2JDSA

Structure of camp-dependent protein kinase complexed with a-443654
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
337
structure length
334
Chain Sequence
SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CAMP-DEPENDENT PROTEIN KINASE
publication title A Structural Comparison of Inhibitor Binding to Pkb, Pka and Pka-Pkb Chimera
pubmed doi rcsb
source organism Bos taurus
total genus 109
structure length 334
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2jdsA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2jdsA02
2GS2A 3DBDA 3NYVA 3ACKA 5CSXA 3DJ5A 4EBVA 3WZDA 3UJGA 3TWJA 3P5KA 2X2KA 2ZOQA 3PP0A 1ZLTA 3QWKA 4G3CA 3TTIA 4YSMA 4FTCA 2B52A 3R9NA 3RZBA 4BC6A 4DHFA 4Q9ZA 4R1VA 1W83A 2ITWA 4DEGA 4NT4A 3QD4A 3UTOA 1JNKA 3FZOA 4BR3A 4IM2A 3N9XA 3QCSA 4KRCA 4L00A 4NK9A 1KWPA 5EOLA 4BF2A 4LM5A 2YM8A 1JWHA 3KXHA 3GCQA 4FSUA 4GT4A 5HICA 2R3HA 4IAAA 4RQKA 4AGCA 5M44A 5HI2A 2G2FA 4L9IA 4CFVA 2H6DA 4ZJJA 3BYMA 3TKUA 3POOA 4LMNA 4XBRA 4F09A 5EHYA 2UW6A 4CTCA 2PUUA 3MSSA 4FIEA 4IC8A 3HRCA 2RG6A 4RX5A 3O17A 2ACXA 3A62A 5HTCA 2JKMA 1BLXA 4EOKA 5KHWA 5KMNA 3DXPA 4BCJA 4A4OA 2VTMA 5FXQA 4EQUA 4TYEA 4EI4A 2BZHB 4BTJA 4F7SA 3HA6A 3SW4A 4EH8A 3ZUTA 4Z7HA 4CCUA 3A61A 3K5UA 5IA3A 2WAJA 4RGJA 4LI5A 3NUAA 5M55A 4D2PA 2GQRA 3MJ2A 5M4CA 2XJ0A 4DGMA 4YBJA 2X4ZA 2OZAA 4TW9A 2WTIA 3OF0A 3R8LA 2WKMA 3FLWA 4HGTA 3G15A 3RPVA 2BFXA 2V5QA 3E88A 3GOPA 1U54B 2X2LA 2AYPA 3MVJA 1H1QA 4C4JA 3HMIA 2H96A 4OTHA 4W9XA 3EB0A 1AD5A 4ORKA 4WRGA 3UQFA 5GHVA 3ZS5A 2ITNA 4M8TA 1GZOA 4GU6A 4FEUA 3OW3A 4Y83A 5EQYA 4X2NA 3NMUF 3SA0A 2YITA 2A1AB 3O23A 3HV6A 4FKPA 4FTKA 4X2JA 1Y6AA 2O5KA 3VW8A 4HOKA 3NNVA 3S1HA 4IX5A 4RFMA 5CU4A 3QLFA 3VF8A 2ZMDA 3VS4A 2YEXA 3DB8A 3BX5A 2HCKA 3PIYA 4YZDA 4X3JA 3RTPA 4BWKA 4F9WA 3TNHA 2Z7LA 3G6HA 2XJ1A 1UNGA 3GUBA 4CLIA 2RG5A 1SVHA 2BROA 3W10A 4EZ7A 2C0IA 3C0IA 3RPSA 3V5TA 4HGSA 3LQ5A 4XOYA 5AA9A 5HTIA 4RWKA 4N0SA 4PDPA 4H05A 4GVJA 3P78A 4I22A 4UZHA 5DR2A 5A6NA 4FSMA 3FHIA 4DG2E 1PMEA 2YCFA 1MUOA 3MY0A 2G2IA 4USDA 5T3QA 1OZ1A 3JXWA 1F3MC 2HK5A 1Q8WA 2W5HA 3UIMA 3R9OA 1YRPA 2G2HA 3EOCA 3RZFA 1ERKA 2E9UA 2WOUA 3I6WA 3MBLA 2OG8A 4RVMA 1ZZLA 4RJ7A 4TZRA 4DA5A 2PE1A 3MI9A 3NW5A 4D0WA 3KCKA 3EL7A 3CTJA 3OHTA 1OECA 2WMXA 5BVFA 5I5ZA 4CD0A 2ITVA 2VN9A 2UVYA 3MY5A 2W4KA 3PRFA 4RIWB 4RIYB 3G9NA 5DGZA 2B4SB 4YZMA 5AUYA 3IW7A 4KWPA 1B38A 1R0PA 2R9SA 5GIOE 4XLVA 4L45A 3TKIA 3FXXA 4GL9A 3DKGA 2ESMA 3H9FA 2XP2A 4GK3A 4P4CA 4YJUA 2WTWA 4YJTA 4X3FA 2XKCA 3RAKA 4MBJA 4EOMA 1A48A 3HV4A 2PSQA 4C3FA 4KSPA 3H9RA 3OY1A 4OR5A 3I5ZA 2C0TA 4KS7A 4NYEA 3GFWA 2A2AA 4M12A 4YHFA 2VTHA 3HECA 3U87A 4E6QA 5A14A 2Z02A 4KD1A 3QTQA 4D2VA 4UB7A 4EYMA 5J5SA 1NT2A 3D9VA 3E8EA 4FVPA 2WGJA 4GVAA 4KBCA 3PE2A 1DAYA 2R4BA 4NEUA 3R30A 4X2KA 3BU5A 3IECA 4MYGA 3ET7A 3VUDA 3NSZA 4NJDA 3TG1A 4HNFA 3KULA 2PVNA 5D11A 3TIYA 1F5QA 5AP5A 1OI9A 4E93A 5JGDA 5KNJA 2YM7A 1DM2A 4GW8A 5HVYA 5EM5A 2GFCA 3PJ3A 3R7EA 3RM6A 3UOLA 4HW7A 4YC3A 5AR8A 4JQ7A 5J9ZA 2VTLA 5CVFA 4JS8A 4D2RA 2P55A 5A54A 4OBOA 1JKLA 4NFNA 3ZOSA 4I24A 2BRMA 4ITIA 2R64A 3QD2B 4HYUA 2IVUA 4PPCA 3UOHA 3QTWA 3BCEA 4YMJA 5L2WA 3TM0A 2VTQA 3U51A 4EKLA 4G3FA 4FTRA 4H3PA 4NW6A 3E7OA 4BDJA 1Q8TA 3O7LB 4PPAA 4OTGA 4EH3A 5KKRB 3UNKA 2UZVA 4EZ5A 4JQ8A 4FOCA 3R9RA 3GCPA 3K5VA 2GFSA 4K2RA 3ZLSA 5B2MA 3OEFX 3EQDA 5DRDA 2YA9A 2ETMA 2UW5A 4IFGA 4YLJA 4NM3A 1LP4A 2RFNA 2CJMA 5EG3A 2CDZA 3ORXA 4YJPA 4GRBA 3F61A 2C3IB 2XNEA 3OS3A 1GIJA 1XO2B 5EHLA 4BIBA 2Y4IC 5HLNA 4BDCA 4YSJA 2PYWA 4IAKA 3I0QA 3WARA 1OPLA 1W84A 3BPRA 4KKGA 4MD8E 1YHWA 2XEZA 5I9UA 2QOQA 3TIZA 3PVWA 3G5DA 4F0GA 2JC6A 4QMMA 3NEWA 3QTRA 4NFMA 4R3CA 5CSWA 2ZDUA 3VBQA 4YURA 1OIYA 4L53A 2UZLA 3DAEA 4FSYA 2VTSA 2VWWA 3IO7A 4QP9A 3DTCA 4RQVA 3TTJA 2WMBA 2WMUA 3RCJA 2CGXA 3HL7A 4I6FA 4K1BA 1VJYA 4LUEA 4XP2A 5KZ0A 2YAKA 4AZWA 4UMQA 2GNJA 2X4FA 3HMMA 3D0EA 3LPBA 3M1SA 4HYHA 4J97A 5AP1A 1E1VA 2VWZA 4DEIA 4NTTA 2C6DA 3ZHPC 1H01A 2O65A 2XBJA 3RINA 3WF8A 4D2WA 3CJFA 3RI1A 3T3UA 2ITYA 4ZZOA 4K8AA 4FKQA 2JKQA 5CEKA 4UMTA 4ITHA 1URCA 4YTFA 5HU9A 2BTRA 1T46A 3QGYA 5FLFA 5F94A 2HOGA 3SRVA 4H36A 2XRWA 3KXGA 3MN3A 1BX6A 4FBXA 2C6MA 4J53A 4R3PA 3MFSA 3AC8A 3VJOA 4L7FA 4JDHA 5CSPA 1YHSA 3QUPA 4E8AA 4C3PA 4BCFA 4DN5A 3HZTA 5IZFA 4B0GA 5LOHA 2RL5A 4BY9E 4WNPA 2EWAA 1T45A 3SLSA 3UNJA 3ANQA 3UO5A 5GIPE 1REJA 2CN5A 3UC4A 2AC3A 2QOKA 4JLCA 4OTWA 1PXKA 1YW2A 3ZXZA 3FBVA 1OIQA 4ZSGA 5DBXA 2WQMA 2UZOA 3PG3A 3FQEA 4M97A 1A06A 3FDNA 2FVDA 4IVAA 1DS5A 2CCHA 4K6ZA 2R0UA 4DLIA 4ZZMA 2R3OA 4UYNA 2YACA 4JNWA 4NKSA 2YWVA 3Q04A 4G3GA 5E91A 1G3NA 1ND4A 4USFA 4M13A 2EXCX 3JY0A 1XH8A 5K5XA 2GU8A 2XF0A 2XCKA 2CSNA 3R28A 3V04A 4AACA 3O71A 1JSUA 3LZBA 5F4NA 3E92A 4UWCA 3QBNA 2WIHA 5CWZA 3IS5A 5EK7A 2YZAA 5AP2A 3R8PA 5LMKA 2UZWE 3EQGA 4E4XA 5LVPA 4QRCA 4U5JA 3RVGA 3C1XA 4FIGA 3TEIA 3F7WA 1M7NA 3PY0A 4X6RA 4QP1A 1TQMA 2BDJA 2PMOX 3EZRA 3JYAA 4IFCA 1IA8A 3OTVA 1TQPA 4DC2A 4ID7A 3K2LA 1QPEA 3AMYA 2XK6A 5HE3A 2PZIA 3NYXA 4IWDA 2X9EA 3EQBA 3VW6A 5ANDA 3R04A 4ACCA 4ANLA 1DAWA 1W98A 1GNGA 1BYGA 2Z8CA 3ZO2A 4ANQA 4ZSJA 2HZNA 4M3QA 3ORLA 2UZBA 4IZ7A 3TDWA 5AX9A 1BL7A 2IZUA 3U6JA 3DTWA 5HO7A 3JY9A 3G0EA 3D94A 3R00A 1OIUA 2FYSA 2XH5A 4P90A 4D4VA 1V0PA 3Q5ZA 3Q5IA 4ZSLA 3G90X 3Q9XA 3RHKA 4J98A 4BI2A 3PWYA 3KULB 3QQUA 3B8QA 3R73A 3HV3A 2R0IA 2OFVA 3FZTA 4IC7A 4PUZA 2J0IA 4FV5A 3CTHA 3RM7A 1O6LA 3U54A 4XV1A 2BILB 4FV6A 3ZCLA 2W1IA 1WZYA 3I1AA 4YC8A 4GU9A 4C4GA 4CSVA 1PMUA 2ZB0A 2J4ZA 3OC1A 4I21A 5L3AA 2OXXA 3L9LA 5EQEA 3UVQA 3PXYA 4O7NA 2IW9A 5IQAA 1H4LA 1MRYA 3QRKA 4HNIA 4FEQA 4YTIA 2FH9A 5CLPA 1NA7A 3BKBA 3C4XA 3WF9A 4F9BA 4ASEA 5JGBA 5L6OA 3I7CA 3MDYA 3TACA 4DCAA 1PHKA 5JFSA 4QP3A 2P0CA 1QPJA 3WE4A 3F3TA 5JK3A 4CV8A 2ZV7A 4E7WA 3TZ7A 3RK5A 4ZLZA 5G6VA 3FV8A 4DF3A 3DY7A 5CF6A 4MXCA 2IZSA 4MCVA 3EFLA 3TNPC 4ZTNA 4CQEA 1U4DA 3CC6A 5KBRA 2X8DA 1J3HA 4CMOA 5DEWA 3T3VA 5KE0A 3ZO3A 3C4CA 2PMIA 3U9CA 2J50A 3GT8A 4DFZE 4BFMA 3NUSA 3ZEPA 4IIRA 3FLYA 3ZC6A 5IA2A 4IQ6A 4FZFB 2JAMA 3UP2A 4FSZA 1ZRZA 4R7HA 1ZYJA 2IZRA 3DQXA 4W4WA 5CU0A 1WFCA 2YCQA 1R39A 3IW5A 4H3QA 5HG9A 3VN9A 4IDTA 4A4LA 3OWLA 3MFUA 2QI8A 2YJRA 3GCUA 4BL1A 1YOMA 2WMVA 5FQDC 3F69A 3QYZA 3GC7A 2ONLC 5E7RA 5HBEA 3HP2A 4V01A 3BYSA 3QZGA 4FV0A 4TKSA 2VGPA 3COKA 3FMEA 2ZV9A 4YHTA 3NNUA 1REKA 2B54A 4RWLA 4AU8A 4F9AA 3W8QA 4BCMA 2F7ZE 1PMVA 4TXCA 4WBBB 3BELA 1QPCA 5IF1A 5L6PA 4E5WA 4DINA 2C1BA 5FM2A 4EC9A 4LOQA 3MA6A 2DUVA 2YJSA 3TV6A 5I0BA 2JD5A 5IQEA 2SRCA 1G5SA 1PKDA 3HEGA 1TQIA 3PJ1A 4FL2A 4G2FA 5E8SA 4QYFA 1UU9A 5DOSA 4ZTSA 4GYGA 4DAWA 4IXPA 3F3UA 4V05A 4D28A 3ZUUA 1ZAOA 3L9NA 4ZK5A 2WU7A 4C36A 1SYKA 3GQIA 3CS9A 3VS7A 3VBWA 3SRVB 2ZJWA 4G5PA 5AP3A 3AT3A 5E8UA 5KMLA 2QKRA 3U55A 2JKOA 4CG8A 4EONA 3HDMA 4ZS4A 4CT1A 3N4VA 3UIXA 4YJOA 3LFFA 4KIKB 3QD0A 3QWJA 1IRKA 2YLEA 2W4OA 5JZNA 2CNUA 1DI9A 4CT2A 2X8IA 5CY3A 2X6EA 2ZMCA 3EMGA 2YAAA 3MJ1A 4U6RA 4DGLC 3OT3A 2RFSA 5DPVA 1PXPA 2OJIA 4KIOA 4L01A 3L9MA 3TT0A 3Q2MA 3IOPA 4EOOA 3QU0A 3VHEA 2GS7A 5CZIA 4U0IA 4DFUA 4UMUA 2CHLA 3ZLWA 4DEAA 4QMQA 3NYOA 2PPQA 3LCTA 3FC2A 4TYIA 5FP5A 5A9UA 4G6NA 2VRXA 4I5CA 3FJQE 4RWJA 3QKLA 4JG7A 2QOFA 5CEOA 3HAVA 4YJQA 4RIXB 4UBAA 4FIFA 4GT3A 3V5JA 1W7HA 2WHBA 4QQJA 2IJMA 2A4LA 2W17A 4G34A 2QR7A 2C69A 3OMVA 2QOCA 5CALA 5I9VA 4FV9A 5AUWA 2QO2A 5DLSA 4MH7A 2XRUA 5HESA 2OIQA 4D1ZA 2NO3A 1M2PA 2GTNA 2UZTA 3R22A 2YFXA 3FHRA 1E9HA 4GH2A 2HW6A 3QD3A 5CSHA 3ENMA 4G1WA 2VAGA 5M09A 1KV2A 2BALA 3ZMMA 4FE2A 4XH6A 4F1OA 2X8EA 2F7XE 3BGZA 3QCYA 3RK9A 5CF4A 4GKHA 4M67A 4E4MA 3GP0A 4YJVA 2OWBA 2ITOA 2WTJA 4GEOA 1JKTA 4RC3A 2VTTA 5HU3A 4NM0A 4EWQA 1VYWA 1X8BA 2B0QA 2UW8A 4IB0A 5ITAA 4I93A 4IX4A 5I9WA 4FIIA 3W1FA 4FX3A 5EKNA 3P7AA 3WZUA 4RPVA 3II5A 1H8FA 4MEDA 3Q96A 4W8DA 5C9CA 4AW5A 4EK3A 2OW3A 3QGWA 4BDHA 4LG4A 5HEZA 2XK8A 4R77A 4BI1A 4RZVA 3PVGA 3VUKA 4FEVA 4Y46A 1OL5A 3IDBA 2Z7QA 3F3VA 3MYGA 3R1NA 4I23A 2CKOA 4IAYA 3EN9A 2C3KA 4NTSA 3KA0A 1W82A 3DPKA 4RJ5A 3FMLA 4D9TA 2JAVA 2XNPA 4D4YA 1ZY4A 3IKAA 5D7AA 1KUTA 4ANSA 3L8SA 5BUJA 3V6RA 3K3JA 1P5EA 3NCZA 1NXKA 4HVDA 2QONA 1GJOA 2X0GA 4QPSA 4PL4A 4ZAUA 5EHOA 5C27A 3VF9A 4J8NA 2O0UA 2W1ZA 1Q8UA 3KQ7A 2W1DA 5I9XA 1UNLA 3WF7A 3PXKA 2J6MA 2PL0A 3BEGA 3BHHA 4IZAA 2XKFA 1GAGA 1O9UA 3ITZA 4J71A 5CAPA 3BI6A 3Q9YA 3EFJA 4IBMA 3LFQA 1OKVA 2XB7A 4NW5A 1LR4A 2GNGA 2HY0A 1ZZ2A 2V55A 2VTRA 3MB7A 4DH5A 5I9YA 4BN1A 4JDIA 3PXZA 5EFQA 3EFWA 4MXYA 3AQVA 3CD3A 5KMMA 3NW6A 3LMIA 3KFAA 3QTXA 3C4EA 3AD4A 3DOGA 3FLQA 1BMKA 4O84A 2B53A 5IQCA 3QTUA 3NLBA 3H4JA 5JMSA 5J1VA 4DH8A 3A7JA 4O6EA 4TT7A 3UPZA 4JL9A 1Y8YA 3G2FA 1STCE 1IASA 4Y85A 5EM8A 1BUHA 3T9IA 3ACJA 5IMEA 2B9FA 4QTDA 4ZY6A 2E2BA 1MP8A 3WOWA 3DAKA 1CDKA 2Y9QA 4PMSA 4UY9A 4XP3A 5H8EA 2WNTA 3R8ZA 2YCSA 4JIAA 5CU2A 3NVKI 5ETFA 5HHWA 2EVAA 4UMRA 1R1WA 3CGFA 1Y8GA 2XCHA 1TKIA 2DS1A 3BWFA 5C03A 4BIDA 4MD7E 2OK1A 4D9UA 1R3CA 3Q4ZA 3DGKA 3OXIA 1Z9XA 3QHRA 2BCJA 4QMVA 4O0WA 3E5AA 5EM6A 4YR8A 3NDMA 1L3RE 4ARKA 4TL0A 4S32A 4AA0A 3TNQB 1XQZA 4EL9A 4RVKA 4ERKA 3TCPA 3AGMA 3WYXA 3HRBA 2VWXA 3AMBA 3CKWA 3GU6A 3ZRKA 2QHNA 3DAJA 3PPZA 3EYHA 3P1AA 4IZ5A 4YZNA 4AOIA 1XHAA 4X0MA 3OTUA 2JDVA 4IMYA 4RFYA 1I44A 1OPKA 2CPKE 3N4TA 4QYGA 4FSQA 1NY3A 3S95A 4NU1A 4TNDA 3W33A 4E3CA 2KTYA 4U7ZA 4K9YA 4MXZA 4AQCA 4FNYA 4BGGA 3FI4A 4DFNA 4R6VA 2C1AA 5CX9A 3HVCA 3ZRMA 4AZSA 4O7TA 3BIZA 4BCQA 3EQFA 3EQIA 4L67A 3PZHA 4M68A 4R1YA 2GNHA 2C5OA 1SVEA 2QQ7A 3FI8A 4A9SA 5JQ8A 3FEGA 4G5JA 4ZSEA 4HYIA 4KBKA 5HTBA 3A7HA 3R2BA 3SX9A 1JOWB 3SAYA 5FWKK 4L6QA 3GQLA 2VUWA 3HLLA 2PMNX 4GJ3A 5ETCA 5D1JA 3E7VA 2OFUA 1OPJA 4JVGA 5T68A 3A7GA 3DBFA 3MVMA 3VQHA 3VRZA 3SOAA 4ZTMA 2WQEA 3E64A 3R71A 4GMYA 4S30A 3ZH8A 4QMWA 5HX6A 4DEDA 3EQPA 3KU2A 2W96B 5AR2A 3Q53A 4FKOA 3RJCA 3KXXA 4A9YA 4EH2A 2BHHA 3PA3A 2Y6MA 4FKRA 3R83A 1MQ4A 3NZ0A 4YJSA 2WXVA 3OEZA 5LCKA 5CQUA 3ZFXA 5A46A 3ORPA 2EXEA 2VTIA 5DFPA 3PA4A 5C1QB 4QP7A 3SG8A 1PRYA 3ORIA 4FKVA 5CT7A 2YIYA 3PXRA 2OF4A 3AC2A 2C5NA 3QUDA 4RLLA 5AV2A 3GXLA 3V8TA 5AV4A 4BTMA 2VWYA 1OL7A 2VTNA 4MBLA 1JSTA 2YIQA 4EHEA 2J90A 2C6LA 3SXRA 1ZOGA 3LFSA 3F2AA 4BHNA 1R78A 4E4NA 1B39A 3RCDA 5KX8A 3A7FA 3GBZA 4EYJA 2GPHA 3MGYA 3F82A 1Q3WA 1OITA 2B9JA 1H26A 3DDQA 4QO9A 4HVHA 5BUIA 4FKSA 2P2IA 4R78A 4JBQA 5IEYA 3V8WA 1PJKA 1XBAA 5LXMA 3QFVA 5CU3A 3FL4A 5AV0A 3KVXA 1WBOA 2C0OA 1APME 2UW0A 1YKRA 2DYLA 4FICA 2W9FB 5CVHA 4D2SA 5CXZA 4JG8A 1ZMUA 3N4UA 4M69B 4O0YA 4B4LA 1ZYDA 2VO7A 3LKMA 1RJBA 4UXLA 3R7IA 4U3ZA 3UZPA 4H1JA 2VTOA 2XKEA 3QQFA 3BEAA 2J0LA 3I4BA 2WQNA 3R2YA 4RJ4A 4PL3A 1WBPA 4LFIA 5M07A 1Z57A 3S4QA 2BRHA 4O0TA 4X2FA 3TDVA 5IQFA 4IX3A 5BVWA 4E20A 3ORKA 3VBXA 5AUZA 3ZM9A 4ZP5A 1GZKA 3ERKA 5CEQA 2DQ7X 4HVSA 1JPAA 5IEXA 2OJJA 3PWDA 3E3BX 3OG7A 4FA2A 1M52A 3MIYA 3LCOA 3QRTA 1JKSA 3QA8A 2XYNA 3ODYX 3IONA 4B6LA 4BWPA 2WMAA 3BRBA 4IWQA 4I3ZA 1KOBA 3ANRA 2E9PA 3HKOA 3QYWA 3LXLA 2IW6A 4PDSA 4MNFA 5FXSA 4DE4A 2YDKA 4I0RA 1WBTA 4DG3E 3SVVA 4LMUA 3NGAA 3EKNA 2QLUA 4IDVA 5FBNC 3KXMA 4O21A 2NP8A 3QAME 4GUEA 3VUHA 5LJJA 3AC1A 4EK6A 2JFMA 4EEVA 2ZB1A 4N70A 4IWOA 4II5A 3EWHA 5GJDA 5T6KA 2GS6A 4OT6A 3P23A 3LXKA 4KKHA 4FNWA 4WNKA 3MH2A 4DLJA 3BGPA 4XRLA 4ERWA 5M51A 3QKMA 3VUIA 4CZYB 2IWIA 3KRRA 1FPUA 4LGDA 4UMPA 2OLCA 4P5ZA 5B0XA 3ROCA 4O6LA 5CNOA 2HENA 3Q9ZA 4OUCA 3FLZA 4QYYA 3P9JA 4MXOA 5ANEA 3U4WA 4R3RA 4F7NA 5BUEA 2OXDA 3UDBA 4PWNA 3NR9A 4U3YA 3W32A 4FL1A 3LFAA 2PWLA 3IOKA 5CU6A 2OI4X 3CQUA 1SMHA 3ROYA 2X39A 5AM7A 4FZAB 2V62A 2OH0E 3S00A 4FTAA 3MFRA 4AFJA 2WQBA 4FYNA 3V5LA 4ZMEA 3DK7A 3C9WA 2PMLX 2W1EA 2GNFA 2J7TA 2JFLA 3LM5A 3FMMA 4FSRA 3A4PA 4IE9A 4AWIA 4DT8A 1CSNA 4L3JA 3LJ0A 5DG5A 5ANOA 5FM3A 2YIRA 3BLHA 4BDKA 4R7BA 3S2PA 3FY0A 2OO8X 4YZBA 4O83A 4FVRA 4ZMFA 3NNXA 5EW8A 5CEMA 1PXNA 2UV2A 3CR0A 5KBQA 3ZLXA 2QKWB 4G16A 5CAVA 1JSVA 2JDOA 5ETAA 2Q83A 4K18A 4NZWB 5F9EA 2OU7A 3U8WA 4DH3A 1WMKA 4W9WA 2BRGA 4XEYA 2HZ0A 3KRLA 2B9HA 3DFAA 3PJ8A 3FMNA 4FT9A 4MWIA 5AP7A 3L9PA 5M4IA 3LIJA 4MBIA 5AM6A 4BTFA 4CNHA 2OZAB 3FZPA 2UW7A 5J5TA 5K5NA 2ERKA 2EXMA 4FIHA 3KL8A 3KY2A 4LV8A 4DFYA 4NUSA 5HCYA 2PVLA 1UU7A 3L8PA 4AP7A 2W7XA 3QCQA 5TO8A 1QPDA 3OUNB 3KK8A 5HNBA 3BV3A 3EJ1A 4RJ3A 4FTNA 4IM3A 5B2KA 1SM2A 4AGWA 2XIXA 3IG7A 4B99A 2HWOA 2ZYBA 3NYNA 3DU8A 4EZ3A 3T9TA 4D4RA 3N51A 3VUTA 2RFDA 4AT3A 3P7BA 2B1PA 3P79A 4BCGA 4YO4A 1BL6A 3E87A 3BHTA 4FKWA 4QMZA 5DT4A 5CYIA 4HGLA 4MX9A 4CTBA 4D1SA 3IW8A 3FMHA 4F99A 2CLXA 2WTKB 3TUDA 5DT0A 3DNDA 5J9LA 4D4SA 5EDRA 4E5AX 2F2UA 3D4QA 4EHVA 3AC4A 3SDJA 3Q6UA 4MF1A 3FUPA 3K3IA 4ONAA 4F9CA 4CFNA 5K0KA 3VBVA 5JEBA 2CLQA 2BZIB 3P86A 1YXTA 2CNQA 4PL5A 3C5UA 3E63A 3QRIA 4KNBA 4D1XA 5AA8A 3W2OA 5LQFA 4PMTA 3U6IA 3BQCA 2YIWA 5HLPA 3DLSA 5DR6A 4FL3A 5HD4A 5D10A 2BDWA 3FYJX 3P0MA 2FUMA 3WZKA 4ALWA 4D58A 4CFUA 5IG1A 4XUFA 2C5XA 3QQHA 3R02A 4U40A 3HMPA 5A4CA 1U59A 3NX8A 3EN6A 4B8LA 2A19B 4I5HA 2WMRA 3ALOA 4F08A 5LWNA 3W18A 4QTCA 5M53A 4FGRA 3HA8A 4JR7A 3V51A 4J7BA 4QP4A 4E6AA 5JRSA 3MVHA 2WEVA 4WOVA 5KUPA 3LMHA 2PY3A 5CEPA 4G3DA 4JIKA 4QMOA 4BKYA 4XV9A 4FTUA 4O1PA 5HO6A 3CEKA 4IH8A 3GENA 4U80A 2R2PA 4C8BA 4HCTA 4C33A 5FRIA 5D12A 2V22A 3VULA 4U97A 1KE5A 2J0MB 2X7FA 4X3FB 4HPUE 4Y5HA 5EW9A 4FGBA 1H27A 4ASZA 4BKJA 4DFLA 4EBWA 4EOSA 2X1NA 3FKOA 2G15A 4FYOA 3MESA 3GC8A 4IM0A 2OKRA 4ANMA 1Q99A 4L52A 3UYTA 2R3RA 4X2GA 3FSFA 3R0TA 4RX9A 4EK4A 2WMSA 3PIXA 3COMA 3QLGA 2RF9A 4XG2A 3TNIA 4EC8A 3PSCA 4CV9A 3FC1X 2LAVA 3OOMA 4ACMA 1OKZA 5L2QA 1JVPP 4DYMA 3ZBXA 1IA9A 4GUBA 1PYEA 4M0YA 2OXYA 3PSBA 4Y8DA 4GK4A 5HGIA 4RRVA 5A6OA 2W06A 4RVTA 4FG7A 1ZMVA 4GG7A 5EDQA 1XH9A 2OF2A 4O2PA 4FV7A 4BTKA 1KE7A 1KE8A 5ICPA 2BDFA 4XS2A 3OBJA 3O51A 3BE2A 4D55A 4I4FA 1XH7A 1P4FA 3I81A 2W99B 1E1XA 2BPMA 4ZZNA 1OUKA 3UGCA 1HCKA 3LFNA 1WAKA 4FTTA 4BDAA 3TI1A 1M2QA 4TYJA 4BDDA 4WHZA 4E6DA 3TV4A 3R9DA 3SD0A 2P33A 5DR9A 5E8YA 4BCKA 4CYIA 3S3IA 4RZWA 3WILA 4QMPA 4QYHA 3R21A 3ID6C 4W4XA 3DJ7A 5FG8A 2WD1A 4OTRA 3R1QA 5CXHA 3GCVA 1KOAA 2A27A 3NUPA 4LOPA 4M66A 5JGAA 3LCSA 3EFKA 4RSSA 4RJ8A 5AIRA 4KINA 3UO4A 5IUHA 2Q0BA 4JT3A 2V7OA 3G6GA 4FVQA 4ACDA 2ITQA 2OGVA 4LL5A 4R5SA 5FTQA 4PDYA 3Q4TA 2XNNA 4WKQA 3ZXTA 2HWPA 3WBLA 3RALA 3PTGA 1VZOA 2FB8A 4Q5HA 3QXOA 4JI9A 4XNEA 3VS1A 4KUJA 4DBNA 2XYUA 4MQ1A 5HIBA 2V0DA 5EI2A 2VO0A 4JXFA 4QP6A 4RFZA 4WO5A 5TF9A 3OCSA 2J5EA 4O7SA 4WNOA 2XM8A 2XIZA 1YWRA 3UVPA 1J91A 3BBTB 2I0HA 4Q2AA 2VV9A 3ORMA 2WZJA 3ENHA 4J8MA 4PQNA 2XK7A 5H8BA 5K9IA 5KCVA 5LVMA 1L8TA 4V04A 4EUTA 5EM7A 3OP5A 1ZY5A 4X6QC 4YBKA 5AR7A 3U4UA 5AUTA 4L42A 1YI3A 2FSLX 1J1CA 2J2IB 1MRUA 2B9IA 3E8NA 4GIIA 5H9BA 3WZJA 4ACHA 4BCPA 2IVVA 1KSWA 5DEYA 3OOGA 4HGEA 3OXTA 4BKZA 2YLFA 3DLZA 3NUNA 3O7LD 4YPSA 3CQEA 2BKKA 3R9HA 2PULA 3HAMA 3UIBA 1NVQA 1H00A 1OL2A 3NUUA 2BZKB 4CFWA 2GSFA 4O91A 3LOKA 3GU7A 3FZSA 3VS5A 3R8MA 5KMJA 3DBEA 5ACBC 3RPRA 4CQGA 4HCUA 4IHPA 4WSYA 5BX0A 2HAKA 5FXRA 1V0OA 5AR3A 1GY3A 2Y4IB 3BU6A 4RT7A 2PZYA 3MTFA 4RX8A 3ZFMA 5AADA 5AAEA 4CLJA 3PA5A 2QNJA 1TVOA 1YQJA 5E9EA 3R7VA 4ZTHA 1VR2A 3DXNA 1ATPE 3HV7A 4GSBA 3TXOA 5HNIX 2ITPA 3V8SA 4BCHA 4HZSA 4AA4A 3C5IA 2OJFE 4XG7A 3DKCA 2IZTA 2ITZA 1OKWA 5AP4A 3SOCA 4DITA 4YU2A 2UW3A 2GMXA 1H1SA 3C4FA 1NW1A 5BYLA 4IW0A 4F0IA 2BRNA 5AMNA 2BVAA 4U79A 5L8KA 5AWMA 1OL1A 2I0EA 3FLNC 3HYHA 1ZWSA 2FA2A 4JAJA 2BAKA 2H34A 4OAVB 3QZFA 4MK0A 3GCSA 5AV1A 4E6CA 5B7VA 3QX4A 1SVGA 4YLLA 5IEVA 4L8MA 3GVUA 4JX7A 4RMZA 5D7VA 1AGWA 3W2RA 3CP9A 5AAFA 4OAUC 3M11A 5CASA 3SC1A 4G6LA 3MWUA 5ANKA 5DMZA 3LW0A 1ZOHA 4J52A 2JITA 4RA4A 1YHVA 1ZXEA 4P5QA 3Q4UA 4C34A 4XHKB 1H24A 3VAPA 5I9ZA 3R7YA 3R8VA 3VUMA 3DK3A 3EN5A 4QPAA 3FZRA 3R1SA 5AR5A 4J96A 4FT5A 3ELJA 4JDJA 3D5UA 4IAIA 4RA5A 2PUIA 4UZDA 2GHMA 3SXFA 5CF5A 5EYKA 5H8GA 5M4FA 1AQ1A 2JIIA 2WIPA 3LFEA 3UIUA 4EH4A 4R5YA 5GZAA 1Q4LA 2F49A 2XUUA 3LXPA 1CTPE 3PSDA 3LJ2A 4JRVA 4IB3A 4TN6A 3UVRA 4AGUA 2I40A 4C4IA 2GTMA 4O96A 5GZ9A 2C68A 4I20A 2YCRA 3F5XA 4CFMA 5L8LA 3LQ3A 5CENA 3UG2A 5E4HA 4C37A 2KULA 3CY3A 1GIHA 3JS2A 4QMXA 3PJ2A 2RKUA 3T8OA 3FSKA 2R3JA 1OVEA 4XOZA 4FV4A 3KN5A 4UYAA 5IDPA 3UZRA 3HDNA 3NWWA 1B6CB 1OGUA 3Q4CA 4FODA 4K11A 4FTOA 4IZYA 4L43A 4M84A 3SV0A 3RK7A 3TJCA 5AR4A 1NVRA 1OL6A 4FK3A 3VUGA 4NCTC 4BDFA 4DEHA 2IVTA 3RP9A 2GDOA 4UWBA 3PLAE 1CKIA 3BQRA 3AD6A 4FZDB 4IB5A 4A07A 2VTJA 3TNWA 1OUYA 4E73A 4LRJA 4JBVA 4YNOA 4NM7A 2V7AA 5FDPA 1ZARA 3QUEA 5GJGA 4HVIA 3HV5A 2QU5A 2OIBA 4A9TA 2ZM1A 2ZM3A 3V5WA 3W8LA 4JR3A 4AGDA 3PDTA 1JKKA 4CMTA 5IU2A 4FZ6A 1V0BA 3HUCA 1YI4A 2BZJA 2XNMA 2Y0AA 3RMFA 5CAUA 4YJRA 2CMWA 2X81A 5BNJA 4KS8A 3QL8A 1Q24A 4LYNA 4WSQA 2X6DA 4QOXA 2GCDA 4BHZA 2YDJA 5CNNA 4IVDA 4DGOA 1GZNA 2QOHA 5HO8A 4ANOA 4R7IA 1WVWA 2R3QA 3W2CA 1EH4A 2IG7A 2IVSA 3DDPA 2VNWA 3LVPA 3FY2A 3VBTA 4KAOA 3C51A 4APPA 1GZ8A 2QOOA 2CGVA 3FQSA 5EQPA 3I5NA 3NS9A 4O86A 3OCGA 4C59A 2AC5A 5E1SA 4GT5A 1DI8A 1FMKA 3WIKA 5ANGA 3M42A 4IVCA 3UYSA 4QTAA 3O8UA 2AUHA 2VTPA 3PFQA 5CSVA 5LVOA 4FTQA 3MPAA 3U6HA 2R7IA 3ATSA 4FEWA 2W05A 1XKKA 5IISA 1IAHA 4EHZA 4JQEA 3FPQA 3RNIA 4ZSAA 4TWNA 3KGAA 3BGQA 3QC9A 5H2UA 2IN6A 4F65A 3QRJA 3L1SA 4C0TA 3H0YA 4H1MA 4DGGA 2GHLA 3DB6A 5IUIA 5CEIA 3ZC5A 2W1CA 3RKBA 3CBLA 4S31A 5K3YA 2BFYA 5DYJA 4H3BA 2EU9A 5DN3A 4I92A 4XV3A 4RIYA 4RIWA 3FMJA 3MY1A 4N6YA 3Q32A 2Y8OA 4QTBA 3OROA 4TRLA 1Q62A 2BRBA 2OIDA 4WT6A 3ZSIA 5I4NA 5FD2A 2PVKA 3C7QA 2JGZA 3QKKA 2Z60A 4TTHB 4G6OA 1H28A 2BR1A 3OWJA 2C3JA 4J95A 3OXZA 5LWMA 3RNYA 1S9JA 2UZUE 4L3PA 4FV8A 5IUGA 4TNBA 4AAAA 2WELA 2X7GA 2YM3A 4QNYA 4AS0A 5FUTA 3B2WA 2PZRA 5BVKA 4AE9A 5AV3A 4FSNA 3F3WA 5CQWA 5BMSA 5AJQA 4RC2A 2EB2A 5HVKA 2O3PA 3UQCA 3ULIA 4QYEA 4AF3A 3MH1A 5EI8A 3VQUA 4N6ZA 1HCLA 2PE0A 4XV2A 4C61A 4CG9A 3EQRA 3I0OA 2F2CB 2UZDA 4DEBA 4CKJA 2CKEA 3W55A 4Z7GA 1J7LA 3ZSGA 4G9CA 3OBGA 5I3OA 1CKPA 2FSMX 3ORZA 3S0OA 3ZLYA 3BLQA 1I09A 3G0FA 3HX4A 3LJ1A 1HOWA 3AT2A 3KB7A 3MH3A 4FI1A 4JJRA 2BAQA 5BVEA 2PK9A 3RPOA 4DH1A 4EOLA 2GQSA 4W4VA 1Q8ZA 2YERA 3KREA 1K9AA 3AMAA 3D2KA 4PY1A 1F0QA 4ALVA 2QLQA 5J8IA 5E1EA 3A8XA 2W1GA 4S34A 4W4YA 4FKJA 3LMGA 3QTZA 4PP9A 4FOBA 4AN9A 2LGCA 3H9OA 1R0EA 2WO6A 2PUPA 5IH4A 2O2UA 2JLDA 2Y4PA 4YGAA 5ACKA 3MW1A 3TUCA 1V1KA 5CI6A 5CVGA 1FGKA 2W1HA 2XNOA 3F5GA 2WQOA 1Y57A 4ASDA 3FQHA 4KIQA 5HE0A 3AD5A 4L7SA 5CT0A 3RAHA 3MFTA 4KRDA 4C3RA 4AOTA 4U9AA 2PVJA 4QQTA 2P4IA 4YLKA 3D5VA 1OB3A 2QOLA 3G9LX 1YWVA 4I6BA 4O0RA 1G8AA 5CANA 4U45A 1WBNA 1YXUA 3UMXA 4PNIA 3R8UA 2PVYA 4PTEA 4C57A 1H1PA 4YHJA 5A4TA 2PUNA 2YZLA 1W8CA 5JKGA 5C01A 4O7ZA 3CE3A 1IR3A 1LEZA 4IJPA 2RSVA 2Z7RA 1J1BA 4TWPA 2CKQA 4AUAA 3R6XA 5AUVA 4EK8A 2R3KA 3DBQA 3SHEA 4LV5A 2ZM4A 3AGLA 1ZYCA 4UV0A 2GQGA 3SXSA 4CRSA 4IB1A 1UNHA 4AZTA 3JVRA 3COIA 1XJDA 4YJNA 4JX3A 4CMUA 3NPCA 2CNVA 5JN2A 2FGIA 3LQ8A 1XH6A 1H07A 5JT2A 4YNEA 2WTKC 4EQCA 4Y5QA 2F9GA 3OT8A 4ZLOA 2OICA 3GU5A 3O2MA 3A99A 2XNGA 3KXNA 3BZ3A 1UKHA 5K0XA 5GJFA 4EHGA 5J9YA 3VS2A 3O8TA 4EKKA 2B55A 4B7TA 4F7JA 3I79A 3O8PA 3OW4A 5FDXA 2WTDA 3F2RA 4CVAA 3HUBA 4ZLYA 1FMOE 4DH7A 4FTIA 3Q6WA 1PMNA 3GU8A 4FTJA 1OIRA 4Y72A 5IH5A 5L2TA 1JAMA 2HXLA 3ALNA 3C0GA 3MPTA 4L3LA 5LVNA 3TUBA 4DBXA 3O96A 5E8VA 2OJGA 4GS6A 3SGCA 4I6HA 4YO6A 3D83A 3LFDA 3PP1A 3TZ9A 2ZV8A 3W16A 3SW7A 1WBSA 4BGHA 4HVGA 5I3RA 1Q8YA 3EIDA 4EOPA 2BKZA 3NVMB 5CAQA 3A60A 5IQIA 4U8ZA 5H3QA 1K3AA 2ETRA 4BCOA 3F88A 4B8MA 3OCTA 1UU3A 3VC4A 4BICA 3CLYA 5HE1A 4S33A 3D5WA 4EORA 4ZJVA 5IPJA 3FKNA 2P2HA 4JRNA 2VX3A 5E8TA 3TKHA 2BAJA 3CGOA 4NIFA 4M0ZA 4BGQA 3KF7A 3PUPA 4RIOA 3ZONA 1PY5A 4X3FC 2WPAA 4FF8A 4GIHA 3UOKA 2GNLA 4FTMA 4IEBA 2E9VA 3R01A 2Z7SA 2C6KA 5GINE 3OFMA 2VO3A 4XP0A 4FKLA 5KZIA 3OWPA 3LE6A 4OTFA 4UXQA 4C4FA 4F0FA 2QG7A 4XX9A 3NAYA 1M17A 2O8YA 2P3GX 3LCDA 3MV5A 1PXJA 5KO1A 5IQGA 3BHYA 4IANA 3OWKA 3MH0A 2VWIA 4FR4A 3ZDIA 4Z3VA 2C4GA 4NJ3A 2XEYA 2BHEA 2F4JA 3A2CA 5FP6A 3TJDA 2YDIA 3CXWA 2GNIA 5C26A 4I1ZA 5JFVA 4PP7A 2CGUA 4IJ9A 4IVBA 2JIUA 2FSOX 4QMLA 4I41A 2I7QA 4QPMA 5EI6A 3FL5A 2C47A 3AOXA 4BBMA 5JSMA 2R7BA 3QQGA 4KB8A 4MTAA 5KMKA 5HZNA 3F7ZA 5JH6A 2ETKA 2UW9A 4PMMA 4C35A 4EUUA 3Q9WA 1M14A 3D5XA 4O7LA 2VZ6A 5GZ8A 2F7EE 2WMWA 4ZTLA 1PKGA 4M7IA 4GKIA 2Q0NA 3PY1A 5HD7A 4FIJA 4GV1A 4B9DA 1KE9A 4E5BA 4RX7A 4NSTA 3P08A 3ZO4A 4RBLA 1UV5A 4NH1A 4L44A 3ZUVA 4AT4A 4Z16A 1ZMWA 5K4IA 4UWYA 1VEBA 4FEXA 5LMAA 2QU6A 2OBJA 4BZDA 3L8XA 4YUQA 3G51A 3QTSA 3P7CA 4JBOA 5DWRA 4AZEA 4I5MA 1SNXA 1UVRA 3EH9A 2QD9A 4KSQA 3LLAA 3SKCA 4O38A 2IO6A 2HIWA 3MVLA 3H3CA 5AIKA 1K2PA 4AXAA 4WIHA 3ETAA 4Y73A 1FINA 2R3PA 3F2NA 4QP2A 2PTKA 4KA3A 5HOAA 1WVYA 4ASXA 3UPXA 3FMDA 2HXQA 3Q3BA 4UX9A 2HW7A 3K54A 5FEQA 4GFMA 2OZOA 4FTLA 5ANIA 5A4QA 4MNEA 4BI0A 2UVXA 2Y7JA 5HKMA 1YI6A 3BHUA 5M4UA 3QXPA 2PVMA 4AT5A 3V3VA 3I6UA 3BYOA 5CI7A 1PXOA 1VYZA 5DH3A 3TV7A 2OSCA 2BIKB 2EUFB 4EH6A 5D9HA 1PW2A 4AFEA 2CGWA 2I0YA 3NAXA 4OLIA 4R8QA 2ZDTA 1UWHA 5DE2A 3DZQA 3GNIB 4XMOA 4KABA 1QCFA 4FNZA 5DI1A 2C6IA 1PXIA 4BRXA 2XA4A 5HIEA 5IQBA 2ERZE 3C50A 4FSTA 2XK3A 1XH5A 2XKDA 1H0VA 3PY3A 2C5VA 3QQJA 3R7GA 4ACGA 4C4HA 4NL0A 1XBCA 2FO0A 3BLRA 4O7VA 4CKRA 1CM8A 4RVLA 4WUNA 4RWIA 3HGKA 5BQ0A 3KC3A 5A3XA 4ZY5A 1MRVA 4FV3A 4KKEA 5DNRA 4ZTQA 4C38A 5LARA 3F5UA 4CKIA 4ZOGA 5FTGA 3ORTA 3ZFYA 1H0WA 3PE1A 5J95A 4JG6A 3DV3A 5DHJA 4ALUA 4QT1A 4FSWA 3DK6A 5ETIA 3HNGA 4AG8A 4XG8A 3KN6A 4F7LA 3SG9A 1S9IA 3IDCA 4WG3A 4MD9E 3VIDA 2HELA 4BVUA 5JFXA 4O7WA 1XBBA 1YDTE 3CPCA 3EHAA 4WUAA 5KKRC 4AOJA 1Y91A 1NVSA 2YISA 3MPMA 4JAIA 3REPA 5BYZA 1OM1A 5LCJA 4IAZA 3UMWA 2JDTA 2PVRA 1ZOEA 3DKFA 2J51A 2J9MA 2XJ2A 2Y6OA 4ZTRA 4PTCA 3LLTA 2UVZA 2XIKA 2JBOA 4C4EA 4USEA 2PVFA 4IWPA 5IDNA 3ZBFA 5JFWA 4MF0A 4EOIA 1YVJA 4OTPA 2QO9A 2C6EA 2R3GA 4O0UA 5M57A 3OZ6A 2CKPA 3IGGA 4XLIA 2NRYA 4PTGA 5HORA 2WTCA 3CSVA 3HMOA 2XVDA 5TKDA 5TT7A 5IA1A 2HZ4A 4P2KA 4OTIA 4BDEA 3NUXA 3WIGA 1W0XC 3QCXA 3QALE 4QNAA 2XK9A 5B2LA 3ULZA 3R7UA 4FZ7A 4ANBA 4YC6A 4MHAA 4PMPA 4RJ6A 4AW2A 2JBPA 1U5QA 2VWUA 4AN2A 3R1YA 4O2ZA 5LMKC 4NIFB 4GCJA 2WOTA 1YOJA 2PVHA 3ZU7A 2REIA 4KIKA 4LRMA 4G31A 4YZCA 4J1RA 3RHXA 3G33A 4LQMA 4BCNA 3UZTA 2PHKA 4C58A 1SZMA 3CKXA 4BBFA 3W2SA 4DCEA 3AXWA 3D14A 3TZ8A 4GG5A 3DXQA 3MIAA 2ITUA 4O7RA 4PRJA 5A4LA 1Q41A 3NIEA 4BDBA 1FVRA 2C6TA 2W0JA 2YM4A 4OBPA 4Q5EA 2QHMA 3VS3A 1Q97A 3WZEA 3P4KA 5AX3A 2QVSE 3Q2JA 3VO3A 4O0SA 4EH7A 3BYVA 5FBOA 4W8EA 4N57A 1H1WA 1QL6A 1RE8A 3E3PA 4O27B 5DA3A 1WBVA 3C13A 4X21A 4WA9A 5E92A 3PYYA 3L8VA 4FNXA 5IQDA 4RIXA 3ORNA 2BMCA 4HYSA 3VWAA 4C2VA 4NWMA 2VTAA 3FMKA 3W2PA 3F3ZA 3GFEA 3KMWA 3ZSHA 4U44A 5BYYA 4D0XA 3PLSA 4Y95A 2QODA 4F9YA 1U46A 5EDPA 4MKCA 5F95A 5HBJA 5C8MA 4I0SA 3ZYAA 3Q52A 3MS9A 3D7TA 4K0YA 5C4LA 2QOIA 3CPBA 3DA6A 4PDOA 4BWXA 4MAOA 2QURA 4PNKA 4O82A 3GI3A 3E8DA 5E8WA 3JPVA 5JQ5A 3ATTA 5K4JA 2XMYA 4XG3A 1FOTA 5KMIA 2VNYA 4D2TA 1XH4A 3LXNA 4HPTE 2OH4A 4A4XA 2BTSA 5E8XA 3EYGA 3TZMA 2H9VA 4EJNA 2NPQA 2YIXA 3GC0A 5HCZA 1P2AA 2XS0A 4K33A 4A06A 4BYIA 4EWHA 1M2RA 2QC6A 2YWPA 1YXVA 3CTQA 3QZIA 4LGHA 5C8NA 2XIRA 4G17A 4E1ZA 4TPTA 1FVVA 4XCUA 1LEWA 2CN8A 4N4SA 3ZZEA 4O0XA 3QTIA 4CRLA 4DEEA 4TYHA 3RWQA 2ZAZA 5D41A 5EYMA 1RQQA 3RGFA 5HCXA 2R3NA 3VNTA 5LMBA 3QA0A 3EQHA 3ZO1A 5FTOA 2YM6A 3OVVA 4PX6A 5CTPA 3FWQA 3NIZA 5E8ZA 1P4OA 3IK3A 1BI8A 1YXSA 4C62A 4F63A 4ZJIA 4CGAA 3PVUA 3FAAA 4DTAA 3AG9A 3PXFA 4ANNA 2RGPA 1PXLA 4FUXA 3RWPA 4QQ5A 5L2IA 4MNEB 1KE6A 3D2IA 5EOBA 3KEXA 5DT3A 3COHA 4CFFA 1U5RA 5J1WA 3KRWA 5IA0A 1WVXA 3VRYA 5JRQA 4BIEA 2QG5A 4MXAA 4WG5A 2JIVA 5IH6A 4MWHA 2DWBA 3R63A 4LUDA 2J0KA 4TWCA 3B8RA 4TWOA 3V01A 3VHKA 4AN3A 4CFXA 2G9XA 2R3FA 3EZVA 4DFBA 1Q5KA 4YP8A 3LFBA 2A0CX 4FKTA 4UN0C 1OMWA 4L68A 5AUXA 1OBGA 4XBUA 5L8JA 3SQQA 5IA4A 4XJ0A 3I60A 3LAUA 3ZEWA 3OD6X 1LPUA 4V0GA 4AZFA 3W2QA 3CCNA 4U43A 4CZUA 3VVHA 1YWNA 3QRUA 2XNBA 2I1MA 3IW4A 3JVSA 4XG9A 1IEPA 2IW8A 3KXZA 3C0HA 3UNZA 2I0VA 3B2TA 2C30A 3OUKA 3RAIA 4AW0A 5L2SA 2OJ9A 2XIYA 2NNWB 1YDRE 2FSTX 3TL8A 3C4WA 4J99A 5L4QA 3PPJA 5HVJA 3BE9A 1H25A 3DQWA 3H10A 1KV1A 3WYYA 3HRFA 4QMUA 4U81A 3TN8A 2WMQA 3OY3A 4FG9A 5IKWA 3PRIA 3MA3A 4QP8A 1JQHA 5M08A 1O6YA 4LRKA 3PZEA 3ZM4A 5CS6A 3PJCA 3Q60A 2R3IA 4OTQA 3UG1A 1BKXA 3PIZA 4AA5A 2WFYA 5TR6A 2G01A 4LOOA 3KMMA 3V5QA 4F6UA 3PXQA 3KMUA 2QCSA 4C02A 2XZSA 2WB8A 2UUEA 4FKUA 5BMMA 3RPYA 1OBDA 1PXMA 3KRJA 4ZY4A 2VO6A 5LVLA 1SNUA 5EYDA 3KKVA 2F57A 4MQ2A 4ZS0A 3UBDA 3UC3A 1YDSE 4XG4A 5E90A 4BDGA 4BYJA 4C2WA 5BVOA 4NKAA 2ONLA 3DZOA 5ANJA 4D5HA 3GB2A 1WBWA 5CAOA 2PU8A 4DT9A 3EN4A 2VWVA 3FI2A 3ZDUA 5HLWA 2RIOA 4IX6A 3A4OX 3AT4A 4RC4A 3DCVA 5AAGA 3KF4A 3BYUA 4FUYA 3BBWA 1UWJA 4I6QA 4HZRA 4M15A 4QMNA 4JDKA 3GU4A 2X2MA 4MVFA 4U41A 4WD5A 4C7TA 1FBNA 1JBPE 2W5BA 5EW3A 3QF9A 2JKKA 5C8KA 5HIDA 3NRMA 3EN7A 2YN8A 4HJOA 2UZNA 4YZ9A 4EH5A 4L46A 3WF6A 3E62A 1OKYA 5KHXA 4YTCA 3DNEA 4QMSA 1BI7A 3RAWA 4WNMA 1M7QA 4GFOA 3LM0A 3IW6A 5JZJA 4O7YA 5TE0A 3FKLA 2IPXA 2WMTA 1Q3DA 5J7BA 4G3EA 4H58A 5IMXA 2B7AA 4ZEGA 5EYCA 2HY81 2C5YA 5IA5A 4PV0A 4FK6A 2I6LA 1GOLA 2W5AA 1Z5MA 4BB4A 4AZVA 3LFCA 2WTVA 4TYGA 2QR8A 3KCFA 3FXZA 4EJ7A 4EK5A 2HYYA 5FGKA 3CD8A 2JDRA 2W1FA 4XRJA 3AC5A 2W4JA 4CZTA 1YXXA 3VS6A 1J7IA 4X7QA 4FKGA 4H39A 3C4ZA 1MQBA 2VU3A 3MTLA 4EH9A 1H1RA 1IG1A 1URWA 3D15A 4M14A 3EL8A 2EB3A 5AP0A 4AX8A 5IQHA 3D7TB 4QMTA 3FZ1A 4Q9SA 3BWJA 4O1OA 4YPDA 5G1XA 4DTKA 3CJGA 4DG0E 5M06A 4WRSA 3F66A 3BHVA 1U54A 4QTEA 4ZXTA 4U42A 2ZVAA 4I4EA 2VX1A 5HG7A 3UQGA 5HE2A 3WF5A 3GEQA 2YM5A 4ZIMA 3QX2A 3NNWA 3F6XA 5M56A 3M2WA 4GFGA 3E93A 2JDSA 5CZHA 2PZ5A 4OBQA 2PE2A 3DKOA 1CKJA 3KVWA 4G9RA 4RG0A 3UE4A 3HMNA 3IPHA 4PPBA 2PZPA 2C3LA 3A8WA 2O64A 1O6KA 2R3MA 4EOQA 1PF8A 4F6WA 1J7UA 2C6OA 2J5FA 4K77A 4TYHB 3LCKA 3RBWA 4JBPA 5BVNA 4DTBA 5C4KA 4E4LA 4AW1A 5CF8A 4IAFA 2VD5A 2RFEA 4FG8A 4JOAA 4DFXE 3U9NA 3QC4A 2YHVA 4ENYA 2YABA 3IDPA 5F20A 5HBHA 4CEGA 3E8CA 4F6SA 4HCVA 4XYFA 3ZZWA 2H8HA 3FE3A 4IADA 2E9OA 2Z2WA 3FXWA 1UKIA 4ITJA 4LGGA 1UU8A 4I0TA 1GIIA 4NCTA 3DBCA 3VS0A 3ZTXA 2VWBA 5A4EA 3I7BA 4QMYA 3HP5A 5BPYA 3O0GA 3PPKA 3AC3A 3OCBA 5HG8A 5FEDA 4EOJA 4O81A 5HQ0A 5J79A 2VX0A 4MXXA 5HX8A 2WEIA 1IAJA 4FMQA 3DS6A 2R3LA 3DJ6A 4I5PA 5KMOA 4M69A 4UEUA 3UODA 4ENXA 2UW4A 3FPMA 4PF4A 3V5PA 3WE8A 4CCBA 4DGNA 2XBAA 1RW8A 5AFVA 1CMKE 1JLUE 4IACA 5AUUA 1Y6BA 5HNGA 4GK2A 1FQ1B 4F4PA 1LUFA 2J0JA 2X7OA 3IQ7A 3LHJA 2VGOA 5EH0A 3QHWA 4CYJA 3NW7A 3R7OA 1QMZA 2JEDA 5J87A 1Q61A 4KBAA 4FKIA 2W9ZB 2HZIA 4V0GB 5BVDA 3A7IA 2R5TA 4FV1A 4RLKA 5AP6A 1ZYLA 5L6WL 1P14A 3GOKA 4I94A 1WCCA 3UP7A 3VJNA 3ZRLA 4A9UA 5DIAA 3NCGA 5F1ZA 4E26A 3KRXA 4O0VA 5DVRA 4QQCA 2ZV2A 4FV2A 3H30A 4LL0A 3FI3A 1FVTA 5DRBA 3VBYA 1XWSA 3POZA 3BV2A 3GC9A 3O50A 3ODZX 4EQMA 3DFCB 5HG5A 4OTDA 3NUYA 4O22A 3CQWA 1H08A 1PYXA 2GHGA 2UZEA 4APCA 4F1MA 4GYIA 4P7EA 2BIYA 4D5KA 5EKOA 2QOBA 3FYKX 1RDQE 2QO7A 3CIKA 5FEEA 2ITTA 2G1TA 3IGOA 3BU3A 4FT0A 3DT1A 3D7ZA 4OGRA 4WBOA 3QQKA 3EQCA 4FT7A 4GJ2A 4KIPA 4OT5A 2XM9A 5GNKA 4F1TA 4A7CA 1G8SA 4BCIA 3F5PA 4TY1A 3CY2A 4UALA 4S2ZA 3THBA 4BZOA 1UA2A 4F70A 3UOJA 2E9NA 1A9UA 4AE6A 2NRUA 1XR1A 3GGFA 4BZNA 1ZYSA 3PVBA 4CXAA 2CCIA 4FC0A 4A9RA 3JR1A 2X9FA 3QZHA 4Z55A 3KK9A 3MB6A 3JUHA 2WU6A 3PG1A 3V6SA 3FLSA 5AEPA 4Z9LA 4XG6A 4OW8A 4F64A 3WI6A 5TOZA 3UO6A 3F9NA 4NM5A 2ITXA 4QD6A 4BBEA 2XK4A 4FT3A 4WG4A 5J7HA 4BDIA 2O63A 3EKKA 1YOLA 3H0ZA 4YTHA 2BUJA 3QQLA 1FGIA
chains in the Genus database with same CATH superfamily
2GS2A 3DBDA 3NYVA 3ACKA 5CSXA 3DJ5A 4EBVA 3WZDA 3UJGA 3TWJA 3P5KA 2X2KA 2ZOQA 3PP0A 1ZLTA 3QWKA 4G3CA 3TTIA 4YSMA 4FTCA 2B52A 3R9NA 3RZBA 4BC6A 4DHFA 4Q9ZA 4R1VA 1W83A 2ITWA 4DEGA 4NT4A 3QD4A 3UTOA 1JNKA 3FZOA 4BR3A 4IM2A 3N9XA 3QCSA 4KRCA 4L00A 4NK9A 1KWPA 5EOLA 4BF2A 4LM5A 2YM8A 1JWHA 3KXHA 3GCQA 4FSUA 4GT4A 5HICA 2R3HA 4IAAA 4RQKA 4AGCA 5M44A 5HI2A 2G2FA 4L9IA 4CFVA 3BLAA 2H6DA 4ZJJA 3BYMA 3TKUA 3POOA 4LMNA 4XBRA 4F09A 5EHYA 2UW6A 4CTCA 2PUUA 3MSSA 4FIEA 4IC8A 3HRCA 2RG6A 4RX5A 3O17A 2ACXA 3A62A 5HTCA 2JKMA 1BLXA 4EOKA 5KHWA 5KMNA 3DXPA 4BCJA 4A4OA 2VTMA 5FXQA 4EQUA 4TYEA 4EI4A 2BZHB 4BTJA 4F7SA 3HA6A 3SW4A 4EH8A 3ZUTA 4Z7HA 4CCUA 3A61A 3K5UA 5IA3A 2WAJA 4RGJA 4LI5A 3NUAA 5M55A 4D2PA 2GQRA 3MJ2A 5M4CA 2XJ0A 4DGMA 4YBJA 2X4ZA 2OZAA 4TW9A 2WTIA 3OF0A 3R8LA 2WKMA 3FLWA 4HGTA 3G15A 3RPVA 2BFXA 2V5QA 3E88A 3GOPA 1U54B 2X2LA 2AYPA 3MVJA 1H1QA 4C4JA 3HMIA 2H96A 4OTHA 4W9XA 3EB0A 1AD5A 4ORKA 4WRGA 3UQFA 5GHVA 3ZS5A 2ITNA 4M8TA 1GZOA 4GU6A 4FEUA 3OW3A 4Y83A 5EQYA 4X2NA 3NMUF 3SA0A 2YITA 2A1AB 3O23A 3HV6A 4FKPA 4FTKA 4X2JA 1Y6AA 2O5KA 3VW8A 4HOKA 3NNVA 3S1HA 4IX5A 4RFMA 5CU4A 3QLFA 3VF8A 2ZMDA 3VS4A 2YEXA 3DB8A 3BX5A 2HCKA 3PIYA 4YZDA 4X3JA 2IF8A 3RTPA 4BWKA 4F9WA 3TNHA 2Z7LA 3G6HA 2XJ1A 1UNGA 3GUBA 4CLIA 2RG5A 1SVHA 2BROA 3W10A 4EZ7A 2C0IA 3C0IA 3RPSA 3V5TA 4HGSA 3LQ5A 4XOYA 5AA9A 5HTIA 4RWKA 4N0SA 4PDPA 4H05A 4GVJA 3P78A 4I22A 4UZHA 5DR2A 5A6NA 4FSMA 3FHIA 4DG2E 1PMEA 2YCFA 1MUOA 3MY0A 2G2IA 4USDA 5T3QA 1OZ1A 3JXWA 1F3MC 2HK5A 1Q8WA 2W5HA 3UIMA 3R9OA 1YRPA 2G2HA 3EOCA 3RZFA 1ERKA 2E9UA 2WOUA 3I6WA 3MBLA 2OG8A 4RVMA 1ZZLA 4RJ7A 4TZRA 4DA5A 2PE1A 3MI9A 3NW5A 4D0WA 3KCKA 3EL7A 3CTJA 3OHTA 1OECA 2WMXA 5BVFA 5I5ZA 4CD0A 2ITVA 2VN9A 2UVYA 3MY5A 2W4KA 3PRFA 4RIWB 4RIYB 3G9NA 5DGZA 2B4SB 4YZMA 5AUYA 3IW7A 4KWPA 1B38A 1R0PA 2R9SA 3W0QA 4XLVA 5GIOE 4L45A 3TKIA 3FXXA 4GL9A 3DKGA 2ESMA 3H9FA 2XP2A 4GK3A 4P4CA 4YJUA 2WTWA 4YJTA 4X3FA 2XKCA 3RAKA 4MBJA 4EOMA 1A48A 3HV4A 2PSQA 4C3FA 4KSPA 3H9RA 3OY1A 4OR5A 3I5ZA 2C0TA 4KS7A 4NYEA 3GFWA 2A2AA 4M12A 4YHFA 2VTHA 3HECA 3U87A 4E6QA 5A14A 2Z02A 4KD1A 3QTQA 3W0SA 4D2VA 4UB7A 4EYMA 5J5SA 1NT2A 3D9VA 3E8EA 4FVPA 2WGJA 4GVAA 4KBCA 3PE2A 1DAYA 2R4BA 4NEUA 3R30A 4X2KA 3BU5A 3IECA 4MYGA 3ET7A 3VUDA 3NSZA 4NJDA 3TG1A 4I6LA 4HNFA 3KULA 2PVNA 5D11A 3TIYA 1F5QA 5AP5A 1OI9A 4E93A 5JGDA 5KNJA 2YM7A 1DM2A 4GW8A 5HVYA 5EM5A 2GFCA 3PJ3A 3R7EA 3RM6A 3UOLA 4HW7A 4YC3A 5AR8A 4JQ7A 5J9ZA 2VTLA 5CVFA 4JS8A 4D2RA 2P55A 5A54A 4OBOA 1JKLA 4NFNA 3ZOSA 4I24A 2BRMA 4ITIA 2R64A 3QD2B 4HYUA 2IVUA 4PPCA 3UOHA 3QTWA 3BCEA 4YMJA 5L2WA 3TM0A 4AQKA 2VTQA 3U51A 4EKLA 4G3FA 4FTRA 4H3PA 4NW6A 3E7OA 4BDJA 1Q8TA 3O7LB 4PPAA 4OTGA 4EH3A 5KKRB 3UNKA 2UZVA 4EZ5A 4JQ8A 4FOCA 3R9RA 3GCPA 3K5VA 2GFSA 4K2RA 3ZLSA 5B2MA 3OEFX 3EQDA 5DRDA 2YA9A 2ETMA 2UW5A 4IFGA 4YLJA 4NM3A 1LP4A 2RFNA 2CJMA 5EG3A 2CDZA 3ORXA 4YJPA 3TMOA 4GRBA 3F61A 2C3IB 2XNEA 3OS3A 1GIJA 1XO2B 5EHLA 4BIBA 2Y4IC 5HLNA 4BDCA 4YSJA 2PYWA 4IAKA 3I0QA 3WARA 1OPLA 1W84A 3BPRA 4KKGA 4MD8E 1YHWA 2XEZA 5I9UA 2QOQA 3TIZA 3PVWA 3G5DA 4F0GA 2JC6A 4QMMA 3NEWA 3QTRA 4NFMA 4R3CA 5CSWA 2ZDUA 4JMQA 3VBQA 4YURA 1OIYA 4L53A 2UZLA 3DAEA 4FSYA 2VTSA 3BL9A 2VWWA 3IO7A 4QP9A 3DTCA 4RQVA 3TTJA 2WMBA 2WMUA 3RCJA 2CGXA 3HL7A 4I6FA 4K1BA 1VJYA 4LUEA 4XP2A 5KZ0A 2YAKA 4AZWA 4UMQA 2GNJA 2X4FA 3HMMA 3D0EA 3LPBA 3M1SA 4HYHA 4J97A 5AP1A 1E1VA 2VWZA 4DEIA 4NTTA 2C6DA 3ZHPC 1H01A 2O65A 2XBJA 3RINA 3WF8A 4D2WA 3CJFA 3RI1A 3T3UA 2ITYA 4ZZOA 4K8AA 4FKQA 2JKQA 5CEKA 4UMTA 4ITHA 1URCA 4YTFA 5HU9A 2BTRA 1T46A 3QGYA 5FLFA 5F94A 2HOGA 3SRVA 4H36A 2XRWA 3KXGA 3MN3A 1BX6A 4FBXA 2C6MA 4J53A 4R3PA 3MFSA 3AC8A 3VJOA 4L7FA 4JDHA 5CSPA 1YHSA 3QUPA 4E8AA 4C3PA 4BCFA 4DN5A 3HZTA 5IZFA 4B0GA 5LOHA 2RL5A 4BY9E 4WNPA 2EWAA 1T45A 3SLSA 3UNJA 3ANQA 3UO5A 5GIPE 1REJA 2CN5A 3UC4A 2AC3A 2QOKA 4JLCA 4OTWA 1PXKA 1YW2A 3ZXZA 3FBVA 1OIQA 4ZSGA 5DBXA 2WQMA 2UZOA 3PG3A 3FQEA 4M97A 1A06A 3FDNA 2FVDA 4IVAA 1DS5A 2CCHA 4K6ZA 2R0UA 4DLIA 1ST0A 4ZZMA 2R3OA 4UYNA 2YACA 4JNWA 4NKSA 2YWVA 3Q04A 4G3GA 5E91A 1G3NA 1ND4A 4USFA 4M13A 2EXCX 3JY0A 1XH8A 5K5XA 2GU8A 2XF0A 2XCKA 2CSNA 3R28A 3V04A 4AACA 3O71A 1JSUA 3LZBA 5F4NA 3E92A 4UWCA 3QBNA 2WIHA 5CWZA 3IS5A 5EK7A 2YZAA 5AP2A 3R8PA 5LMKA 2UZWE 3EQGA 4E4XA 1XMMA 5LVPA 4QRCA 4U5JA 3RVGA 3C1XA 4FIGA 3TEIA 3F7WA 1M7NA 3PY0A 4X6RA 4QP1A 1TQMA 2BDJA 2PMOX 3EZRA 3JYAA 4IFCA 1IA8A 3OTVA 1TQPA 4DC2A 4ID7A 3K2LA 1QPEA 3AMYA 2XK6A 5HE3A 2PZIA 3NYXA 4IWDA 2X9EA 3EQBA 3VW6A 5ANDA 3R04A 4ACCA 4ANLA 1DAWA 1W98A 1GNGA 1BYGA 2Z8CA 3ZO2A 4ANQA 3W0PA 4ZSJA 2HZNA 4M3QA 3ORLA 2UZBA 4IZ7A 3TDWA 5AX9A 1BL7A 2IZUA 3U6JA 3DTWA 5HO7A 3JY9A 3G0EA 3D94A 3R00A 1OIUA 2FYSA 2XH5A 4P90A 4D4VA 1V0PA 3Q5ZA 3Q5IA 4ZSLA 3G90X 3Q9XA 3RHKA 4J98A 4BI2A 3PWYA 3KULB 3QQUA 3B8QA 3R73A 3HV3A 2R0IA 2OFVA 3FZTA 4IC7A 4PUZA 2J0IA 4FV5A 3CTHA 3RM7A 1O6LA 3U54A 4XV1A 2BILB 4FV6A 3ZCLA 2W1IA 1WZYA 3I1AA 4YC8A 4GU9A 4C4GA 4CSVA 1PMUA 2ZB0A 2J4ZA 3OC1A 4I21A 5L3AA 2OXXA 3L9LA 5EQEA 3UVQA 3PXYA 4O7NA 2IW9A 5IQAA 1H4LA 1MRYA 3QRKA 4HNIA 2A98A 4FEQA 4YTIA 2FH9A 5CLPA 1NA7A 3BKBA 3C4XA 3WF9A 4F9BA 4ASEA 5JGBA 5L6OA 3I7CA 3MDYA 3TACA 4DCAA 1PHKA 5JFSA 4QP3A 2P0CA 1QPJA 3WE4A 3F3TA 5JK3A 4CV8A 2ZV7A 4E7WA 3TZ7A 3RK5A 4ZLZA 5G6VA 3FV8A 4DF3A 3DY7A 5CF6A 4MXCA 2IZSA 4MCVA 3EFLA 3TNPC 4ZTNA 4CQEA 1U4DA 3CC6A 5KBRA 2X8DA 1J3HA 3P5JC 4CMOA 5DEWA 3T3VA 5KE0A 3ZO3A 3C4CA 2PMIA 3U9CA 2J50A 3GT8A 4DFZE 4BFMA 3NUSA 3ZEPA 4IIRA 3FLYA 3ZC6A 5IA2A 4FJVA 4IQ6A 4FZFB 2JAMA 3UDTA 3UP2A 4FSZA 1ZRZA 4R7HA 1ZYJA 2IZRA 3DQXA 4W4WA 5CU0A 1WFCA 2YCQA 1R39A 3IW5A 4H3QA 5HG9A 3VN9A 4IDTA 4A4LA 3OWLA 3MFUA 2QI8A 2YJRA 3GCUA 4BL1A 1YOMA 2WMVA 5FQDC 3F69A 3QYZA 3GC7A 2ONLC 5E7RA 5HBEA 3HP2A 4V01A 3BYSA 3QZGA 4FV0A 4TKSA 2VGPA 3COKA 3FMEA 2ZV9A 4YHTA 3NNUA 1REKA 2B54A 4RWLA 4AU8A 4F9AA 3W8QA 4BCMA 2F7ZE 1PMVA 4TXCA 4WBBB 3BELA 1QPCA 5IF1A 5L6PA 4E5WA 4DINA 2C1BA 5FM2A 4EC9A 4LOQA 3MA6A 2DUVA 2YJSA 3TV6A 5I0BA 2JD5A 5IQEA 2SRCA 1G5SA 1PKDA 3HEGA 1TQIA 3PJ1A 4FL2A 4G2FA 5E8SA 4QYFA 1UU9A 5DOSA 4ZTSA 4GYGA 4DAWA 4IXPA 3F3UA 4V05A 4D28A 3ZUUA 1ZAOA 3L9NA 4ZK5A 2WU7A 4C36A 1SYKA 3GQIA 3CS9A 4AXCA 3VS7A 3VBWA 3SRVB 2ZJWA 4G5PA 5AP3A 3AT3A 5E8UA 5KMLA 2QKRA 3U55A 2JKOA 4CG8A 4EONA 3HDMA 4ZS4A 4CT1A 3N4VA 3UIXA 4YJOA 3LFFA 4KIKB 3QD0A 3QWJA 1IRKA 2YLEA 2W4OA 5JZNA 2CNUA 4F78A 1DI9A 4CT2A 2X8IA 5CY3A 2X6EA 2ZMCA 3EMGA 2YAAA 3MJ1A 4U6RA 4DGLC 3OT3A 2RFSA 5DPVA 1PXPA 2OJIA 4KIOA 4L01A 3L9MA 3TT0A 3Q2MA 3IOPA 4EOOA 3QU0A 3VHEA 2GS7A 5CZIA 4U0IA 4DFUA 4UMUA 2CHLA 3ZLWA 4DEAA 4QMQA 3NYOA 2PPQA 3LCTA 3FC2A 4TYIA 5FP5A 5A9UA 4G6NA 2VRXA 2IEWA 3FJQE 4I5CA 4RWJA 3QKLA 4JG7A 2QOFA 5CEOA 3HAVA 4YJQA 4RIXB 4UBAA 4FIFA 4GT3A 3V5JA 1W7HA 2WHBA 4QQJA 2IJMA 2A4LA 2W17A 4G34A 2QR7A 2C69A 3OMVA 2QOCA 5CALA 5I9VA 4FV9A 5AUWA 2QO2A 5DLSA 4MH7A 2XRUA 5HESA 2OIQA 4D1ZA 2X0PA 2NO3A 1M2PA 2GTNA 2UZTA 3R22A 2YFXA 3FHRA 1E9HA 4GH2A 2HW6A 3QD3A 5CSHA 3ENMA 4G1WA 2VAGA 5M09A 1KV2A 1VLRA 2BALA 3ZMMA 4FE2A 4XH6A 4F1OA 2X8EA 2F7XE 3BGZA 3QCYA 3RK9A 5CF4A 4GKHA 2X0QA 4M67A 4E4MA 3GP0A 4YJVA 2OWBA 2ITOA 2WTJA 4GEOA 1JKTA 4RC3A 2VTTA 5HU3A 4NM0A 4EWQA 1VYWA 1X8BA 2B0QA 2UW8A 4IB0A 5ITAA 4I93A 4IX4A 5I9WA 4FIIA 3W1FA 4FX3A 5EKNA 3P7AA 3WZUA 4RPVA 3II5A 1H8FA 4MEDA 3Q96A 4W8DA 5C9CA 4AW5A 4EK3A 2OW3A 3QGWA 4BDHA 4LG4A 5HEZA 2XK8A 4R77A 4BI1A 4RZVA 3PVGA 3VUKA 4FEVA 4Y46A 1OL5A 3IDBA 2Z7QA 1TZDA 3F3VA 3MYGA 3R1NA 4I23A 2CKOA 4IAYA 3EN9A 2C3KA 4NTSA 3KA0A 1W82A 3DPKA 4RJ5A 3FMLA 4D9TA 2JAVA 2XNPA 4D4YA 1ZY4A 3IKAA 5D7AA 1KUTA 4ANSA 3L8SA 5BUJA 3V6RA 3K3JA 1P5EA 1G8KA 3NCZA 1NXKA 4HVDA 2QONA 1GJOA 2X0GA 4QPSA 4PL4A 4ZAUA 5EHOA 5C27A 3VF9A 4J8NA 2O0UA 2W1ZA 1Q8UA 3KQ7A 2W1DA 5I9XA 1UNLA 3WF7A 3PXKA 2J6MA 2PL0A 3BEGA 3BHHA 4IZAA 2XKFA 1GAGA 1O9UA 3ITZA 4J71A 5CAPA 3BI6A 3Q9YA 3EFJA 4IBMA 1G8JA 3LFQA 1OKVA 2XB7A 4NW5A 1LR4A 2GNGA 2HY0A 1ZZ2A 2V55A 2VTRA 3MB7A 4DH5A 5I9YA 4BN1A 4JDIA 3PXZA 5EFQA 3EFWA 4MXYA 3AQVA 3CD3A 5KMMA 3NW6A 3LMIA 3KFAA 3QTXA 3C4EA 3AD4A 3DOGA 3FLQA 1BMKA 4O84A 2B53A 5IQCA 3QTUA 3NLBA 3H4JA 5JMSA 5J1VA 4DH8A 3A7JA 4O6EA 4TT7A 3UPZA 4JL9A 1Y8YA 3G2FA 2XANA 1STCE 4AXFA 1IASA 4Y85A 5EM8A 1BUHA 4LV7A 3T9IA 3ACJA 5IMEA 2B9FA 4QTDA 4ZY6A 2E2BA 1MP8A 3WOWA 3DAKA 1CDKA 2Y9QA 4PMSA 4UY9A 4XP3A 5H8EA 2WNTA 3R8ZA 2YCSA 4JIAA 5CU2A 3NVKI 5ETFA 5HHWA 2EVAA 4UMRA 1R1WA 3CGFA 1Y8GA 2XCHA 1TKIA 2DS1A 3BWFA 5C03A 4BIDA 4MD7E 2OK1A 4D9UA 1R3CA 3Q4ZA 3DGKA 3OXIA 1Z9XA 3QHRA 2BCJA 4QMVA 4O0WA 3E5AA 5EM6A 4YR8A 3NDMA 1L3RE 4ARKA 4TL0A 4S32A 4AA0A 3TNQB 1XQZA 4EL9A 4RVKA 4ERKA 3TCPA 3AGMA 3WYXA 3HRBA 2VWXA 3AMBA 3CKWA 3GU6A 3ZRKA 2QHNA 3DAJA 3PPZA 3EYHA 3P1AA 4IZ5A 4YZNA 4AOIA 1XHAA 4X0MA 3OTUA 2JDVA 4IMYA 4RFYA 1I44A 1OPKA 2CPKE 3N4TA 4QYGA 4FSQA 1NY3A 3S95A 4NU1A 4TNDA 3W33A 4E3CA 2KTYA 4U7ZA 4K9YA 4MXZA 4AQCA 4FNYA 4BGGA 3FI4A 4DFNA 4R6VA 2C1AA 5CX9A 3HVCA 3ZRMA 4AZSA 4O7TA 3BIZA 4BCQA 3EQFA 3EQIA 4L67A 3PZHA 4M68A 4R1YA 2GNHA 2C5OA 1SVEA 2QQ7A 3FI8A 4A9SA 5JQ8A 3FEGA 4G5JA 4ZSEA 4HYIA 4KBKA 5HTBA 3A7HA 3R2BA 3SX9A 1JOWB 3SAYA 5FWKK 4L6QA 3GQLA 2VUWA 3HLLA 2PMNX 4GJ3A 5ETCA 5D1JA 3E7VA 2OFUA 1OPJA 4JVGA 5T68A 3A7GA 3DBFA 3MVMA 3VQHA 3VRZA 3SOAA 4ZTMA 2WQEA 3E64A 3R71A 4GMYA 4S30A 3ZH8A 4QMWA 5HX6A 4DEDA 3EQPA 3KU2A 2W96B 5AR2A 3Q53A 4FKOA 3RJCA 3KXXA 4A9YA 4EH2A 2BHHA 3PA3A 2Y6MA 4FKRA 3R83A 1MQ4A 3NZ0A 4YJSA 2WXVA 3OEZA 5LCKA 5CQUA 3ZFXA 5A46A 3ORPA 2EXEA 2VTIA 5DFPA 3PA4A 5C1QB 4QP7A 3SG8A 1PRYA 3ORIA 4FKVA 5CT7A 2YIYA 3PXRA 2OF4A 3AC2A 2C5NA 3QUDA 4RLLA 5AV2A 3GXLA 3V8TA 5AV4A 4BTMA 2VWYA 1OL7A 2VTNA 4MBLA 1JSTA 2YIQA 4EHEA 2J90A 2C6LA 3SXRA 1ZOGA 3LFSA 3F2AA 4BHNA 1R78A 4E4NA 1B39A 3RCDA 5KX8A 3A7FA 3W0MA 3GBZA 4EYJA 2GPHA 3MGYA 3F82A 1Q3WA 1OITA 2B9JA 1H26A 3DDQA 4QO9A 4HVHA 5BUIA 4FKSA 2P2IA 4R78A 4JBQA 5IEYA 3V8WA 1PJKA 1XBAA 5LXMA 3QFVA 5CU3A 3FL4A 5AV0A 3KVXA 1WBOA 2C0OA 1APME 2UW0A 1YKRA 2DYLA 4FICA 2W9FB 5CVHA 4D2SA 5CXZA 4JG8A 1ZMUA 3N4UA 4M69B 4O0YA 4B4LA 1ZYDA 2VO7A 3LKMA 1RJBA 4UXLA 3R7IA 4U3ZA 3UZPA 4H1JA 2VTOA 2XKEA 3QQFA 3BEAA 2J0LA 3I4BA 2WQNA 3R2YA 4RJ4A 4PL3A 1WBPA 4LFIA 5M07A 1Z57A 3S4QA 2BRHA 4O0TA 4X2FA 3TDVA 5IQFA 4IX3A 5BVWA 4E20A 3ORKA 3VBXA 5AUZA 3ZM9A 4ZP5A 1GZKA 3ERKA 5CEQA 2DQ7X 4HVSA 1JPAA 5IEXA 2OJJA 5K5NA 3PWDA 3E3BX 3OG7A 4FA2A 1M52A 3MIYA 3LCOA 3QRTA 1JKSA 3QA8A 2XYNA 3ODYX 3IONA 4B6LA 4BWPA 2WMAA 3BRBA 4IWQA 4I3ZA 1KOBA 3ANRA 2E9PA 3HKOA 3QYWA 2XAMA 3LXLA 2IW6A 4PDSA 4MNFA 5FXSA 4DE4A 2YDKA 4I0RA 1WBTA 4DG3E 3SVVA 4LMUA 3NGAA 3EKNA 2QLUA 4IDVA 5FBNC 3KXMA 4O21A 2NP8A 3QAME 4GUEA 3VUHA 5LJJA 3AC1A 4EK6A 2JFMA 4EEVA 2ZB1A 4N70A 4IWOA 4II5A 3EWHA 5GJDA 5T6KA 2GS6A 4OT6A 3P23A 3LXKA 4KKHA 4FNWA 4WNKA 3MH2A 4DLJA 3BGPA 4XRLA 4ERWA 5M51A 3QKMA 3VUIA 4CZYB 2IWIA 3KRRA 1FPUA 4LGDA 4UMPA 2OLCA 4P5ZA 5B0XA 3ROCA 4O6LA 5CNOA 2HENA 3Q9ZA 3AKJA 4OUCA 3FLZA 4QYYA 3P9JA 4MXOA 5ANEA 3U4WA 4R3RA 4F7NA 5BUEA 2OXDA 3UDBA 4PWNA 3NR9A 4U3YA 3W32A 4FL1A 3LFAA 2PWLA 3IOKA 5CU6A 2OI4X 3CQUA 1SMHA 3ROYA 2X39A 5AM7A 4FZAB 2V62A 2OH0E 3S00A 4FTAA 3MFRA 4AFJA 2WQBA 4FYNA 3V5LA 4ZMEA 3DK7A 3C9WA 2PMLX 2W1EA 2GNFA 2J7TA 2JFLA 3LM5A 3FMMA 4FSRA 3A4PA 4IE9A 4AWIA 4DT8A 1CSNA 4L3JA 3LJ0A 5DG5A 5ANOA 5FM3A 2YIRA 3BLHA 4BDKA 4R7BA 3S2PA 3FY0A 2OO8X 4YZBA 4O83A 4FVRA 4O4FA 4ZMFA 3NNXA 5EW8A 5CEMA 1PXNA 2UV2A 3CR0A 5KBQA 3ZLXA 2QKWB 4G16A 5CAVA 1JSVA 2JDOA 5ETAA 2Q83A 4K18A 4NZWB 5F9EA 2OU7A 3U8WA 4DH3A 1WMKA 4W9WA 2BRGA 4XEYA 2HZ0A 3KRLA 2B9HA 3DFAA 3PJ8A 3FMNA 4FT9A 4MWIA 5AP7A 3L9PA 5M4IA 3LIJA 4MBIA 5AM6A 4BTFA 4CNHA 2OZAB 3FZPA 1W2FA 2UW7A 5J5TA 2ERKA 2EXMA 4FIHA 3KL8A 3KY2A 4LV8A 4DFYA 4NUSA 5HCYA 2PVLA 1UU7A 3L8PA 4AP7A 2W7XA 3QCQA 5TO8A 1QPDA 3OUNB 3KK8A 5HNBA 4QDEA 3BV3A 3EJ1A 4RJ3A 4FTNA 4IM3A 5B2KA 1SM2A 4AGWA 2XIXA 3IG7A 4B99A 2HWOA 2ZYBA 3NYNA 3DU8A 4EZ3A 3T9TA 4D4RA 3N51A 3VUTA 2RFDA 4AT3A 3P7BA 2B1PA 3P79A 4BCGA 4YO4A 1BL6A 3E87A 3BHTA 4FKWA 4QMZA 5DT4A 5CYIA 4DDGA 4HGLA 4MX9A 4CTBA 4D1SA 3IW8A 3FMHA 4F99A 2CLXA 2WTKB 3TUDA 5DT0A 3DNDA 5J9LA 4D4SA 5EDRA 4E5AX 2F2UA 3D4QA 4EHVA 3AC4A 3SDJA 3Q6UA 4MF1A 3FUPA 3K3IA 4ONAA 4F9CA 4CFNA 5K0KA 3VBVA 5JEBA 2CLQA 2BZIB 3P86A 1YXTA 2CNQA 4PL5A 3C5UA 3E63A 3QRIA 4KNBA 4D1XA 5AA8A 3W2OA 5LQFA 4PMTA 3U6IA 3BQCA 2YIWA 5HLPA 3DLSA 5DR6A 4FL3A 5HD4A 5D10A 2BDWA 3FYJX 3P0MA 2FUMA 3WZKA 4ALWA 4D58A 4CFUA 5IG1A 4XUFA 2C5XA 3QQHA 3R02A 4U40A 3HMPA 5A4CA 1U59A 3NX8A 3EN6A 4B8LA 2A19B 4I5HA 2WMRA 3ALOA 4F08A 5LWNA 3W18A 4QTCA 5M53A 4FGRA 3HA8A 4JR7A 3V51A 4J7BA 4QP4A 4E6AA 5JRSA 3MVHA 2WEVA 4WOVA 5KUPA 3LMHA 2PY3A 5CEPA 4G3DA 4JIKA 4QMOA 4BKYA 4XV9A 4FTUA 4O1PA 5HO6A 3CEKA 4IH8A 3GENA 3UDSA 4U80A 2R2PA 4C8BA 4HCTA 4C33A 5FRIA 5D12A 2V22A 3VULA 3UDZA 4U97A 1KE5A 2J0MB 2X7FA 4X3FB 4HPUE 4Y5HA 5EW9A 4FGBA 1H27A 4ASZA 4BKJA 4DFLA 4EBWA 4EOSA 2X1NA 3FKOA 2G15A 4FYOA 3MESA 3GC8A 4IM0A 2OKRA 4ANMA 1Q99A 4L52A 3UYTA 2R3RA 4X2GA 3FSFA 3R0TA 4RX9A 4EK4A 2WMSA 3PIXA 3COMA 3QLGA 2RF9A 4XG2A 3TNIA 4EC8A 3PSCA 2XALA 4CV9A 3FC1X 2LAVA 3OOMA 4ACMA 1OKZA 5L2QA 1JVPP 4DYMA 3ZBXA 1IA9A 4GUBA 1PYEA 4M0YA 2OXYA 4FRFA 3ML1A 3PSBA 4Y8DA 4GK4A 5HGIA 4RRVA 5A6OA 2W06A 4RVTA 4FG7A 1ZMVA 4GG7A 5EDQA 1XH9A 2OF2A 4O2PA 4FV7A 4BTKA 1KE7A 1KE8A 5ICPA 2BDFA 4XS2A 3OBJA 3O51A 3BE2A 4D55A 4I4FA 1XH7A 1P4FA 3I81A 2W99B 1E1XA 2BPMA 4ZZNA 1OUKA 3UGCA 1HCKA 3LFNA 1WAKA 4FTTA 4BDAA 3TI1A 1M2QA 4TYJA 4BDDA 4WHZA 4E6DA 3TV4A 3R9DA 3SD0A 2P33A 5DR9A 5E8YA 4BCKA 4CYIA 3S3IA 4RZWA 3WILA 4QMPA 4QYHA 3R21A 3ID6C 4W4XA 3DJ7A 5FG8A 2WD1A 4OTRA 3R1QA 5CXHA 3GCVA 1KOAA 2A27A 3NUPA 4LOPA 4M66A 5JGAA 3LCSA 3EFKA 4RSSA 4RJ8A 5AIRA 4KINA 3UO4A 5IUHA 2Q0BA 4JT3A 2V7OA 3G6GA 4FVQA 4ACDA 2ITQA 2OGVA 4LL5A 4R5SA 5FTQA 2XARA 4PDYA