 5CASA 5EHYA 3FLWA 4E6QA 2WTCA 1M17A 3I79A 4CEGA 2QU6A 3QHRA 5AUWA 4ZTSA 3QYWA 3GFEA 1DAWA 3BBTB 3NCGA 4B0GA 1S9JA 4WG5A 4EWHA 4ZLYA 4DT9A 2XM9A 3QUPA 5BUIA 4F70A 3O17A 5D11A 2DUVA 4OTDA 3IW5A 1BL7A 3NUPA 2VWXA 2OI4X 3TI1A 3DU8A 2VGOA 4PQNA 4CFNA 3COIA 3QUEA 3OTUA 4ZSLA 1M2QA 4U7ZA 1H25A 4E26A 3C9WA 3A4PA 5K4IA 2QHMA 3D94A 3KRJA 5D1JA 4A9SA 3OW4A 2JAVA 5BVFA 3WIGA 4I5MA 4IZAA 4R3RA 2QOOA 3P5KA 2WTVA 1JLUE 4D0WA 4QQCA 4MX9A 3RNYA 1XH9A 5HBEA 4CG8A 1YRPA 4L45A 1VJYA 3ERKA 2HZ4A 3FKLA 2WOUA 4CMOA 3R9RA 5CS6A 4ANMA 2QKRA 5CAOA 3QTXA 4KBAA 2WPAA 2XKFA 5CALA 2R3KA 3QQFA 4C38A 3RMFA 2YABA 2PVJA 4ITJA 3C5UA 3UO5A 4W4VA 3UOJA 1U54A 5BYZA 3EYGA 3WZUA 2YIWA 1PRYA 5B2MA 4B8LA 3CS9A 3GCQA 4FODA 4G1WA 2ZYBA 4UALA 4FKOA 2GTNA 2XIZA 3C50A 3QZFA 4XP3A 1JKKA 4MTAA 2IW9A 4CD0A 3AC4A 2HCKA 3MYGA 5T3QA 5ANEA 1WZYA 3ZHPC 4D1SA 2W1IA 2X7GA 3RINA 1JKSA 3V5TA 4KWPA 2ITZA 3NYVA 3R02A 2X2MA 3E3BX 2DYLA 1OIYA 3EB0A 3LFAA 4I92A 4P2KA 1UWJA 3HMOA 4CV9A 4JDIA 3F3TA 2UVXA 3PE2A 3BIZA 3U55A 2YISA 5AFVA 3U54A 4QTAA 3GGFA 3T3VA 5IQHA 4O1PA 4FTOA 3D5XA 4V04A 4Q5HA 1ZRZA 5JK3A 3Q5IA 4XNEA 2FUMA 3V3VA 4IAKA 3E87A 3CQEA 4XOZA 3RM6A 4I22A 3R1SA 4LRMA 3ZLWA 2PVRA 2GMXA 3O71A 5CI7A 4WD5A 3AD4A 3F6XA 3QCYA 3ROYA 2A19B 1RDQE 3HUCA 4EOKA 1YI4A 3BU6A 3RZBA 3ANRA 3AOXA 3WYYA 4C57A 3QD2B 5HHWA 3K54A 3QRIA 1VZOA 4IWOA 5IUIA 4BDJA 5ETAA 4DH1A 4XBUA 4FV8A 3NUYA 2H6DA 5I3OA 4C35A 3Q6UA 2W17A 5KMOA 4IX5A 4F1MA 5KMIA 3UYTA 4KRDA 3MA3A 3MTLA 5HX6A 2C69A 4DYMA 4EORA 3GCSA 4CFFA 4ASZA 2PZIA 3P08A 3EN7A 3DDPA 3ORMA 4I5PA 3CBLA 4IANA 3BKBA 2Q0BA 5L6PA 3TG1A 4CNHA 1ZMUA 5CVHA 4BR3A 2HZIA 4FSTA 5CX9A 4E4MA 4EQUA 3POOA 2BDFA 3FC2A 2G2FA 5F4NA 4HYIA 3A60A 3N9XA 2BDWA 4JL9A 3BWFA 4G9RA 3JVSA 2WO6A 3VS7A 4BHNA 5HLNA 5AP0A 3R83A 4AXAA 2REIA 1PMNA 4IAFA 3OWLA 1J1BA 4M8TA 4U6RA 3C0IA 5H8BA 2X8IA 5ICPA 4QQ5A 2YCFA 3CE3A 4CFMA 4YLLA 5FDPA 3GC9A 2HYYA 4MXOA 5M09A 3SAYA 4F63A 4FK3A 4BCQA 4BDHA 1WFCA 4GS6A 2VWYA 4RIOA 4ZK5A 4DH8A 5CTPA 4K2RA 4AP7A 5CZHA 4M3QA 2F4JA 2J0KA 1WCCA 3NVKI 1XQZA 3I0QA 4GK2A 4M13A 3ZUTA 4M97A 4B99A 1GAGA 4IDTA 5AUXA 2QG7A 4EHZA 5HOAA 3ZBFA 4RX5A 2R3RA 3OZ6A 4PTGA 2XA4A 1F3MC 3TV6A 3ZXZA 2NPQA 1GY3A 1U5RA 4MQ1A 3W1FA 3QD0A 3OT8A 4AE6A 1U59A 3Q4CA 3F7ZA 2F57A 1IA9A 1PKGA 4OR5A 4IB3A 1Q8TA 2I6LA 5KMMA 1FOTA 4GUBA 4F0IA 4J71A 2Z7QA 2C30A 2QD9A 1J3HA 2UUEA 4FUXA 4Y95A 4ANSA 3E8EA 5JKGA 2HXLA 3NYXA 4XS2A 3GT8A 2YCRA 1H1RA 3WZEA 4CSVA 4C0TA 4E4NA 3GC8A 4RPVA 1TQIA 3GU5A 3PVUA 4RLKA 4BKYA 4ZTNA 2JITA 3I6UA 5DT3A 1W98A 1H07A 3RBWA 4NKAA 4PX6A 5DHJA 4A4OA 4RWJA 5EOLA 2ZV7A 5ACBC 3FKOA 3QFVA 2SRCA 1CSNA 1YWVA 1H00A 3HX4A 4I0SA 4Y83A 2ITXA 2QNJA 3PIYA 5AA8A 4QQJA 4DE4A 1H0WA 4ACGA 4F0FA 5A4CA 3QXOA 4GIIA 5M07A 3LQ8A 4YSJA 5L3AA 2JFMA 4L52A 4ZY5A 2UVYA 3D5UA 3KL8A 2HY0A 4HCTA 5CEPA 2BIKB 1PXIA 4MXYA 4B8MA 3HA8A 3OY3A 4MQ2A 4I41A 4IC8A 2OK1A 4QMMA 3DGKA 3PIZA 3ALOA 5BMMA 4O0XA 2C0TA 3PWDA 3P0MA 5M4UA 3Q60A 2QOFA 3KXMA 4R5YA 3R7YA 3V8SA 5J95A 3LJ2A 1L3RE 4F7NA 2VTPA 5J7BA 4MD9E 3W10A 4RVTA 3LLTA 3FI4A 4DEEA 4FYOA 4K11A 5C9CA 4CFWA 4EZ5A 5HTBA 4AW1A 3QX2A 5IQGA 5CYIA 1XH4A 3F2AA 5E8UA 4FKPA 3SXSA 3FMJA 4J96A 4E93A 2X9FA 2WMXA 3PXZA 4FG7A 4DGOA 5IQEA 3DFCB 4GT5A 4YC3A 3CD3A 3PIXA 4JR7A 3SQQA 2BAJA 3TIYA 3QWKA 4FIHA 5J87A 2YIQA 5ETCA
chains in the Genus database with same CATH superfamily
4B9DA 3LOKA 1MQ4A 2YJSA 4W9XA 3RZFA 3SD0A 3VVHA 2XNEA 4I5CA 3TN8A 4FKIA 4GIHA 3D5WA 3QCQA 1H8FA 3C4ZA 3OC1A 4EEVA 3D9VA 3IK3A 3SXRA 4FEVA 3NUUA 4FZFB 4YPDA 3IGOA 3WF8A 5C01A 5LARA 4E6AA 4LGGA 2CN5A 5HKMA 3V5LA 4DFZE 3BLQA 3G15A 2VX3A 2W7XA 2WAJA 1OL2A 4EWQA 2O0UA 4X2GA 1IR3A 3KQ7A 4JRVA 3ZC5A 3L9NA 3I7CA 4TRLA 4E4LA 2BZKB 3BRBA 4P5ZA 2X0PA 4S33A 4WUNA 3ZSIA 1YQJA 2PY3A 3CGOA 2B1PA 3HMNA 3ZLXA 2QOCA 2XKCA 4D2VA 2OH0E 3LVPA 4QTDA 4WO5A 1LEZA 3BCEA 2HENA 2XRWA 4EH9A 3MI9A 2QOHA 3RPOA 2IPXA 5J9YA 2E9NA 5EYCA 4UMTA 1G3NA 5AUYA 4GUEA 5EDRA 4S31A 4GT3A 3RCDA 4PWNA 5JQ5A 5IEYA 5EW3A 3NRMA 4CT2A 2X7OA 1U4DA 3L9MA 1BL6A 4QP3A 5IQBA 1GZKA 3HP5A 1H4LA 2YIRA 4MD7E 5HCZA 3DT1A 3GC7A 2C1BA 4YTIA 2VV9A 4R1YA 2H8HA 3ZOSA 5M57A 4I6FA 2ZAZA 2V55A 3ROCA 3F9NA 2WQEA 5HE1A 2OF2A 1M2RA 4G6LA 3W18A 1GZNA 4FKRA 4QQTA 2UZLA 3ULZA 4ARKA 5CF8A 1ZARA 5M51A 4I3ZA 1YW2A 4L01A 3CC6A 5AUZA 4BDGA 4BBMA 4F78A 3HMIA 4MNEA 4AWIA 3FZSA 1UU9A 2XALA 4BTJA 5M55A 3FZOA 3LFSA 3V5PA 3HKOA 5DH3A 3OCSA 4BI2A 2ITNA 4GKIA 2RFNA 3GU4A 4U79A 5CZIA 4TWCA 3S1HA 2OBJA 1PMEA 3TZMA 5HD4A 4HYUA 4EOPA 3ORIA 3QU0A 3KK9A 4YHFA 4EOQA 2X39A 3RPVA 4NYEA 4FTAA 4O83A 2A4LA 2LGCA 5HE0A 4FTKA 2C47A 3ENHA 4YC6A 5JH6A 4LV5A 2XEZA 2PVKA 1CKPA 3RVGA 5LVPA 3FMHA 4FI1A 5C8NA 5IQFA 2BAQA 2GS2A 2ITPA 2QU5A 4HPTE 5I9ZA 3C5IA 2E2BA 4ASDA 3DOGA 4L9IA 3S4QA 4FV0A 1JPAA 4TYHB 3D7TB 3MIYA 5H2UA 5E8VA 4MKCA 5HNIX 3SRVA 3NGAA 4H1MA 3WI6A 2XK7A 2YAKA 1YI3A 2W5AA 1IG1A 4QMNA 3F61A 3EMGA 5CU3A 3TNIA 3LM5A 2IN6A 4NFNA 5GZAA 4HPUE 3KF7A 3DBCA 3NUNA 3LFCA 5ANIA 1OL5A 4BICA 5FBNC 3PY0A 2PE1A 3O7LD 5HESA 5ANKA 3EIDA 3LXNA 4QP9A 3TYKA 4QRCA 2CLQA 3KY2A 3BU3A 4EK5A 2NYAA 1NA7A 5CAQA 3W8QA 4M69A 2XP2A 4LGHA 5J9LA 4G2FA 4RFMA 4R7BA 5KMLA 4FTMA 2HXQA 3ML1A 4I5HA 5I9VA 4P5QA 2VWVA 3KEXA 1ZXEA 3LQ5A 5AJQA 1IASA 4R3CA 4F7JA 2FSTX 3B8QA 3P7CA 3EQRA 4QNYA 2A0CX 4ANOA 5J9ZA 3DXQA 3W8LA 4LUDA 3TNPC 4ZS4A 1ZLTA 1B39A 3MJ2A 4J52A 2YCSA 4EBVA 4OLIA 5E91A 3MH2A 4JDJA 5BUEA 4DTKA 2WOTA 4XP0A 3GFWA 4PTCA 2BMCA 5AP2A 4IJ9A 2XIYA 1BI7A 1T45A 1URCA 4X3FA 3PG1A 4CFXA 4Z7HA 5LMKC 2ZV2A 3VJOA 4NL0A 2O63A 3Q9ZA 1FMKA 1U54B 4BGQA 1KE5A 1JBPE 3LFDA 3OOGA 3HECA 3WE4A 5HI2A 3I6WA 2HWOA 4NM0A 2C68A 5F95A 5LVLA 3KVXA 4XV9A 4PMTA 1Q8UA 4BCPA 2WZJA 4YTHA 1Z9XA 3KFAA 3UMXA 5DN3A 3L9LA 1Q99A 5A6OA 5B2LA 3DPKA 2AUHA 4OTGA 2F49A 5AAFA 4FGBA 5CWZA 2QI8A 1ZMWA 2OF4A 3HMMA 4HZSA 5GJGA 4BDBA 1E1XA 4CZTA 5DA3A 5BX0A 3BL9A 2C0OA 1XH6A 2VTRA 2GQGA 2UW9A 2JKKA 3QTRA 4GU6A 4BZDA 3D14A 4XG6A 3VRYA 2W1GA 3T9IA 1KSWA 2WELA 4QMPA 4H58A 3VRZA 2VTOA 1PXMA 3UZRA 4IM3A 5AAGA 5HBHA 3NEWA 3PLAE 1SVHA 2ZM1A 3GUBA 4JOAA 4BCKA 4K6ZA 3K5UA 2J9MA 2V22A 3RCJA 4NUSA 4FNWA 3V6SA 2R3NA 4DF3A 4XG9A 3VS3A 3S00A 4BN1A 4JS8A 3MS9A 4QPAA 3PLSA 3FQEA 4FOBA 5K3YA 4DHFA 5GZ8A 2C3JA 1JOWB 4TN6A 4L53A 4O7RA 3P86A 4E20A 5E1SA 2PZRA 4ZY4A 3G9NA 5C03A 4G6NA 3UODA 5AA9A 2J5EA 4JQ7A 2YEXA 4O0RA 1IAHA 4E3CA 3BGQA 3E88A 5HVYA 4BCIA 4HGSA 3R8PA 2WQNA 1WBTA 3FPMA 4RRVA 4WG4A 3R7EA 5JFXA 2AC5A 3ZFXA 4MNFA 3G0FA 2G2IA 3FZTA 3ZO2A 4Z55A 3EOCA 3AD6A 3KVWA 5A3XA 4MWIA 3KA0A 3KXZA 2XRUA 2WFYA 3R04A 2CHLA 1UWHA 4LOPA 4EJ7A 4G17A 2ZOQA 4RWIA 3D2KA 4UXLA 3SW4A 5IUGA 3W2QA 2RG6A 4DFBA 4HGLA 2R7BA 4BGHA 3L8PA 1PXLA 4O0TA 5L2TA 5E8XA 3IO7A 1ND4A 1O6LA 3BV2A 3PG3A 2P3GX 2Z7LA 5EOBA 5EQPA 5IU2A 1R3CA 3VUGA 2O5KA 2VWWA 4I4FA 3UOKA 2CKOA 2PMOX 4YZBA 4E6DA 3BELA 3FWQA 4GJ3A 4DG0E 1OKZA 3VBXA 2X2KA 3ULIA 3QQLA 2BUJA 4CV8A 5FXQA 2C3LA 3UPXA 3U6IA 2PUUA 4FSNA 4MXAA 3C1XA 3QD3A 2YACA 3CGFA 3PRFA 2IZUA 1VR2A 4F7SA 3EQGA 5E90A 4J97A 4KKEA 3RHXA 1RQQA 3EQHA 3IG7A 3RK9A 3MWUA 2RF9A 3NUXA 4RSSA 4TKSA 3PE1A 5DE2A 2W1CA 1H0VA 5DT0A 5BVKA 4RIWA 4IXPA 1WBNA 3RWPA 4E5AX 3K3JA 5JT2A 5CT0A 5AUUA 1W82A 1J91A 3BPRA 3DJ6A 1W2FA 2OXDA 4FV3A 3TEIA 3TV4A 3R21A 4DEGA 4KUJA 3FLSA 4PDYA 4UMRA 3MIAA 4BDEA 4JJRA 4EH7A 5AR5A 5DR6A 5HE3A 3PRIA 1FVRA 4O0SA 4CZYB 4JRNA 5BVDA 1GIJA 4OTIA 1XBCA 3JUHA 2WTKB 4CRSA 1LEWA 4DG3E 2HK5A 3FEGA 4AQKA 5FGKA 2UZDA 3LFEA 1YDSE 4AXCA 4CQGA 5DLSA 2C0IA 2ERKA 2EWAA 5FTGA 3VS5A 1ZZLA 2UW4A 1K9AA 3CKXA 3HL7A 1W2DA 4OT5A 4XCUA 3VUKA 1FQ1B 1SM2A 5AR4A 5F20A 2XJ0A 4AOIA 3PJ2A 4LV7A 2PL0A 3PSBA 5E8WA 5E8ZA 4JAIA 1SZMA 2V7OA 3KULB 2BZIB 5LMAA 3GP0A 2CGWA 2P2HA 3TKUA 5EDQA 4FKQA 1Z57A 5IDNA 3DFAA 1P5EA 3QCXA 3ACJA 2BKZA 3H30A 2PULA 3C13A 4ZZNA 1XH7A 2GTMA 2QO9A 3EZRA 4F9CA 2ZDTA 3TNWA 5CF6A 2YCQA 4QPMA 2XIKA 1PXOA 4GT4A 2IW6A 3ZCLA 3ELJA 4IE9A 4IAYA 4FG9A 4EKKA 3FBVA 5JZJA 3NNVA 5EYKA 5KMNA 3UP2A 3PP0A 2HELA 3VBVA 2O2UA 3UOHA 1Q3DA 3PWYA 3R28A 4ASXA 2C6TA 4YLJA 1TQMA 4O7WA 3OXZA 5AP3A 4GH2A 4M15A 4GL9A 2YZLA 1R0PA 3ACKA 3DAJA 1CM8A 4YNOA 3AD5A 1NVRA 3W32A 5I9WA 3DCVA 2J0LA 2HZ0A 2VO6A 3VUIA 4KS7A 2JDTA 2YLEA 2YN8A 4TWOA 3AC2A 5GZ9A 1GZOA 2OO8X 3G5DA 3HVCA 3NNUA 1MP8A 4L68A 2O8YA 2OJGA 4EK6A 2VNYA 1R1WA 3PJ3A 4NIFA 4WNPA 5T6KA 4E8AA 2ZMDA 4IH8A 5DI1A 4CYIA 3EN4A 1V1KA 1JSTA 4C33A 3FYJX 3LJ0A 4OW8A 3F3UA 4UV0A 4ZLOA 1ZMVA 3DKGA 1TZDA 4H05A 4AGUA 5HIBA 2PE0A 5CEKA 3Q04A 4FF8A 4EJNA 2QOBA 3EFKA 2ZB0A 2GCDA 1UNGA 1SVEA 2NNWB 1OITA 5ETFA 4U41A 4WG3A 2JDOA 2X9EA 4AGWA 4DEBA 1REKA 2WU7A 3E8DA 4AACA 4CCUA 5AX3A 4BKJA 5IH4A 5KO1A 4Y72A 3OXIA 2HIWA 3SOCA 5CANA 3ZUVA 3AQVA 4OT6A 3R9HA 4UN0C 2W4JA 3R22A 4RMZA 4FRFA 4IB5A 5LVNA 2CN8A 3O96A 4W9WA 5EI8A 4OTQA 2F7XE 3FY2A 1UKHA 4FT9A 3TZ8A 2XM8A 5ANJA 2QLUA 4R78A 4AS0A 2BRHA 2BRBA 3ANQA 4E6CA 4HW7A 5A54A 2UW6A 2OJFE 5FXSA 4LG4A 2J0IA 5KMKA 3CY2A 3KREA 5EQYA 3NDMA 4IADA 4A9UA 4RJ7A 2PHKA 3PXKA 4DN5A 1PXKA 5EHOA 5M08A 3VWAA 4LRKA 3MTFA 3ORTA 3DK7A 5K5NA 5M53A 3Q3BA 4FSWA 1SVGA 1K2PA 3E64A 4JR3A 3KXNA 4ERWA 1XH8A 4AOTA 3ITZA 2YITA 4YJTA 2BALA 2UZWE 5AV1A 4FKUA 3O0GA 4OTWA 1BLXA 1AD5A 3KMWA 2B52A 2UZBA 2X2LA 2X0OA 4FNYA 3GBZA 3TV7A 1STCE 4MCVA 3P4KA 3FSKA 4JIAA 5E9EA 2CKEA 4G16A 2PVNA 3H9OA 4GFMA 3ZM4A 4BWPA 1P4FA 4TYIA 4I0TA 3HRBA 4FL2A 3BGZA 1RW8A 4WSYA 3HV5A 3TTIA 5B2KA 4QTEA 2V62A 3F5XA 2VO3A 4F7LA 2YJRA 3F66A 3A61A 4FKWA 2GNHA 4GV1A 4TYEA 1GZ8A 3RHKA 1OBDA 4OGRA 5D7AA 2IJMA 2W1DA 5CNOA 5KKRB 2J51A 1XWSA 3DXNA 3QHWA 4MNEB 3IDBA 5AR8A 5HG7A 4DAWA 3R0TA 4EK3A 3FMKA 3NAXA 2G1TA 3QZHA 1CKIA 2X4ZA 5CT7A 1H1WA 2WIPA 1Y6BA 4FTTA 4J53A 1J7UA 5AR3A 4YHTA 1IEPA 3PUFC 3CPBA 1WVYA 2OICA 4HYHA 1OZ1A 1YOJA 5E4HA 3R2BA 4NKSA 2QO2A 3KRXA 2IZSA 4YJSA 5LVOA 3PA4A 1I44A 2WMUA 3ZRMA 3UZTA 3GENA 3KK8A 4C36A 2X6DA 2FO0A 5FEEA 1L8TA 2ONLC 4HCUA 2QHNA 3QQHA 4YO6A 3MY0A 4FL1A 4F6WA 5ITAA 4O86A 1PJKA 2CKQA 3DAEA 4RVLA 3WIKA 1FMOE 3TACA 2XF0A 2XK8A 2ZVAA 3EQPA 4EOOA 4KD1A 2XK3A 2FSMX 4M12A 5DPVA 3EH9A 3DZQA 3RNIA 2G9XA 3PXYA 2VWUA 2X0QA 5CENA 4JIKA 3GU8A 3NW6A 4QP4A 4ACHA 3QRTA 4FICA 4FTQA 3SRVB 2KTYA 2NRUA 4BCFA 4HVHA 4JXFA 5EI2A 4YPSA 4FBXA 5AEPA 5L8KA 4R6VA 3P79A 1KOAA 4X2NA 4D2TA 5HU3A 3QQUA 3HAVA 2PVLA 2XZSA 5HU9A 2VAGA 4FV9A 3FE3A 4DC2A 2R64A 4OTFA 5DG5A 3U51A 4LYNA 2GS6A 3AC8A 3DQXA 4BFMA 2BDJA 3V8TA 3KIOC 2R0UA 5LQFA 3TZ7A 2YIXA 4O2ZA 1H08A 4IHPA 4L44A 2QKWB 5K9IA 2W99B 3E7OA 3EJ1A 1O6YA 4X3JA 4M69B 2XARA 3L9PA 4C3FA 3R7VA 4C58A 4A9TA 2BVAA 3W2OA 2PZYA 3RPYA 2RG5A 3C51A 4EHEA 3MFTA 3LCSA 3AT2A 5FD2A 5K0KA 1A48A 4N6YA 4F4PA 2BTRA 3MPTA 3F2RA 4KIOA 2JIIA 5HQ0A 4PL5A 1Q5KA 2CLXA 3PP1A 5CNNA 4WBOA 4PF4A 4D4YA 4DH3A 3E93A 3QKLA 4MK0A 5J7HA 1PYXA 3NPCA 3DBQA 2X0GA 3VHKA 4BB4A 1ST0A 1IRKA 3ENMA 3NWWA 4HGTA 3WOWA 3DXPA 4AAYA 3VF8A 1UU8A 2GNIA 4O38A 4M68A 5BVOA 3MVMA 4Y5HA 4X3FB 3UC3A 2JKQA 1Y8YA 4JX7A 4C3RA 4BYIA 3BLHA 4RX9A 4PV0A 4BBFA 1H28A 5CSVA 4QDEA 1YDRE 3ZRLA 4BL1A 5A6NA 5L4QA 2R5TA 3ZYAA 4DHIB 4ZMEA 2XH5A 5HTIA 5K4JA 5AP1A 3LMIA 4TTHB 5DR2A 4IB1A 4NW6A 3E7VA 5B0XA 4MXXA 3U9CA 4BDAA 2VZ6A 4CFVA 2B9JA 4FT3A 5JN2A 1VYZA 4DLJA 2W1EA 3BU5A 3UDTA 4RFZA 2JGZA 2CNQA 3PYYA 1W7HA 3HP2A 3EZVA 1QCFA 4AT3A 2ZM3A 3F88A 4PNKA 3DAKA 3VUHA 4Z3VA 2HW7A 2WNTA 1UV5A 2RIOA 3O51A 3QL8A 4USFA 2XCKA 3QZIA 2UZNA 5HVJA 5JSMA 2R9SA 3MVLA 3SKCA 4BTMA 5IQIA 5BYLA 3LKMA 4AA5A 4DT8A 2WHBA 3FJQE 4JBQA 4O1OA 4RBLA 2XANA 3D83A 3B8RA 4D1XA 5CF5A 2WMSA 4G6OA 2X6EA 2C6DA 3KULA 4BTFA 3HV6A 3G2FA 5DIAA 4FOCA 1SMHA 4GKHA 3D5VA 4FKGA 2X8EA 3DK6A 3F5GA 1E1VA 2UZOA 3MPAA 4FTJA 4S30A 5CAUA 4D58A 2PVHA 4J8MA 4C4JA 3FL5A 4D2WA 3ZTXA 2BFYA 4U9AA 3KF4A 4NCTA 5ACKA 2Q83A 3FQSA 3R1QA 5EYMA 1P2AA 5EH0A 3VONA 4WNMA 2FSLX 5HO8A 3V04A 3QLGA 4IVCA 3AMYA 4CGAA 4O81A 4FEWA 4D2PA 2F7ZE 3KRLA 2A98A 3AXWA 3GCPA 4DEDA 2WQOA 3COHA 3FZRA 4IIRA 5HGIA 3UOLA 3PJ1A 1V0BA 4LI5A 3GC0A 4OTPA 5J79A 3O8UA 4XYFA 2PSQA 1QL6A 5JZNA 4ACCA 4FKSA 2QONA 4GEOA 4BBEA 4O7LA 3UYSA 4PUZA 4GK4A 3PY3A 4GSBA 5FG8A 3UC4A 2BZHB 4LM5A 4H1JA 1CTPE 3HUBA 4BIBA 4FVPA 2YM8A 4UBAA 3JR1A 1ZOHA 3KB7A 3OWJA 2E9VA 3CQWA 1QPEA 3HRFA 4U97A 3VBQA 4EK8A 4CFUA 3L8SA 4IJPA 4FV6A 3KMUA 3IPHA 4WBBB 4IFGA 4FUYA 5CEMA 4QO9A 4NZWB 3QTIA 4XLVA 4FSQA 1OL7A 4AG8A 5J1WA 5GIOE 4G3GA 4M0ZA 3TNHA 4ZS0A 4DFXE 2P4IA 3BV3A 2ZV9A 3NYOA 2ZDUA 3BYOA 5AR7A 4HVGA 2UW7A 3DBDA 1DAYA 3O50A 4MWHA 3DZOA 4QMOA 2RFEA 2OZAB 2VN9A 4EUTA 2EB3A 3QA8A 5AUTA 3Q4UA 4I6HA 1BYGA 3RGFA 3EHAA 3W33A 3E3PA 4FKLA 3IW6A 3MH3A 1DI8A 4FEXA 2Y6MA 4YUQA 4R7HA 4LUEA 5HD7A 4MD8E 1H27A 3BLAA 4AF3A 4EOLA 4XG3A 3W2PA 3IECA 3UQFA 4KAOA 4AN2A 1H1SA 2WKMA 3KGAA 2OWBA 3QX4A 3FI2A 1YHVA 3PY1A 3RM7A 3KN6A 3KCKA 5K0XA 1V0OA 1F0QA 3ALNA 3QRKA 3A7GA 4RC2A 5EW9A 3W0SA 4RIWB 2UZTA 4JBPA 3PVGA 4IC7A 3IKAA 4NM7A 5KE0A 4BHZA 3ETAA 3BWJA 3O8TA 3GVUA 1ZYSA 2GDOA 4YNEA 4F9WA 3FZPA 4YJPA 5CI6A 4HZRA 3BEAA 4MHAA 3IGGA 4ANNA 2UW0A 1PW2A 3AC1A 3SXFA 4OAVB 2ZV8A 2QG5A 3F3VA 1GJOA 2EVAA 2QO7A 4FZ7A 5E7RA 5F94A 2XEYA 3P78A 4E1ZA 3UO4A 2GHMA 4YJUA 5IUHA 2OGVA 5M56A 3G51A 2WTKC 3VS2A 4C4IA 4MUQA 4QMLA 3HDMA 2QR7A 3OBJA 1LR4A 4O4DA 3OT3A 4AFJA 4CMTA 4QP7A 5EM5A 2PK9A 1APME 4GFOA 5JRQA 2XCHA 1WVWA 1OB3A 3DKFA 3N4UA 1E9HA 2XBAA 4FSUA 2VO0A 4IQ6A 1Z5MA 3WYXA 2C5VA 4FZ6A 3F69A 5JFVA 5EHLA 3U6JA 5A4EA 5FUTA 2JAMA 3R71A 4BI0A 1NXKA 1HCLA 2YA9A 3QQKA 4K33A 3FDNA 5FLFA 5BVEA 4W4YA 5EG3A 4ITIA 2IO6A 1BKXA 4QNAA 4QTCA 3AG9A 5J8IA 4XG7A 5BMSA 4N4SA 5AV4A 1H1PA 4LMNA 3FI3A 3PZHA 2RL5A 5HNGA 5IMEA 4RVMA 3HZTA 4LRJA 2VX1A 3NIEA 5C4KA 3R9DA 3BLRA 3HLLA 3QZGA 5FDXA 2AC3A 4BWKA 1XR1A 5CEOA 4UYAA 3Q4ZA 2WMBA 4FV2A 4FC0A 2C1AA 3A2CA 1OIQA 4PMSA 3TTJA 4G3DA 3OW3A 3W0RA 1M2PA 3QGWA 4DCEA 3JVRA 4K18A 3DLZA 3ZBXA 4BYJA 4CQEA 5BPYA 4GYIA 5HZNA 3UIMA 5I5ZA 4WA9A 4QYEA 5C8KA 3UVPA 4ALUA 5D12A 3PPZA 4TWPA 4C34A 5AUVA 4P4CA 2B9HA 4D4SA 3BQRA 4KSQA 4NIFB 2XIXA 3QTWA 4XH6A 3AKLA 2JIUA 5IPJA 2ZM4A 4L7SA 3FLQA 3QTQA 4JLCA 2C5OA 4V05A 4FIFA 3Q2MA 3Q52A 3IW8A 2UVZA 4FE2A 2ETKA 3PXRA 2QODA 4KA3A 3RKBA 4IW0A 3SW7A 5DR9A 4JQEA 5DGZA 5FM3A 1MQBA 5F9EA 2XYNA 2ZJWA 2J7TA 1QMZA 4GK3A 1OPLA 3K2LA 4XV1A 2VTLA 4LOQA 4QD6A 5EQEA 2QCSA 2CCIA 2J4ZA 5ETIA 5HIEA 3ORPA 4RVKA 5D41A 4U43A 3FC1X 3MW1A 5IISA 3TUBA 3W2CA 5E8YA 4NM5A 3R63A 4OTRA 3BX5A 5H9BA 3EL7A 3OXTA 3KXXA 4BCMA 4X2FA 1YXTA 2OIBA 3HDNA 3IONA 3QF9A 2PZPA 2GHLA 2C6OA 2VTSA 4KINA 4QMWA 3LMHA 5LXMA 1KV1A 3QWJA 4KNBA 3VIDA 1FPUA 1J7IA 1M14A 1RJBA 2IWIA 4FG8A 2I40A 5FBOA 1YHSA 4BCGA 4FEUA 3BHVA 3PA3A 1U5QA 2ITYA 4I4EA 2XNGA 5E8TA 2XNOA 3ZSGA 2Y6OA 4YTFA 4I1ZA 4QMQA 2UZUE 1OI9A 4ZXTA 5C26A 2W05A 1M7QA 1JSUA 5IA1A 4RJ3A 2CKPA 3LW0A 4OBOA 4QMTA 4D0XA 5C4LA 5KUPA 3QC4A 3DTCA 2QQ7A 2BAKA 2J5FA 2OG8A 3JYAA 3EYHA 4MYGA 3DNEA 4DFLA 3LXLA 1Y57A 4RJ6A 4QYYA 2WIHA 4FL3A 3TXOA 4TL0A 4YZDA 3VULA 3VS0A 4QMZA 1HOWA 2DS1A 4IB0A 2Y0AA 2IVSA 5AAEA 3MJ1A 5IA0A 3LFQA 5HBJA 3QBNA 4WKQA 4PY1A 2DWBA 2ITTA 5CU4A 4E5WA 3VF9A 3QQGA 2RFDA 3PJ8A 5DEYA 4V0GB 3S95A 4NH1A 4DFYA 1XJDA 5KHXA 4OAUC 1OL6A 4RZVA 4ACMA 4UEUA 3LCTA 4ONAA 1DS5A 1MRUA 3LPBA 3BE2A 5CAVA 5L6OA 3VN9A 3O2MA 2W9ZB 3R8UA 4GVAA 4TYGA 4ZJJA 4H3BA 2XNPA 3F2NA 3Q53A 3BEGA 4A06A 4EK4A 2BRGA 4IX3A 4FT0A 2XVDA 2FA2A 1O9UA 2ETMA 5IA3A 3R1NA 4PL4A 5KKRC 4O0YA 1H01A 5HORA 1NVSA 1OIRA 3KKVA 5ANGA 3DNDA 4RIXB 4CKRA 4W8EA 2IG7A 3BBWA 3MB7A 4ORKA 4H36A 2C3KA 2HAKA 2NO3A 3FUPA 3HA6A 4I23A 4RWLA 1PYEA 2WTIA 3F82A 4PPBA 3UIUA 4GYGA 2C5NA 4NM3A 2I0EA 3CPCA 3FMMA 1PMUA 4BDFA 2PVFA 5TR6A 5HTCA 3DA6A 4R77A 2VWBA 2QR8A 5FQDC 4LL0A 2BIYA 2C6EA 4V01A 4ZEGA 3UQCA 3OCGA 3OCBA 3ZH8A 5LMBA 1KUTA 5LWMA 4NJDA 3R8MA 3GNIB 3F5UA 3ODZX 2PYWA 4FT5A 3R7UA 3V5QA 4F65A 4DTBA 4FR4A 1W84A 2B53A 3WZJA 5EDPA 2V5QA 3ZM9A 1LPUA 3U9NA 2X8DA 4YZCA 4A4XA 3NVMB 4M0YA 1WBOA 2VWIA 3NX8A 3RAIA 4FV5A 4ZZMA 4BCJA 5ANDA 2R0IA 4D2RA 1PY5A 4MH7A 1QPJA 3U8WA 2PVMA 4RA4A 3T3UA 4UY9A 3UBDA 5IQDA 3M11A 3SHEA 5JFSA 4U44A 3G90X 1OKVA 2OIDA 4IAIA 1ATPE 2R3LA 4O91A 1GNGA 5JQ8A 3DDQA 2GFSA 3MPMA 4KIKA 2EB2A 3II5A 1BI8A 2Q0NA 2W1ZA 3OD6X 4EH2A 4XOYA 4A07A 4AZSA 4PMMA 2QOQA 2R3IA 3SGCA 4EH8A 5HO6A 5IKWA 2OZAA 1NVQA 4IZ5A 2BROA 4KIPA 4FYNA 1G5SA 3TNQB 2PPQA 3LJ1A 3OG7A 1MRVA 2QOLA 3M42A 2YDKA 1XH5A 1XBAA 3COKA 1TKIA 2OFUA 2XNBA 3DBEA 1OM1A 3LFBA 4BTKA 4KIQA 1JKTA 4IM0A 3UVQA 1OBGA 5M4CA 2PZ5A 3ID6C 4DBNA 4ANLA 1TVOA 4ZSAA 4BIEA 1QPCA 1OMWA 1REJA 2VTAA 3FMDA 4FK6A 3PFYA 4QMYA 4QYGA 4C4FA 2NRYA 2XIRA 3R73A 4G5JA 4X3FC 3R8ZA 1K3AA 3MVJA 4LFIA 4A4LA 4BWXA 3W0NA 4BDDA 4AXFA 3WZDA 2FB8A 1G8SA 2J50A 4RJ5A 1ZOGA 4JI9A 5IA5A 3U87A 1KE7A 3BQCA 3ODYX 4O6EA 4O4BB 3HMPA 3U4WA 3ZFMA 3ZEPA 4C61A 1OGUA 1YVJA 3OTVA 1SNUA 4FSMA 4X0MA 5DRBA 4EOIA 4G5PA 2XK9A 5AV2A 4QDVA 3VJNA 4PMPA 4I93A 3ET7A 4I0RA 2FYSA 4ZSGA 2XAOA 2R7IA 5JGBA 4DINA 3EFLA 3BYUA 3OEZA 1FVVA 3K3IA 2IVTA 4J98A 4O4EA 3DB6A 1FGIA 4TZRA 5H8EA 3D15A 4C2WA 3DK3A 3ZFYA 4UMUA 5CSXA 2JBOA 3MVHA 3U6HA 3Q9WA 2OFVA 3ZDIA 4DFNA 2HOGA 5CSPA 4XG4A 1TQPA 2W5HA 1YXXA 3MFUA 4LL5A 5FTOA 3VAPA 3R1YA 2VNWA 1S9IA 3QRJA 4O0VA 3LIJA 4USDA 3WF6A 4BF2A 3VS1A 4I6BA 4PDSA 2WMWA 3LLAA 3EFWA 5TO8A 5GIPE 2OJJA 4AE9A 3PXQA 5TOZA 3NR9A 4PDPA 4PP7A 2C4GA 2YM4A 3R8LA 4QMSA