2JDSA

Structure of camp-dependent protein kinase complexed with a-443654
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAMP-DEPENDENT PROTEIN KINASE
publication title A Structural Comparison of Inhibitor Binding to Pkb, Pka and Pka-Pkb Chimera
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 109
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jdsA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jdsA02
4IB3A 5EI8A 4H58A 1ZWSA 3QQFA 3OG7A 4YHTA 4EORA 4HCTA 2QONA 5EYDA 2C5NA 4O84A 4BGQA 5M4FA 3QA0A 3QZHA 4L01A 4FTOA 1K2PA 4FV5A 4CG8A 3TG1A 5CU6A 2BIKB 2VAGA 3ZHPC 5IA4A 3HV3A 4GT5A 4EOPA 4IB0A 4YR8A 3R2BA 3N4VA 5BVKA 3UZTA 4O7RA 3K5UA 3A7HA 3QWJA 4NM7A 3D7TB 3QLFA 2JDVA 2PVHA 3FZSA 2Z8CA 4FTIA 2J50A 3SRVA 1FVVA 2PUPA 3BV3A 4FSZA 4Y85A 3R7OA 5GJDA 4ZJVA 2I40A 1ZYLA 2P0CA 2JKKA 3GI3A 3R00A 4FTAA 2X6DA 3VS6A 1P14A 3ULIA 3ZO4A 3ZUTA 4KKEA 4UB7A 2HXQA 4QQ5A 4AXAA 1LR4A 2VTOA 2W06A 3DT1A 1OIYA 2VWWA 2WD1A 1JSTA 3HDNA 3JS2A 1YQJA 1A9UA 2VGPA 3SQQA 2QI8A 4L45A 3BHUA 3R9HA 4U40A 3QKMA 4H39A 1LPUA 2H8HA 2IZRA 3OVVA 3QQHA 4JIKA 3ZDIA 3HMMA 5BVWA 4QYEA 2QD9A 4FV0A 4D5HA 3LXLA 3ZRMA 3TUDA 2JIUA 2R3NA 3FI4A 1TQMA 2RFEA 3R8LA 4O7YA 4ZTSA 2OF2A 2W5BA 2W1DA 5BUJA 4RX8A 4ZZMA 1E1VA 5HHWA 3V6SA 3O2MA 5I9YA 4EHGA 4IC7A 3P79A 2O64A 5CWZA 3QAME 1SNXA 1Q8YA 2XRWA 4O22A 4UEUA 1PXIA 2YITA 2XIRA 4G6NA 4TNDA 4RPVA 4D2PA 3E87A 4UBAA 3RWPA 3PYYA 2Y8OA 3I0QA 2VTPA 3BEGA 4I24A 4O7SA 3FDNA 1Y91A 3TDVA 2ZV8A 3OEFX 2YISA 4LUEA 4QMOA 3WF8A 4J53A 3EN7A 5IMXA 4AN2A 2O8YA 3OOMA 3VS3A 3TKIA 2W4JA 1BLXA 3MH3A 4FR4A 4YNEA 4FTMA 5L2SA 3OTUA 5BVOA 3ATSA 2JDSA 4JI9A 4KIKB 4B9DA 3FV8A 1ZRZA 3ZSIA 2R3HA 2YZAA 3KGAA 4AA0A 1ND4A 2GS2A 4EQCA 3ID6C 1I09A 4KA3A 5CAOA 2OH0E 3MFUA 2PZ5A 2PK9A 3D94A 3T8OA 3Q9ZA 4BDJA 3C0GA 3DJ7A 4KAOA 2C5XA 2XJ0A 2GQGA 4BZNA 4EONA 4NH1A 4NW5A 4GK4A 2OXDA 3W2OA 2UV2A 2QODA 4A7CA 5HLPA 3BU5A 1Z5MA 3VBYA 1XH9A 1V0OA 3ZDUA 3E64A 4DGMA 1OKWA 1PMEA 2CCHA 3ZZWA 4BTFA 4PP7A 4O0UA 2IW6A 3QTSA 3OUNB 3DGKA 5L8KA 1PKGA 3A99A 1PKDA 4EH2A 3UNJA 3IW4A 2IZSA 4L44A 3ZEPA 5IDNA 4FV2A 3NYVA 4H1JA 4ALUA 4C33A 3OWKA 2XJ2A 5GHVA 4X2KA 3KFAA 4MEDA 1AGWA 4GJ2A 3JUHA 4DAWA 4F7SA 2NRYA 1OMWA 4JDHA 1OIUA 4U79A 4CMTA 2ITNA 1G5SA 4ZZOA 4JDIA 1TQPA 4BZDA 5J9ZA 3UZPA 4FKJA 4U6RA 4EK5A 1JQHA 4NUSA 4B4LA 2JEDA 5LMAA 2W4KA 3OZ6A 4TTHB 2WTVA 3I81A 3MVHA 2JDOA 4RWLA 4U45A 3R8VA 3T3VA 3DBCA 3U4UA 4EKLA 2IPXA 3FLNC 4F7NA 2C69A 4WA9A 3V8TA 2Y6OA 3ZLSA 2UVYA 3OTVA 3O71A 4XJ0A 4O0XA 4GJ3A 4QMLA 3WARA 4JG7A 1PYEA 2WZJA 3F69A 4G3DA 4FZDB 4JDJA 3PJ1A 5AP0A 3UGCA 4AE6A 3H0YA 2QVSE 1JKSA 2ZVAA 5T3QA 1XH7A 4AW2A 4X2GA 2X2MA 1GIIA 2HELA 3KEXA 5AP5A 1H01A 4USDA 4QMVA 5JFSA 2PVMA 1OI9A 4EUTA 3C4EA 3QLGA 2CKQA 3L8PA 1U5RA 2QNJA 1JSUA 2YM7A 1OUKA 2J0IA 4UYNA 3ODZX 4M68A 3UP2A 4ZAUA 4RLKA 4ZK5A 1CM8A 3FYKX 4CFFA 1F3MC 4FIFA 2X8IA 5EM8A 5HLNA 5IUIA 3ACJA 3BLQA 1W0XC 4D2SA 3EYGA 4O86A 4CZTA 4I6QA 1P2AA 1L8TA 3TL8A 4GKIA 5M4UA 5JFWA 2YAAA 4TYHA 1CKIA 3HUBA 3FKNA 2GFSA 5HZNA 2HK5A 3DQXA 3E88A 4CEGA 5JGDA 4H36A 3VQUA 2ZOQA 1GZNA 3QKLA 3ZZEA 2VWVA 3G33A 1Y6BA 2F57A 3GB2A 3L1SA 2R3FA 3MS9A 1UWHA 4YJRA 4RWKA 5FP6A 4MD8E 4LG4A 4QNYA 4QTDA 5CSVA 4W4YA 3TM0A 2QOIA 2R3LA 2Y9QA 1JBPE 3JVRA 1E9HA 4YSMA 3RKBA 2ZV2A 1WBPA 1IR3A 4CFMA 1APME 4AZSA 2X39A 1OBGA 2ERZE 4YSJA 4ANSA 3KKVA 3I4BA 4JG8A 5JGAA 4N6ZA 1ZAOA 4A9UA 3DFAA 2ETKA 3GC7A 2X0GA 3R1NA 3F9NA 5KMLA 4IX5A 3F66A 2PMNX 5CNNA 5EHLA 2BKZA 2PE2A 2R5TA 4BI1A 5IA2A 3ITZA 2BZJA 3FLSA 4E3CA 4D4SA 3JR1A 2X7OA 2H6DA 5B7VA 2QOHA 4C4FA 3H9FA 3Q53A 3NVKI 3L8VA 3G5DA 1GIJA 4GT4A 3O23A 4GW8A 5FEEA 2EUFB 4O96A 4EK8A 3MBLA 4AT3A 5IA1A 2UUEA 2XRUA 1YVJA 2ITUA 3B2TA 2J0KA 3DK3A 5FTQA 3WF5A 4DYMA 1IAJA 3G90X 2ZJWA 5JH6A 4TYIA 4X2NA 4L8MA 3LQ5A 3VJOA 5LMKA 3MB6A 4FODA 4BTKA 4USEA 4JQ7A 4WNMA 4AWIA 4D1SA 3TZMA 5CSHA 4LGDA 1M7NA 2PVFA 4G34A 3FMNA 5CTPA 5DIAA 5HTIA 5LQFA 4AT4A 2XK8A 5CI7A 2R7BA 4DH1A 3GP0A 4FV7A 5DR6A 4MBLA 3FMHA 4DFNA 5CEMA 4GKHA 3C50A 2Y0AA 4JBPA 1UKHA 3NSZA 2EXCX 3C4XA 1XH4A 3KK8A 4E5WA 5IZFA 1BL7A 1XH8A 3D2IA 5LMKC 5IQIA 1V0PA 3AOXA 2X9EA 3QFVA 5EI6A 1H4LA 4FTRA 4IHPA 3H9OA 3UDBA 3KXHA 4GYIA 4U0IA 4IX3A 4CD0A 4ZMEA 4BC6A 5GJGA 5F9EA 3UOLA 3FAAA 2BRHA 3KULB 3VIDA 3QZFA 3EWHA 4Q9SA 4IAZA 4XG9A 2FH9A 5JZJA 3W2CA 1H00A 2JKQA 5AV2A 4HVIA 5BPYA 1J7UA 4O0TA 5BVEA 3W2SA 5B2MA 1OZ1A 3WZEA 5L2IA 2CMWA 4YUQA 4RWIA 3ZYAA 4F0IA 4W9XA 4BCOA 3R2YA 2WB8A 1FBNA 5KHWA 3N4UA 4QP8A 4ZSLA 1L3RE 4WOVA 3UC3A 1B39A 4PRJA 4WT6A 3OBGA 5IQGA 4O6EA 5DR2A 1ATPE 3Q04A 4FV9A 5I3RA 1Q62A 2FSLX 3NRMA 4FK3A 4KB8A 3TV6A 5LVNA 1WAKA 4TPTA 1OL7A 2WIHA 4XS2A 5E7RA 4DEDA 5AP3A 3BGPA 2PZIA 4YMJA 2X4ZA 3EZVA 5KMOA 5TO8A 4BIDA 4WHZA 3EKKA 2XK9A 1YRPA 3NIEA 1R78A 3LQ3A 3BYSA 3MGYA 2C6MA 3OXTA 5TOZA 1UNLA 3R83A 3ODYX 4LOPA 4AA5A 2DYLA 4FVPA 2KULA 5L2WA 5AV1A 2A2AA 2B7AA 3DLSA 3LJ2A 3DJ6A 3S4QA 3W2QA 5AA9A 3FEGA 3EJ1A 3WYXA 3TN8A 2WMAA 2VUWA 3OHTA 4RJ5A 4K0YA 4HYIA 2IJMA 5F1ZA 2IVSA 4YHFA 5DYJA 4MXOA 4CZYB 3DXPA 3LCOA 4JBOA 2Y4IC 3BWFA 4ACGA 4TYHB 5IUGA 2F4JA 2CGUA 3L9LA 3UIBA 4D58A 4P90A 3FQSA 4R3CA 3UG2A 5K0KA 1IA8A 3A61A 4D0WA 4E8AA 2IW8A 4GK3A 4AA4A 4OTWA 3RAKA 3LFAA 1WZYA 2VRXA 5EDPA 4C36A 3ORIA 4XUFA 3FPQA 5DGZA 3UPXA 4JOAA 4ZSJA 4QQCA 3UG1A 4OTIA 4O38A 4MH7A 3R7EA 4NFMA 5JRSA 4C02A 4C7TA 4IM0A 5ANDA 3F3UA 5LWNA 2C1AA 4RC4A 4DEIA 3N4TA 5K4IA 4E4LA 4BHNA 2JIIA 4E4XA 3LQ8A 2QC6A 5AIKA 5E9EA 2YCFA 3UJGA 3E8NA 1M17A 2WTKB 2OU7A 2BRGA 1DI8A 2V7OA 4JR7A 3E8EA 4J97A 4RC2A 3RZFA 3T9TA 4DBNA 2OW3A 4O91A 2HYYA 1GIHA 1NVQA 2REIA 2GQRA 3DBFA 3D5UA 3MJ2A 5EYKA 3MFSA 4C0TA 5CEOA 3BHTA 5HE1A 3QGWA 4IZAA 4Y95A 3RP9A 4EQMA 4KBCA 3AXWA 3QKKA 3ZFXA 3UNZA 2CGXA 2V22A 2UZLA 5HO6A 3E92A 1XO2B 1F5QA 3PPKA 1B38A 5A46A 1K9AA 2JDRA 3ZFMA 3EQPA 1ZYJA 2Y7JA 3Q9WA 2QURA 2X8DA 3W33A 3LLAA 2QHNA 4TYGA 5HCYA 4KIPA 5IPJA 2I0VA 1PF8A 3IS5A 3K5VA 4E6QA 5J7HA 2BPMA 3OW3A 4CKIA 2OF4A 3R8ZA 2R0UA 2XCKA 5AA8A 3KRJA 1JVPP 3T3UA 2BRBA 4B7TA 3A8WA 1W82A 2ITOA 5KCVA 5L4QA 1RQQA 1KUTA 2R3OA 4CV9A 1UU7A 2HW7A 3GT8A 3IGOA 1OL6A 3R04A 1WBTA 4PTEA 1URCA 1SVGA 3EB0A 3KL8A 4WG3A 4UYAA 2R3GA 5HD7A 3FLZA 4AOIA 5C1QB 3P23A 3CTHA 2YEXA 4U3ZA 3PRIA 5FDXA 2QOOA 3CJGA 3HEGA 4FTTA 2E9VA 3FE3A 4DGNA 3RPVA 2XUUA 4EWHA 2YDJA 3R6XA 4FX3A 5LMBA 4F1OA 4DGLC 4FT9A 4FTKA 1DM2A 3HV4A 3RPYA 3ORNA 4L53A 3PY1A 3KVWA 5BUIA 5E8YA 2C0TA 3PSDA 3NNUA 1FMKA 5FM3A 3WBLA 3ZC6A 4DGGA 4IJPA 3GCVA 4RT7A 5F95A 1O9UA 1FGKA 2F49A 2GNFA 2BDFA 3DDPA 3OFMA 2GCDA 3ORZA 1R1WA 2C6TA 3HL7A 4IQ6A 5G6VA 1XQZA 3UTOA 3SXFA 4GVJA 2YFXA 3RHKA 2NP8A 4D4YA 5HU9A 3I7CA 2BFXA 2C6EA 3ELJA 1Y8GA 4IZ7A 3VHEA 4NZWB 2JBPA 5D7AA 4BDKA 1JKTA 3GU6A 4JX3A 4ERWA 2CDZA 3JVSA 3HUCA 3PP0A 2PPQA 3EHAA 3PIYA 4P2KA 4RQKA 4C59A 4D4RA 1VEBA 4CMUA 1JKLA 4QO9A 4JT3A 4M8TA 3EN5A 3G6HA 4TWOA 3FZ1A 2QOLA 2HXLA 3DY7A 3H4JA 1MRYA 4CVAA 3OC1A 1R3CA 4GVAA 3HX4A 2V55A 3WZJA 3PIZA 4DH3A 2YWPA 3DPKA 2ZMCA 4GCJA 1OVEA 4OT6A 5H9BA 4O7TA 2F7EE 5AWMA 5A4LA 3VO3A 5D9HA 5J5TA 4I92A 1WVXA 1MRUA 3PJ8A 3GOPA 3EFKA 3Q4TA 3DV3A 4R1YA 5CT7A 3Q9XA 3ZUVA 3TJDA 2CLQA 4IAAA 4AZTA 3QC4A 2BZKB 3HMIA 1P5EA 4PL3A 3F3VA 5AEPA 5AM7A 5AV0A 1U4DA 4DFZE 5FQDC 4F64A 4JAIA 4XG2A 5E90A 5M07A 4GSBA 2OI4X 2YIRA 3DOGA 5F20A 5IU2A 5FBOA 2XNPA 2EB3A 5AP7A 2QO7A 2VV9A 3IO7A 4EK4A 4ERKA 3ORXA 3UQFA 4CGAA 1FPUA 4FTUA 5JGBA 2PL0A 4K11A 5HE2A 2J90A 5AMNA 2FO0A 2R4BA 3BYVA 4UZDA 5M06A 2QOCA 3SKCA 4XV1A 3FZTA 1R39A 2OO8X 4I6HA 4IWQA 4RIOA 3LFQA 4NM0A 4L46A 4I6BA 1H08A 4A07A 2B9JA 4YNOA 5J95A 2G1TA 3GCSA 4CT2A 3QALE 2WKMA 2RL5A 3LCSA 4FVRA 5E8UA 3PVBA 3E3BX 3E7VA 1DAWA 2XM9A 4NSTA 3UE4A 4FNXA 2YM3A 3I60A 3IW5A 5ANOA 4ZTQA 4PTCA 3O7LB 1E1XA 3LM5A 4V0GB 3V01A 4D1ZA 2J6MA 2J7TA 3FPMA 5L2TA 4O0SA 2OZAA 3S1HA 4WRSA 4ZTLA 4GL9A 2YA9A 2R3KA 5L8JA 4CFVA 5ETIA 5CU4A 5FBNC 2IO6A 2ZB1A 4W8EA 3HRFA 4O7VA 4HGEA 2YAKA 3V5TA 1GY3A 4RIYB 5C9CA 4BDEA 1RDQE 2F7ZE 1WCCA 4X3FA 4JQEA 4U41A 2HCKA 5AP1A 3CIKA 1NW1A 2UZOA 5EM7A 3CXWA 1FVRA 2X2LA 4XEYA 1PJKA 4AFJA 4EYMA 4EL9A 3O50A 1REKA 3QUDA 3AC1A 4KBKA 4P4CA 3KCKA 3VUKA 3Q2JA 2VWIA 2QU5A 4IZYA 4G31A 1F0QA 4XV3A 2J0LA 4F70A 2YIYA 5TF9A 3RNIA 1YDSE 1GZ8A 3ZEWA 5DT0A 2YJSA 3LFBA 3PE2A 5AADA 5KZIA 3CTJA 4L43A 3FL5A 4O6LA 3QQKA 3FMLA 4NKSA 4PPAA 4CKJA 4X3FC 4F99A 1MQ4A 3PLAE 4AW5A 3RHXA 3H0ZA 3RTPA 2SRCA 4YZNA 3C7QA 4J99A 4U81A 3PDTA 1ZLTA 3RZBA 4CZUA 2VZ6A 3NUUA 3W10A 2E9NA 3PXQA 4FKUA 2ZM1A 3MWUA 3ORMA 3DTWA 4G3CA 2GHLA 4BYIA 3G15A 4RC3A 5CXZA 3DDQA 2IG7A 2C1BA 5CEIA 3F2AA 2UZBA 4CCUA 2P55A 4J98A 4Y5QA 5KMKA 4CKRA 3BHYA 3FMMA 2UZVA 3MIAA 4RFMA 5C4LA 2UZUE 5JN2A 3WF6A 3QD4A 5AUXA 4NIFA 5HO8A 4XMOA 4XH6A 5A4CA 2PVKA 1NY3A 1IG1A 3KF7A 2VWXA 1R0PA 3CD3A 3GENA 4F9WA 3COMA 3C5IA 3TV7A 1RE8A 3SVVA 1U5QA 3F3TA 2JKMA 1YHSA 1YI6A 1H1PA 4H3BA 3R8MA 2P2HA 4EI4A 4G5JA 2B9FA 2YERA 3VUMA 1Q61A 3FJQE 2A0CX 4G5PA 4O0RA 1PMVA 1ZZ2A 1MP8A 1BI7A 2WMVA 3QTUA 3LXKA 4IANA 5AAFA 4B0GA 2JFMA 4BCMA 3A4PA 5CALA 1PW2A 3GU4A 3NUPA 4HJOA 4C38A 1Q8WA 4ITHA 4A9TA 2WQBA 2VU3A 3QTIA 4BBMA 3U9CA 3SG8A 4J96A 3RBWA 4EK3A 3PVWA 2WFYA 3DKFA 4KBAA 4ONAA 4ZY4A 3C0IA 2WMRA 4QQJA 2O65A 2I0EA 3EQGA 2YM6A 2FSOX 1YXUA 4QMWA 4YJSA 1WBOA 2PMIA 3Q2MA 4YLLA 2PUUA 5HNIX 3ZLYA 3L8SA 1CKJA 2QO2A 4QYYA 4QYHA 4UV0A 4EUUA 2QG5A 3HDMA 3CBLA 3EQCA 3NEWA 3PPJA 5IA0A 1YOLA 5JEBA 2PTKA 5CU2A 3GNIB 4E6CA 1BL6A 3OCGA 4YLJA 3UMXA 3KXNA 3PA3A 4PL5A 1XJDA 1A48A 4FE2A 3VF9A 5CANA 4K33A 5M53A 2J51A 2CGVA 2RG6A 2W0JA 2FSTX 1VYWA 3CC6A 3PG1A 2Z60A 4YURA 4FIIA 5HG9A 3U54A 2J2IB 3MI9A 4ITJA 3PVGA 5J9LA 4MHAA 4WD5A 1H07A 2PYWA 3LMIA 4XG3A 2HENA 2VNYA 2ACXA 3EZRA 4U5JA 4XLVA 3F5UA 4TRLA 2GHMA 1RJBA 4UXQA 3I5NA 1ZYSA 4N6YA 3B8RA 4TW9A 2VWUA 4RX7A 3HZTA 2IN6A 5I9XA 1G8SA 2CNQA 3R28A 2B53A 2RIOA 5CS6A 3QX4A 1U54B 4EK6A 4CLIA 3B8QA 2XK4A 4HVGA 4CYIA 2CN5A 4QMYA 3PRFA 3TT0A 2G2HA 4M0ZA 5C8MA 5JZNA 4R7IA 4C3RA 4YTFA 3ZM9A 2UW0A 4OBQA 3E63A 4EH7A 1URWA 3BX5A 2OXXA 2BIYA 4EH6A 2V7AA 2XP2A 3R1QA 3FHRA 4AZFA 1XHAA 5FD2A 4O27B 3ZMMA 3NAYA 5D10A 5BYZA 3SC1A 4CQGA 4QP9A 4PY1A 1CTPE 1NA7A 4ZJIA 2GS7A 4EKKA 5KZ0A 5BVFA 3KRLA 3A7GA 2JITA 4P7EA 4UWBA 4AFEA 4G9RA 3GC0A 4BDIA 3G9NA 2G2FA 3R1YA 4FTQA 4BCGA 4AAAA 1ZOGA 3FQHA 2YIQA 5D12A 2GNIA 3MJ1A 4IAFA 3AMAA 5KBRA 4U44A 4QP3A 5JT2A 2O3PA 3EN9A 2QLQA 3A62A 3C5UA 4EZ3A 1H25A 4RA5A 3I0OA 3UIUA 1QCFA 3ZLWA 5AJQA 3QX2A 3W2PA 5JSMA 1YXSA 1GAGA 2EU9A 2OFUA 3IGGA 5HQ0A 2ETMA 2QO9A 4M0YA 2W1EA 3H10A 4FKGA 4BI2A 3OEZA 4HCUA 4YZBA 5HVJA 4BDCA 4F4PA 4ZSAA 4Y5HA 2ITPA 4MQ2A 3ZOSA 3EH9A 4CNHA 4ZIMA 4F6UA 3C0HA 4MXAA 3RK7A 5KKRC 4FIGA 2C5OA 3Q5ZA 4NIFB 2VO6A 5LVOA 3AC8A 4RRVA 4FF8A 1S9IA 1P4OA 1H27A 2HZNA 3D0EA 3W16A 5C27A 5JQ5A 4D2WA 2HW6A 4FK6A 3R8PA 2A27A 4RFZA 1YI3A 4AGCA 3NUAA 2QOKA 4A9YA 4ANLA 3A60A 4FG7A 5GZAA 3F61A 4MTAA 3RGFA 3U6JA 2BR1A 5E8VA 3SXRA 4F7LA 4MNEB 4A9SA 4CFXA 2YM4A 4QMTA 4K1BA 5L2QA 3QWKA 3R9OA 3VUHA 4APPA 3AG9A 3ENHA 3ETAA 3NAXA 4NJDA 4HVDA 5CSWA 2W7XA 4G6OA 4QTAA 4ZSEA 5DFPA 2J0MB 4RVTA 4ACMA 2B4SB 3VUIA 3GEQA 4B99A 3UVPA 4C58A 3MH2A 4R7HA 5EQYA 4WBBB 5BVNA 1PXNA 4DLIA 2C6DA 4FIEA 4DHFA 4O21A 5AP6A 3JPVA 1PXPA 3O8TA 3BKBA 3LJ0A 3GQIA 2OH4A 3H30A 4MNFA 4IAYA 2JC6A 4FSNA 3TNHA 3PTGA 4E5AX 2BVAA 4D55A 3OOGA 4F1TA 3AMBA 3LCKA 2XKFA 2WO6A 4QTCA 3EQRA 4PWNA 4MX9A 2HIWA 3O51A 2X7FA 3Q96A 4S33A 4U3YA 1CMKE 2XIXA 4ASXA 3BBWA 3OCSA 3R9NA 5IF1A 5JFVA 5LOHA 4G2FA 4TT7A 2XKCA 3K3IA 3VJNA 4LL0A 3QRJA 2I1MA 4OW8A 3RNYA 4UN0C 5BVDA 2VN9A 2G9XA 4JL9A 4OGRA 1FOTA 3K2LA 2C47A 4ZEGA 4S34A 3KA0A 3SRVB 2ZV7A 4BRXA 2NPQA 4GU6A 1JLUE 3CQUA 3CEKA 3IDBA 1T45A 4O2PA 5EOLA 2ESMA 5GZ8A 4EOJA 3LMHA 3QD0A 3RALA 3U51A 3R1SA 3GCPA 4PPBA 4ZJJA 4FNZA 3F2RA 4HNFA 3KMMA 4EHVA 5CEKA 2ITTA 4RVLA 5DA3A 4CTBA 5BNJA 2I6LA 5TE0A 4PV0A 4I20A 4DC2A 5AX9A 4S31A 4FKOA 5DMZA 4JBQA 3K54A 3F6XA 4AUAA 4FT7A 1H28A 4OTHA 4FGBA 2PVJA 1LUFA 5TT7A 1OKYA 4NTTA 4KIOA 3MTFA 5B0XA 4C2WA 5KUPA 2JKOA 2QQ7A 2VX0A 5FUTA 4OBPA 3VN9A 3VW6A 3WIGA 2ZM4A 4LRJA 2XCHA 5HCXA 2XKDA 4CRLA 3FZOA 4YPDA 2YCSA 3AC5A 4FKRA 1AD5A 3DLZA 3ERKA 5CXHA 3LXPA 4KD1A 2PVRA 4WSYA 4IBMA 5EYCA 5HBHA 4PTGA 2P3GX 2O63A 3C1XA 1T46A 3BGZA 5GNKA 2CKOA 3PE1A 4GUEA 4M69A 1Y6AA 4IDTA 4MXXA 3NW7A 4RFYA 3AGLA 2HWOA 2PHKA 2WELA 4G16A 3SHEA 3TTJA 4C4EA 4J7BA 1ZMWA 3NUNA 1OB3A 1G3NA 1H0WA 3WI6A 4XNEA 4MAOA 4C4GA 3JY9A 3LW0A 3GBZA 4FSQA 4TKSA 3VAPA 2C0IA 4FZAB 3AT4A 3BU3A 4I1ZA 2VD5A 4JBVA 4IEBA 3R30A 4DINA 3KRRA 2OZOA 3UNKA 2AUHA 3DK7A 5DT3A 4YU2A 4R77A 4EOQA 3LFSA 4QMNA 3CSVA 2R3MA 4KS8A 3TKUA 2JDTA 3M2WA 3TXOA 4J8MA 5E8WA 3C4WA 5HE0A 3F5GA 3TWJA 1WBNA 2WHBA 5HLWA 2RF9A 4L3JA 4BICA 2XNOA 5ETCA 2BTSA 3G2FA 3O8PA 3QQUA 4GFGA 3KVXA 4AN3A 4C3FA 5M08A 5CZHA 5DE2A 5EHYA 5K4JA 1NT2A 3PZHA 5AP4A 4BCJA 3F5PA 2VTJA 3S0OA 2WTKC 1WBWA 4DH7A 5HO7A 5F4NA 1IA9A 5HU3A 2PULA 3DBEA 2OJJA 3QYWA 4JQ8A 4FV8A 3NNVA 3UVQA 4LV8A 4PPCA 4BY9E 5DLSA 2BKKA 4I23A 2ITZA 4OTPA 3R9DA 5HORA 3MV5A 4YO6A 3GXLA 5AUUA 4AGWA 4K8AA 5CAVA 2B1PA 2KTYA 5J1VA 5A3XA 3ZSGA 4JXFA 3P7BA 3Q4CA 4W4WA 4DEEA 3THBA 3QC9A 3NNXA 4RZWA 4FVQA 3QXPA 4Y83A 4N57A 2NRUA 3U6IA 5M55A 2GQSA 2IVUA 2EXMA 3VHKA 3VULA 2VTHA 5K5NA 4NFNA 4EQUA 2JD5A 4Q5HA 4L3PA 5AM6A 3QBNA 4ACDA 3DQWA 4APCA 3MA6A 5FP5A 3D14A 4O82A 1GOLA 1PMNA 4GYGA 2WQOA 3IOKA 1R0EA 5GINE 1BMKA 3IECA 4MYGA 3DNEA 4FKTA 1SVEA 5C26A 3COIA 3IW6A 5HI2A 2Z7SA 3MPMA 2PE0A 5LCJA 3IG7A 1OBDA 1BUHA 2H9VA 4JRVA 4G9CA 3QZIA 4DT8A 4QMMA 2UZWE 3FLYA 3ORLA 5IQHA 4C4HA 2OK1A 5HIDA 2PE1A 3HP5A 1UWJA 2R3IA 4LUDA 2WMTA 4NT4A 3TUCA 1IAHA 5FLFA 5EYMA 1ZYDA 4C37A 3E8CA 4ZLZA 2C4GA 3RM6A 2B55A 4HGTA 4CXAA 4D4VA 4DH5A 1NVRA 5IMEA 4W4VA 4DGOA 4IWDA 3BCEA 2C30A 2OIQA 4IIRA 3BYMA 5D11A 2HZIA 4FT5A 3PXYA 4QYFA 5GZ9A 1JPAA 2ONLA 5ICPA 4WIHA 4ZP5A 3ZU7A 1M2RA 1KV2A 3F2NA 3RI1A 4LGHA 4FMQA 4FT0A 3VS2A 5D41A 3V8SA 3TACA 2ZDUA 1OL1A 1PYXA 3HV6A 3VUGA 4R78A 3HRCA 4RIWA 3T9IA 3B2WA 4TWPA 3MA3A 2WMQA 2C3LA 5L6OA 2AYPA 5GIOE 2HZ0A 4M69B 5J9YA 3RM7A 3V6RA 4KUJA 2FYSA 2Y6MA 2DWBA 2ONLC 3V5PA 4XRJA 2C6KA 1U59A 4UMQA 3MDYA 4JJRA 3C4FA 5HVYA 4FKWA 4YPSA 3CS9A 1B6CB 2CNUA 4EH3A 3NS9A 3GU7A 4BB4A 1XWSA 3VS1A 3FY2A 4U43A 3GFWA 4FOCA 3RK5A 4JR3A 4YC6A 3REPA 1WBSA 3KREA 3CQEA 1OIQA 3F7WA 3KXZA 3IONA 4M67A 3V3VA 4FSWA 2IZUA 4Z7GA 5FRIA 3QTZA 3UOJA 2B9IA 3OWPA 4IVAA 3TNIA 4QOXA 5G1XA 4AT5A 3MH0A 5AUZA 5CVHA 3R7VA 1XBAA 2C3KA 2HZ4A 3CP9A 4MF0A 2ITVA 1YXXA 4ARKA 2AC5A 5HIBA 4QTEA 5CF8A 3BWJA 3PY3A 1YKRA 4LMUA 2W5AA 3PXKA 1Q4LA 3W8QA 2VO7A 4YTIA 4MKCA 4C35A 4FV4A 3U6HA 4I21A 4ANBA 3ALOA 5L6WL 3VF8A 4HYHA 4BTJA 2GNGA 4B8MA 3SV0A 3ZM4A 4XG4A 4CRSA 4XV2A 2C6OA 2BUJA 3AD4A 3F3ZA 1OKVA 2PZRA 4RA4A 3ENMA 4YZDA 1LEZA 3PIXA 5DI1A 5EKOA 4V01A 3ZRKA 3A7IA 5C8NA 4FEXA 3OT8A 3OWJA 5KNJA 4FKQA 3BLHA 4QD6A 4N0SA 1VZOA 1FMOE 4GU9A 3RPOA 4FICA 4UMRA 2HY0A 3WE4A 4S30A 4EBVA 2XVDA 3S95A 3ZXZA 3VS5A 1OGUA 3SDJA 2W17A 3QRTA 4RVKA 4HZRA 1DI9A 3BQRA 4TY1A 4BIEA 3BGQA 2OLCA 3R7YA 3RAWA 1CDKA 4UY9A 3SA0A 2PZPA 2FUMA 3BYOA 3QHRA 2I0YA 2VTAA 5F94A 1Q8ZA 4XOYA 4LRKA 4UX9A 5IG1A 3I79A 1PXKA 3UZRA 3HECA 2OWBA 4DF3A 2Y4IB 2OICA 3A7FA 4FSMA 4UWCA 3G6GA 3MPTA 3DZOA 4GV1A 4FUYA 4IVBA 4ASEA 5B2LA 3QF9A 3PFQA 4OTDA 4PMTA 2PSQA 3UQGA 3PLSA 2WU7A 3IW8A 3R21A 2X81A 3MH1A 4R3RA 4S2ZA 4ALWA 3QTWA 2WXVA 4EZ7A 2PUIA 4O83A 1Q8UA 3SGCA 1UKIA 2GNJA 5IQEA 5H8BA 3GU5A 3UO6A 4UMPA 3TUBA 3UYTA 5GIPE 4I41A 4OLIA 5KMJA 2WMXA 3QZGA 4GFOA 5CF5A 5CVFA 3A4OX 1FVTA 4KWPA 4QPSA 3AMYA 4DTAA 3IPHA 4F1MA 4WNPA 4EBWA 4BVUA 5AV3A 2P4IA 3DXNA 4LL5A 5AR2A 3HYHA 4YJUA 2VWZA 3DKGA 4IE9A 5D7VA 5LVMA 3LCDA 2WU6A 1IASA 2VNWA 5HX6A 3HLLA 3L9MA 3O0GA 3OY1A 2PY3A 3NWWA 4HYUA 3UP7A 4S32A 4GFMA 2C68A 5H2UA 3PWDA 4EHZA 4BTMA 5EKNA 4H05A 3R7GA 4ITIA 1KOBA 1TVOA 4E6DA 1M2QA 1O6KA 1OPKA 3AC4A 3MYGA 4I5PA 4ANOA 1YOMA 2F2CB 2X4FA 1ZMUA 2YIWA 3E93A 4IFGA 3EIDA 2UW6A 4XYFA 4RIWB 5IISA 4NK9A 5FEDA 4M13A 2CJMA 4M84A 3RWQA 3QCXA 4CT1A 3QRUA 1U46A 3IW7A 5BYYA 4WBOA 3BHVA 4JDKA 5ETAA 3DA6A 4FNYA 3DZQA 3GC9A 4FTNA 2VTMA 4IB1A 5EG3A 2OFVA 5EI2A 2NNWB 5HX8A 3ROCA 4E4MA 1UV5A 2JFLA 3MFTA 4AZEA 3NMUF 3PPZA 4FV3A 3VWAA 2CPKE 4RG0A 1GNGA 2CHLA 3RMFA 4BBFA 2HOGA 2DUVA 2IZTA 3ALNA 3E3PA 4AZWA 3CQWA 3DNDA 4QP7A 1YOJA 5HNGA 5J8IA 5CU0A 3ZTXA 3VRZA 3TNWA 1Q24A 5IA5A 4FEVA 5M44A 3EMGA 2VGOA 2B52A 1GZOA 1WVYA 2BZHB 2ZB0A 3DAEA 3TNPC 4F9YA 3S3IA 2X2KA 4FL2A 1PXMA 4BDAA 4AG8A 4RZVA 5CQUA 3MN3A 5I3OA 2YZLA 4BWKA 3TTIA 5IH6A 1LP4A 5ANKA 4FA2A 5J79A 3D7TA 2XKEA 4BFMA 3ET7A 4OTFA 4ENXA 4AW0A 2XBJA 3EL7A 4U9AA 4AE9A 4Z7HA 4TZRA 2UVZA 3W32A 4FYOA 3RAIA 3F7ZA 3MY1A 5T6KA 3QQJA 4BKYA 3MSSA 4D5KA 2QKRA 2XEZA 4X2JA 5CEPA 3QYZA 5CLPA 3G9LX 4D2TA 4F9AA 5LARA 2VWYA 5EM5A 5E1SA 4DFLA 1YXTA 3OMVA 2EB2A 4A4XA 4PMSA 3DS6A 4BDBA 3NNWA 3ZCLA 5DRDA 2BFYA 2Z2WA 4QMXA 4IB5A 3BHHA 3LCTA 4Z55A 3NCGA 4XP0A 3FI3A 4ANNA 4FZ6A 4PMMA 4KSQA 1Q8TA 4PDPA 4CQEA 3TZ7A 4ID7A 2AC3A 2W1IA 3ZBFA 2H96A 5K5XA 1UVRA 4GUBA 4IX6A 2R7IA 4TN6A 3M42A 4E7WA 2ETRA 3EFJA 2ITYA 3POZA 5AUWA 5FM2A 3WYYA 1XBCA 3LHJA 4L3LA 5M4IA 2W1GA 4EH9A 3SX9A 5HVKA 2Q0BA 3COHA 3PY0A 5LVLA 4MQ1A 4NJ3A 5AV4A 3PXRA 3UYSA 4CYJA 3AC3A 3LOKA 1Y57A 2BALA 2OJIA 1ZOHA 2UW7A 3WILA 5DOSA 3DB6A 4IWPA 4FTLA 4QP6A 3DBDA 4I4FA 2VTSA 4H3PA 3LE6A 2R3PA 4Y72A 5CF6A 3IKAA 3KCFA 4WG5A 4IM2A 2WOUA 2XNGA 2WMSA 4O7ZA 3GU8A 2CKEA 2YABA 3HMPA 5CEQA 3WZKA 3Q9YA 5FDPA 5HTBA 4C34A 5ETFA 4K6ZA 2XH5A 4L00A 5CF4A 4I0SA 5IDPA 2YJRA 5FXQA 1QPJA 1XH5A 2V5QA 1DS5A 4DE4A 2O5KA 5H8GA 3FXZA 3TIZA 1FQ1B 3Q32A 3QL8A 3VUDA 2ZV9A 5KBQA 5AR5A 3DAJA 4MBIA 5AAEA 2OKRA 4DFUA 3LJ1A 3N51A 4F9CA 1Z57A 4FI1A 2GTMA 1ZY4A 5BQ0A 3FYJX 4M15A 3EKNA 3VW8A 2WIPA 3AC2A 4ALVA 5JKGA 3TKHA 2W1CA 4UALA 3GVUA 2QG7A 3VS7A 3TZ8A 3FWQA 2RFDA 4J52A 4K77A 2XIYA 3NYNA 4AGDA 5CAQA 4C61A 5J7BA 1OUYA 4FUXA 3QCYA 4KSPA 3ZO1A 4Z16A 4CG9A 2WEVA 2UZEA 4RIXA 3OCTA 3FC1X 2E2BA 3EQDA 5CU3A 4YTCA 5E8ZA 5EFQA 4RJ8A 3UPZA 4IX4A 3EN6A 4F7JA 4OTGA 4OTQA 1JOWB 4UZHA 4ZTMA 3HKOA 1TKIA 4FSRA 2GMXA 1ERKA 5DT4A 3FI8A 2OSCA 3W8LA 3VBQA 3Q3BA 4G3FA 4XBRA 1BKXA 3ZRLA 1Z9XA 4BF2A 2OZAB 4L67A 1QL6A 2UW4A 4N4SA 3DBQA 5M57A 4KINA 4BZOA 4F9BA 4FYNA 2A1AB 3OXZA 3NIZA 3MVMA 4IVCA 5ANJA 3FLQA 4MF1A 4PF4A 1M2PA 5HEZA 5TR6A 5M4CA 2A19B 2WTIA 3EL8A 4X3FB 1JSVA 2VTRA 4XP2A 3N9XA 1M52A 1PHKA 1QPDA 3VNTA 4EOMA 3PJCA 1J1BA 2WTWA 1O6LA 2WMUA 4LGGA 4BCQA 3DU8A 4F0GA 2XZSA 3FHIA 2XMYA 2YDKA 4HYSA 1OITA 1ZYCA 4I4EA 3U55A 3CLYA 4YGAA 3LFFA 2VTNA 3FZRA 4FG9A 5AUTA 2ITWA 4FL3A 4QP4A 4GIIA 4BDHA 4BN1A 4AOJA 4XHKB 4YC8A 2YCQA 2UZNA 4Y46A 1Q5KA 1QPCA 3GFEA 2PVNA 1J3HA 3BU6A 2R3JA 3R9RA 3R71A 1OECA 3TNQB 4FT3A 4R3PA 2QOBA 4FEUA 4D28A 5CAUA 1UU9A 3OXIA 3LKMA 5HG8A 4FV6A 3TZ9A 4EOLA 4IJ9A 5IQAA 1Y8YA 3FKLA 4RJ4A 4RMZA 4XX9A 3EQIA 1BYGA 4OT5A 4WUNA 4NU1A 3DCVA 2PMOX 3VVHA 5DG5A 5BMMA 2BAKA 4MXCA 4IDVA 3NYXA 1O6YA 2C5YA 4V05A 3NW5A 3RAHA 3EQHA 2RSVA 3TI1A 4NCTA 1YHVA 5I9ZA 2Z02A 5IQFA 4X3JA 1REJA 3DB8A 2X7GA 3MIYA 4GS6A 4H1MA 3FQEA 3LZBA 2E9OA 4G17A 2BCJA 5L6PA 2YCRA 2UW9A 3P7AA 3O17A 2YM8A 3LLTA 2YM5A 2WTCA 4YHJA 4AQCA 2GHGA 2H34A 1XKKA 1OPJA 3VBWA 4JX7A 2W99B 4A4OA 5CT0A 3E62A 4X0MA 4KKGA 4OUCA 4I6FA 4W8DA 3EQBA 2OJFE 3ZSHA 4O2ZA 5EW3A 3UO4A 3BELA 3PZEA 3G51A 4O0YA 4F09A 1W84A 4ZXTA 4J1RA 4NCTC 5CY3A 3LFCA 3WZUA 3QD3A 3V5WA 5KHXA 5ACKA 4HGLA 1M7QA 3QCSA 2JLDA 3QD2B 4FTCA 4NKAA 2W1ZA 1H0VA 4PP9A 4JS8A 1KE5A 3KRWA 4EC8A 3PA4A 2BTRA 4A06A 1A06A 4QNAA 5JFXA 3IQ7A 3V5LA 1QMZA 1PXLA 4QP2A 3MVJA 2QKWB 3MY0A 2R3RA 5DNRA 4D0XA 4HCVA 4BWPA 4ENYA 3PXZA 4FIJA 4ZTHA 5HICA 4AGUA 5AR4A 3QA8A 3C4CA 3S00A 3ROYA 3CJFA 1ZZLA 3PJ2A 4ZMFA 2JAVA 4RIXB 2G01A 2UW8A 3NUSA 5CNOA 2A4LA 4MK0A 1YHWA 4W4XA 4ASDA 3ZBXA 5A6NA 1PXOA 2DQ7X 3PJ3A 2G2IA 2BILB 2QR8A 2BRNA 3PSCA 2VWBA 2R0IA 3HV7A 1UU3A 4F63A 4DEBA 3KULA 1SMHA 2B54A 2JAMA 4IH8A 4C2VA 2LAVA 4BL1A 4DFXE 4Y73A 3K3JA 4EC9A 2GSFA 3Q6WA 3BLRA 4FTJA 4EWQA 5E92A 5FG8A 4C57A 1H26A 4O1OA 1H24A 2PUNA 3HV5A 3RVGA 2XM8A 4Z9LA 3TIYA 3SAYA 4F6SA 3COKA 5EK7A 2GFCA 2W96B 4QQTA 2F7XE 4TL0A 2WEIA 3CKXA 3SW4A 3C13A 4C8BA 3HVCA 4JG6A 5EM6A 3BIZA 3HMNA 4U8ZA 1J1CA 4IVDA 1Q3WA 2JGZA 3CGFA 1WBVA 5DH3A 4ANQA 3QHWA 3BQCA 4R7BA 1HCLA 4MWHA 3CY2A 4FGRA 2GNHA 4FSUA 4XG7A 5IKWA 4EHEA 1PXJA 2IW9A 3PWYA 4OTRA 2YACA 3DKCA 4TWNA 4HGSA 4ZTNA 4CV8A 2WOTA 4RSSA 5I0BA 4BIBA 2BAJA 5I9WA 3I7BA 3UO5A 3NGAA 4B6LA 3ANQA 3QQGA 4G3EA 1P4FA 3R02A 3NVMB 3WF9A 3ZC5A 5M09A 3E5AA 1KE8A 4IWOA 3LFNA 3UVRA 4DCAA 2VTIA 1ZMVA 2IVTA 2WTJA 1SYKA 2XNBA 3A8XA 5DRBA 3WZDA 3ORKA 5CAPA 4HVHA 3QUPA 4YJVA 3R73A 4UXLA 3QUEA 4YJTA 2FB8A 3PVUA 4QRCA 1J7IA 4GMYA 3FXWA 2OJGA 5E8SA 4RLLA 5KX8A 2BHEA 2LGCA 3FXXA 3M1SA 3QTXA 3O8UA 3OY3A 1KWPA 4Q5EA 4DG2E 5KKRB 4LMNA 3BBTB 4XLIA 3PUPA 3NR9A 2C3JA 4IMYA 4WUAA 4RWJA 1HOWA 4XBUA 3U4WA 4DTBA 3V51A 4LFIA 4YO4A 2OIDA 2OGVA 2Q0NA 3P1AA 4OR5A 3RINA 4AF3A 4RVMA 5HBEA 1LEWA 3PG3A 2IVVA 4RQVA 1KSWA 1OIRA 4YZCA 3DK6A 5ANEA 4LYNA 3GGFA 5DN3A 2XYUA 5C01A 3PSBA 4JLCA 3LFEA 1Q97A 4DH8A 5A14A 3HAVA 3MTLA 3NLBA 4I94A 3VBXA 1W7HA 3Q52A 5DBXA 4KRCA 5HG5A 3F3WA 5CI6A 5HE3A 3UQCA 4RJ6A 2C5VA 5A4TA 5DEWA 1G8AA 5JRQA 2QR7A 5ITAA 1JKKA 1Q41A 4TWCA 3HAMA 2EXEA 4PX6A 4AOTA 3VRYA 1NVSA 3C51A 2G15A 2W1HA 3EOCA 4QMQA 4EH8A 4KIQA 2WGJA 4IXPA 2PVYA 5A6OA 2V62A 2QLUA 2WQEA 4EYJA 4FEQA 3O96A 3CE3A 3C9WA 3V04A 3AD5A 2XK7A 3EYHA 5K9IA 4M66A 2ITXA 4DFBA 3DJ5A 5T68A 4O0VA 4K18A 1ZOEA 3NUYA 4CSVA 5I9VA 2O0UA 2XB7A 3KQ7A 4HPUE 4I0RA 3Q4UA 4JIAA 2CCIA 4LQMA 3RPRA 1H1SA 4G3GA 4EEVA 4FBXA 4RJ3A 4J71A 5J87A 4R5SA 1MQBA 2Q83A 3QTQA 3OROA 1RW8A 4DLJA 2F2UA 4CMOA 3C4ZA 3DKOA 5B2KA 2PVLA 3FSKA 3PP1A 2R3QA 3JYAA 2WQMA 4DEHA 4GT3A 5H3QA 3ACKA 1M14A 3U87A 3DFCB 4FSYA 4O0WA 4XOZA 3TV4A 4XG8A 4BHZA 3EFWA 5IEXA 1K3AA 4WRGA 2FVDA 3CGOA 3NDMA 4JRNA 5AUYA 4USFA 4EOIA 3RPSA 1UNGA 4M97A 2IWIA 3LAUA 4L7SA 4PNKA 3FC2A 3WOWA 4H3QA 5AIRA 2JIVA 4C62A 3LMGA 3P08A 4NW6A 3CCNA 3RJCA 4F08A 2UZDA 3P0MA 4L7FA 2EVAA 4FG8A 4KKHA 1SZMA 4HW7A 5J1WA 3NW6A 2R64A 3L9NA 3IDCA 4W9WA 5CZIA 2XJ1A 4IADA 4ZLOA 5IQDA 1PY5A 3CD8A 1H1RA 1YDTE 1Q99A 3OS3A 4RJ7A 4F6WA 4E4NA 3KB7A 1FGIA 4NWMA 2QHMA 4ACHA 2ZYBA 5EW9A 2NO3A 5E8XA 4HOKA 5AR8A 4XP3A 2QCSA 4QYGA 5I9UA 4D9TA 4MXZA 5L3AA 4R6VA 4NYEA 3I5ZA 2XIKA 5KMIA 4GEOA 3TCPA 3A7JA 3R63A 4LV5A 2XEYA 2GTNA 1X8BA 4R5YA 2PWLA 4YJOA 2GU8A 3TEIA 4NEUA 5L8LA 3M11A 4AZVA 4MVFA 5IQCA 5A9UA 3S2PA 1OPLA 2OBJA 2WTDA 2WMBA 3QXOA 2VTLA 3AQVA 4BI0A 4NTSA 3AT2A 3VBTA 3FI2A 4UMUA 1YWVA 3W55A 5KMNA 2C6LA 3G0FA 4IACA 3MVLA 3D5VA 3FL4A 4FKIA 3W2RA 2JBOA 4AP7A 3NCZA 2RKUA 5K3YA 2C6IA 3KC3A 4ZTRA 3HA8A 4I22A 4CFUA 5AAGA 3Q5IA 4DN5A 3QTRA 4E5BA 1PMUA 3HA6A 4CFNA 5CSXA 3SD0A 5HBJA 1MUOA 3CTQA 3FKOA 5IEVA 4FV1A 3V5QA 2OXYA 3FBVA 3KK9A 2I0HA 4G1WA 2Y4PA 3IK3A 4WSQA 5ANGA 1Q3DA 1W83A 3KXXA 5A4EA 3F82A 3OF0A 2CKPA 3D5WA 2E9PA 3DTCA 2UVXA 1YXVA 4MXYA 3OW4A 4MCVA 2YIXA 4OAVB 5FXRA 3ORPA 4O7NA 5CQWA 5EW8A 2BMCA 4QPMA 2BZIB 3LM0A 5DR9A 2DS1A 2PMLX 3UOKA 3F5XA 4A9RA 4C3PA 5CSPA 2WAJA 3PA5A 3R7IA 4ZS4A 5CX9A 2VX3A 3LPBA 4GG7A 1S9JA 3UBDA 1V0BA 3D15A 2WPAA 4L52A 4BYJA 3CPCA 4XG6A 5AP2A 3ATTA 3NYOA 5HNBA 5IH5A 1KV1A 1J91A 5LWMA 3MPAA 4UMTA 2XK3A 3Q4ZA 3W1FA 4Q9ZA 4IM3A 5HIEA 2W5HA 3ZLXA 5FWKK 5IUHA 2FSMX 2BHHA 3D4QA 4BR3A 2VX1A 1EH4A 4UWYA 4GK2A 4ZLYA 4D1XA 4PUZA 1QPEA 5DWRA 1W98A 3KMWA 4IAKA 5EDRA 5CENA 1XH6A 4V0GA 5E4HA 1UU8A 5IQBA 1IEPA 4HNIA 4FNWA 4R8QA 3BEAA 1GZKA 3D9VA 4WO5A 2X8EA 4DEGA 1NXKA 3FUPA 2ZDTA 1CKPA 2FA2A 4HZSA 3ZH8A 5BUEA 4QMSA 4C4IA 2ZAZA 2XBAA 2XNEA 2YN8A 5C8KA 5M56A 3UC4A 3TDWA 3IOPA 4RIYA 4D2VA 2ITQA 4G6LA 4DCEA 4O7LA 4ZSGA 4V04A 2X6EA 2PU8A 3OP5A 2OG8A 3GCUA 3LIJA 5EHOA 4JNWA 4FKSA 1YI4A 3P5KA 5HG7A 3NPCA 5DPVA 4BCKA 4QP1A 4I0TA 4WNOA 3SG9A 5FTGA 2GPHA 1IRKA 4EOSA 5CYIA 5AR7A 2ZMDA 2W9FB 4QT1A 4FEWA 3ANRA 3P78A 4BCHA 4A4LA 4QMPA 1HCKA 1YWRA 3GC8A 4KS7A 3R8UA 2CLXA 4X6RA 4K2RA 2W4OA 4K9YA 4FKPA 3I6WA 1VJYA 3FZPA 3GOKA 4II5A 3BYUA 3E8DA 4I5MA 3D5XA 2RFSA 3Q60A 4BBEA 1SVHA 4E73A 3BRBA 4EH5A 3ULZA 4R1VA 1STCE 3OUKA 5E1EA 1OM1A 2E9UA 2GDOA 4IC8A 5CVGA 2J4ZA 5FGKA 3SLSA 2Z7RA 4F65A 4CLJA 3MFRA 5IEYA 4KABA 2QOFA 5JQ8A 3H3CA 5M51A 2OJ9A 4X7QA 5AFVA 4EOKA 1OL5A 2CNVA 3BPRA 4MD7E 4X21A 4DG3E 1OKZA 3QRIA 4IW0A 4RGJA 5TKDA 2QU6A 3OT3A 4M14A 2FGIA 3FLWA 3RCDA 4ACCA 3QCQA 1CSNA 3KY2A 2RG5A 3KF4A 4QMUA 5A4QA 4QPAA 3VUTA 2CN8A 3FMJA 5EQEA 4FKVA 1WVWA 5C03A 2XF0A 5HTCA 4E26A 3R22A 3EFLA 4L6QA 5DEYA 5HESA 4CCBA 2C3IB 1JNKA 3GCQA 3OBJA 4I5HA 4YZMA 5DVRA 5AR3A 3OWLA 4ZY6A 4GIHA 4RX9A 4IZ5A 3ZONA 4F0FA 2VTQA 3ZO3A 4WNKA 4FL1A 3SXSA 2Z7QA 2WMWA 3DXQA 1KE9A 3QU0A 4LM5A 2F9GA 4MWIA 4E6AA 3EQFA 5JK3A 1H1WA 3OCBA 2UW5A 2UW3A 4M3QA 2YDIA 2W9ZB 3PXFA 4I5CA 4PMPA 2UZTA 3KRXA 2RGPA 3AT3A 4BDGA 4GRBA 1DAYA 4N70A 3LXNA 5LVPA 4BCFA 1YW2A 3IDPA 5HCZA 3P9JA 5BYLA 4BCPA 5EOBA 2WNTA 3LVPA 4FIHA 5C4KA 4QTBA 3P4KA 5LCKA 2YWVA 3L8XA 4ZOGA 2CGWA 3UOHA 1SM2A 1YDRE 4TYEA 4IAIA 5E91A 3LFDA 2B9HA 1OL2A 2XNNA 2YHVA 3I1AA 3A2CA 1BI8A 4PNIA 3FMKA 3AD6A 3MW1A 2VO0A 1VYZA 4YLKA 4J8NA 4B8LA 4IFCA 5FEQA 3W18A 5K0XA 1PRYA 4YP8A 4Y8DA 3NZ0A 5AUVA 4E93A 3ORTA 2BROA 1WMKA 4XV9A 4BDDA 3I6UA 4AU8A 4EOOA 3UIXA 4RBLA 2C0OA 4WKQA 3D7ZA 3RCJA 3ZXTA 4BCIA 3OD6X 1GJOA 4DBXA 1XBBA 3SOCA 1MRVA 4D2RA 4ZZNA 4EJ7A 4BCNA 1UNHA 2X9FA 2P33A 4JAJA 4MBJA 1KE7A 1ZY5A 5FTOA 3TJCA 5I4NA 3DAKA 3CR0A 3BI6A 4NM5A 5BMSA 3SOAA 3VQHA 5A54A 4O1PA 3KN5A 2VO3A 4J95A 1ZXEA 4M7IA 3HGKA 4GH2A 4BKJA 5I5ZA 4LOOA 4QMZA 4FZ7A 4AS0A 4OBOA 3QRKA 5LXMA 4KNBA 2EWAA 4LI5A 4BKZA 4CTCA 4DEAA 2BAQA 2BRMA 3CPBA 2B0QA 3KXMA 1U54A 2J0JA 1KOAA 2HY81 2PZYA 2W1FA 3JY0A 4CFWA 4Z3VA 2HWPA 1WFCA 2WQNA 3FMEA 4P5QA 3NUXA 5KE0A 3R7UA 3NX8A 3CY3A 3CKWA 3ZS5A 4WG4A 3U8WA 3HNGA 4FC0A 2XK6A 4PDSA 3RK9A 3VC4A 1SNUA 2O2UA 3FY0A 4TXCA 2XS0A 3ZO2A 1H1QA 2BDJA 2RFNA 4L9IA 4I93A 5HKMA 3UIMA 3FMDA 1I44A 2J5EA 4U42A 3H9RA 3QQLA 4JVGA 5HGIA 3L9PA 3KXGA 2W05A 2HAKA 4PDYA 4O7WA 2VTTA 2GS6A 4ZS0A 3ZFYA 4ZY5A 1XR1A 2ERKA 4BWXA 3BE2A 5IA3A 4BGGA 3Q6UA 2QOQA 4PDOA 5E8TA 3POOA 4FKLA 3HRBA 3O7LD 4X2FA 2XNMA 4ORKA 3G0EA 1AQ1A 2CSNA 4EZ5A 3HP2A 5HD4A 2R9SA 4TNBA 3GUBA 4U97A 2Z7LA 4YBKA 2P2IA 3KU2A 3QGYA 4L68A 4BDFA 4OAUC 1JAMA 5EH0A 1KE6A 4GG5A 3VS0A 3P86A 1FINA 3WIKA 4DTKA 3ZUUA 3D2KA 3D83A 3UODA 1UA2A 4E1ZA 5ANIA 3MB7A 1J7LA 1V1KA 1YWNA 3WE8A 4KIKA 4P5ZA 4PL4A 4U80A 3II5A 4XRLA 4FSTA 4LRMA 4DT9A 4YJQA 4YTHA 3VBVA 4DA5A 2ZM3A 4YJPA 2XA4A 2YLEA 4TYJA 4YZ9A 4YJNA 5BX0A 4HPTE 4L42A 3UMWA 5CASA 5IH4A 5EDQA 4DG0E 3MESA 5DHJA 3BE9A 4EH4A 1VR2A 2XIZA 3R01A 4AACA 3SW7A 2X1NA 5AX3A 3HMOA 4MD9E 5GJFA 3AGMA 4BGHA 5LJJA 3P7CA 4AX8A 2XYNA 2J9MA 3MY5A 3VS4A 3V8WA 4HVSA 4Q2AA 4DFYA 5ACBC 1ZARA 3BV2A 4XCUA 3KN6A 3R0TA 4YBJA 4E20A 5H8EA 5JMSA 4D9UA 4X6QC 1TQIA 5KMMA 4RX5A 4I3ZA 1JWHA 3E7OA 4KRDA 4ASZA 4MNEA 2I7QA 4AN9A 3KMUA 2V0DA 2GNLA 3FSFA 2BDWA 5HOAA 3U9NA 3V5JA 4ANMA 3JXWA 4FZFB 4PQNA 4U7ZA 5KO1A 4O81A 2OIBA 3WF7A 5D1JA 2R2PA 4EJNA 3GQLA 4M12A 5J5SA 4NM3A 4NL0A 3EN4A 5FXSA 4FOBA 1H8FA 4AW1A 3BZ3A 4DITA 4LOQA 4C4JA 5EQPA 1BX6A 2J5FA 4YC3A 2YLFA 1W8CA 3F88A
chains in the Genus database with same CATH superfamily
4IB3A 5EI8A 4H58A 1ZWSA 3QQFA 3OG7A 4YHTA 4EORA 4HCTA 2QONA 5EYDA 2C5NA 4O84A 4BGQA 5M4FA 3QA0A 3QZHA 4L01A 4FTOA 1K2PA 4FV5A 4CG8A 3TG1A 5CU6A 2BIKB 2VAGA 3ZHPC 5IA4A 3HV3A 4GT5A 4EOPA 4IB0A 4YR8A 3R2BA 3N4VA 5BVKA 3UZTA 4O7RA 3K5UA 1W2CA 3A7HA 3QWJA 4NM7A 3D7TB 3QLFA 2JDVA 2PVHA 3FZSA 2Z8CA 4FTIA 2J50A 3SRVA 1FVVA 2PUPA 3BV3A 4FSZA 4Y85A 3R7OA 5GJDA 4ZJVA 2I40A 1ZYLA 2P0CA 2JKKA 3GI3A 3R00A 4FTAA 2X6DA 3VS6A 1P14A 3ULIA 3ZO4A 3ZUTA 4KKEA 4UB7A 2HXQA 4QQ5A 4AXAA 1LR4A 2VTOA 2W06A 3DT1A 1OIYA 2VWWA 2WD1A 1JSTA 3HDNA 3JS2A 1YQJA 1A9UA 2VGPA 3SQQA 2QI8A 4L45A 3BHUA 3R9HA 4U40A 3QKMA 4H39A 1LPUA 2H8HA 2IZRA 3OVVA 3QQHA 4JIKA 3ZDIA 3HMMA 5BVWA 4QYEA 2QD9A 4FV0A 4D5HA 3LXLA 3ZRMA 3TUDA 2JIUA 2R3NA 3FI4A 1TQMA 2RFEA 3W0SA 3R8LA 4O7YA 4ZTSA 2OF2A 2W5BA 2W1DA 5BUJA 4RX8A 4ZZMA 1E1VA 5HHWA 3V6SA 3O2MA 5I9YA 4EHGA 4IC7A 3P79A 2O64A 5CWZA 3QAME 1SNXA 1Q8YA 2XRWA 4O22A 4UEUA 1PXIA 2YITA 2X0OA 2XIRA 4G6NA 4RPVA 4TNDA 4D2PA 3E87A 4UBAA 3RWPA 3PYYA 2Y8OA 3I0QA 2VTPA 3BEGA 4I24A 4O7SA 3FDNA 1Y91A 3TDVA 2ZV8A 3OEFX 2YISA 4LUEA 4QMOA 3WF8A 4J53A 3EN7A 5IMXA 4AN2A 2O8YA 3OOMA 3VS3A 3TKIA 2W4JA 1BLXA 3MH3A 4FR4A 4YNEA 4FTMA 5L2SA 3OTUA 5BVOA 3ATSA 2JDSA 4JI9A 4KIKB 4B9DA 3FV8A 1ZRZA 3ZSIA 2R3HA 2YZAA 3KGAA 4AA0A 1ND4A 2GS2A 4EQCA 3ID6C 1I09A 4AXCA 4KA3A 3TMOA 5CAOA 2OH0E 3MFUA 2PZ5A 2PK9A 3D94A 3T8OA 3Q9ZA 4BDJA 3C0GA 3DJ7A 4KAOA 2C5XA 2XJ0A 2GQGA 4BZNA 4EONA 4NH1A 4NW5A 4GK4A 2OXDA 3W2OA 2UV2A 2QODA 4A7CA 5HLPA 3BU5A 1Z5MA 3VBYA 1XH9A 1V0OA 3ZDUA 3E64A 4DGMA 1OKWA 1PMEA 2CCHA 3ZZWA 4BTFA 4PP7A 4O0UA 2IW6A 3QTSA 3OUNB 3DGKA 5L8KA 1PKGA 3A99A 1PKDA 4EH2A 3UNJA 3IW4A 2IZSA 4L44A 3ZEPA 5IDNA 4FV2A 3NYVA 4H1JA 4ALUA 4C33A 3OWKA 2XJ2A 5GHVA 4X2KA 3KFAA 4MEDA 1AGWA 4GJ2A 3JUHA 4DAWA 4F7SA 2NRYA 1OMWA 4JDHA 1OIUA 4U79A 4CMTA 2ITNA 1G5SA 4ZZOA 4JDIA 1TQPA 4BZDA 5J9ZA 3UZPA 4FKJA 4U6RA 4EK5A 1JQHA 4NUSA 4B4LA 2JEDA 5LMAA 2W4KA 3OZ6A 4TTHB 2WTVA 3I81A 3MVHA 2JDOA 4RWLA 4U45A 3R8VA 3T3VA 3DBCA 3U4UA 4EKLA 2IPXA 3FLNC 4F7NA 2C69A 4WA9A 3V8TA 1W2FA 2Y6OA 2UVYA 3OTVA 3ZLSA 3O71A 4XJ0A 4O0XA 4GJ3A 4QMLA 3WARA 4JG7A 1PYEA 2WZJA 3F69A 4G3DA 4FZDB 4JDJA 3PJ1A 5AP0A 3UGCA 4AE6A 4LDTA 3H0YA 2QVSE 1JKSA 2ZVAA 5T3QA 1XH7A 4AW2A 4X2GA 2X2MA 1GIIA 2HELA 3KEXA 5AP5A 1H01A 4USDA 4QMVA 5JFSA 2PVMA 1OI9A 4EUTA 3C4EA 3QLGA 2CKQA 3L8PA 1U5RA 2QNJA 1JSUA 2YM7A 1OUKA 2J0IA 4UYNA 3ODZX 4M68A 3UP2A 4ZAUA 4RLKA 4ZK5A 1CM8A 3FYKX 4CFFA 1F3MC 4FIFA 2X8IA 5EM8A 5HLNA 5IUIA 3ACJA 3BLQA 1W0XC 4D2SA 3EYGA 4O86A 4CZTA 4I6QA 1P2AA 1L8TA 3TL8A 4GKIA 5M4UA 5JFWA 2YAAA 4TYHA 1CKIA 3HUBA 3FKNA 2GFSA 5HZNA 2HK5A 3DQXA 3E88A 4CEGA 5JGDA 4H36A 3VQUA 2ZOQA 1GZNA 3QKLA 3ZZEA 2IF8A 2VWVA 3G33A 1Y6BA 2F57A 3GB2A 3L1SA 2R3FA 3MS9A 1UWHA 4YJRA 4RWKA 5FP6A 4MD8E 4LG4A 4QNYA 4QTDA 5CSVA 4W4YA 3TM0A 2QOIA 2R3LA 2Y9QA 1JBPE 3JVRA 1E9HA 4YSMA 3RKBA 2ZV2A 1WBPA 1IR3A 4CFMA 1APME 4AZSA 2X39A 1OBGA 2ERZE 4YSJA 4ANSA 3KKVA 3I4BA 4JG8A 5JGAA 4N6ZA 1ZAOA 4A9UA 3DFAA 2ETKA 3GC7A 2X0GA 3R1NA 3F9NA 5KMLA 4IX5A 3F66A 2PMNX 5CNNA 5EHLA 2BKZA 2PE2A 2R5TA 4BI1A 5IA2A 3ITZA 2BZJA 3FLSA 4E3CA 4D4SA 3JR1A 2X7OA 2H6DA 5B7VA 2QOHA 4C4FA 3H9FA 3Q53A 3NVKI 3L8VA 3G5DA 1GIJA 4GT4A 3O23A 4GW8A 5FEEA 2EUFB 4O96A 4EK8A 3MBLA 4AT3A 5IA1A 2UUEA 2XRUA 1YVJA 2ITUA 3B2TA 2J0KA 3DK3A 5FTQA 3WF5A 4DYMA 1IAJA 3G90X 2ZJWA 5JH6A 4TYIA 4X2NA 4L8MA 3LQ5A 3VJOA 5LMKA 3MB6A 4FODA 4BTKA 4USEA 4JQ7A 4WNMA 4AWIA 4D1SA 3TZMA 5CSHA 4LGDA 1M7NA 1ST0A 2PVFA 4G34A 3FMNA 5CTPA 5DIAA 5HTIA 5LQFA 4AT4A 2XK8A 5CI7A 2R7BA 4DH1A 3GP0A 4FV7A 5DR6A 4MBLA 3FMHA 4DFNA 5CEMA 4GKHA 3C50A 2Y0AA 4JBPA 1UKHA 3NSZA 2EXCX 3C4XA 1XH4A 3KK8A 4E5WA 5IZFA 1BL7A 1XH8A 3D2IA 5LMKC 5IQIA 1V0PA 3NFFB 3AOXA 2X9EA 3QFVA 5EI6A 1H4LA 4FTRA 4IHPA 3H9OA 3UDBA 3KXHA 4GYIA 4U0IA 4IX3A 4CD0A 4ZMEA 4BC6A 5GJGA 5F9EA 3UOLA 3FAAA 2BRHA 3KULB 3VIDA 1W2DA 3QZFA 3EWHA 4Q9SA 4IAZA 4XG9A 2FH9A 5JZJA 4BJJB 3W2CA 1H00A 2JKQA 5AV2A 4HVIA 5BPYA 1J7UA 4O0TA 5BVEA 3W2SA 5B2MA 1OZ1A 3WZEA 5L2IA 1TFFA 2CMWA 4YUQA 4RWIA 3ZYAA 4F0IA 4W9XA 4BCOA 3R2YA 2WB8A 1FBNA 5KHWA 3N4UA 4QP8A 4ZSLA 1L3RE 4WOVA 3UC3A 1B39A 4PRJA 4WT6A 3OBGA 5IQGA 4O6EA 5DR2A 1ATPE 3Q04A 4FV9A 5I3RA 1Q62A 2FSLX 3NRMA 4FK3A 4KB8A 3TV6A 5LVNA 1WAKA 4TPTA 1OL7A 2WIHA 4XS2A 5E7RA 4DEDA 5AP3A 3BGPA 2PZIA 4YMJA 2X4ZA 3EZVA 5KMOA 5TO8A 4BIDA 4WHZA 3EKKA 2XK9A 1YRPA 3NIEA 1R78A 3AKJA 3BYSA 3LQ3A 3MGYA 2C6MA 3OXTA 5TOZA 1UNLA 3R83A 3ODYX 4LOPA 4AA5A 2DYLA 4FVPA 2KULA 5L2WA 5AV1A 2A2AA 2B7AA 3DLSA 3LJ2A 3DJ6A 3S4QA 3W2QA 5AA9A 3FEGA 3EJ1A 3WYXA 3W0MA 3TN8A 2WMAA 2VUWA 3OHTA 4RJ5A 4K0YA 4HYIA 2IJMA 5F1ZA 2IVSA 4YHFA 5DYJA 4MXOA 4CZYB 3DXPA 3LCOA 4JBOA 2Y4IC 3BWFA 4ACGA 4TYHB 5IUGA 2F4JA 2CGUA 3L9LA 3UIBA 4D58A 4P90A 3FQSA 4R3CA 3UG2A 5K0KA 1IA8A 3A61A 4D0WA 4E8AA 2IW8A 4GK3A 4AA4A 4OTWA 3RAKA 3LFAA 1WZYA 2VRXA 5EDPA 4C36A 3ORIA 4XUFA 3FPQA 5DGZA 3UPXA 4JOAA 4ZSJA 4QQCA 3UG1A 4OTIA 4O38A 4MH7A 3R7EA 4NFMA 2AQXA 5JRSA 4C02A 4C7TA 4IM0A 5ANDA 3F3UA 5LWNA 2C1AA 4RC4A 4DEIA 3N4TA 5K4IA 4E4LA 4BHNA 2JIIA 4AXFA 4E4XA 3LQ8A 2QC6A 5AIKA 5E9EA 2XALA 2YCFA 3UJGA 3E8NA 1M17A 2WTKB 2OU7A 2BRGA 1DI8A 2V7OA 4JR7A 3E8EA 4J97A 4RC2A 3RZFA 3T9TA 4DBNA 2OW3A 4O91A 2HYYA 1GIHA 1NVQA 2REIA 2GQRA 3DBFA 3D5UA 3MJ2A 5EYKA 3MFSA 4C0TA 5CEOA 3BHTA 5HE1A 3QGWA 4IZAA 4FJVA 4Y95A 3RP9A 4EQMA 4KBCA 3AXWA 3QKKA 3ZFXA 3UNZA 2CGXA 2V22A 2UZLA 5HO6A 3E92A 1XO2B 1F5QA 3PPKA 1B38A 5A46A 1K9AA 2JDRA 3ZFMA 3EQPA 1ZYJA 2Y7JA 3Q9WA 2QURA 2X8DA 3W33A 3LLAA 2QHNA 4TYGA 5HCYA 4KIPA 5IPJA 2I0VA 1PF8A 3IS5A 3K5VA 4E6QA 5J7HA 2BPMA 3OW3A 4CKIA 2OF4A 3R8ZA 2R0UA 2XCKA 5AA8A 3KRJA 1JVPP 3T3UA 2BRBA 4B7TA 3A8WA 1W82A 2ITOA 5KCVA 5L4QA 1RQQA 1KUTA 2R3OA 4CV9A 1UU7A 2HW7A 3GT8A 3IGOA 1OL6A 3R04A 1WBTA 4PTEA 1URCA 1SVGA 3EB0A 3KL8A 4WG3A 4UYAA 2R3GA 5HD7A 3FLZA 4AOIA 5C1QB 3P23A 3CTHA 2YEXA 4U3ZA 3PRIA 5FDXA 2QOOA 3CJGA 3HEGA 4FTTA 2E9VA 3FE3A 4DGNA 3RPVA 2XUUA 4EWHA 2YDJA 3R6XA 4FX3A 5LMBA 4F1OA 4DGLC 4FT9A 4FTKA 1DM2A 3HV4A 3RPYA 3ORNA 3PFYA 4L53A 3PY1A 3KVWA 5BUIA 5E8YA 2C0TA 3PSDA 3NNUA 1FMKA 5FM3A 3WBLA 3ZC6A 4DGGA 4IJPA 3GCVA 4RT7A 5F95A 1O9UA 1FGKA 2F49A 2GNFA 2BDFA 3DDPA 3OFMA 2GCDA 3ORZA 1R1WA 2C6TA 3HL7A 4IQ6A 5G6VA 1XQZA 3UTOA 3SXFA 4GVJA 2YFXA 3RHKA 2NP8A 4D4YA 5HU9A 3I7CA 2BFXA 2C6EA 3ELJA 1Y8GA 4IZ7A 3VHEA 4NZWB 2JBPA 5D7AA 4BDKA 1JKTA 3GU6A 4JX3A 4ERWA 2CDZA 3JVSA 3HUCA 3PP0A 2PPQA 3EHAA 3PIYA 4P2KA 4RQKA 4C59A 4D4RA 1VEBA 4CMUA 1JKLA 4QO9A 4JT3A 4M8TA 3EN5A 3G6HA 4TWOA 3FZ1A 2QOLA 2HXLA 3DY7A 3H4JA 1MRYA 4CVAA 3OC1A 1R3CA 4GVAA 3HX4A 2V55A 3WZJA 3PIZA 4DH3A 2YWPA 3DPKA 2ZMCA 4GCJA 1OVEA 4OT6A 5H9BA 4O7TA 2F7EE 5AWMA 5A4LA 3VO3A 5D9HA 5J5TA 4I92A 1WVXA 1MRUA 3PJ8A 3GOPA 3EFKA 3Q4TA 3DV3A 4R1YA 5CT7A 3Q9XA 3ZUVA 3TJDA 2CLQA 4IAAA 4AZTA 3QC4A 2BZKB 3HMIA 1P5EA 4PL3A 3F3VA 5AEPA 5AM7A 5AV0A 1U4DA 4DFZE 5FQDC 4F64A 4JAIA 4XG2A 5E90A 5M07A 4GSBA 2OI4X 2YIRA 3DOGA 5F20A 5IU2A 5FBOA 2XNPA 2EB3A 5AP7A 2QO7A 2VV9A 3IO7A 4EK4A 4ERKA 3ORXA 3UQFA 4CGAA 1FPUA 5BV3A 4FTUA 5JGBA 2PL0A 4K11A 5HE2A 2J90A 5AMNA 2FO0A 2R4BA 3BYVA 4UZDA 5M06A 2QOCA 3SKCA 4XV1A 3FZTA 1R39A 2OO8X 4I6HA 4IWQA 4O4DA 4RIOA 3LFQA 4NM0A 4L46A 4I6BA 1H08A 4A07A 2B9JA 4YNOA 5J95A 2G1TA 3GCSA 4CT2A 3QALE 2WKMA 2RL5A 3LCSA 4FVRA 5E8UA 3PVBA 3E3BX 3E7VA 1DAWA 2XM9A 3NFGB 4NSTA 3UE4A 4FNXA 3AKLA 2YM3A 3I60A 3IW5A 5ANOA 4ZTQA 4PTCA 3O7LB 1E1XA 3LM5A 4V0GB 3V01A 4D1ZA 2J6MA 2J7TA 3FPMA 5L2TA 4O0SA 2OZAA 3S1HA 4WRSA 4ZTLA 4GL9A 2YA9A 2R3KA 5L8JA 4CFVA 5ETIA 5CU4A 5FBNC 2IO6A 2ZB1A 4W8EA 3HRFA 4O7VA 4HGEA 2YAKA 3V5TA 1GY3A 4RIYB 5C9CA 4BDEA 1RDQE 2F7ZE 1WCCA 4X3FA 4JQEA 4U41A 2HCKA 5AP1A 3CIKA 1NW1A 2UZOA 5EM7A 3CXWA 1FVRA 2X2LA 4XEYA 1PJKA 4AFJA 4EYMA 4EL9A 3O50A 1REKA 3QUDA 3AC1A 4KBKA 4P4CA 3KCKA 3VUKA 3Q2JA 2VWIA 2QU5A 4IZYA 4G31A 1F0QA 4XV3A 2J0LA 4F70A 2YIYA 5TF9A 3RNIA 1YDSE 1GZ8A 3ZEWA 5DT0A 2YJSA 3LFBA 2XANA 3PE2A 5AADA 5KZIA 3CTJA 4L43A 3FL5A 4O6LA 3QQKA 3FMLA 4NKSA 4PPAA 4CKJA 4X3FC 4F99A 1MQ4A 1XMMA 4AW5A 3RHXA 3H0ZA 3RTPA 2SRCA 4YZNA 3C7QA 4J99A 4U81A 3KIOC 1ZLTA 3PDTA 3RZBA 4CZUA 2VZ6A 3NUUA 3W10A 2E9NA 3PXQA 4FKUA 2ZM1A 3MWUA 3ORMA 3DTWA 4G3CA 2GHLA 4BYIA 3G15A 4RC3A 5CXZA 3DDQA 2IG7A 2C1BA 5CEIA 3F2AA 2UZBA 4CCUA 2P55A 4J98A 1XMLA 4Y5QA 5KMKA 4CKRA 3BHYA 3FMMA 2UZVA 3MIAA 4RFMA 5C4LA 2UZUE 5JN2A 3WF6A 3QD4A 5AUXA 4NIFA 5HO8A 4XMOA 4XH6A 5A4CA 2PVKA 1NY3A 1IG1A 3KF7A 2VWXA 1R0PA 3CD3A 3GENA 4F9WA 3COMA 3C5IA 3TV7A 1RE8A 3SVVA 1U5QA 3F3TA 2JKMA 1YHSA 1YI6A 1H1PA 4H3BA 3R8MA 2P2HA 4EI4A 4G5JA 2B9FA 2YERA 3VUMA 1Q61A 3FJQE 2A0CX 4G5PA 4O0RA 1PMVA 3BLAA 1ZZ2A 1MP8A 1BI7A 2WMVA 3QTUA 3LXKA 4IANA 5AAFA 4B0GA 2JFMA 4BCMA 3A4PA 5CALA 1PW2A 3GU4A 3NUPA 4HJOA 4C38A 1Q8WA 4ITHA 4A9TA 2WQBA 2VU3A 3QTIA 4BBMA 3U9CA 3SG8A 4J96A 3RBWA 4EK3A 3PVWA 2WFYA 3DKFA 4KBAA 4ONAA 4ZY4A 3C0IA 2WMRA 4QQJA 2O65A 4JMQA 2I0EA 3EQGA 2YM6A 2FSOX 1YXUA 4QMWA 4YJSA 1WBOA 2PMIA 3Q2MA 4YLLA 2PUUA 5HNIX 3ZLYA 3L8SA 1CKJA 2QO2A 4QYYA 4QYHA 4UV0A 4EUUA 2QG5A 3HDMA 3CBLA 3EQCA 3NEWA 3PPJA 5IA0A 1YOLA 5JEBA 2PTKA 5CU2A 3GNIB 4E6CA 1BL6A 3OCGA 4YLJA 3UMXA 3KXNA 3PA3A 4PL5A 1XJDA 1A48A 4FE2A 3VF9A 5CANA 4K33A 5M53A 2J51A 2CGVA 2RG6A 2W0JA 2FSTX 1VYWA 3CC6A 3PG1A 2Z60A 4YURA 4FIIA 5HG9A 3U54A 2J2IB 3MI9A 4ITJA 3PVGA 5J9LA 4MHAA 4WD5A 1H07A 2PYWA 3LMIA 4XG3A 2HENA 2VNYA 2ACXA 3EZRA 4U5JA 4XLVA 3F5UA 4TRLA 2GHMA 1RJBA 4UXQA 3I5NA 1ZYSA 4N6YA 3B8RA 4TW9A 2VWUA 4RX7A 3HZTA 2IN6A 5I9XA 1G8SA 2CNQA 3R28A 2B53A 2RIOA 5CS6A 3QX4A 1U54B 4EK6A 4CLIA 3B8QA 2XK4A 4HVGA 4CYIA 2CN5A 4QMYA 4AAYA 3PRFA 3TT0A 2G2HA 4M0ZA 5C8MA 5JZNA 4R7IA 4C3RA 4YTFA 3ZM9A 2UW0A 4OBQA 3E63A 4EH7A 1URWA 3BX5A 2OXXA 2BIYA 4EH6A 2V7AA 2XP2A 3R1QA 3FHRA 4AZFA 1XHAA 5FD2A 4O27B 3ZMMA 3NAYA 5D10A 5BYZA 3SC1A 4LV7A 4CQGA 4QP9A 4PY1A 1CTPE 1NA7A 4ZJIA 2GS7A 4EKKA 5KZ0A 5BVFA 3KRLA 3A7GA 2JITA 4P7EA 4UWBA 4AFEA 4G9RA 3GC0A 4BDIA 3G9NA 2G2FA 3R1YA 4FTQA 4BCGA 4AAAA 1ZOGA 3FQHA 2YIQA 5D12A 2GNIA 3MJ1A 4IAFA 3AMAA 5KBRA 4U44A 4QP3A 5JT2A 2O3PA 3EN9A 2QLQA 3A62A 3C5UA 4EZ3A 1H25A 4RA5A 3I0OA 3UIUA 1QCFA 3ZLWA 5AJQA 3QX2A 3W2PA 5JSMA 1YXSA 1GAGA 2EU9A 2OFUA 3IGGA 5HQ0A 2ETMA 2QO9A 4M0YA 2W1EA 3H10A 4FKGA 4BI2A 3OEZA 4HCUA 4YZBA 5HVJA 4BDCA 4F4PA 4ZSAA 4Y5HA 2ITPA 4MQ2A 3ZOSA 3EH9A 4CNHA 4ZIMA 4F6UA 3C0HA 4MXAA 3RK7A 5KKRC 4FIGA 2C5OA 3Q5ZA 4NIFB 2VO6A 5LVOA 3AC8A 4RRVA 4FF8A 1S9IA 1P4OA 1H27A 2HZNA 3D0EA 3W16A 5C27A 5JQ5A 4D2WA 2HW6A 4FK6A 3R8PA 2A27A 4RFZA 1YI3A 4AGCA 3NUAA 2QOKA 4A9YA 4ANLA 3A60A 4FG7A 5GZAA 3W0RA 3F61A 4MTAA 3RGFA 3U6JA 2BR1A 5E8VA 3SXRA 4F7LA 4MNEB 4A9SA 4CFXA 2YM4A 4QMTA 4K1BA 5L2QA 3QWKA 3R9OA 3VUHA 4APPA 3AG9A 3ENHA 3ETAA 3NAXA 4NJDA 4HVDA 5CSWA 2W7XA 4G6OA 4QTAA 4ZSEA 5DFPA 2J0MB 4RVTA 4ACMA 2B4SB 3VUIA 3GEQA 4B99A 3UVPA 4C58A 3MH2A 4R7HA 4QDVA 5EQYA 4WBBB 5BVNA 1PXNA 4DLIA 2C6DA 4FIEA 4DHFA 4O21A 5AP6A 3JPVA 1PXPA 3O8TA 3BKBA 3LJ0A 3GQIA 2OH4A 3H30A 4MNFA 4IAYA 2JC6A 4FSNA 3TNHA 3PTGA 4E5AX 2BVAA 4D55A 3OOGA 4F1TA 3AMBA 3LCKA 2XKFA 2WO6A 4QTCA 3EQRA 4PWNA 4MX9A 2HIWA 3O51A 2X7FA 3Q96A 4S33A 4U3YA 1CMKE 2XIXA 4DHJA 4ASXA 3BBWA 3OCSA 3R9NA 5IF1A 5JFVA 5LOHA 4G2FA 4TT7A 2XKCA 3K3IA 3VJNA 4LL0A 3QRJA 2I1MA 4OW8A 3RNYA 4UN0C 5BVDA 2VN9A 2G9XA 4JL9A 4OGRA 1FOTA 3K2LA 2C47A 4ZEGA 4S34A 3KA0A 3SRVB 2ZV7A 4BRXA 2NPQA 4GU6A 1JLUE 3CQUA 3CEKA 3IDBA 1T45A 4O2PA 5EOLA 2ESMA 5GZ8A 4EOJA 3LMHA 3QD0A 3RALA 3U51A 1OGYA 3R1SA 4FRFA 3GCPA 2XAOA 4PPBA 4ZJJA 4FNZA 3F2RA 4HNFA 3KMMA 4EHVA 5CEKA 2ITTA 4RVLA 5DA3A 4CTBA 5BNJA 2I6LA 5TE0A 4PV0A 4I20A 4DC2A 5AX9A 4S31A 4FKOA 5DMZA 4JBQA 3K54A 3F6XA 4AUAA 4FT7A 1H28A 4OTHA 4FGBA 2PVJA 1LUFA 5TT7A 1OKYA 4NTTA 4KIOA 3MTFA 5B0XA 4C2WA 5KUPA 4AQKA 2JKOA 2QQ7A 2VX0A 5FUTA 4OBPA 3VN9A 3VW6A 3WIGA 2ZM4A 4LRJA 2XCHA 5HCXA 2XKDA 4CRLA 3FZOA 4YPDA 2YCSA 3AC5A 4FKRA 1AD5A 3DLZA 3ERKA 5CXHA 3LXPA 4KD1A 2PVRA 4WSYA 4IBMA 5EYCA 5HBHA 4PTGA 2P3GX 2O63A 3C1XA 1T46A 3BGZA 5GNKA 2CKOA 3PE1A 4GUEA 4M69A 1Y6AA 4IDTA 4MXXA 3NW7A 4RFYA 3AGLA 2HWOA 2PHKA 2WELA 4G16A 3SHEA 3TTJA 4C4EA 4J7BA 1ZMWA 3NUNA 1OB3A 1G3NA 1H0WA 3WI6A 4XNEA 4MAOA 4C4GA 3JY9A 3LW0A 3GBZA 4FSQA 4TKSA 3VAPA 2C0IA 4FZAB 3AT4A 3BU3A 4I1ZA 2VD5A 4JBVA 4IEBA 3R30A 4DINA 3KRRA 2OZOA 3UNKA 2AUHA 3DK7A 5DT3A 4YU2A 4R77A 4EOQA 3LFSA 4QMNA 3CSVA 2R3MA 4KS8A 3TKUA 2JDTA 3M2WA 3TXOA 4J8MA 5E8WA 3BL9A 3C4WA 5HE0A 3F5GA 3TWJA 1WBNA 2WHBA 5HLWA 2RF9A 4L3JA 4BICA 2XNOA 5ETCA 2BTSA 3G2FA 3O8PA 3QQUA 4GFGA 3KVXA 4AN3A 4C3FA 5M08A 5CZHA 5DE2A 5EHYA 5K4JA 1NT2A 3PZHA 5AP4A 4BCJA 3F5PA 2VTJA 3S0OA 2WTKC 1WBWA 4DH7A 5HO7A 5F4NA 1IA9A 5HU3A 2PULA 3DBEA 2OJJA 3QYWA 4JQ8A 4FV8A 3NNVA 3UVQA 4LV8A 4PPCA 4BY9E 5DLSA 2BKKA 4I23A 2ITZA 4OTPA 3R9DA 4QEBA 5HORA 3MV5A 4YO6A 3GXLA 5AUUA 4AGWA 4K8AA 5CAVA 2B1PA 2KTYA 5J1VA 5A3XA 3ZSGA 4JXFA 3P7BA 3Q4CA 4W4WA 4DEEA 3THBA 3QC9A 3NNXA 4RZWA 4FVQA 3QXPA 4Y83A 4N57A 2NRUA 3U6IA 5M55A 2GQSA 2IVUA 2EXMA 3VHKA 3VULA 2VTHA 5K5NA 4NFNA 4EQUA 2JD5A 4Q5HA 4L3PA 5AM6A 3QBNA 4ACDA 3DQWA 4APCA 3MA6A 5FP5A 3D14A 4O82A 1GOLA 1PMNA 4GYGA 2WQOA 3IOKA 1R0EA 5GINE 1BMKA 3IECA 4MYGA 3DNEA 4FKTA 4DHIB 1SVEA 5C26A 3COIA 3IW6A 5HI2A 3TYKA 2Z7SA 3MPMA 2PE0A 5LCJA 3IG7A 1OBDA 1BUHA 2H9VA 4JRVA 4G9CA 3QZIA 4DT8A 4QMMA 2UZWE 3FLYA 3ORLA 5IQHA 4C4HA 2OK1A 5HIDA 2PE1A 3HP5A 1UWJA 2R3IA 4LUDA 2WMTA 4NT4A 3TUCA 1IAHA 5FLFA 5EYMA 1ZYDA 4C37A 3E8CA 3O5AA 4ZLZA 2C4GA 3RM6A 2B55A 4HGTA 4CXAA 4D4VA 4DH5A 1NVRA 5IMEA 4W4VA 4DGOA 4IWDA 3BCEA 2C30A 2OIQA 4IIRA 3BYMA 5D11A 2HZIA 4FT5A 3PXYA 4QYFA 5GZ9A 1JPAA 2ONLA 5ICPA 4WIHA 4ZP5A 3ZU7A 1M2RA 1KV2A 3F2NA 3RI1A 4LGHA 4FMQA 4FT0A 3VS2A 5D41A 3V8SA 3TACA 2ZDUA 1OL1A 1PYXA 3HV6A 3VUGA 4R78A 3HRCA 4RIWA 3T9IA 3B2WA 4TWPA 3MA3A 2WMQA 2C3LA 5L6OA 2AYPA 5GIOE 2HZ0A 4M69B 5J9YA