3C9WA

Crystal structure of erk-2 with hypothemycin covalently bound
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
349
structure length
336
Chain Sequence
AAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPTRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
publication title Molecular modeling and crystal structure of ERK2-hypothemycin complexes
pubmed doi rcsb
source organism Rattus norvegicus
total genus 99
structure length 336
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3c9wA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3c9wA01
4FTLA 2PVHA 3DB6A 4TNBA 2BZHB 5HD4A 3QALE 1PMUA 5EDRA 2G9XA 2WTVA 4NTTA 5HI2A 4BVUA 4YTCA 3EFLA 5C8KA 5CTPA 4BDDA 5IF1A 2R3IA 4E5AX 4O6EA 3FLNC 3R9OA 3O2MA 3QA0A 3RK9A 4C33A 3THBA 2JAVA 4ITJA 4C2WA 4CFWA 3U6JA 1M52A 3PXKA 4ZMEA 4YJPA 1ERKA 1PKDA 3E62A 2RFEA 1R0EA 2JD5A 3P9JA 4GIHA 5HBEA 3UIBA 2P33A 5GZ8A 3W2PA 3DDPA 3QXPA 4HYHA 2OIQA 2VTMA 3SG9A 1ZYCA 4BIEA 1OITA 4OGRA 2JKMA 4QD6A 2OG8A 2JFMA 4G3FA 1YWVA 2VGOA 3FMHA 4BDGA 3F5GA 2C3KA 2HW6A 4ZZOA 1VZOA 3OW3A 5HHWA 2HZNA 3E8CA 1JSTA 4UWBA 4CQEA 3UYTA 2IO6A 2WELA 5BMMA 4FTTA 4QYHA 5LVLA 4MQ1A 3COIA 1XBBA 2V5QA 3R8MA 5HD7A 4AG8A 5IU2A 3QRIA 5TT7A 3F2RA 2OJJA 4Y95A 4HW7A 1J91A 4NIFB 2B9IA 5JZJA 2RFSA 2YIXA 3LFEA 3PSDA 4YMJA 3CSVA 4ZXTA 2X8DA 4OW8A 4BCGA 2JAMA 4F4PA 5HTIA 3W2QA 3VBTA 4S30A 1V0OA 4ERWA 2BHEA 2C6TA 5DR9A 3TDWA 3OCGA 3FQEA 3OS3A 3RZFA 3UG1A 5G6VA 2XNEA 1YHWA 4FV5A 3JY0A 4QQJA 2GMXA 3W55A 5JN2A 5C4KA 4L7SA 1VYWA 2F9GA 4AE9A 4FR4A 1RW8A 2IG7A 1J1BA 2YIYA 3DZQA 3ZLWA 1IA9A 2XK7A 1OBGA 4FTMA 3VUKA 2ZM1A 3C4EA 2WTCA 2IVSA 2UZWE 4YNEA 4ALVA 2NPQA 4GKHA 2AUHA 1YXUA 2X8IA 4QRCA 1YXTA 1ZXEA 3VUDA 4JVGA 4BTJA 4CZYB 3K5VA 2KULA 3A60A 3RK5A 3PY3A 4K33A 5LVNA 3MDYA 4Y85A 3W32A 2J0JA 4EORA 3V5LA 3L9MA 3AD5A 1AGWA 2OZAA 2Z7SA 3IKAA 4FEXA 3BYUA 3B8RA 5CU2A 4BGQA 1UKIA 4RGJA 4EL9A 4RJ5A 3LQ8A 4YZDA 2V7OA 2I0VA 3Q4TA 3WI6A 5AMNA 1J7LA 1PMVA 5A4TA 4FV4A 4R3PA 3T8OA 3PWDA 3QQLA 3W2RA 4ASEA 1YQJA 4EJ7A 4NIFA 3RTPA 4EK4A 3F61A 3G15A 3HNGA 4ARKA 4MF0A 3QQJA 5ICPA 4N0SA 4UX9A 4GFGA 1REJA 4DGLC 4FT5A 4OTPA 4P4CA 1O6YA 1MRYA 2YM6A 3S95A 4F7JA 4JG8A 2WU7A 3S4QA 2OKRA 2WGJA 3FMEA 4IX5A 4AW2A 4EJNA 5HX6A 5CI6A 1SYKA 4NCTA 5CS6A 1LUFA 3E7VA 3QTWA 5L6PA 3RCJA 1UA2A 5DRBA 3CGFA 4FV1A 4MK0A 3QZIA 3VHEA 3LFCA 4GFOA 4IHPA 2PYWA 3QQFA 1APME 3D7TA 1YXSA 2FSTX 2HWPA 3FUPA 3UG2A 3BQCA 3CQUA 3QKKA 1OMWA 4IW0A 2R3PA 4IX4A 3PVBA 4C3FA 3OY1A 2FUMA 3PVWA 4D0XA 3FYKX 3KFAA 3O0GA 4ZAUA 1I44A 2XEYA 5HEZA 3NCZA 1STCE 5A4QA 3PXFA 2ERZE 4EH7A 3BHUA 3R8PA 5IPJA 2YEXA 4MBIA 2BAQA 3TZ8A 4XRJA 3CQEA 3MSSA 3W18A 3ZLSA 1PMNA 4Z7GA 5C01A 4F6SA 3FZPA 4O2PA 5EKNA 2XCKA 1UWHA 3OW4A 4W4YA 2IW6A 3IK3A 2VV9A 4Y72A 4O2ZA 3UOKA 4AXAA 4LQMA 3ORIA 2GNHA 2C3LA 1BKXA 1WBWA 4HVHA 4BDKA 3C4WA 2BZJA 4QTDA 3FMMA 1V0PA 4J71A 4EOSA 2XKDA 2CCHA 3VS2A 5LMKC 1ZZLA 4YHTA 4PNIA 3FL4A 3PIXA 2HXQA 4WHZA 4AZSA 4F09A 3PP1A 4ZTMA 3BELA 4AX8A 2PY3A 2O2UA 4ANQA 2QKRA 3FL5A 3QX2A 4AN3A 2YIQA 1MUOA 3DJ5A 3V5QA 3K3JA 4QPAA 2J50A 2JC6A 5ETCA 2ERKA 1PXPA 2PMIA 4HGSA 1Q99A 4E6AA 5AJQA 2WMBA 4CG9A 3SXRA 3DKCA 1Q3WA 4JR3A 4IWQA 3PA3A 3GC0A 3MVHA 4FIHA 5AUVA 4QOXA 2XUUA 4UEUA 1REKA 5C8NA 2BIKB 4NYEA 3PLSA 4PTEA 3AMAA 4O82A 1IEPA 1YW2A 3ELJA 3ETAA 4BKJA 3RCDA 1XBCA 1OL2A 3H10A 2XRUA 1E1VA 1Q3DA 1Z57A 4KIKB 4F9WA 2OI4X 2JDSA 1WFCA 2R7BA 1OL7A 2PHKA 4WNMA 4BYJA 4OBOA 2JBOA 3UO6A 4M0ZA 2OO8X 4HNIA 2CGUA 3DBDA 5KE0A 4AW0A 1H0WA 4CKRA 1SVHA 4FIEA 3V8WA 3FPMA 2IVVA 1WVWA 2QHNA 1BL6A 4C61A 5DFPA 3WZEA 3DJ6A 4UZHA 3DS6A 3DAEA 4O7TA 4G31A 4M12A 4U80A 4F9YA 4EKKA 2VWBA 4BRXA 3ZSGA 2HZ0A 5M4UA 1Z9XA 1A06A 4YZMA 2W4OA 3KQ7A 3COKA 4JNWA 4PRJA 3W2OA 2C47A 2OGVA 4DFNA 4WSYA 4FOCA 4HVGA 4RVMA 4JAIA 1NA7A 3VBYA 5LWMA 5AEPA 4CVAA 3LCOA 1G8SA 5EQEA 4J97A 2O0UA 4BHNA 3TCPA 4E4XA 4ITIA 3TNQB 2JKOA 4ZY4A 3GC8A 3Q5IA 2BMCA 1W84A 3Q9XA 4RJ4A 5BVKA 5AUXA 3EMGA 2BTRA 3E5AA 3QD2B 3WE8A 2WMQA 2QONA 4IFCA 3MA3A 3ZM4A 2GCDA 4KIPA 4YUQA 4USEA 4WA9A 4A9RA 4OBPA 4V0GB 4W8EA 3FI2A 4IZYA 1PXKA 3EN9A 3NEWA 4KIQA 4KIKA 1OL1A 4TYHB 3WZJA 5M08A 4CXAA 3U87A 3HMPA 2BAKA 2HK5A 4QP8A 5I9XA 5LMKA 3R63A 4H1MA 3UTOA 5FTGA 3R30A 3UP2A 3NAXA 4MBJA 5TF9A 3RAWA 3PP0A 4DHFA 3FXZA 3Q9WA 3QD4A 2ZV8A 4C59A 4XBRA 4EH5A 3UOJA 3TWJA 3VW6A 4E8AA 5BUIA 4AW1A 4I5MA 4BDJA 4FL2A 4GH2A 2WMSA 3PSBA 4C4JA 4K9YA 5CQWA 4E73A 1GZ8A 2Z02A 5AR7A 4TPTA 2XRWA 2W06A 4R1YA 3RJCA 4FTAA 2YM4A 2CKPA 4M7IA 4BL1A 3DJ7A 1R78A 3LIJA 3LZBA 3RHKA 1YDRE 2UVYA 5C8MA 4FX3A 4O1OA 4XH6A 4U5JA 2YLEA 2VTAA 3AG9A 3LKMA 4R5YA 5DIAA 2WTJA 3LMGA 5AP1A 1OPKA 5KMKA 3FMDA 4JDHA 4IEBA 2RFDA 4TRLA 5DPVA 4JIAA 4M8TA 3SG8A 5ETAA 5T6KA 5E8TA 4RQKA 1O6KA 4FTJA 2UZDA 2XIXA 4F6WA 4LL0A 4RJ6A 5EI2A 3EQRA 5FEDA 5HU3A 3GU7A 4OTIA 3R01A 4TWCA 4XLIA 4NM3A 3PFQA 5EYKA 3RALA 4U0IA 2X6EA 4C3PA 1I09A 1ZY4A 4AACA 1XH5A 4BDAA 1XQZA 3LCTA 4J99A 4RMZA 2NRYA 1PJKA 3DXQA 4DH3A 4G34A 1SMHA 3OT3A 4NK9A 1YKRA 4USDA 3EN5A 2VU3A 5IEXA 2QQ7A 5J9ZA 1KV1A 2Z2WA 4I6HA 4XNEA 5BVFA 2PMOX 4CD0A 3UBDA 4DFZE 3ZFYA 5LJJA 4NJ3A 4O22A 2JIUA 2NRUA 4FSZA 4EC8A 4USFA 4FV0A 4IC7A 3ZM9A 4FV6A 4BB4A 4WNKA 3MVLA 4EH9A 3D7ZA 5E7RA 3A7HA 3FLQA 4AZTA 2R2PA 3AQVA 3K2LA 1FOTA 5CWZA 3TNHA 4BDEA 4G9CA 4L7FA 1V1KA 4ACDA 1URCA 3CLYA 4TNDA 3IGGA 4FGRA 4O7RA 3OXIA 5AIRA 3DKFA 4GYIA 3EQDA 4YC3A 4YO4A 2I0YA 1OPLA 3MA6A 5EKOA 5J8IA 3RBWA 2R3FA 3T9IA 4A7CA 1EH4A 3UE4A 3NYVA 3RMFA 4E93A 5AUUA 2SRCA 3O50A 4FK3A 4I41A 3WIGA 1U4DA 3D9VA 4EH8A 4BYIA 3MVMA 4NH1A 3MI9A 2X2KA 5A4EA 4XLVA 4ALUA 3EWHA 1U59A 3A7GA 2GTMA 2W1EA 5M53A 4QMWA 3UNKA 2EUFB 3ZLXA 4MXOA 4L44A 5AUYA 1OIYA 4ALWA 2WMWA 4DEDA 3NIZA 4ACMA 4O7ZA 3F3TA 5H2UA 4GK4A 4ZMFA 2UUEA 2QURA 5E8ZA 3CR0A 4M69B 3O17A 4W9XA 4JJRA 4JAJA 3DTWA 3LXPA 3W8QA 5L8KA 4BTMA 4TW9A 4TKSA 3PVUA 3LMHA 3KRWA 2XIYA 3ERKA 2UZVA 3QCXA 2PPQA 3BV2A 2UW5A 3NYOA 4DFLA 3DKOA 3G33A 5FDXA 4FTKA 4PTCA 4FOBA 4R8QA 2Q83A 5BYYA 4X2JA 3MESA 4UXQA 4FVRA 4K6ZA 1QPJA 1RDQE 2UZEA 3Q96A 2XVDA 3QXOA 1UNGA 3IECA 4B7TA 4E3CA 5EM8A 4TY1A 2W1ZA 5A6OA 2XYNA 3D2IA 4CMUA 4D58A 5GINE 2PWLA 4G17A 4FTOA 4O83A 3LFQA 2WQNA 4IAZA 1GZNA 2VWVA 4D2SA 4I0RA 2WIPA 3H0YA 4MCVA 3R28A 3FDNA 5F20A 4E26A 4EBWA 1Q41A 4RFYA 4ANMA 2C1BA 2JLDA 2CN8A 4ZZMA 3PDTA 4ZTNA 3UYSA 3NUPA 4FYNA 3RI1A 3P86A 3BGZA 1GIHA 2XBAA 5DHJA 5E1EA 3Q9YA 4WUAA 3ZUUA 4O7LA 3QC9A 4CFFA 4P5ZA 3LLAA 5HNGA 3MW1A 4IZAA 1WAKA 5CX9A 4D5KA 4EK8A 3PVGA 4N4SA 4FNXA 5BUEA 5GNKA 3MB7A 4BY9E 4W8DA 4O0TA 4YJQA 1MP8A 3ZEPA 4M69A 1H07A 4CYJA 3TZMA 3R2YA 3A99A 2LGCA 4JQ8A 1S9JA 2C5VA 4FK6A 3P79A 2H34A 3KXHA 4FF8A 4DE4A 3OWKA 4QMSA 3A62A 3I6UA 3OHTA 2GDOA 3IW8A 3ZRKA 3TNPC 2O5KA 4ZSLA 4JG6A 3WE4A 4FZFB 4IAIA 5E91A 3D2KA 5I9UA 2QNJA 5CAPA 4Y5HA 2DQ7X 4RG0A 5JH6A 3W10A 1DAWA 4U41A 4DT9A 2H9VA 1CSNA 5AV2A 4XP2A 5GZ9A 3BHTA 2BRNA 4GIIA 3WOWA 2IW9A 3L9PA 4FNWA 4CLJA 3ZO1A 2C69A 3H30A 2R64A 4C3RA 4Z9LA 1JKLA 4F99A 3WIKA 3D5WA 4GJ2A 4BWPA 3BLHA 4IZ5A 5HORA 3PXRA 3R1QA 1K2PA 1FMOE 3CJFA 3DDQA 3QRJA 5J9YA 2XJ1A 3HAMA 1F5QA 4TT7A 4QTEA 3DK6A 4CFUA 4CV8A 4UN0C 5E4HA 3M2WA 3POZA 1OZ1A 2OIBA 3E64A 3GB2A 3ZO3A 1ZOHA 4RZWA 4D28A 4F63A 1CM8A 2O63A 1H00A 2PE0A 1GAGA 3QTZA 3RWPA 4QMZA 5M4CA 4YLJA 3GI3A 4KBCA 4FTQA 4N57A 4RFZA 3RAKA 1NXKA 3UPXA 3ORLA 2R3GA 3AT2A 3SAYA 1S9IA 4DT8A 4G16A 5DT0A 5KMMA 4R1VA 3FQHA 4TYGA 2YM8A 5B7VA 4BKYA 4PP7A 4C58A 3R1SA 3CKXA 4NUSA 3MN3A 4ID7A 2VTOA 4IB0A 3F66A 4WUNA 2B0QA 3MIAA 1QPDA 2VTHA 4RLKA 5A4CA 3SX9A 4O7YA 4KRDA 4FSNA 2OJFE 4D9TA 5CSXA 4F0GA 2UW9A 2PUNA 5FTOA 2C4GA 4GK3A 4YC8A 3PZHA 4U97A 3HV4A 4YLLA 3CD8A 4NZWB 4ENXA 4XBUA 4WO5A 5AUWA 4C35A 1ZZ2A 4FODA 3NUYA 2X6DA 3ZO4A 4W4WA 3FI8A 4L9IA 3W33A 2IZUA 3IO7A 5DI1A 2ZV9A 4LFIA 3HRCA 1UNLA 4L46A 4PL5A 2XJ2A 2JFLA 2UV2A 2X2LA 1WVYA 5M55A 2CGXA 4J8MA 3F5UA 3BLRA 5HBHA 4FUXA 4Z55A 3TKHA 4L3PA 2UVXA 2VO7A 3PA5A 2QC6A 3EN7A 4PP9A 4BIBA 5HE0A 2Y8OA 3GOKA 4PDOA 2GQGA 2QLQA 1H0VA 3RGFA 4GEOA 3FKLA 4F70A 2Y6MA 2WTWA 1JKSA 3LQ5A 4LOOA 4UWCA 1BMKA 5AP0A 4EH6A 1NT2A 4QMTA 3ZFMA 2PVMA 4ZSEA 2CKEA 2ZB0A 3E8DA 3EFWA 3R9DA 4MD8E 4F7NA 2KTYA 2QHMA 3KRLA 4WT6A 3CTHA 4LV5A 1FMKA 1MRVA 5HG8A 4KUJA 5M57A 4V05A 3RNIA 2XKCA 2VWYA 4LOPA 3KU2A 1SM2A 2JIIA 2NP8A 4OUCA 4UXLA 4UV0A 3NVMB 2VGPA 2OXYA 3HDNA 4BBFA 1FINA 4MQ2A 2XNOA 3QF9A 2OW3A 3IPHA 2AC3A 4G3CA 2R3MA 2BCJA 3KULB 4EOIA 2ZMCA 4D4VA 5K9IA 4FC0A 2YHVA 2C0IA 3BGQA 1JWHA 3GP0A 3EQFA 2PVRA 3QTRA 3E88A 3TT0A 5CI7A 3C9WA 4F65A 4XEYA 4XG8A 2VTSA 5EFQA 2R3QA 1KV2A 3F7WA 1PHKA 4XOYA 3UNJA 3E93A 4D2WA 4KS8A 3QGYA 4I6BA 5CNOA 3WILA 3RKBA 1ZY5A 3TUDA 3ZDUA 4QP2A 3SLSA 3EYGA 3PXZA 5I5ZA 5FM3A 3S0OA 3RPSA 3QCYA 2YWVA 4YJOA 2W99B 3RHXA 4PTGA 2WMTA 5H9BA 5HCZA 2JDVA 4JQEA 2JKKA 5CF5A 3AT4A 4IWOA 5AIKA 4Q9ZA 4QMNA 4ZLZA 3RWQA 2GTNA 2RIOA 3ODZX 3RPVA 2ZVAA 3COMA 4MWIA 1KWPA 4JRNA 3R7YA 1W8CA 4BTKA 4DH5A 3LE6A 3KN5A 4MX9A 4YJVA 5DH3A 4Z3VA 5BVNA 5HNIX 5JSMA 4HVIA 1L8TA 3LFSA 3AOXA 3FMLA 3Q2JA 2XIKA 4XG2A 2Z7LA 3VBQA 4U8ZA 2A27A 3ZBFA 2P0CA 4RC4A 5AP7A 4R78A 4N6ZA 5J79A 3MVJA 1M14A 4BCHA 4DH7A 3F2NA 3KRRA 1ZARA 4NKSA 5EM7A 3PE1A 1KE8A 4L00A 2XM9A 3O8PA 4XOZA 4YLKA 3HV6A 3KULA 4B9DA 4YTFA 1GY3A 2W17A 3NW5A 4V01A 4MVFA 3QCSA 3C4ZA 3PG3A 5I9VA 5K5NA 4FNZA 5ETFA 5KZIA 4F1OA 3LMIA 3EKNA 2OXXA 3NUUA 5EDPA 4X6RA 5L4QA 3BYVA 4JG7A 2GFSA 3KA0A 1SVGA 3DZOA 4I24A 4L67A 4NCTC 3AGLA 5CVFA 5F94A 2R3LA 3U55A 5CASA 3PY1A 4GSBA 3IOKA 3CTJA 4U9AA 1BI8A 3EZRA 3PPJA 5CAVA 1DI9A 2XM8A 2QOOA 4RIXA 4EC9A 3WF9A 4EKLA 4FUYA 4F6UA 5CEMA 2G2FA 1CDKA 3UP7A 3C50A 3QYZA 5L6OA 4AGDA 5IMEA 1UKHA 3IQ7A 2UZOA 3D14A 3OTVA 5F1ZA 4ZY5A 5IEYA 4PX6A 2VNWA 2OIDA 5DE2A 5CEIA 3R00A 3QUEA 4I1ZA 3ZEWA 3EKKA 4JX7A 4QTCA 2WQMA 3F3WA 3CCNA 5KUPA 4PUZA 2V0DA 4AWIA 3I6WA 2CSNA 2P4IA 4DA5A 5AR3A 5A4LA 4CFXA 4NW5A 1UNHA 5BVWA 1DS5A 2P55A 2VWZA 2X4ZA 4J52A 4OBQA 4QMOA 4EHZA 4HVDA 3DK3A 2YERA 4XG9A 5AAEA 4IM3A 5LMAA 4FTNA 2OH4A 2XNPA 4RPVA 1LEWA 2CNQA 3TKIA 1IASA 1AD5A 2X0GA 3ROYA 4M3QA 4DH8A 2WTKB 4UMQA 3GCUA 4FTCA 4X3JA 2X81A 4FT0A 4B6LA 1KOBA 2YZAA 3C0HA 3LCDA 2PUPA 4JQ7A 4AE6A 5AP5A 4I21A 3FI3A 4G6NA 5KCVA 4DC2A 4R7BA 3JS2A 5HVKA 2C3IB 2FA2A 2RG6A 4X2GA 1FVTA 3C7QA 3KC3A 4IIRA 4BR3A 3AGMA 4YHJA 5IQCA 2UW6A 3SXSA 4EOOA 4U81A 2YM5A 3IG7A 5ANOA 4ACHA 4FA2A 5AR4A 3DV3A 2UZUE 3L8SA 2F7EE 2IN6A 5FXRA 1PRYA 4RT7A 1E1XA 5JQ8A 3GC7A 1OIQA 4D4YA 2PZ5A 4D2PA 5B2LA 3SOCA 4EUUA 3Q2MA 4FG8A 3ROCA 4JDJA 2ZYBA 3R22A 3AC5A 3SHEA 3W8LA 3ZXZA 4U45A 2CLXA 3CQWA 1AQ1A 5CENA 3U4UA 3VN9A 1JSVA 4FKTA 2EVAA 2XKEA 4U43A 3U4WA 1OL6A 4FV8A 1ZYSA 4YBJA 3PE2A 3VNTA 2OF4A 4EHEA 3TUCA 3LFBA 4U44A 3TNIA 2PMNX 2C5OA 4FL1A 3GT8A 5AAFA 3U54A 3TJDA 4BCFA 3TZ7A 4CZTA 3G5DA 3ORMA 3WZUA 1YVJA 2XK9A 3BQRA 3N4TA 5JQ5A 5AV0A 5DT3A 5TKDA 4D2VA 3GGFA 4DINA 4PDSA 4M66A 4X7QA 2CKOA 3PY0A 2UZBA 5DWRA 4DFXE 2VUWA 3PIZA 5D12A 2X8EA 2EWAA 4E4LA 1H8FA 4AN9A 3FMNA 3TI1A 2XK8A 5EQYA 4D2RA 2C30A 3BBTB 1PKGA 5CU4A 4BWKA 1UV5A 4QMXA 5AV4A 3Q4CA 4XV2A 4AW5A 4DEEA 5EYMA 2ZDTA 3DGKA 4G5PA 1YOMA 3FZRA 4AA0A 4IADA 5A9UA 4RC3A 5D1JA 5EOLA 2C0OA 4DH1A 3CTQA 3GCSA 2W1FA 2Z60A 5GHVA 3FQSA 2B53A 2C0TA 3G0FA 3G9NA 3A61A 5KBQA 5EM5A 4RX8A 3RPOA 1JPAA 2RGPA 1UWJA 5K3YA 3MY5A 1YHVA 2JIVA 4CTBA 5K4JA 4U7ZA 3ZHPC 2F57A 2OBJA 4QP4A 3GQIA 1ZYJA 2FH9A 3HP2A 2C6LA 4YJTA 3RVGA 3C4FA 3ANRA 4X2FA 4FSYA 3RZBA 3TL8A 5JFSA 1MQ4A 4IM0A 3VUHA 3GQLA 2GHGA 4A06A 5IG1A 4CNHA 3H0ZA 4G1WA 2GNGA 2W5BA 4WNOA 5E1SA 2DUVA 5AR5A 4BKZA 4OTWA 4E20A 4Y73A 1WBVA 3CGOA 3NUNA 4MF1A 4YJSA 3QYWA 4P7EA 4HVSA 4JDKA 5GJDA 5HE3A 4YZNA 4FSRA 2OK1A 1TQPA 2ETRA 2OXDA 3P7BA 3JXWA 4F9BA 2QD9A 3I4BA 5ANKA 3TUBA 4FEVA 4ZTLA 3DBCA 2X9FA 4PMPA 3BI6A 3I0QA 4KNBA 4NM5A 2PMLX 3R6XA 1WVXA 2X7FA 5F4NA 3PJCA 4FKWA 4MTAA 4WRGA 2WMUA 4FSUA 4KA3A 4FT9A 3NYNA 4E6QA 4O38A 4K2RA 4ANBA 1GZOA 3S00A 4RIOA 1FQ1B 2FYSA 4L3JA 5AWMA 2PUUA 3TDVA 2R3RA 2VD5A 3VS5A 2Q0NA 5IA5A 4AT3A 2CMWA 4CFVA 2WMVA 3AT3A 5LARA 1YHSA 3HVCA 4FT7A 3CJGA 4G9RA 5BYZA 3PG1A 3NUSA 3ORKA 3DXPA 2ZDUA 4ZEGA 1PXJA 3JVRA 3LQ3A 1PMEA 4AGWA 2FSOX 4RWIA 4E5BA 5CNNA 3FC2A 3MS9A 3NZ0A 4NSTA 4I92A 4WIHA 3LCKA 1M2QA 3W2SA 5FEQA 4D55A 3QKLA 5CEPA 4PPCA 4L52A 3GCQA 3PJ2A 3IGOA 2GHMA 3N9XA 5HLWA 5IMXA 3GNIB 1FBNA 4O7SA 3HRFA 3NUAA 3FPQA 2Y4IC 4EOLA 3F3ZA 2E9VA 4XYFA 5FM2A 4CLIA 3OBJA 4PV0A 5CU6A 3UIMA 5CAQA 2NNWB 4C4EA 4U3YA 2WMXA 3CP9A 5J1VA 4YJRA 5JT2A 3VS4A 4C8BA 3R7EA 4FG7A 1SVEA 1VEBA 3HA6A 4JBPA 3VQHA 3ZFXA 5IQIA 1FVRA 4RVKA 4YZ9A 3GU5A 5BUJA 3LHJA 4BZOA 3I60A 2HY81 2WFYA 4G3DA 4FKVA 4AGCA 4AP7A 3GFWA 3PWYA 1TQMA 2XJ0A 2W5HA 4AOTA 2OFUA 4H3QA 3H9OA 5L2WA 2QODA 3JYAA 3R8VA 5AA8A 2OH0E 3DT1A 2OZOA 4WNPA 5E8UA 3CBLA 3B8QA 4C34A 4EH4A 2B7AA 3BHYA 3W2CA 4DYMA 1J7UA 5EYCA 3Q4UA 2CGVA 3ET7A 4C4HA 4O7WA 2VTJA 5HE2A 4C02A 2OWBA 4F0IA 1U5RA 3HLLA 4BTFA 4WKQA 4EHVA 4DFBA 3AC1A 4ANSA 3LFDA 4G5JA 4HYUA 4BIDA 2BR1A 2Y4IB 1WCCA 2WIHA 2E9NA 3SXFA 5M06A 1UU7A 4YR8A 2XK3A 5CZHA 5HO7A 4CG8A 4HYSA 2PVKA 4TXCA 4C4FA 4IDTA 3ATTA 2XIZA 1MRUA 4Y8DA 2UW3A 4YZBA 3D4QA 4E7WA 1HCLA 1NVQA 5GJFA 4IVAA 2CGWA 4AA4A 3IW4A 3MIYA 3S2PA 2HAKA 3NRMA 5L3AA 2J9MA 3V5PA 2ETKA 3G9LX 5KMNA 3V01A 4HPUE 3QAME 3KXXA 1OM1A 4FIGA 3R0TA 4LGHA 4XUFA 5FEEA 3EJ1A 3PXQA 4MBLA 4UALA 5CXZA 2C6DA 4BI0A 1OKWA 2PTKA 3MPTA 5EOBA 3GC9A 1OECA 3R83A 1W7HA 2Z7QA 5J95A 4PY1A 1RQQA 3TIZA 3DA6A 2YAAA 2C1AA 3D83A 4FTUA 5FXSA 4OTQA 3GEQA 3QQKA 2HXLA 4XP3A 3EFKA 3U9NA 4APPA 1R0PA 3UIUA 3O96A 4YSMA 5T3QA 2QR8A 4EOPA 2VX3A 1P2AA 1LR4A 2O65A 3D15A 4M13A 4HGTA 2WB8A 4O6LA 3AC8A 3UPZA 2YCRA 3O71A 4GS6A 4EH2A 4S31A 2Z7RA 3MY0A 2YLFA 4YBKA 4YSJA 3V5WA 5IQAA 2UZLA 4LYNA 4CKIA 4C4GA 2R3KA 2UW4A 4KWPA 2RFNA 3L9LA 4BDCA 2VNYA 1KSWA 4BC6A 1K9AA 3NW7A 4C37A 4O1PA 1ZWSA 4FBXA 5AM7A 4A4OA 2HCKA 3NSZA 5BMSA 2QLUA 5HCYA 4V0GA 3V04A 4E6CA 4D4SA 2XYUA 4G6OA 4I4FA 4TYHA 1CTPE 2FB8A 2IZSA 2JITA 4FZAB 3WYYA 1GIIA 2C3JA 3SC1A 3DNDA 2J51A 4S2ZA 2WMAA 5EG3A 4ANOA 4BDHA 2Y4PA 1FGKA 5BYLA 2P3GX 3UVPA 4RFMA 4R7HA 5DLSA 4IX3A 4M84A 3CC6A 4BCOA 3JUHA 4KKGA 5ACBC 3COHA 3R9HA 3UVQA 4RX7A 1BUHA 2E9UA 5F9EA 1U46A 3C0IA 5EH0A 3MYGA 5BVEA 3GUBA 4UB7A 2FSMX 5BVOA 5HLNA 5D11A 3ZH8A 5BX0A 4IAFA 5HQ0A 3OP5A 4QP6A 4YC6A 5CSVA 2HOGA 5AX3A 4YHFA 5HZNA 2AC5A 4MH7A 1JSUA 1W98A 2F49A 3C0GA 5EM6A 1PF8A 5D41A 3IW6A 5H8BA 2UZNA 1XWSA 2VAGA 4HJOA 4DBNA 4GMYA 5KMIA 3F3VA 5DYJA 3QCQA 1WMKA 3AXWA 5KX8A 5HO6A 3OTUA 4Q9SA 5HG9A 2J6MA 1ZOEA 3KRXA 4QYFA 3BV3A 4WBOA 3VULA 1XH8A 3MPMA 3QQHA 3UMXA 5JEBA 3OWJA 3FLSA 4AUAA 3A7IA 4DLIA 4XV3A 4ENYA 1KE9A 3VRZA 2Y6OA 4WBBB 3QL8A 5EDQA 3NVKI 1XH4A 4OT5A 3O7LB 2QG5A 4LGGA 2UW8A 4J96A 5AUTA 2XA4A 3DY7A 3QTQA 4I5PA 4RA4A 5AP3A 2GQSA 4FKRA 4M67A 3WZKA 3OY3A 3I5ZA 2W5AA 4FVPA 2W1CA 2YIWA 1BI7A 4QMYA 5CVGA 1Q61A 3JVSA 3Q52A 3VQUA 3QZHA 4R6VA 2YDKA 3JY9A 1TKIA 3OC1A 4O7VA 3FE3A 2W1IA 3DBEA 4AOIA 2WTDA 1GIJA 3DBFA 3EN6A 5JRQA 5LXMA 2YJRA 3DTCA 4ZZNA 3ORZA 5DR6A 1CMKE 4BDBA 1WBOA 5DA3A 3AD4A 3R9NA 4NTSA 3EQGA 5KNJA 1O6LA 5IQFA 1IA8A 4JS8A 3VRYA 3DBQA 4JI9A 4OLIA 2C6KA 4ZS0A 3VS7A 3SV0A 4FMQA 3W1FA 4TWPA 5JGAA 4R77A 1OKZA 4EK6A 1WBPA 4G3EA 3H9FA 5CF4A 2XNNA 2BKZA 5ANIA 3KEXA 5C1QB 5BVDA 3ORTA 3ZUTA 1PYXA 2H8HA 4AT5A 2I0HA 5KHWA 5JRSA 3NIEA 3O8TA 4RRVA 2ZMDA 3MFSA 3UODA 3PYYA 3P1AA 3Q6WA 3WF5A 4D1XA 2OU7A 4O0UA 4H39A 2J90A 4B8LA 5FGKA 1KE7A 4JT3A 3ZRMA 4EUTA 1XHAA 3I7CA 4NU1A 4CRSA 3U51A 4XCUA 1XH6A 4Y5QA 4RBLA 4ACCA 2C5XA 2ITYA 1M17A 3OEZA 3KB7A 4KAOA 4EOJA 2HY0A 5HE1A 3LLTA 4O0VA 1FPUA 1GNGA 1QPEA 1CKIA 4GVJA 3NX8A 3V3VA 4RA5A 4AT4A 4C7TA 2QCSA 1YDSE 3FWQA 3O51A 3CEKA 5CQUA 3TXOA 1YXXA 1W82A 4P2KA 4Q5EA 3ZYAA 4IMYA 3QX4A 2YABA 4FT3A 5H3QA 3U9CA 4ORKA 1PY5A 2R3HA 3R1NA 4D1ZA 1H08A 4GU6A 4OTGA 4IC8A 5JFWA 3ZSHA 4BI2A 3OWLA 4XG4A 3P78A 4MD7E 4Q5HA 5AP2A 1UVRA 4F7SA 2UW0A 4P5QA 1XJDA 4BBEA 1YRPA 2H96A 1U54B 3W16A 2A0CX 3FHIA 1H26A 4KBAA 3NNXA 1M7NA 2YM3A 4DG2E 4YU2A 3PSCA 3N4UA 3SD0A 5CAUA 3L9NA 4X6QC 2G2IA 4DEGA 4ZOGA 4PF4A 2QG7A 2B55A 2OFVA 4QP9A 5AADA 4FIIA 1UU3A 4GG5A 4BICA 4CMTA 4CT2A 2QU5A 3R1YA 3VS6A 4K8AA 2BDWA 3LFNA 4L42A 2YN8A 2ZOQA 3KK9A 2E9OA 3POOA 5EW8A 3SDJA 3RNYA 2DYLA 2WOUA 2PZPA 2PZRA 2JGZA 5IH5A 3QZFA 2BZIB 5BNJA 5M07A 2G15A 5AV3A 3OOMA 4ZP5A 4AFJA 5M09A 4QYGA 4GYGA 2OJGA 1Q97A 1TVOA 3DCVA 3G90X 3QD3A 2WPAA 3R73A 4C0TA 4H3BA 1T45A 3LXLA 3R21A 4RWKA 5JFVA 4K0YA 4H36A 1F3MC 2C5NA 2FVDA 3FLYA 4S32A 4YNOA 4DGGA 3NNUA 2JEDA 2V7AA 4QP7A 4O96A 3QQGA 5CSPA 1QMZA 4YP8A 3EQPA 3VBVA 5HIDA 4AN2A 2O3PA 4GT4A 4I4EA 4PMSA 4DN5A 4F64A 2P2HA 5DMZA 3KGAA 4J98A 3HA8A 5IH4A 4MXAA 4BCKA 3Q60A 1U54A 3N51A 2GS6A 1M2PA 3DK7A 4TYEA 2ZAZA 3IS5A 3QUDA 3TM0A 4G6LA 1VJYA 4B8MA 4QQCA 1DI8A 1OB3A 2ZM3A 3QU0A 2ITZA 1H28A 3ANQA 4KKHA 4H1JA 3JR1A 2ITXA 3CKWA 4DEAA 4S33A 2I6LA 5LWNA 3ZO2A 3VF9A 4X2KA 3VVHA 3PRIA 2EXCX 4HZRA 2XB7A 1G5SA 3QTIA 1HCKA 4O0XA 5CAOA 5JGBA 4CKJA 2YAKA 3I81A 5A6NA 4NJDA 2JDTA 3R7UA 5DBXA 1Q8UA 5A3XA 3TV4A 1G8AA 1VYZA 3MTLA 3VS0A 5M44A 2Y0AA 5G1XA 2I40A 1ZMVA 2QOQA 5L8LA 3E7OA 2BFXA 4CZUA 5E9EA 4BWXA 4I6FA 4TTHB 3UC3A 5A54A 4LMUA 4U6RA 4IAAA 3TTIA 4BCJA 3DU8A 4EK3A 2PZIA 3NS9A 4C4IA 4D2TA 4ANNA 4AZFA 5CYIA 4NW6A 4W4VA 4DCEA 4NFNA 4O7NA 4MWHA 1IAJA 3QQUA 3F69A 5D7VA 3OOGA 2JDOA 3ENMA 4JBOA 4LG4A 4M68A 4DAWA 4FICA 2P2IA 3M42A 4IH8A 3P0MA 5C9CA 3GCPA 4IB5A 3EB0A 3LOKA 5ANJA 1UU9A 3L8XA 3IW5A 1M2RA 4J7BA 2HIWA 3AC2A 3KXNA 5AP6A 1H27A 3OFMA 3UOHA 2UVZA 3VJNA 2BROA 2RG5A 5FQDC 3SKCA 4ZS4A 3FI4A 3A8XA 4ONAA 5ANDA 2REIA 4MXCA 4E1ZA 1KE5A 5DNRA 5J7BA 4FEUA 3R9RA 4XV9A 3R8ZA 4D1SA 2V62A 3FMJA 4NM0A 3QHWA 4DLJA 3BRBA 2B54A 3DOGA 4AA5A 1Q8WA 2VRXA 4QO9A 2CNUA 3CPBA 3RAIA 2GSFA 3HV7A 4ZTSA 3TZ9A 5L2TA 3I5NA 2GHLA 4AOJA 2A2AA 4BGHA 4UMPA 5CANA 3TEIA 5DRDA 1DM2A 4NEUA 4LM5A 5AR2A 3EYHA 4OT6A 5DEWA 5IQBA 5C4LA 2OF2A 1YWRA 4R5SA 3QLGA 1JLUE 2RKUA 3NGAA 2C68A 3DNEA 4U3ZA 3A4OX 2J0KA 5IA2A 2C6OA 5IEVA 2BTSA 4EH3A 3S1HA 3AMYA 3TTJA 2IZTA 1LEZA 3WF8A 4BCIA 1IAHA 4BF2A 2OLCA 4JR7A 2YITA 3LVPA 4F9AA 5CXHA 4XG3A 2W9FB 4MEDA 1KE6A 3D0EA 3VW8A 5IA4A 5DN3A 3LJ2A 2ITNA 4IVCA 2RSVA 1H25A 2CCIA 5DT4A 5H8EA 2A1AB 2BRBA 2VO3A 4ZIMA 3GU4A 4RJ8A 1JQHA 3A2CA 5IA0A 1TQIA 4RIYB 3F5XA 3VS3A 1OUYA 3FY2A 3MH1A 2WTKC 5CLPA 5FD2A 3RM7A 4YJUA 4A9UA 3FSFA 1UU8A 4I23A 5JZNA 4A9TA 4K1BA 2EB2A 4UZDA 4EZ3A 4NFMA 3P7AA 1SZMA 4EOKA 3GVUA 3MBLA 5CEKA 5HNBA 5CEQA 3UGCA 2BILB 2QKWB 4LI5A 5DGZA 3UZTA 2VTNA 3ZZEA 4B99A 2EU9A 5AM6A 5FDPA 4IWDA 4PDYA 1PXOA 2R3JA 3LXNA 4IXPA 4QMLA 3ZOSA 2OICA 4DEHA 4ZLOA 1JOWB 2XEZA 1WBNA 2UZTA 4NWMA 4M97A 4QMMA 4QMUA 2R5TA 2UW7A 3GCVA 4EK5A 4FYOA 3ULIA 5AAGA 3G51A 3KCFA 3R71A 2YFXA 1YXVA 2GNFA 3BGPA 4JRVA 2QVSE 4QP3A 3ZUVA 3FSKA 4ZSAA 3HV5A 2VTLA 3H9RA 4I6QA 3V51A 1H1RA 3P4KA 3HAVA 4KIOA 2F7ZE 3BX5A 3EOCA 1WBSA 5BPYA 2OZAB 3EN4A 4I20A 5A46A 3OEFX 4HYIA 4TWNA 4F0FA 3NUXA 4FSQA 5D7AA 2VWUA 1QL6A 2IWIA 1T46A 3FMKA 4L43A 4QMQA 3PJ3A 4WOVA 1IR3A 3U6IA 4RX9A 4GUEA 1BL7A 1OKYA 5E8SA 3VHKA 2VTRA 3AC3A 1ZYDA 4MD9E 3E92A 3V5JA 4LL5A 4UMUA 3LJ1A 2W9ZB 3OCBA 4RIYA 2F4JA 3QA8A 3UNZA 1PYEA 1Y6BA 2CDZA 3TJCA 3EQIA 3NLBA 3LCSA 2ITPA 3PIYA 3LAUA 3HUCA 3QKMA 4JBVA 3O8UA 4XP0A 3C1XA 4PDPA 4IFGA 3RINA 2YISA 4CCBA 4I0SA 3LJ0A 4QP1A 3PPKA 1WZYA 3BKBA 3MH2A 2VO6A 3BPRA 1OVEA 4DTKA 5T68A 4IDVA 3V8TA 1Q62A 3QBNA 3OUNB 4ITHA 4QTAA 3RAHA 3ZSIA 3A7JA 5AR8A 3HEGA 4MNEB 2CN5A 4RJ3A 4S34A 3QC4A 5EHOA 5AV1A 3WBLA 4IANA 3NYXA 3SRVB 2XKFA 3D7TB 5EYDA 4UBAA 4C62A 3KK8A 5B2MA 2R9SA 3DQWA 1ZMUA 1RE8A 1OIUA 4IBMA 5HKMA 3NDMA 4EQMA 4QYEA 4IX6A 3ZDIA 1IRKA 1HOWA 3GOPA 4C57A 4LUEA 3UIXA 3UQGA 2CLQA 2X4FA 3G2FA 4PQNA 4QNYA 4IJPA 4LRJA 2YDJA 1CKJA 1Q8TA 3F6XA 4X3FC 5ETIA 5HO8A 5J7HA 3NMUF 3OROA 4BCPA 3MPAA 5DOSA 4O84A 1CKPA 2FO0A 2PZYA 4GUBA 4LV8A 3VUTA 4J53A 3ACJA 5KO1A 5I9WA 4RWLA 3C5IA 4FKPA 3C5UA 4YZCA 2LAVA 4DGOA 2HYYA 5GJGA 1FVVA 2C6MA 2YCQA 1OL5A 2W0JA 2R7IA 4K11A 4EOQA 4HGLA 3S3IA 2XF0A 3DAJA 3VAPA 2PU8A 3EFJA 3BWFA 3SW7A 3E87A 1LPUA 3KXZA 4A9YA 3ZTXA 4EHGA 3WZDA 1PW2A 2RF9A 1A9UA 3D94A 4FV7A 3U8WA 3P08A 2ACXA 4CV9A 3QRKA 4MHAA 3AD6A 4OTHA 3MJ2A 3CY2A 4UMRA 4XX9A 3ITZA 5AUZA 2ITWA 5IKWA 3DQXA 4FKSA 4EWQA 3E8NA 3MH3A 2ZB1A 3F88A 1H1WA 4MNEA 4PNKA 5IQDA 3OCSA 4LOQA 3ZXTA 3HMMA 3HDMA 5M4FA 5TE0A 3SRVA 5J5TA 2J4ZA 2ZM4A 4BN1A 2QOFA 4O81A 4X3FB 1H1SA 1H24A 4GK2A 2W7XA 4WG5A 3TNWA 4FKJA 3BEGA 2BAJA 4RZVA 4XRLA 4CMOA 2J7TA 3EQHA 1JVPP 1H1QA 5CU3A 3BU6A 3K3IA 4Z7HA 3DKGA 4K77A 1Q4LA 5FXQA 2VWXA 5KMOA 5A14A 4FZDB 4Y83A 4DBXA 3UO4A 5ITAA 1OI9A 3HL7A 4PL4A 3CIKA 1Q8YA 4ZTHA 3NNWA 5LCKA 2QOBA 3GU6A 4EYJA 3FAAA 4IWPA 4PMMA 3BE2A 1YI3A 2HZIA 4EYMA 5DVRA 4OAUC 3ENHA 4JX3A 4MXZA 4N6YA 2H6DA 1K3AA 4XV1A 1LP4A 2BZKB 2HZ4A 2IJMA 5HESA 3UMWA 3HZTA 4BCQA 2X7GA 3M11A 4KRCA 3C4XA 3FKNA 3VO3A 3EZVA 5HLPA 4ANLA 3VUGA 4AZVA 2WD1A 3ALNA 2XBJA 4DEIA 4IB1A 3C4CA 4IZ7A 3ORPA 2Y9QA 3O23A 5J87A 4X0MA 4FKGA 3DB8A 2XCHA 2GNLA 3CPCA 4KBKA 4RVLA 5IISA 5IQEA 4XG6A 3V6SA 3ZRLA 3QWKA 2X2MA 3EL7A 4UYAA 3ALOA 4MNFA 2E9PA 4AZWA 5GZAA 3FBVA 2XK6A 1QPCA 4UY9A 4KSQA 5H8GA 3B2WA 4U40A 4X3FA 3HECA 1B6CB 3KL8A 4XG7A 5FWKK 1A48A 2WNTA 3R04A 5HCXA 4L68A 4O86A 5IQHA 3BE9A 1J1CA 1ZMWA 4TL0A 2QO7A 2X1NA 4L6QA 2ONLC 5TOZA 4APCA 2IW8A 1Y91A 2F2UA 4QPSA 2R4BA 3QFVA 3SA0A 2BUJA 3LFAA 2R0IA 3HGKA 4EZ7A 1IG1A 4JIKA 2YDIA 2FGIA 1P4FA 1PXMA 4RLLA 4DITA 3R02A 3I0OA 1QCFA 2Q0BA 3FZTA 4OTRA 5L2IA 3ZBXA 3LM5A 3MY1A 5I4NA 4KKEA 3UQCA 3ULZA 2PSQA 4JLCA 3RP9A 2JDRA 1B39A 2QOHA 3GBZA 4A4XA 1KUTA 1Y8GA 3UZPA 4TZRA 2PK9A 4ZK5A 1L3RE 5EK7A 2ITQA 3R7GA 3NCGA 3BIZA 3OT8A 2WHBA 4I22A 3BBWA 4TN6A 2B52A 1JNKA 2VX1A 5HBJA 4D9UA 2X7OA 4A4LA 3PJ1A 3KY2A 2C6IA 3CE3A 3IDBA 4GT5A 3PJ8A 3T3VA 3ODYX 2YWPA 2A19B 1E9HA 3ACKA 3V5TA 3IDPA 5JFXA 4H58A 3NAYA 5IA3A 4ACGA 3G6HA 3VJOA 4YPSA 4BCMA 5CU0A 3UO5A 4ZSJA 2OJ9A 5C26A 4JDIA 2GQRA 3T3UA 3HMOA 5IDNA 2YCSA 4GL9A 2C6EA 2PE1A 4OTDA 2ZV2A 1YWNA 3ZC6A 5DR2A 2DWBA 5EW9A 5J9LA 3FLWA 4YTHA 1OBDA 5FP6A 4M15A 3BU3A 2G1TA 2E2BA 4XMOA 3E63A 4MKCA 4EWHA 1YI6A 4FSTA 4ZY6A 4D0WA 3HV3A 2IVUA 3MTFA 3MWUA 4QQTA 3FLZA 2PVNA 3C13A 2QU6A 4PWNA 1P5EA 5LMBA 4J8NA 2CKQA 1XO2B 2B1PA 3RK7A 2XNGA 4IAKA 4E4MA 3VWAA 2QOCA 1F0QA 4LRMA 2J0IA 1MQBA 1Y57A 1P4OA 2B9JA 3CY3A 4EQCA 3KXGA 2W05A 2WKMA 5FUTA 3Q4ZA 2PE2A 3FJQE 3BCEA 3QTUA 4O21A 4ZSGA 1YOLA 4HZSA 2BHHA 5DEYA 3REPA 3D5VA 3VBWA 4L8MA 3MJ1A 2F2CB 3GU8A 4HPTE 3PXYA 5AFVA 3HP5A 2ONLA 4RX5A 4FL3A 5FLFA 3KMMA 4JL9A 4B0GA 4LUDA 3EIDA 2PVYA 2JKQA 3NR9A 1GZKA 2HW7A 2O8YA 3FY0A 4CFNA 4B4LA 4EI4A 4RJ7A 2VTQA 2XS0A 3RPRA 1GJOA 1XR1A 3Q6UA 2ITVA 2XH5A 3LFFA 4AZEA 2YIRA 5E8VA 4N70A 1DAYA 3V8SA 5TO8A 5IA1A 2W96B 4KD1A 4KINA 2HELA 3N4VA 4Z16A 4O27B 3FZSA 5HX8A 3I1AA 4TYIA 3PTGA 2PVLA 3F3UA 3HMIA 3QD0A 4XS2A 4YJNA 2IVTA 2YCFA 2O64A 3RPYA 3R7VA 3MB6A 3WF7A 3CS9A 5FG8A 4UYNA 3SVVA 1Q5KA 5HTCA 1W0XC 4G3GA 4HCVA 2BVAA 3MV5A 2XP2A 2I7QA 3EHAA 2WEVA 2ESMA 4JOAA 4QT1A 4BCNA 3I7BA 3UJGA 3I79A 4NT4A 4DTBA 3Q9ZA 5HG7A 3BYMA 4EOMA 4HGEA 3CD3A 5CF8A 2FSLX 3QWJA 4CCUA 1YI4A 5B2KA 2XMYA 2IZRA 2VTTA 4I5HA 3QTXA 4RSSA 1J7IA 2X39A 4ZJJA 2VN9A 2ZV7A 3QGWA 2AYPA 5J1WA 1ZAOA 2JBPA 3F9NA 2J2IB 1OIRA 4J95A 5GIOE 3MH0A 4JXFA 1H01A 5JKGA 5IUGA 1M7QA 2BALA 2XZSA 3KCKA 3MGYA 1NVSA 3Q04A 1SNUA 3LW0A 4FEQA 3ORNA 4FTIA 4QTBA 2QOLA 2G2HA 4FE2A 4K18A 1KOAA 2B9FA 1GOLA 5FTQA 4D4RA 4KSPA 2BPMA 3ZCLA 4UWYA 3VC4A 3VUIA 4NM7A 3GENA 3KF4A 2J0LA 3PA4A 5CSWA 1OUKA 5LQFA 4CYIA 2Z8CA 1BLXA 3AMBA 4GCJA 4M0YA 4FKLA 3ZLYA 5F95A 4GG7A 3L1SA 3JPVA 3PUPA 4I5CA 5DG5A 5TR6A 1BX6A 4DGNA 2BKKA 2BDJA 4EQUA 5CALA 4HNFA 5HVJA 4FV9A 4GT3A 2VZ6A 5LVOA 5CEOA 3HUBA 3ATSA 3BEAA 2HENA 2EXEA 3B2TA 3OXZA 4FKQA 4EZ5A 3U6HA 5B0XA 2GS7A 1Q24A 5CT0A 2VO0A 3GXLA 4OAVB 3DFCB 2GS2A 3NWWA 4IACA 3BWJA 5K5XA 1URWA 4PMTA 4IQ6A 5K0XA 2BFYA 2CHLA 4G2FA 3SQQA 1BYGA 5CT7A 4DGMA 5L2SA 1U5QA 1Y6AA 3QRTA 1H4LA 5E90A 2HWOA 4GV1A 4L53A 4JBQA 3OBGA 4RWJA 4DFUA 3BZ3A 2BRGA 5D10A 5CY3A 2WOTA 3QLFA 3IONA 2V55A 2I0EA 4J1RA 4OR5A 4X21A 3HRBA 4O91A 5IQGA 4YPDA 3F5PA 3UQFA 3ZS5A 3P7CA 5K4IA 1O9UA 2YM7A 5ANGA 5FRIA 4I0TA 1B38A 4RC2A 3TACA 4E5WA 3ZU7A 1OKVA 3R8UA 4ASXA 5LVMA 5FBNC 2B4SB 3MFTA 5CSHA 5M51A 4UMTA 2VWIA 5I0BA 4F1TA 5KHXA 2YACA 3NW6A 2VWWA 5HICA 5IDPA 3AC4A 1NVRA 3LPBA 4AQCA 3OG7A 4PPBA 3DLZA 5LCJA 3PLAE 2ETMA 2PULA 4O0YA 5FBOA 2C5YA 3NNVA 3OD6X 4NKAA 3ID6C 1JKKA 3M1SA 2PVFA 2CPKE 4I93A 4FKIA 1Y8YA 5EI6A 3VIDA 5ACKA 2XNBA 4BDFA 5KMLA 5AA9A 5IH6A 1OPJA 3T9TA 2J5FA 3UVRA 1W83A 2W4KA 2BIYA 1ZYLA 2DS1A 2EXMA 2J5EA 2R0UA 3CXWA 5HIBA 4GRBA 4RIWB 4TWOA 2VTIA 3Q32A 3MFRA 4C36A 3IDCA 4PL3A 4C2VA 4WSQA 4XHKB 2QO2A 2W1HA 3GFEA 4QMPA 4FGBA 2GNIA 4QYYA 4A9SA 3F7ZA 5HVYA 1ATPE 4FEWA 3OF0A 3DLSA 5KBRA 3OVVA 2QO9A 3EH9A 3R7OA 4ZJVA 2GFCA 3EL8A 5I9YA 4CEGA 3IW7A 4QMVA 4AS0A 5AX9A 2ZJWA 2QR7A 2YJSA 4WG4A 4FVQA 3NPCA 3QTSA 1Q8ZA 5IZFA 3MFUA 1ND4A 2GPHA 4R3CA 3L8PA 3R8LA 4CT1A 3SGCA 1XH9A 4U79A 3FC1X 4L3LA 3WARA 2W1GA 2WQBA 3DXNA 3QHRA 4IE9A 4YTIA 3TV6A 5JK3A 3KKVA 2WAJA 5EHYA 3WF6A 1X8BA 5AP4A 2WTIA 5KKRC 3ZC5A 4HOKA 4LGDA 3TV7A 4EONA 2J0MB 3II5A 2CNVA 1YDTE 2WQEA 2G01A 3RM6A 3OUKA 2BDFA 2OJIA 3OWPA 3E3BX 4FZ7A 4MYGA 4AU8A 2W4JA 4DTAA 4IAYA 2I1MA 3E8EA 4E6DA 1OGUA 4IVBA 3H4JA 5HU9A 5D9HA 3R2BA 4PPAA 4M14A 1NY3A 1G3NA 4ZJIA 5LVPA 3O7LD 2PUIA 2EB3A 1J3HA 1JAMA 3FXWA 4GW8A 3OXTA 5CF6A 4MXXA 3G6GA 3PPZA 3LXKA 4EBVA 4C38A 4KABA 3VUMA 3WYXA 2X9EA 2WQOA 5HG5A 4FSWA 4RIWA 4F7LA 3KRJA 3OCTA 3TN8A 4WG3A 5HOAA 3D5UA 2ITUA 3BU5A 4FIFA 4FG9A 1FGIA 5CVHA 3F2AA 5GIPE 4AF3A 5KZ0A 3Q5ZA 2GU8A 4BDIA 2ITOA 3SOAA 4RVTA 4ZTRA 4MXYA 5M56A 2PL0A 4AGUA 1ZLTA 3FXXA 4FI1A 5I3OA 4GFMA 4FV3A 2F7XE 3PZEA 4TYJA 4YGAA 5KKRB 2QOKA 1PXLA 1WBTA 3EQBA 3OZ6A 3FV8A 4FKUA 4L45A 4QNAA 4ASZA 5EQPA 4GJ3A 4BZDA 4FKOA 3P5KA 3BHHA 4GVAA 4CRLA 4O0RA 3VF8A 4QQ5A 5EI8A 4AFEA 2Y7JA 4ZLYA 4ZTQA 5L6WL 5HIEA 1JKTA 4OTFA 4MAOA 4P90A 5KMJA 4QPMA 1RJBA 4CSVA 4I3ZA 2PVJA 3KVWA 3KXMA 1YOJA 2V22A 4D5HA 3TIYA 1SNXA 4IB3A 4BFMA 3G0EA 3A8WA 3KMUA 2WO6A 1XKKA 5K0KA 4DCAA 4W9WA 5FP5A 3HYHA 4Q2AA 3OMVA 5JGDA 2XIRA 4YURA 1H1PA 2RL5A 4IM2A 3FZ1A 5C27A 3SW4A 1PXIA 4LRKA 3FKOA 4BHZA 5L8JA 3P23A 4FTRA 4F08A 2WZJA 2YA9A 2NO3A 3HX4A 2WMRA 3KN6A 4W4XA 5C03A 4WD5A 1ZRZA 3PRFA 4BI1A 5LOHA 2VTPA 4EEVA 2ITTA 1P14A 3UDBA 1R1WA 1VR2A 3BYOA 2QI8A 4H05A 2BRMA 3DAKA 4Y46A 4KS7A 3KF7A 4L01A 3TKUA 3H3CA 4CQGA 4GU9A 5J5SA 4II5A 1NW1A 3KVXA 5L2QA 3TG1A 3A7FA 3FYJX 3ZONA 3DPKA 4XJ0A 3EQCA 1PXNA 2OSCA 3F82A 3R7IA 3VS1A 3BLQA 4ASDA 4R3RA 3QUPA 3ORXA 4R7IA 4E4NA 3FHRA 2IPXA 5I3RA 2WXVA 4BGGA 5IUIA 2A4LA 3K5UA 3V6RA 3UZRA 3BYSA 2GNJA 4CGAA 3KMWA 3Q3BA 4F9CA 1ZOGA 4O0WA 4FNYA 3IOPA 2R3NA 4GKIA 1R3CA 4YO6A 4I94A 4BBMA 2XNMA 5JMSA 4RIXB 4O0SA 2YZLA 3QZGA 3LM0A 4HCTA 4HCUA 5E8WA 4V04A 4NL0A 5HTBA 3E3PA 3C51A 3L8VA 5EW3A 4AAAA 3K54A 1XH7A 1Z5MA 4H3PA 4F1MA 2BRHA 3QRUA 4A07A 2W1DA 2WEIA 2QOIA 3HKOA 2R3OA 3FZOA 5E8YA 4IJ9A 5E92A 1XBAA 3BHVA 3DFAA 4CTCA 5IUHA 3KREA 3HMNA 4DEBA 5HGIA 5M4IA 4KB8A 5ANEA 3ZZWA 3A4PA 1JBPE 1R39A 5E8XA 4CFMA 4DFYA 3D5XA 4FV2A 4ERKA 4WRSA 5BQ0A 4DF3A 5I9ZA 4IVDA 4DG0E 3UC4A 2B9HA 4BZNA 4X2NA 2WU6A 4FIJA 4FSMA 3FEGA 2VX0A 3Q53A 3UOLA 4FZ6A 5EHLA 4DG3E 2XK4A 3VBXA 4LMNA 4U42A 3ZMMA 2CJMA 4RQVA 5CZIA 1V0BA
chains in the Genus database with same CATH superfamily
4FTLA 2PVHA 3DB6A 4TNBA 2BZHB 5HD4A 3QALE 1PMUA 5EDRA 2G9XA 2WTVA 4NTTA 5HI2A 4BVUA 4YTCA 3EFLA 5C8KA 5CTPA 4BDDA 5IF1A 2R3IA 4E5AX 4O6EA 3FLNC 3R9OA 3O2MA 3QA0A 3RK9A 4C33A 3THBA 2JAVA 4ITJA 4C2WA 4CFWA 3U6JA 1M52A 3PXKA 4ZMEA 4YJPA 1ERKA 1PKDA 3E62A 2RFEA 1R0EA 2JD5A 3P9JA 4GIHA 5HBEA 3UIBA 2P33A 5GZ8A 1XMLA 3W2PA 3DDPA 3QXPA 4HYHA 2OIQA 2VTMA 3SG9A 1ZYCA 4BIEA 1OITA 4OGRA 2JKMA 4QD6A 2OG8A 2JFMA 4G3FA 2AEGA 1YWVA 2VGOA 3FMHA 4BDGA 2X0PA 2C3KA 3F5GA 2HW6A 4ZZOA 1VZOA 3OW3A 5HHWA 2HZNA 3E8CA 1JSTA 4UWBA 4CQEA 3UYTA 2IO6A 2WELA 5BMMA 4FTTA 4QYHA 5LVLA 4MQ1A 3COIA 1XBBA 2V5QA 3R8MA 5HD7A 4AG8A 5IU2A 3QRIA 5TT7A 3F2RA 2OJJA 4Y95A 4HW7A 1J91A 4NIFB 2B9IA 5JZJA 2RFSA 2YIXA 3LFEA 3PSDA 4YMJA 2IF8A 3CSVA 4ZXTA 2X8DA 4OW8A 4BCGA 2JAMA 4F4PA 5HTIA 3W2QA 3VBTA 4S30A 1V0OA 4ERWA 2BHEA 2C6TA 5DR9A 3TDWA 3OCGA 3FQEA 3OS3A 3RZFA 3UG1A 5G6VA 4BJJA 2XNEA 1YHWA 4FV5A 3JY0A 4QQJA 2GMXA 3W55A 5JN2A 5C4KA 4L7SA 1VYWA 2F9GA 4AE9A 4FR4A 1RW8A 2IG7A 1J1BA 2YIYA 3DZQA 3ZLWA 1IA9A 2XK7A 1OBGA 4FTMA 3VUKA 2ZM1A 3C4EA 2WTCA 2IVSA 2UZWE 4YNEA 4ALVA 2NPQA 4GKHA 2AUHA 1YXUA 4FRFA 2X8IA 4QRCA 1YXTA 1ZXEA 3VUDA 4JVGA 4BTJA 4CZYB 3K5VA 2KULA 3A60A 3RK5A 3PY3A 4K33A 5LVNA 3MDYA 4Y85A 3UDSA 3W32A 2J0JA 4EORA 3V5LA 3L9MA 3AD5A 1AGWA 2OZAA 2Z7SA 3IKAA 4FEXA 4AAYA 3BYUA 3B8RA 5CU2A 4BGQA 1UKIA 4RGJA 4EL9A 4RJ5A 3LQ8A 4YZDA 2V7OA 2I0VA 3Q4TA 3WI6A 5AMNA 1J7LA 3W0OA 1PMVA 5A4TA 4FV4A 4R3PA 3T8OA 3PWDA 3QQLA 3W2RA 4ASEA 1YQJA 4EJ7A 4NIFA 3RTPA 4EK4A 3F61A 3G15A 3HNGA 4ARKA 4MF0A 3QQJA 5ICPA 4N0SA 4UX9A 4GFGA 1REJA 4DGLC 4FT5A 4OTPA 4P4CA 1O6YA 1MRYA 2YM6A 3S95A 4F7JA 4JG8A 4DHIB 2WU7A 3S4QA 2OKRA 2WGJA 3FMEA 4IX5A 4AW2A 4EJNA 5HX6A 5CI6A 1SYKA 4NCTA 5CS6A 1LUFA 3E7VA 3QTWA 5L6PA 3RCJA 1UA2A 5DRBA 3CGFA 4FV1A 4MK0A 3QZIA 3VHEA 3LFCA 4GFOA 4IHPA 2PYWA 3QQFA 1APME 3D7TA 1YXSA 2FSTX 2HWPA 3FUPA 3UG2A 3BQCA 3CQUA 3QKKA 1OMWA 4IW0A 2R3PA 4IX4A 3PVBA 4C3FA 3OY1A 2FUMA 3PVWA 4D0XA 3FYKX 3KFAA 3UDZA 3O0GA 4ZAUA 1I44A 2XEYA 5HEZA 3NCZA 1STCE 5A4QA 3PXFA 2ERZE 4EH7A 3BHUA 3R8PA 5IPJA 2YEXA 4MBIA 2BAQA 3TZ8A 4XRJA 3CQEA 3MSSA 3W18A 3ZLSA 1PMNA 3W0RA 4Z7GA 5C01A 4F6SA 3FZPA 4O2PA 5EKNA 2XCKA 1UWHA 3OW4A 4W4YA 2IW6A 3IK3A 2VV9A 4Y72A 4O2ZA 3UOKA 4AXAA 4LQMA 3ORIA 2GNHA 2C3LA 1BKXA 1WBWA 4HVHA 4BDKA 3C4WA 2BZJA 4QTDA 3FMMA 1V0PA 4J71A 4EOSA 2XKDA 2CCHA 3VS2A 5LMKC 1ZZLA 4YHTA 4PNIA 3FL4A 3PIXA 2HXQA 4WHZA 4AZSA 4F09A 3PP1A 4ZTMA 3BELA 4O4BB 4AX8A 2PY3A 2O2UA 4ANQA 2QKRA 3FL5A 3QX2A 4AN3A 2YIQA 1MUOA 3DJ5A 3V5QA 3K3JA 4QPAA 2J50A 2JC6A 5ETCA 2ERKA 1PXPA 2PMIA 4HGSA 1Q99A 4E6AA 5AJQA 2WMBA 4CG9A 3SXRA 3DKCA 1Q3WA 4JR3A 4IWQA 3PA3A 3GC0A 3MVHA 4FIHA 5AUVA 4QOXA 2XUUA 4UEUA 1REKA 5C8NA 2BIKB 4NYEA 3PLSA 4PTEA 3AMAA 4O82A 1IEPA 1YW2A 3ELJA 3ETAA 4BKJA 3RCDA 1XBCA 1OL2A 3H10A 2XRUA 1E1VA 1Q3DA 1Z57A 4KIKB 4F9WA 2OI4X 2JDSA 1WFCA 2R7BA 1OL7A 2PHKA 4WNMA 4BYJA 4OBOA 2JBOA 3UO6A 4M0ZA 2OO8X 4HNIA 4AXEA 2CGUA 3DBDA 5KE0A 4AW0A 1H0WA 4CKRA 1SVHA 4FIEA 3V8WA 3FPMA 2IVVA 1WVWA 2QHNA 1BL6A 4C61A 1VLRA 5DFPA 3WZEA 3DJ6A 4UZHA 3DS6A 3UDTA 3DAEA 4O7TA 4G31A 4M12A 4U80A 4F9YA 4EKKA 2VWBA 4BRXA 3ZSGA 2HZ0A 5M4UA 1Z9XA 1A06A 4YZMA 2W4OA 3KQ7A 3COKA 4JNWA 4PRJA 3W2OA 2C47A 2OGVA 4DFNA 4WSYA 4FOCA 4HVGA 4RVMA 4JAIA 1NA7A 3VBYA 5LWMA 5AEPA 4CVAA 3LCOA 1G8SA 5EQEA 4J97A 2O0UA 4BHNA 3TCPA 4E4XA 4ITIA 3TNQB 2JKOA 4ZY4A 3GC8A 3Q5IA 2BMCA 1W84A 3Q9XA 4RJ4A 5BVKA 5AUXA 3EMGA 2BTRA 3E5AA 3QD2B 3WE8A 2WMQA 2QONA 4IFCA 3MA3A 3ZM4A 2GCDA 4KIPA 4YUQA 4USEA 4WA9A 4A9RA 4OBPA 4V0GB 4W8EA 3FI2A 4IZYA 1PXKA 3EN9A 3NEWA 4KIQA 4KIKA 1OL1A 4TYHB 3WZJA 5M08A 4CXAA 3U87A 3HMPA 2BAKA 2HK5A 4QP8A 5I9XA 3BLAA 5LMKA 2X0OA 3R63A 4H1MA 3UTOA 5FTGA 3R30A 3UP2A 3NAXA 4MBJA 5TF9A 3RAWA 3PP0A 4DHFA 3FXZA 3Q9WA 3QD4A 2ZV8A 4C59A 4XBRA 4EH5A 3UOJA 3TWJA 3VW6A 4E8AA 5BUIA 4AW1A 4I5MA 4BDJA 4FL2A 4GH2A 2WMSA 3PSBA 4C4JA 4K9YA 5CQWA 4E73A 1GZ8A 2Z02A 5AR7A 4TPTA 3AKLA 2XRWA 2W06A 4R1YA 3RJCA 4FTAA 2YM4A 2CKPA 4M7IA 4BL1A 3DJ7A 1R78A 3LIJA 3LZBA 3RHKA 1YDRE 2UVYA 5C8MA 4FX3A 4O1OA 4XH6A 4U5JA 2YLEA 2VTAA 3AG9A 3LKMA 4R5YA 5DIAA 2WTJA 3LMGA 5AP1A 1OPKA 5KMKA 3FMDA 4JDHA 4IEBA 2RFDA 4TRLA 5DPVA 4JIAA 4M8TA 3SG8A 5ETAA 5T6KA 5E8TA 4RQKA 1O6KA 4FTJA 2UZDA 2XIXA 4F6WA 4LL0A 4RJ6A 5EI2A 3EQRA 4DHZA 5FEDA 5HU3A 3GU7A 4OTIA 3R01A 4TWCA 4XLIA 4NM3A 3PFQA 5EYKA 3RALA 4U0IA 2X6EA 2A98A 4C3PA 1I09A 1ZY4A 4AACA 1XH5A 4BDAA 1XQZA 3LCTA 4J99A 4RMZA 2NRYA 1PJKA 3DXQA 4DH3A 4G34A 1SMHA 3OT3A 4NK9A 1YKRA 4USDA 3EN5A 4DDGA 2VU3A 5IEXA 2QQ7A 5J9ZA 1KV1A 2Z2WA 4I6HA 4XNEA 5BVFA 2PMOX 4CD0A 3UBDA 4DFZE 3ZFYA 5LJJA 4NJ3A 4O22A 2JIUA 2NRUA 4FSZA 4EC8A 4USFA 4FV0A 4IC7A 3ZM9A 4FV6A 4BB4A 4WNKA 3MVLA 4EH9A 3D7ZA 5E7RA 3A7HA 3FLQA 4AZTA 2R2PA 3AQVA 3K2LA 1FOTA 5CWZA 3TNHA 4BDEA 4G9CA 4L7FA 1V1KA 4ACDA 1URCA 3CLYA 4TNDA 3IGGA 4FGRA 4O7RA 3OXIA 5AIRA 3DKFA 4GYIA 3EQDA 4YC3A 4YO4A 2I0YA 1OPLA 3MA6A 5EKOA 5J8IA 3RBWA 2R3FA 3T9IA 4A7CA 1EH4A 3UE4A 3NYVA 3RMFA 4E93A 5AUUA 2SRCA 3O50A 4FK3A 4I41A 3WIGA 1U4DA 3D9VA 4EH8A 4BYIA 3MVMA 4NH1A 3MI9A 2X2KA 5A4EA 4XLVA 4ALUA 3EWHA 1U59A 3A7GA 2GTMA 2W1EA 5M53A 4QMWA 3UNKA 2EUFB 3ZLXA 4MXOA 4L44A 5AUYA 1OIYA 4ALWA 2WMWA 4DEDA 3NIZA 4ACMA 4O7ZA 3F3TA 5H2UA 4GK4A 4ZMFA 2UUEA 2QURA 5E8ZA 3CR0A 4M69B 3O17A 4W9XA 4JJRA 4JAJA 3DTWA 3LXPA 3W8QA 5L8KA 4BTMA 4TW9A 4TKSA 3PVUA 3LMHA 3KRWA 2XIYA 3ERKA 2UZVA 3QCXA 2PPQA 3BV2A 2UW5A 3NYOA 4DFLA 3DKOA 3G33A 5FDXA 4FTKA 4PTCA 4FOBA 4R8QA 2Q83A 5BYYA 4X2JA 3MESA 4UXQA 4FVRA 4K6ZA 1QPJA 1RDQE 2UZEA 3Q96A 2XVDA 3QXOA 1UNGA 3IECA 4B7TA 4E3CA 5EM8A 4TY1A 2W1ZA 5A6OA 2XYNA 3D2IA 4CMUA 4D58A 5GINE 2PWLA 4G17A 4FTOA 4O83A 3LFQA 2WQNA 4IAZA 1GZNA 2VWVA 4D2SA 4I0RA 2WIPA 3H0YA 4MCVA 3R28A 3FDNA 5F20A 4E26A 4EBWA 1Q41A 4RFYA 4ANMA 2C1BA 2JLDA 2CN8A 4ZZMA 3PDTA 4ZTNA 3UYSA 3NUPA 4FYNA 3RI1A 3P86A 3BGZA 1GIHA 2XBAA 5DHJA 5E1EA 3Q9YA 4WUAA 3ZUUA 4O7LA 3QC9A 4CFFA 4P5ZA 3LLAA 5HNGA 3MW1A 4IZAA 1WAKA 5CX9A 4D5KA 4EK8A 3PVGA 4N4SA 4FNXA 5BUEA 5GNKA 3MB7A 4BY9E 4W8DA 4O0TA 4YJQA 1MP8A 3ZEPA 4M69A 1H07A 4CYJA 3TZMA 3R2YA 3A99A 2LGCA 4JQ8A 1S9JA 2C5VA 4FK6A 3P79A 2H34A 3KXHA 4FF8A 4DE4A 3OWKA 4QMSA 3A62A 3I6UA 3OHTA 2GDOA 3IW8A 3ZRKA 3TNPC 2O5KA 4ZSLA 4JG6A 3WE4A 4DDIA 4FZFB 4IAIA 5E91A 3D2KA 5I9UA 2QNJA 5CAPA 4Y5HA 2DQ7X 4RG0A 5JH6A 3W10A 1DAWA 4U41A 4DT9A 2H9VA 1CSNA 5AV2A 4XP2A 5GZ9A 3BHTA 2BRNA 4GIIA 3O5AA 3WOWA 2IW9A 3L9PA 4FNWA 4CLJA 3ZO1A 1TFFA 2C69A 3H30A 2R64A 4C3RA 4Z9LA 1JKLA 4F99A 3WIKA 3D5WA 4GJ2A 4BWPA 3BLHA 4IZ5A 5HORA 3PXRA 3R1QA 1K2PA 1FMOE 3CJFA 3DDQA 3QRJA 5J9YA 2XJ1A 3HAMA 1F5QA 4TT7A 4QTEA 3DK6A 4CFUA 4CV8A 4UN0C 5E4HA 3M2WA 3POZA 1OZ1A 2OIBA 3E64A 3GB2A 3ZO3A 1ZOHA 4RZWA 4D28A 4F63A 1CM8A 2O63A 1H00A 2PE0A 1GAGA 3QTZA 3RWPA 4QMZA 5M4CA 4YLJA 3GI3A 1G8JA 4KBCA 4FTQA 4N57A 4RFZA 3RAKA 1NXKA 3UPXA 3ORLA 2R3GA 3AT2A 3SAYA 1S9IA 4DT8A 4G16A 5DT0A 5KMMA 4R1VA 3FQHA 4TYGA 2YM8A 5B7VA 4BKYA 4PP7A 4C58A 3R1SA 3CKXA 4NUSA 3MN3A 4ID7A 2VTOA 4IB0A 3F66A 4WUNA 2B0QA 3MIAA 1QPDA 2VTHA 4RLKA 5A4CA 3SX9A 4O7YA 4KRDA 4FSNA 2OJFE 4D9TA 5CSXA 4F0GA 2UW9A 2PUNA 5FTOA 2C4GA 4GK3A 4YC8A 3PZHA 4U97A 3HV4A 4YLLA 3CD8A 4NZWB 4ENXA 4XBUA 4WO5A 5AUWA 4C35A 1ZZ2A 4FODA 3NUYA 2X6DA 3ZO4A 4W4WA 3FI8A 4L9IA 3W33A 2IZUA 3IO7A 5DI1A 2ZV9A 4MUQA 4LFIA 3HRCA 1UNLA 4L46A 4PL5A 2XJ2A 2JFLA 2UV2A 2X2LA 1WVYA 5M55A 2CGXA 4J8MA 3F5UA 3BLRA 5HBHA 4FUXA 4Z55A 3TKHA 4L3PA 2UVXA 2VO7A 3PA5A 2QC6A 3EN7A 4PP9A 4BIBA 5HE0A 2Y8OA 3GOKA 4PDOA 2GQGA 2QLQA 1H0VA 3RGFA 4GEOA 3FKLA 4F70A 2Y6MA 2WTWA 1JKSA 3LQ5A 4LOOA 4UWCA 1BMKA 5AP0A 4EH6A 1NT2A 4QMTA 3ZFMA 2PVMA 4ZSEA 2CKEA 2ZB0A 3E8DA 3EFWA 3R9DA 4MD8E 4F7NA 2KTYA 2QHMA 3KRLA 4WT6A 3CTHA 4LV5A 1FMKA 1MRVA 5HG8A 4KUJA 5M57A 4V05A 3RNIA 2XKCA 2VWYA 4LOPA 3KU2A 1SM2A 2JIIA 2NP8A 4OUCA 4UXLA 4UV0A 3NVMB 2VGPA 2OXYA 3HDNA 4BBFA 1FINA 4MQ2A 2XNOA 3QF9A 2OW3A 3IPHA 2AC3A 4G3CA 2R3MA 2BCJA 3KULB 4EOIA 3AKJA 2ZMCA 4D4VA 5K9IA 4FC0A 2YHVA 2C0IA 3BGQA 1JWHA 3GP0A 3EQFA 2PVRA 3QTRA 3E88A 3TT0A 5CI7A 3C9WA 4F65A 4XEYA 4XG8A 2VTSA 5EFQA 2R3QA 1KV2A 3F7WA 1PHKA 4XOYA 3UNJA 3E93A 4D2WA 4KS8A 3QGYA 4I6BA 5CNOA 3WILA 3RKBA 1ZY5A 3TUDA 3ZDUA 4QP2A 3SLSA 3EYGA 3PXZA 5I5ZA 5FM3A 3S0OA 3RPSA 3QCYA 2YWVA 4YJOA 2W99B 3RHXA 4PTGA 2WMTA 5H9BA 5HCZA 2JDVA 4JQEA 2JKKA 5CF5A 3AT4A 4IWOA 5AIKA 4Q9ZA 4QMNA 4ZLZA 3RWQA 2GTNA 2RIOA 3ODZX 3RPVA 2ZVAA 3COMA 4MWIA 1KWPA 4JRNA 3R7YA 1W8CA 4BTKA 4DH5A 3LE6A 3KN5A 4MX9A 4YJVA 5DH3A 4Z3VA 5BVNA 5HNIX 5JSMA 4HVIA 1L8TA 3LFSA 3AOXA 3FMLA 3Q2JA 2XIKA 4XG2A 2Z7LA 3VBQA 4U8ZA 2A27A 3ZBFA 2P0CA 4RC4A 5AP7A 4R78A 4N6ZA 5J79A 3MVJA 1M14A 4BCHA 4DH7A 3F2NA 3KRRA 1ZARA 4NKSA 5EM7A 3PE1A 1KE8A 4L00A 2XM9A 3O8PA 4XOZA 4YLKA 3HV6A 3KULA 4B9DA 4YTFA 1GY3A 2W17A 3NW5A 4V01A 4MVFA 3QCSA 3C4ZA 3PG3A 5I9VA 5K5NA 4FNZA 5ETFA 3W0MA 5KZIA 4F1OA 3LMIA 3EKNA 2OXXA 3NUUA 5EDPA 4X6RA 5L4QA 3BYVA 4JG7A 2GFSA 3KA0A 1SVGA 3DZOA 4I24A 4L67A 4NCTC 3AGLA 5CVFA 5F94A 2R3LA 3U55A 5CASA 3PY1A 4GSBA 3IOKA 3CTJA 4U9AA 1BI8A 3EZRA 3PPJA 5CAVA 1DI9A 2XM8A 2QOOA 4RIXA 4EC9A 3WF9A 4EKLA 4FUYA 4F6UA 5CEMA 2G2FA 1CDKA 3UP7A 3C50A 3QYZA 5L6OA 4AGDA 5IMEA 1UKHA 3IQ7A 1W2CA 2UZOA 3D14A 3OTVA 5F1ZA 4ZY5A 5IEYA 4PX6A 2VNWA 2OIDA 5DE2A 5CEIA 3R00A 3QUEA 4I1ZA 3ZEWA 3EKKA 4JX7A 4QTCA 2NYAA 2WQMA 3F3WA 3CCNA 5KUPA 4PUZA 2V0DA 4AWIA 3I6WA 2CSNA 2P4IA 4DA5A 5AR3A 5A4LA 4CFXA 2X0QA 4NW5A 1UNHA 5BVWA 1ST4A 1DS5A 2P55A 2VWZA 2X4ZA 4J52A 4OBQA 4QMOA 4EHZA 4HVDA 3DK3A 2YERA 4XG9A 5AAEA 4IM3A 5LMAA 4FTNA 2OH4A 2XNPA 4RPVA 1LEWA 2CNQA 3TKIA 1IASA 1AD5A 2X0GA 3ROYA 4M3QA 4DH8A 2WTKB 4UMQA 3GCUA 4FTCA 4X3JA 2X81A 4FT0A 4B6LA 1KOBA 2YZAA 3C0HA 3LCDA 2PUPA 4JQ7A 4AE6A 5AP5A 4I21A 3FI3A 4G6NA 5KCVA 4DC2A 4R7BA 3JS2A 5HVKA 2C3IB 2FA2A 2RG6A 4X2GA 1FVTA 3C7QA 3KC3A 4IIRA 4BR3A 3AGMA 4YHJA 5IQCA 2UW6A 3SXSA 4EOOA 4U81A 2YM5A 3IG7A 5ANOA 4ACHA 4FA2A 5AR4A 3DV3A 2UZUE 3L8SA 2F7EE 2IN6A 5FXRA 1PRYA 4RT7A 1E1XA 5JQ8A 3GC7A 1OIQA 4D4YA 2PZ5A 4D2PA 5B2LA 3SOCA 4EUUA 3Q2MA 4FG8A 3ROCA 4JDJA 2ZYBA 3R22A 3AC5A 3SHEA 3W8LA 3ZXZA 4U45A 2CLXA 3CQWA 1AQ1A 5CENA 3U4UA 3VN9A 1JSVA 4FKTA 2EVAA 2XKEA 4U43A 3U4WA 1OL6A 4FV8A 1ZYSA 4YBJA 3PE2A 3VNTA 2OF4A 4EHEA 3TUCA 3LFBA 4U44A 3TNIA 4AXCA 2PMNX 2C5OA 4FL1A 3GT8A 5AAFA 3U54A 2XARA 3TJDA 4BCFA 3TZ7A 4CZTA 3G5DA 3ORMA 3WZUA 1YVJA 2XK9A 3BQRA 2XALA 5JQ5A 3N4TA 5AV0A 5DT3A 5TKDA 4D2VA 3GGFA 4DINA 4PDSA 4M66A 4X7QA 2CKOA 3PY0A 2UZBA 5DWRA 4DFXE 2VUWA 3PIZA 5D12A 2X8EA 2EWAA 4E4LA 1H8FA 4AN9A 3FMNA 3TI1A 2XK8A 5EQYA 4D2RA 2C30A 3BBTB 1PKGA 5CU4A 4BWKA 1UV5A 4QMXA 5AV4A 3Q4CA 4XV2A 4AW5A 4DEEA 5EYMA 2ZDTA 3DGKA 4G5PA 1YOMA 3FZRA 4AA0A 4IADA 5A9UA 4RC3A 5D1JA 5EOLA 2C0OA 4DH1A 3CTQA 3GCSA 2W1FA 2Z60A 5GHVA 3FQSA 2B53A 2C0TA 3G0FA 3G9NA 3A61A 5KBQA 5EM5A 4RX8A 3RPOA 1JPAA 2RGPA 1UWJA 5K3YA 3MY5A 1YHVA 2JIVA 4CTBA 5K4JA 4U7ZA 3ZHPC 2F57A 2OBJA 4QP4A 3GQIA 1ZYJA 2FH9A 3HP2A 2C6LA 4YJTA 3RVGA 3C4FA 3ANRA 4X2FA 4FSYA 3RZBA 3TL8A 5JFSA 1MQ4A 4IM0A 3VUHA 3GQLA 2GHGA 4A06A 5IG1A 4CNHA 3H0ZA 4G1WA 2GNGA 2W5BA 4WNOA 5E1SA 2DUVA 5AR5A 4BKZA 4OTWA 4E20A 4Y73A 1WBVA 3CGOA 3NUNA 4MF1A 4YJSA 3QYWA 4P7EA 4HVSA 4JDKA 5GJDA 5HE3A 4YZNA 4FSRA 2OK1A 1TQPA 2ETRA 2OXDA 3P7BA 3JXWA 4F9BA 2QD9A 3I4BA 5ANKA 3TUBA 4FEVA 4AXFA 4ZTLA 3DBCA 2X9FA 4PMPA 3BI6A 3I0QA 4KNBA 4NM5A 2PMLX 3R6XA 1WVXA 2X7FA 5F4NA 3PJCA 4FKWA 4MTAA 4WRGA 2WMUA 4FSUA 4KA3A 4FT9A 3NYNA 4E6QA 4O38A 4K2RA 4ANBA 1GZOA 3S00A 4RIOA 1FQ1B 2FYSA 4L3JA 5AWMA 2PUUA 3TDVA 2R3RA 2VD5A 3VS5A 2Q0NA 5IA5A 4AT3A 2CMWA 4CFVA 2WMVA 3AT3A 5LARA 1YHSA 3HVCA 4FT7A 3CJGA 4G9RA 5BYZA 3PG1A 3NUSA 3ORKA 3DXPA 2ZDUA 4ZEGA 1PXJA 3JVRA 3LQ3A 1PMEA 4AGWA 2FSOX 4RWIA 4E5BA 5CNNA 3FC2A 3MS9A 3NZ0A 4NSTA 4I92A 4WIHA 3LCKA 1M2QA 3W2SA 5FEQA 4D55A 3QKLA 5CEPA 4PPCA 4L52A 3GCQA 3PJ2A 3IGOA 2GHMA 3N9XA 5HLWA 5IMXA 3GNIB 1FBNA 4O7SA 3HRFA 3NUAA 3FPQA 2Y4IC 4EOLA 3F3ZA 2E9VA 4XYFA 5FM2A 4CLIA 3OBJA 4PV0A 5CU6A 3UIMA 5CAQA 2NNWB 4C4EA 4U3YA 2WMXA 3CP9A 5J1VA 4YJRA 5JT2A 3VS4A 4C8BA 3R7EA 4FG7A 1SVEA 1VEBA 3HA6A 4JBPA 3VQHA 3ZFXA 5IQIA 1FVRA 4RVKA 4YZ9A 3GU5A 5BUJA 3LHJA 4BZOA 3I60A 2HY81 2WFYA 4G3DA 4FKVA 4AGCA 4AP7A 3GFWA 3PWYA 1TQMA 2XJ0A 2W5HA 4AOTA 2OFUA 4H3QA 3H9OA 5L2WA 2QODA 3JYAA 3R8VA 5AA8A 2OH0E 3DT1A 2OZOA 4WNPA 5E8UA 3CBLA 3B8QA 4C34A 4EH4A 2B7AA 3BHYA 3W2CA 4DYMA 1J7UA 5EYCA 3Q4UA 2CGVA 3ET7A 4C4HA 4O7WA 2VTJA 5HE2A 4C02A 2OWBA 4F0IA 1U5RA 3HLLA 4BTFA 4WKQA 4EHVA 4DFBA 3AC1A 4ANSA 3LFDA 4G5JA 4HYUA 4BIDA 2BR1A 2Y4IB 1WCCA 2WIHA 2E9NA 3SXFA 5M06A 1UU7A 4YR8A 2XK3A 5CZHA 5HO7A 4CG8A 4HYSA 2PVKA 4TXCA 4C4FA 4IDTA 3ATTA 2XIZA 1MRUA 4Y8DA 2UW3A 4YZBA 3D4QA 4E7WA 1HCLA 1NVQA 5GJFA 4IVAA 2CGWA 4AA4A 3IW4A 3MIYA 3S2PA 2HAKA 3NRMA 5L3AA 2J9MA 3V5PA 2ETKA 3G9LX 5KMNA 3V01A 4HPUE 3QAME 3KXXA 1OM1A 4FIGA 3R0TA 4LGHA 4XUFA 5FEEA 3EJ1A 3PXQA 4MBLA 4UALA 5CXZA 2C6DA 4BI0A 1OKWA 2PTKA 3MPTA 5EOBA 3GC9A 1OECA 3R83A 1W7HA 2Z7QA 5J95A 4PY1A 1RQQA 3TIZA 3DA6A 2YAAA 2C1AA 3D83A 4FTUA 5FXSA 4OTQA 3GEQA 3QQKA 2HXLA 4XP3A 3EFKA 3U9NA 4APPA 1R0PA 3UIUA 3O96A 4YSMA 5T3QA 2QR8A 4EOPA 2VX3A 1P2AA 1LR4A 2O65A 3D15A 4M13A 4HGTA 2WB8A 4O6LA 3AC8A 3UPZA 2YCRA 3O71A 4GS6A 4EH2A 4S31A 2Z7RA 3MY0A 2YLFA 4YBKA 4YSJA 3V5WA 5IQAA 2UZLA 4LYNA 4CKIA 4C4GA 2R3KA 2UW4A 4KWPA 2RFNA 3L9LA 4BDCA 2VNYA 1KSWA 4BC6A 1K9AA 3NW7A 4C37A 4O1PA 1ZWSA 4FBXA 5AM7A 4A4OA 2HCKA 3NSZA 5BMSA 2QLUA 5HCYA 4V0GA 3V04A 4E6CA 4D4SA 2XYUA 4G6OA 4I4FA 4TYHA 1CTPE 2FB8A 2IZSA 2JITA 4FZAB 3WYYA 1GIIA 2C3JA 3SC1A 3DNDA 2J51A 4S2ZA 2WMAA 5EG3A 4ANOA 4BDHA 2Y4PA 1FGKA 5BYLA 2P3GX 3UVPA 4RFMA 4R7HA 5DLSA 4IX3A 4M84A 3CC6A 4BCOA 3JUHA 4KKGA 5ACBC 3COHA 3R9HA 3UVQA 4AQKA 4RX7A 1BUHA 2E9UA 5F9EA 1U46A 3C0IA 5EH0A 3MYGA 5BVEA 3GUBA 4UB7A 2FSM