3C9WA

Crystal structure of erk-2 with hypothemycin covalently bound
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
349
structure length
336
Chain Sequence
AAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPTRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular modeling and crystal structure of ERK2-hypothemycin complexes
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Mitogen-activated protein kinase 1
total genus 99
structure length 336
sequence length 349
chains with identical sequence B
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2008-02-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3c9wA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3c9wA01
5AADA 1XHAA 3AGMA 1Y57A 3CQWA 4AW0A 1PKGA 3AD4A 3FQEA 4L7SA 4CFFA 3QD4A 1P4OA 5DNRA 4RIYB 2Q83A 3BQRA 3ACKA 4JBVA 1U5RA 1XBAA 5EG3A 2ITVA 3DK7A 3OW4A 4FYOA 3RM7A 4X21A 2X1NA 3BE2A 3NYXA 5JT2A 5LVPA 1LEZA 2GTNA 4NCTC 3T9IA 4A9RA 3ID6C 4RWIA 5CVGA 2JKMA 3QCSA 2A1AB 3KA0A 4C8BA 4CD0A 3PYYA 1YDRE 4I6QA 3A7IA 4O91A 2CKPA 2IWIA 3GB2A 5BVEA 2X4ZA 4AW5A 3UOHA 4TNBA 3FXZA 1E1XA 4EH3A 5HTBA 3ZMMA 5KNJA 3CD3A 4IEBA 1SNUA 2CJMA 4G6OA 1OIYA 2XIKA 5TF9A 4EZ7A 4YBKA 2J0MB 3TCPA 4YP8A 3PRFA 2EXEA 3W18A 4EH5A 2BHHA 4DG2E 3QF9A 5JGBA 5CASA 1JQHA 2Z8CA 4C0TA 2PWLA 4FTMA 4BIBA 3C0GA 3QC9A 3ZUTA 1YHWA 4TY1A 3LOKA 1IR3A 4M12A 2PY3A 1U54B 5AR3A 3TZ7A 3AC2A 3LZBA 2XK9A 4EOQA 3BI6A 3JY0A 5IQEA 2ZOQA 3FLNC 4GU9A 4A9SA 4YUQA 5FTGA 4FGBA 5FDXA 4AGCA 1TQMA 3G33A 4D4RA 3GCSA 3MVJA 3H10A 4RC4A 3PXRA 2F7EE 1PXKA 4Q5EA 5DOSA 5EH0A 1XJDA 2IZUA 2WMUA 4U81A 3VBWA 4E5AX 3KXMA 1YOMA 1YXVA 2JFLA 1NVSA 5EQYA 4FT9A 2QOHA 2BZIB 4YU2A 4MNEB 2EXMA 1XWSA 2O63A 2OH4A 1PXLA 3BCEA 2V0DA 5AUYA 1W82A 4DEDA 4Z7HA 5KUPA 2IW8A 3CQUA 3O51A 1RE8A 4RMZA 3U51A 2EWAA 3HNGA 3VBTA 2JITA 1BUHA 3KXZA 2ITZA 3BYSA 3II5A 5EW3A 3UMXA 5CAPA 4I1ZA 4FV5A 2I40A 4C3RA 3TNPC 1YOJA 3O7LB 5E8VA 1GNGA 2BMCA 2WOUA 3MWUA 4TPTA 4AZTA 4F0FA 4BWKA 2Y0AA 3GFWA 4KIKA 1OPJA 5IQGA 4MHAA 4Y8DA 5AIRA 4UXQA 4B4LA 4IB5A 4L44A 4QTDA 5AP2A 2FYSA 2OJJA 3HUBA 5CXZA 1F3MC 5IF1A 3QC4A 5C4KA 5T3QA 4RJ5A 2YM5A 4L46A 3U4UA 5IA4A 2YIRA 5HVYA 3OVVA 4G3GA 5AP3A 2W7XA 3LFCA 4FF8A 1QPJA 5JEBA 4JG8A 5K3YA 2PZPA 3NUNA 3MVMA 3KCFA 5FTOA 1SVGA 3OY3A 1UKIA 5EM5A 2PZIA 1JSTA 3FI3A 3CTHA 3O8TA 3TIYA 5A4TA 3VHEA 3DK6A 1SYKA 3NAYA 3V5TA 1U59A 4I3ZA 2VWBA 4QYYA 2YM6A 4EYMA 1YWNA 3I0QA 2WMXA 1B6CB 4NJDA 3LFAA 3ZCLA 3IW7A 2YDKA 1UWJA 2RGPA 4JVGA 5LMKC 3OXTA 2J9MA 2ZM4A 3BHTA 4MX9A 3TTIA 2HELA 5HE1A 5TE0A 4ZSGA 5A4LA 1H0VA 4EI4A 5FUTA 2VAGA 5DMZA 3KQ7A 1ZYSA 2UZOA 2XIRA 3LMGA 5ANIA 4F6SA 5CF6A 2YDIA 3VUKA 2IN6A 3VUIA 3UTOA 2B55A 4FKWA 4U3ZA 2X39A 4OW8A 5CF4A 4IX6A 5GNKA 5IH6A 2E2BA 4A9TA 4DGGA 1G8SA 5EQEA 4BCJA 4K9YA 3GVUA 3M11A 1ATPE 3FSFA 4IMYA 4AA0A 4BCMA 3V6RA 3FQSA 3VS2A 4V01A 3GU6A 1FGKA 4TN6A 5KMIA 3HMMA 5IDPA 3PXKA 2X0GA 4PY1A 4CTCA 4WSYA 1H07A 4P90A 4YTCA 5L2SA 4O0YA 4YPSA 3CKWA 4Q9SA 3AC8A 4QRCA 3TIZA 4E6DA 4KUJA 4ASDA 1M52A 4C62A 2WTWA 3EFWA 3IGGA 4KA3A 4ACGA 3S1HA 2VWZA 3LXLA 3BYVA 4FKQA 4QP7A 2X2MA 4V05A 2C0TA 3R2BA 3HRBA 3V5JA 5M4CA 4A4LA 2HAKA 2XS0A 1UV5A 1RDQE 4PMPA 5IQBA 5CAQA 3IECA 3Q6WA 3WARA 4CMOA 4CZTA 4ZJVA 1CKPA 4NH1A 1YHVA 4FZAB 4QMNA 3QAME 4XG8A 2WMBA 2W05A 5DGZA 1GZOA 2H8HA 1Y6BA 1HCLA 2C6OA 3E63A 2QI8A 3HV6A 3NRMA 3C0IA 2REIA 3T3UA 4DEBA 5GHVA 1YDTE 1AGWA 2GPHA 3C9WA 3DB6A 5EM7A 5LARA 4BFMA 4E5WA 1W83A 3IO7A 5DEYA 4HPTE 3CE3A 3W2SA 3FYKX 4IZYA 2JIIA 5EW8A 5FP6A 5A4QA 2UUEA 2QR8A 3G0EA 3NAXA 4ZZOA 5IG1A 5IISA 5LMBA 1X8BA 3UP7A 2J2IB 3NCZA 3UOLA 4K18A 4XLIA 4ZTHA 4FKOA 1ZLTA 3D9VA 5L6WL 3TI1A 4IVBA 2ITNA 3UNJA 5ICPA 2VWUA 1NA7A 4EONA 3QQFA 3R00A 4OTIA 4RC3A 4E6CA 4XS2A 2JAMA 5CT0A 4CSVA 3PZHA 4XUFA 3O2MA 4F7JA 2JDTA 3C4ZA 4C4GA 5IUHA 3BX5A 5H2UA 3KN5A 3KRLA 4LRMA 5CS6A 3EFJA 2OXDA 3PIZA 4MXOA 4UN0C 1ND4A 1OB3A 2JLDA 3HRCA 3RALA 4V0GA 4GT5A 4ZY4A 4AT5A 5FLFA 5LOHA 5JZNA 4WA9A 2W1HA 2BKZA 4R6VA 3VBQA 4G3EA 5A9UA 4MVFA 3G6GA 2PE0A 2YEXA 1ZMVA 3NNXA 3OP5A 4JL9A 4YHJA 3W32A 3LCKA 4AN3A 5IMXA 5IEVA 3QQGA 4BCGA 2WQMA 4IIRA 1JKTA 1Y8YA 4C61A 3ODYX 3Q53A 3CGFA 1WBTA 3HMNA 4IANA 4JOAA 4QP8A 5ANEA 3HL7A 5EOLA 3OWJA 3MN3A 4FSZA 4U7ZA 5HOAA 3AT2A 2GU8A 3F66A 1LP4A 1YDSE 5CU3A 3ETAA 4IM3A 3ZDIA 4DEHA 4QQJA 5LJJA 4C38A 4R8QA 3IOKA 3GC7A 3ORLA 4QNAA 4U8ZA 3POZA 4AXAA 2VO3A 2WEIA 4WD5A 3ZLSA 4TRLA 5LMAA 4HVIA 5CSHA 3GQLA 3QRIA 3P7CA 2WEVA 5JK3A 4GIIA 2ZB1A 2YAAA 3LXPA 5DN3A 4QP6A 3CKXA 1AQ1A 2GNHA 3K3IA 4D5HA 2WMVA 3E7OA 2ZV7A 4D2WA 4NL0A 4FSQA 3VS3A 4NZWB 5G6VA 3ZO2A 3NW6A 4FG8A 1WBNA 3IW5A 1J3HA 1H24A 4Q9ZA 3CSVA 2YIYA 4YHFA 1BLXA 3EZVA 5EHYA 2UW9A 3UC4A 5GZ8A 1OIUA 3QTWA 5D1JA 2CN8A 1XBBA 3RWQA 3R1SA 1BL7A 4U43A 1DI8A 4DCEA 3C4CA 4BR3A 1YXSA 2X6EA 3PWYA 4FKGA 2JFMA 3R8MA 4AFJA 3HUCA 4O0TA 1QMZA 2XK3A 2R3OA 1GZ8A 2LGCA 4YZNA 2JDVA 3QGYA 5BVWA 4YO4A 2WHBA 4J7BA 4OBOA 4X2FA 2VWYA 4ZJJA 4U79A 4EK6A 4DAWA 2C6IA 3NNUA 4BC6A 1ZYCA 1TQIA 2WTJA 4N0SA 2VTLA 3UZRA 5FP5A 2O5KA 5IDNA 2ZMDA 4RSSA 4XOYA 3MTLA 4YGAA 5FGKA 1KV1A 4PF4A 5LVLA 5HCYA 4FV8A 3R83A 3H9OA 4IWQA 4BYIA 5LWMA 4X6RA 3KVWA 4MF1A 3JVRA 3O7LD 4BZNA 4IWOA 4X2KA 1XR1A 4F6UA 1BI8A 4WNKA 1R78A 3WZUA 4FKPA 3ULZA 4KABA 3OWPA 4WOVA 4W9XA 2C5NA 3DKCA 5E91A 3SKCA 4E3CA 4O82A 3ZUVA 1ZRZA 5HG5A 3GC8A 3OCGA 3GENA 5IQFA 2GSFA 4O83A 3SOCA 2QO9A 4GJ3A 4KB8A 5IEYA 3IONA 4ALUA 2QCSA 5ACKA 5C4LA 4F08A 5JQ8A 4QMXA 3UNZA 3SX9A 2P55A 5HI2A 4KIOA 1WBSA 1P5EA 4PDYA 2V22A 2PK9A 4Q5HA 4BGGA 5J5TA 2Q0NA 2W5HA 4UYAA 4WUNA 4RG0A 2O0UA 4WO5A 3FXWA 4NT4A 4U40A 4KRDA 2B9IA 3TG1A 3WILA 3V5LA 3MB6A 5IUGA 1R0PA 5KBQA 2OFUA 3KXNA 3QZHA 4RJ8A 1JAMA 1XKKA 4YZBA 4QO9A 4CV8A 1ZMUA 4KIQA 3OZ6A 3ZBFA 1W98A 5BQ0A 5GINE 4CQGA 3CPCA 3KK8A 5HKMA 4BTKA 4EQUA 5E9EA 2FH9A 2YDJA 4KIPA 4BHZA 4FK6A 4GYGA 3LXNA 3MVHA 2JIUA 1J7UA 2W4JA 5HIDA 2O2UA 3FLQA 3P79A 3R1YA 5CVFA 3WF9A 3BEGA 4YJSA 4YPDA 3F3UA 4TZRA 1PYXA 1YWVA 3IOPA 2C0OA 1F0QA 3FYJX 4JG7A 3FMJA 2QVSE 2GHGA 2A27A 4QMZA 2GNFA 2VWIA 3W2QA 4ITJA 4Z7GA 2R0IA 3V8WA 5HBEA 3I6WA 2UZNA 4EOPA 2XK4A 4DFNA 4I0TA 5FEDA 3CS9A 3MY0A 4AT3A 1JLUE 2B7AA 3TM0A 4UWYA 4FSNA 5CT7A 4IWDA 4OTGA 3ZRKA 3UIUA 4IAYA 4F7NA 2WPAA 3IS5A 4FG9A 3ZH8A 3PJ8A 3KXXA 3T9TA 4BVUA 3S3IA 3FV8A 2CCIA 3R02A 3PJ1A 5HG7A 4CLIA 4EL9A 2CNVA 2PMNX 2Y7JA 4M66A 3R73A 3BGZA 4W4WA 5HLPA 3KMUA 3UC3A 5I0BA 4PP7A 5EYCA 4BDGA 3K5UA 2XNBA 4KKEA 3CTJA 3LQ5A 2B9JA 5IH4A 4O96A 4FKLA 3R9HA 4ITHA 3M1SA 3UNKA 1YHSA 3QCQA 3TACA 5DLSA 4RWKA 2FA2A 5AUTA 5LVNA 5BUEA 5TO8A 3TNWA 3CP9A 4QYEA 5ETFA 5L6OA 2HZ0A 3ZU7A 5TR6A 2F4JA 4USDA 4E7WA 1IA8A 2R64A 1UNLA 5HG8A 4F9AA 5HLNA 3ZS5A 5I9UA 3VAPA 3I5ZA 3KY2A 2DS1A 3KFAA 4GW8A 3WZJA 4O7VA 2UZBA 4Y85A 1JKSA 5ANOA 2E9OA 5FQDC 2UW6A 4YJRA 3E62A 4GS6A 4ANMA 5M4IA 3E93A 4F64A 4HVGA 4GK3A 3WF5A 4EH9A 3TJDA 2OH0E 5HICA 4ACHA 3I6UA 3QWKA 1M14A 3PLSA 2FGIA 4QMMA 2GNJA 2ETRA 4E6QA 2I0YA 5EOBA 2QLUA 4D58A 4P5ZA 2W4KA 3KMMA 4XJ0A 5A6NA 3ZM4A 4L53A 3MW1A 4CFMA 2QOFA 3EKNA 4K0YA 4IB3A 3IG7A 3DXPA 3U55A 3JY9A 2HYYA 4JX7A 4MTAA 4ARKA 4RWJA 3TV4A 3JVSA 3JPVA 4QOXA 4ANNA 2B54A 2WTKC 2G15A 3KRJA 3KU2A 3LLAA 4RJ7A 5C8KA 3AMAA 2G1TA 3BEAA 4DGMA 1H1SA 5AUZA 2R3PA 3Q6UA 4M84A 3MTFA 1OL5A 2HCKA 2VTHA 4JBQA 4UZHA 3RPSA 2B9HA 2VX0A 3COIA 5AM7A 1R3CA 2Y4IB 5AP6A 4EORA 3WBLA 4YNOA 2HENA 4WNOA 3U6JA 2X2KA 5KKRC 3Q4TA 4UY9A 4QPAA 3TN8A 2B53A 5HX6A 3TWJA 4LGHA 4MF0A 3PXYA 4V0GB 5FEEA 1TQPA 3DLZA 3EJ1A 2JBPA 4NM0A 4AW1A 2QG7A 5CZIA 4AGWA 4IH8A 4ONAA 3NVKI 3OHTA 3VO3A 1PJKA 3BYOA 4N70A 3D15A 2NO3A 2E9PA 2CGWA 4U80A 5AIKA 4PWNA 4CQEA 5C8NA 3RNYA 3WZEA 5I4NA 5LQFA 4ENYA 4ZXTA 2UVZA 5E92A 2YIXA 3DU8A 3EQIA 2V55A 2NP8A 1G5SA 4AZVA 2XNMA 3H9RA 5EKOA 5JQ5A 5D41A 3RZFA 3C4FA 5KMLA 1Q5KA 5GZ9A 4RLKA 5C01A 4BYJA 2NRUA 4BWXA 4M67A 1CTPE 4O22A 4QMPA 4U41A 1KSWA 3E7VA 5L8JA 2VGOA 3UGCA 4PDPA 4CZYB 5IA3A 1JKLA 1JWHA 2XJ0A 5L2IA 3R7UA 3R8PA 2V62A 3QTZA 5DRBA 5DWRA 5M09A 4F99A 3JS2A 1LPUA 4B99A 3OBGA 3WOWA 2ERZE 1XQZA 4FBXA 2Y8OA 3QQKA 3BHYA 3R21A 4D2VA 3DK3A 1QPDA 3DNEA 4MWIA 3ZBXA 4D9UA 3KRWA 5AA9A 5F4NA 5TKDA 2WTKB 3E5AA 4FGRA 1UNHA 1GAGA 5AAEA 4IDTA 5IA5A 3VRYA 4AA4A 2PVHA 2WU6A 3PY0A 1PXJA 2UZWE 3F2RA 4PV0A 4TWOA 5FD2A 4BKYA 2HWPA 5EHOA 1ZYDA 2YITA 4NIFA 4OTPA 4UV0A 2BRNA 1PXMA 4N6ZA 3P9JA 4LV8A 4RC2A 2I1MA 3ALOA 5AAFA 2IG7A 1IAHA 3IW6A 4GRBA 3SV0A 4JS8A 2ITTA 3QLFA 1Q24A 1UU3A 3ZFMA 4CVAA 4DH1A 2CLXA 5HO6A 2AC5A 4RT7A 1IA9A 4X2NA 3ORIA 4G6NA 5ETAA 4QNYA 4U42A 2AC3A 4M15A 4O7NA 1PF8A 5DR6A 3LMIA 4I0SA 4ID7A 3FZSA 4AOIA 3LVPA 3MIAA 3R7EA 4IBMA 2P33A 1PYEA 4IVCA 4DFBA 2H9VA 5JFXA 3LCDA 2GS6A 3NNWA 5ETIA 4JDJA 3G9NA 4BCOA 2WTDA 3DCVA 4L52A 3FI8A 4ZS0A 3BV3A 4ZSEA 1KE5A 1NVQA 2OIDA 3HMOA 3KCKA 1BX6A 2C47A 2OGVA 2XVDA 3DZQA 4MXCA 3ZLYA 4EK3A 2ZM1A 3DBCA 3FMKA 4H58A 4JIKA 2PVJA 4D5KA 3B8RA 5AP7A 3NYOA 4RX8A 5CSVA 4IB1A 2A4LA 3DBQA 3F7WA 5JFSA 3V6SA 4MXXA 4ZZMA 2IJMA 3PRIA 4L01A 3GP0A 4A07A 3VW6A 2BAQA 2UVXA 3FMHA 4JG6A 1SVEA 2A2AA 2JD5A 3F2AA 4PDSA 4TXCA 3COMA 2VTIA 3G2FA 4JIAA 4L6QA 4OTDA 1Q8ZA 2X8DA 5HIBA 5CEKA 2GS2A 3DOGA 5ITAA 4J52A 4IXPA 4HGSA 2Z7SA 4K33A 4FV4A 3E8DA 2RF9A 2OW3A 4XG2A 3NW7A 1XH5A 1JSVA 2YISA 3ORMA 4FTRA 2C69A 4IJ9A 5D10A 2VTTA 4CT2A 4G5PA 1OL6A 5HO8A 3RCDA 4ZLOA 2OI4X 3FY2A 5AR5A 3MY5A 3ZZWA 4BDBA 4D1XA 5DPVA 2WQNA 4D9TA 5M53A 3KEXA 5H8GA 3HX4A 4JQ7A 4CT1A 1YW2A 4IC8A 3V5WA 1U5QA 2WQEA 3A4OX 4ENXA 3QA0A 4O21A 4M3QA 1Z9XA 4B8MA 5M06A 3D5XA 4NJ3A 2B52A 3G9LX 5D9HA 3HVCA 1H1QA 1WZYA 4QQ5A 2W4OA 4MH7A 3I7CA 4UMUA 4CG9A 3WIGA 4QTCA 3G0FA 4U6RA 2LAVA 4GIHA 2WTCA 1LUFA 5CQWA 1PHKA 4OR5A 5AP1A 4ZIMA 1FQ1B 2HOGA 1OL7A 2JDOA 4IW0A 3UIMA 4D2TA 4MKCA 3PXFA 2RFSA 2XCKA 3C50A 3R01A 1M7NA 4II5A 4RIWA 4V04A 4X3FB 5I9XA 3QD0A 4UWCA 4Y46A 3GU5A 1WFCA 2WTVA 3FL4A 3RGFA 3DS6A 1Y91A 5BPYA 3FL5A 2RG5A 2UW8A 4QMLA 4LRKA 3HAMA 4UEUA 3V01A 2WGJA 5CNNA 4XH6A 3C0HA 4U45A 4BDAA 2CGXA 3ZM9A 3SD0A 3QWJA 3W10A 3QHRA 5M4UA 3EB0A 4X3FC 3RNIA 2C3JA 2I6LA 2VO0A 3MFUA 3UO6A 5DG5A 1R0EA 2ITYA 5T6KA 3LFNA 2UZUE 4K2RA 2Y4IC 2YCQA 2BRMA 4WBOA 2R3QA 4C37A 2VX3A 4IAAA 1U46A 1OUKA 3OXZA 3RPVA 2VWWA 3RPRA 3L8VA 5AUWA 4PL4A 5KKRB 3PTGA 1SZMA 3F3VA 2W1ZA 3A7HA 1ZOEA 4M69A 5EDPA 4A7CA 4DE4A 4EQCA 4U5JA 2X4FA 4JRNA 4Z55A 3CQEA 4FSMA 1F5QA 3MFTA 4L8MA 4IE9A 3VS5A 1MRVA 4YC6A 3QLGA 3E8CA 1BKXA 4M13A 3C1XA 3N51A 3BBTB 4O7TA 1O6KA 2GHMA 4BDJA 4DCAA 4L3JA 3VUGA 4R5SA 4G9RA 5AUVA 3AT3A 2HW7A 2WMRA 3OTUA 5BYZA 4CMUA 2XRUA 2QKWB 2RFEA 1OKZA 3RKBA 4EHZA 1YVJA 2JAVA 4UXLA 1BYGA 1YI3A 4JAIA 4CXAA 4IAKA 3VRZA 4EKKA 5LMKA 3FPQA 4KBKA 1PRYA 2FSOX 3I4BA 2KULA 3NLBA 4OBPA 1H28A 1J91A 3P0MA 2XIYA 4C33A 2PUUA 3ZFYA 5AP4A 4GVAA 3PDTA 3VW8A 4FEVA 4FKVA 3U9CA 1OKVA 1GOLA 2XF0A 4GV1A 3ORTA 4C59A 2YFXA 2PULA 3Q9WA 5CANA 3UIXA 2CSNA 3OEZA 4HCTA 3Q04A 4P2KA 3N9XA 3CR0A 4MD8E 3REPA 4DITA 2DWBA 3ORZA 2QNJA 5FG8A 3P7BA 4IWPA 1UA2A 4BIEA 3FBVA 4WG5A 5EYKA 2YIWA 1HCKA 3NW5A 3FDNA 2IO6A 3MV5A 3GI3A 4RFMA 2XM8A 5DHJA 3RM6A 2B9FA 2V7OA 3BKBA 2ONLC 4A9YA 3DBDA 3OS3A 5GIPE 4W4YA 4BDHA 4OTFA 3RZBA 4BF2A 4FI1A 4E1ZA 1W8CA 5L2WA 4LI5A 3F3ZA 2YWPA 1BMKA 4IDVA 4AAAA 5AR8A 3V04A 1Q4LA 3GU4A 2W17A 2OICA 4QMUA 5J5SA 4F6WA 1OITA 2FUMA 3DQXA 2JKQA 2VD5A 3GT8A 3MA6A 5HCXA 3E87A 2R7IA 4YJPA 3FI2A 4XG3A 5E8XA 4S31A 5DT0A 5E90A 1R39A 4FR4A 4D28A 4PQNA 3UZPA 4YMJA 3A60A 3HMIA 1REKA 2YIQA 2IZSA 3RHXA 4FOCA 4QD6A 2YZAA 4S34A 4DH5A 3G15A 1XH8A 4BDCA 4BL1A 5AUUA 5IQCA 4RGJA 2B0QA 5HVKA 3DZOA 2QO2A 3CEKA 2HZNA 2WTIA 5JFVA 5B2KA 2WMSA 4CMTA 3QKLA 3S0OA 1OUYA 4Y5QA 3NMUF 3AGLA 5J1VA 3FZPA 3QFVA 4IHPA 4JBPA 4QP9A 5KHXA 4QTBA 3ZRLA 2VTRA 5AV4A 1H1RA 4YR8A 5BX0A 3QQHA 2XYUA 3QQUA 5I3OA 2VNWA 4OTRA 5DI1A 5L4QA 1OKWA 2CKEA 3UMWA 4NFNA 1FMOE 4MEDA 4KS7A 2QOKA 3EN5A 3C13A 4RQVA 1ZAOA 1V1KA 3KULB 3S4QA 4OTHA 3SOAA 5K9IA 1OBGA 1QPCA 1SM2A 2VO7A 5AV2A 4C7TA 3O8UA 4L67A 2GNGA 1H00A 1M2RA 3DV3A 2BKKA 4DT8A 4PMTA 4NU1A 3ZC5A 1ZOHA 4I23A 4L7FA 3UJGA 4JBOA 3GC9A 3VULA 2VWXA 1KV2A 2Y9QA 3FLZA 3A62A 1DI9A 4WNPA 2QOIA 4DHFA 5FBNC 4FIJA 4I24A 4EKLA 2IZRA 1VJYA 3MIYA 3L9LA 4IX3A 3FQHA 3QRUA 1CKJA 4DLJA 4ZS4A 2GTMA 4D2PA 4UB7A 3SC1A 1H01A 4ZZNA 3R9DA 2PZRA 3NUUA 4EH6A 4I6BA 2BTRA 1PMEA 4H36A 5FEQA 4IAIA 4L68A 5LWNA 2ZDTA 3EZRA 5IA2A 1YXUA 5HEZA 1GIJA 3QQLA 4C57A 2C1BA 3ZEWA 4G3DA 2VNYA 4TTHB 4K8AA 3ZXZA 5M44A 4BTJA 1FGIA 3I7BA 3HV4A 4FC0A 4DGLC 5HGIA 3RTPA 3O8PA 3VUDA 3QUDA 2W1DA 4RX7A 5KMOA 4E93A 1NT2A 4DFUA 5I5ZA 3DJ6A 2QG5A 5BMSA 3FY0A 2ZVAA 3CLYA 4UALA 5CAOA 1FVTA 2GCDA 3KF4A 4CCBA 3BYUA 1L8TA 3C4WA 1J1BA 2GNLA 3KRXA 4I41A 3CIKA 1KE6A 3ENMA 3OROA 4LOPA 3PE1A 3WZKA 4AG8A 3VIDA 4F9YA 4YC3A 1QPEA 2BRGA 2YCRA 4IB0A 1ZY4A 5AV3A 2XK6A 4BBEA 4PNIA 2QONA 5AMNA 2ERKA 4G3FA 5F1ZA 3R7OA 3D5UA 3DQWA 2P0CA 4E4LA 3FPMA 4C34A 1O6LA 4XG9A 4FNWA 4MWHA 3NIZA 5K0XA 4W4XA 2ITUA 3ANQA 3PZEA 4XG6A 4NW6A 5BVKA 1IAJA 4AZSA 3HDNA 4PRJA 2XNOA 5K4IA 2DUVA 4ZSAA 2OLCA 2RKUA 1I09A 5EDRA 4F9CA 2J90A 4MXYA 3EN7A 4RFZA 4YBJA 5IA1A 2C3KA 3HP5A 4YZMA 3E8NA 4C02A 3L8SA 2QOCA 3B2WA 4BTFA 3TNHA 4DEAA 3SVVA 4DINA 1VYZA 4QYGA 1WAKA 2C68A 3UQFA 4YLKA 4GFOA 3ZTXA 1H8FA 4EK8A 4DBNA 1KOAA 4PPAA 3LJ1A 1ZY5A 4QP1A 4XV3A 5EI2A 3SXSA 3QD3A 4O27B 4C35A 1GJOA 3C51A 3DBEA 4JI9A 5F95A 4ZLYA 2NPQA 5AR4A 3Q4ZA 3U54A 3GBZA 3ORNA 4M0ZA 2VZ6A 2PMOX 5FTQA 2C5VA 3O50A 4YSJA 5CF8A 2XM9A 3BLHA 2W1IA 3O96A 3P4KA 2UW7A 2XKDA 2HXLA 5BYLA 2VTAA 3MPAA 3Q9XA 3ZO1A 3EN4A 4QTAA 2J5EA 4A9UA 5HG9A 3MPMA 2YZLA 5E8UA 4O7RA 2R3FA 4RZVA 5CEQA 3FMDA 3VS4A 2VTPA 1K3AA 3BGQA 5LXMA 2YN8A 3WIKA 5CEPA 4EZ5A 4RIXB 4HYUA 1UU7A 4YO6A 4FOBA 2GNIA 5E4HA 2VTOA 4DFYA 1K2PA 3W33A 5CALA 5FM2A 5FDPA 3VHKA 3QX4A 1GZNA 1RJBA 2HY0A 4I4EA 4K1BA 4AZFA 3IW8A 2W1EA 1FVRA 4BCQA 3RPYA 2A19B 5H8BA 2O64A 4R7BA 5JGDA 3N4UA 4MNFA 2QLQA 1KE8A 3D7ZA 4YZDA 3QTQA 4IZAA 2UVYA 4O0WA 5DT4A 3V51A 3N4VA 2QOLA 1OPKA 3CJFA 4OAUC 3VUHA 3MESA 3OOMA 4FICA 1NY3A 3CC6A 3TKHA 1UWHA 1XO2B 4ANLA 4BWPA 1KE9A 4D0XA 4F9WA 4AGUA 4KSPA 4U97A 4AW2A 3MYGA 3V8TA 3QCXA 5KHWA 1B38A 3EQPA 5K5XA 3GGFA 4I94A 3RI1A 3OD6X 5JSMA 5AP5A 5J7BA 1WBPA 3LIJA 5IUIA 2C1AA 1ZWSA 2BR1A 3NYNA 4OLIA 3PY3A 4FNZA 4G16A 3EQCA 5L8LA 4DH3A 4FIGA 4DH7A 3OCBA 2YABA 2YERA 3FZOA 3P23A 2QOBA 3F82A 5BVDA 5FM3A 3DPKA 4JX3A 5CX9A 5EK7A 4BCIA 2H6DA 2ZV2A 3RVGA 4DT9A 4XP0A 2CCHA 2J51A 3D7TA 4MQ1A 3GU7A 5L2QA 1WVWA 3ORPA 3BGPA 3NZ0A 2WIHA 2VTQA 3QKKA 2WD1A 5AX9A 3EFLA 3IK3A 2OIQA 3TZMA 4TWCA 2W1CA 1YI4A 3BHHA 4EEVA 2Z7QA 4EOKA 3HEGA 3FKNA 2JGZA 2ZDUA 3CCNA 4O0UA 2PHKA 2Z60A 3OEFX 4HW7A 3AC5A 4EQMA 4DTBA 4NFMA 3AXWA 4EOMA 2OZAB 2X8IA 5D7VA 3D7TB 4X0MA 3TV7A 2R3NA 4EK4A 3JR1A 4DN5A 1JOWB 3NYVA 4RVMA 2JBOA 5CI6A 3EHAA 3AC1A 3FZRA 5AWMA 4C4HA 1CDKA 1H08A 3HYHA 3PPZA 4GH2A 2FSTX 3LFBA 4RA5A 1PXOA 1QCFA 3U87A 4AE9A 2XIZA 4GT4A 3LQ3A 5J1WA 1FINA 4OGRA 4OAVB 2YWVA 3EQBA 4ZY5A 4TYJA 2RL5A 3MH1A 3A99A 3ODZX 3PPJA 3QU0A 2CGUA 2PVYA 3P1AA 1JBPE 4HZSA 4EOIA 4BGQA 4KRCA 3NX8A 3RMFA 3D83A 4FIHA 3I5NA 4C4EA 4TYEA 3HECA 4HGEA 2OSCA 2YLEA 3F61A 4HOKA 3QUEA 5KMMA 3FWQA 3ZLXA 3VN9A 3COKA 2CLQA 4G31A 3DNDA 2VWVA 3KF7A 5HESA 4FNXA 3UO4A 4KBAA 4ERWA 4J98A 4H3PA 3U4WA 4FODA 5CXHA 1H4LA 4NIFB 3W2RA 4RIYA 4O1OA 5C1QB 4RA4A 4LMNA 4U0IA 4HVHA 4J96A 5BVNA 2BROA 2QKRA 3AG9A 2Z02A 1STCE 4FV3A 4FSUA 3R30A 3VQHA 5HCZA 4YZ9A 4JQ8A 3LM0A 4QMWA 2PU8A 4XBUA 4ZK5A 3RAWA 2PVNA 3SA0A 2BAKA 3SQQA 2R2PA 4PMMA 3R7GA 3TEIA 1Z57A 3FAAA 3G6HA 3K3JA 1REJA 2R0UA 2WU7A 1APME 2E9UA 4ZMFA 3WF8A 5CEOA 2AUHA 2BVAA 1CM8A 3HRFA 2XZSA 3D2KA 3M2WA 2O65A 3R28A 1OM1A 2HW6A 3R8VA 3VS0A 4M7IA 4EWHA 2JDSA 4IADA 2OJGA 4YLLA 4PL5A 4F1TA 4BIDA 3DAEA 3ZDUA 4FTJA 3PJ2A 3Q2MA 3LJ0A 4FZDB 3VBVA 4AN2A 4D1SA 3FMNA 5DA3A 3OUNB 4D4SA 4FA2A 1U54A 2RSVA 3NUXA 4AFEA 4AZWA 3VBXA 3R22A 3ZO4A 3WI6A 4F09A 4AA5A 3R7YA 1JSUA 3OT3A 3R63A 1YQJA 4BI1A 4BKZA 1M17A 1Q62A 3Q3BA 4BDDA 2XNNA 4PPBA 2BUJA 3ROCA 1WCCA 1KOBA 3PXZA 3NVMB 3PIYA 2J0KA 4GL9A 5HBHA 4QT1A 4AN9A 3R9OA 2GDOA 2PSQA 3RK7A 4X2GA 4PTGA 4QMVA 4H3QA 4L42A 2VO6A 4KWPA 3SDJA 3UPXA 3OWKA 1SMHA 4DGOA 4RIWB 4X3FA 1YWRA 4YTFA 3MFRA 4MNEA 1PXPA 5M55A 4BDFA 3I81A 4FSTA 4FKRA 5J87A 2BALA 3DJ7A 5CAVA 3HGKA 4FEXA 3RK9A 3VS1A 5E1SA 2X7OA 3W2PA 4DBXA 3JXWA 4XCUA 3SRVB 4ZLZA 5M07A 4FVRA 5J9ZA 3PJ3A 3QBNA 3NGAA 3RAKA 2F7ZE 4BY9E 2QD9A 1OVEA 2WMWA 1W84A 2RFNA 3DAKA 2GHLA 4BCHA 4NWMA 3GOPA 3QRTA 2R3IA 4MK0A 4RVTA 3N4TA 3EL7A 4CNHA 5C03A 3VC4A 5H3QA 1SNXA 4HZRA 2ITOA 1GIHA 4PUZA 3SG9A 3OC1A 4TYHB 5TOZA 3BYMA 4DFZE 4NCTA 4FKJA 4FIIA 2XRWA 3F3WA 4A4OA 4G1WA 4D2RA 3QRKA 1GZKA 2RG6A 2HZIA 4FV6A 3Q4UA 5HO7A 4FX3A 1Q99A 1O6YA 3D4QA 3TTJA 3VBYA 3AD5A 3B8QA 4EBWA 4NTSA 2RFDA 5I9WA 4XP2A 4HNFA 4BTMA 3V5PA 4EHVA 4TYHA 2EB3A 2W5AA 2XIXA 3AOXA 4FL2A 4FSRA 3P5KA 1IASA 2WNTA 3KB7A 3OFMA 4XOZA 5I9ZA 1T45A 3Q32A 4TWNA 5D12A 3UG2A 4AZEA 5KCVA 4YNEA 4ANSA 4B6LA 4ZTSA 3MJ2A 4LV5A 3DKFA 2W9FB 4B8LA 5DIAA 3G51A 4EOJA 4U9AA 4EJNA 2WAJA 5EQPA 3LFQA 3LE6A 5HNBA 1Z5MA 3R0TA 4BCKA 3IW4A 4BICA 4CG8A 4TL0A 4DG0E 4DEEA 4GFGA 4YTHA 1WMKA 4PL3A 3SLSA 1URCA 2F57A 3AC4A 3OWLA 3PG3A 3EYGA 3K54A 4ZMEA 4FKUA 4WBBB 3QGWA 3BHUA 3F5PA 2C3IB 2CHLA 2O8YA 4H3BA 4KKGA 1CSNA 3GCPA 4LRJA 5F20A 3RINA 3JUHA 2IW6A 5FXSA 5A54A 3L8PA 4XX9A 2VTSA 3UOJA 1IRKA 3OY1A 4DTAA 1XH4A 3EN6A 4O38A 2JDRA 2BDFA 4IFGA 4E4MA 4TWPA 5HE2A 3ENHA 4KINA 5GZAA 3MPTA 2PVKA 4FZ6A 3PSDA 1WBVA 3F5XA 4R1YA 3OF0A 3UVPA 4C3FA 4FV0A 1PXIA 2IPXA 4FEWA 3NS9A 5EYDA 3W1FA 2XBAA 5J7HA 5J9YA 3BIZA 2ZMCA 3DB8A 3LFEA 3I1AA 3NUPA 2X2LA 3IGOA 4FV9A 4HYSA 4KD1A 2JIVA 4NTTA 5IQIA 2O3PA 4G17A 4FV7A 4CEGA 4ORKA 3HP2A 5JKGA 3KRRA 5DBXA 3F69A 2FB8A 4MD7E 3UVQA 5IH5A 4J99A 4ACDA 4UWBA 2I0EA 2YACA 3G90X 3MFSA 3I79A 2R4BA 3DAJA 3PA3A 5DR2A 3BWJA 4YJTA 3TNIA 4BDEA 2I0HA 2CKQA 4PTCA 1MP8A 4DFXE 3RJCA 3GCUA 3H0YA 4MBIA 3FKLA 4FT3A 4HPUE 2XJ1A 1Q8TA 4XEYA 3QZIA 4C4FA 4CTBA 3SG8A 1H0WA 1O9UA 1DAYA 4YJNA 3T8OA 4B7TA 4JDIA 4EYJA 2WXVA 5IEXA 4FYNA 3A61A 1DAWA 4ZAUA 3D0EA 3E3PA 2HY81 3PSBA 2YM3A 2WOTA 4HYIA 4LOOA 4J1RA 2VUWA 4JXFA 2W99B 4M97A 5HVJA 4EZ3A 4GU6A 2W9ZB 3KKVA 4LUDA 3TNQB 1MRUA 4Y5HA 5CLPA 2H34A 4XG7A 1PMUA 2VX1A 2CMWA 3DXNA 4ZTMA 2QO7A 4MCVA 3TUBA 2CNUA 1OIRA 4ZEGA 2XP2A 4H39A 4Y73A 2XKCA 2IVSA 2J50A 4YSMA 1IEPA 3UODA 2WIPA 2NRYA 1BL6A 2WQBA 1ZZLA 3FLSA 3UIBA 3AMYA 3UOKA 4ALWA 4YC8A 3R9NA 2PVLA 4I6FA 4WHZA 2Q0BA 3IQ7A 5HX8A 2KTYA 5HIEA 5E8TA 4GK4A 3OG7A 4RRVA 3LQ8A 1TKIA 3Q5IA 2B1PA 4FL1A 1ZXEA 3CY2A 3NPCA 4HJOA 5CAUA 1M2PA 3QQJA 2J0LA 3NDMA 3HV5A 3R6XA 4KBCA 4L43A 3D94A 3EQDA 4M14A 3WYXA 3TXOA 3Q9YA 2ZV9A 5K4JA 5FRIA 3CJGA 3QD2B 1UVRA 3RAIA 4DLIA 2UZTA 5CYIA 4DFLA 1A48A 3LM5A 4FEQA 5BVFA 5KBRA 2VTNA 4O6LA 1MUOA 2BDWA 2C0IA 4BN1A 4F9BA 5IQHA 2BRHA 4YJOA 1JKKA 3GCQA 2XYNA 3O23A 4NUSA 1MRYA 3DGKA 3MJ1A 4K6ZA 2YM7A 4QMYA 2X9FA 2IVTA 2PUIA 4I5MA 3KGAA 3RWPA 4ZTQA 3E64A 2Y6MA 4J53A 3JYAA 2ETMA 3BWFA 5IQAA 4XRLA 4FL3A 3NSZA 5E7RA 4CV9A 5AP0A 4BGHA 2UW0A 2CKOA 3H4JA 3A7JA 4O86A 4D55A 4R3PA 4EOOA 3VUMA 5D7AA 2ESMA 1ZZ2A 2I0VA 4GK2A 1XH7A 2XK7A 4CRLA 4LG4A 3LCSA 4S2ZA 4EJ7A 5CTPA 3B2TA 4PX6A 5M08A 3KMWA 1H26A 1ZYLA 3R1NA 3EQHA 1KUTA 1UU8A 3D5WA 4EC8A 3ZLWA 5CY3A 1DS5A 4QP4A 3FLWA 5DE2A 2H96A 3WF6A 2YCSA 4R3RA 1OKYA 4P5QA 4F0GA 4QP3A 5IZFA 2HWOA 3MH2A 2C6LA 3W2OA 3Q52A 2BPMA 4CFWA 4D0WA 4CLJA 5CSWA 3FKOA 3E88A 5HTIA 2QU6A 4RBLA 3S2PA 4QTEA 1V0OA 3WE8A 1LR4A 3CY3A 4ZSLA 2ONLA 3PVBA 5A6OA 1JPAA 3BU5A 2ZB0A 5KX8A 3ZC6A 3D5VA 4UX9A 1GIIA 3ELJA 2UW4A 2GQSA 4J8NA 3L9NA 4TT7A 4RIXA 4RWLA 3PP1A 1TVOA 2ITPA 1Q8YA 4UMQA 4GCJA 3PPKA 5CENA 5BYYA 4L45A 4GG5A 5HU9A 5K5NA 3HAVA 1OIQA 4FT7A 2YJRA 4BDIA 1CKIA 4BBFA 4C4JA 4O7ZA 1FPUA 4F0IA 3EQFA 5KMKA 2F2UA 4LYNA 5AAGA 1SVHA 3HV7A 4JT3A 4LOQA 4B9DA 4HVSA 3ORKA 5JRQA 2PUPA 5JN2A 5HQ0A 3RHKA 2C6KA 5ANDA 3PE2A 3FMLA 5DR9A 4Y72A 2ZV8A 3WZDA 5AR2A 4Q2AA 2HK5A 5I3RA 3BQCA 3BHVA 3P78A 4GEOA 2UW5A 2QR7A 1H1PA 3GOKA 3NEWA 4H1JA 3UQGA 4CYIA 3HZTA 3LW0A 5TT7A 3U6IA 3QXOA 3G5DA 3ZEPA 1WBWA 5E8WA 5JGAA 2VTJA 5C9CA 3RCJA 3V8SA 4W9WA 2BHEA 4YJQA 3WF7A 4ANQA 3BV2A 3AMBA 4JDHA 4USFA 1B39A 5AA8A 3SHEA 4TYGA 4JQEA 2EU9A 2UV2A 3OOGA 3ZFXA 3SRVA 4L00A 2FO0A 5G1XA 5L8KA 5HD4A 3QA8A 2EUFB 2VN9A 2GQGA 3UYTA 3VUTA 3LHJA 2BDJA 4CFNA 4D4VA 2RIOA 1OL1A 1QL6A 3FMMA 5JFWA 4HYHA 2HIWA 2P3GX 3UO5A 4CGAA 4I6HA 3LLTA 5ANGA 3RPOA 3A8XA 5B2LA 4IVDA 4IM0A 3IKAA 2YA9A 3Q4CA 2C4GA 3QYWA 3EOCA 5CI7A 2J0IA 3MBLA 4QQCA 2ITWA 3CTQA 5JMSA 2X7FA 4RX5A 3DT1A 4PTEA 4ANOA 3SXRA 4KS8A 3QUPA 4AP7A 2J6MA 2QQ7A 3CPBA 3EFKA 3DKGA 5H9BA 5CQUA 2Z7LA 3KL8A 2IVUA 4GMYA 3FJQE 4N6YA 4JNWA 4BZDA 1H27A 3C4EA 4BBMA 5LVOA 4MXZA 5DFPA 4U44A 3BRBA 2OF4A 2PPQA 3OCSA 4I5CA 2PE2A 3GQIA 1I44A 3TZ9A 4NM3A 1YKRA 3QL8A 4RX9A 4WG4A 5E1EA 2OU7A 3FHRA 5IQDA 5EM8A 5BUIA 5IU2A 2XNPA 3DJ5A 3DBFA 5JH6A 3Q2JA 2ZM3A 4LL5A 5ANKA 4YZCA 2PVRA 4DC2A 4XYFA 3DLSA 4GKIA 4ITIA 4A4XA 3DY7A 5DRDA 5E8ZA 3PJCA 2CDZA 3NR9A 3ORXA 4MAOA 4BI0A 4ZTNA 2PUNA 1URWA 2FSMX 4W4VA 2GS7A 5A46A 4FVPA 3RAHA 3TUDA 4AF3A 3D2IA 3ZRMA 4A06A 3PVWA 5A3XA 5I9VA 2BRBA 4ALVA 1W7HA 5CEMA 3A4PA 4UZDA 1ZYJA 3NUAA 3C5UA 3BZ3A 2CGVA 3NUYA 1OGUA 2OXXA 3PUPA 1FMKA 4CKRA 1MQBA 5DVRA 5CF5A 1YOLA 3UVRA 3QTXA 5IKWA 3HMPA 3D14A 3R2YA 3R8LA 2OF2A 4O1PA 3R04A 2HZ4A 2OKRA 4F7SA 3ZONA 1VYWA 2W06A 4RVLA 2WELA 4IX4A 3VS7A 2XA4A 2FVDA 5DH3A 3GFEA 4O84A 5E8YA 4HNIA 3Q5ZA 2I7QA 3EIDA 5HE0A 3DA6A 4MXAA 4TYIA 4FTNA 3DFCB 3H0ZA 1UU9A 1VZOA 3ZSHA 4M8TA 5CU2A 3VWAA 3SXFA 4QPMA 5IMEA 3EKKA 3M42A 2WB8A 5KE0A 2ITQA 5C8MA 5C26A 5ANJA 4YTIA 2YM4A 3GXLA 4L9IA 3ZO3A 4DEIA 2R9SA 4X3JA 1RQQA 3F6XA 2UW3A 3ROYA 3ALNA 3PIXA 3H30A 3DTWA 3EQRA 4PNKA 1Q8UA 4WRGA 1AD5A 3ZXTA 4EBVA 4EOSA 2C6EA 3EWHA 3TT0A 3RK5A 1L3RE 2BCJA 2X9EA 3R8UA 5HZNA 4P7EA 2P2IA 4NSTA 4RPVA 4ZJIA 3ZOSA 4Y95A 3WE4A 4ERKA 2J0JA 2WZJA 2DYLA 5BMMA 4G6LA 4O0VA 4FKTA 4WNMA 4DF3A 4KAOA 1ZMWA 4E26A 1OL2A 4DGNA 1WVYA 4XG4A 1YRPA 3A7FA 2R3MA 4O2PA 5GIOE 4FTKA 3U8WA 4FSYA 3HLLA 4GFMA 4O0SA 2VV9A 2XKFA 4PDOA 1P2AA 3AT4A 2PMIA 4I4FA 3HA6A 3VNTA 5B2MA 1OPLA 3PSCA 2C5YA 3RBWA 3LFFA 2OJIA 3AC3A 2W1GA 5AX3A 4JJRA 4AS0A 4CFUA 5KO1A 1J7LA 1E1VA 3CGOA 5ETCA 1M2QA 4OT5A 3VQUA 2V5QA 4OTQA 4FTOA 4RJ4A 4CRSA 2GFSA 4EUTA 4HVDA 4R77A 2PZ5A 3NCGA 2Y4PA 3BPRA 3LFSA 2Z7RA 3PXQA 4LGGA 4R5YA 4DYMA 4X2JA 3DDQA 4EWQA 4FMQA 5LCJA 3PLAE 3S95A 4QMOA 4G2FA 4TKSA 2QC6A 4O81A 1Y8GA 5B7VA 4H1MA 1YXXA 3FZ1A 3HA8A 4WT6A 4USEA 4Z3VA 5KMJA 4RVKA 4CKJA 2WMAA 3OBJA 5DT3A 5FWKK 4FTLA 3LXKA 4WUAA 2AYPA 2VGPA 3EH9A 3QTUA 5CVHA 4CKIA 4EH4A 3ACJA 4PP9A 2OZAA 3LPBA 4CCUA 4KSQA 4GYIA 1PY5A 3KULA 4GG7A 3FXXA 3RP9A 5A4CA 2UZDA 3GCVA 1P4FA 3CXWA 4JR3A 3MH0A 5CEIA 3R7IA 3EL8A 3KC3A 4IVAA 2UZEA 4XV9A 2QODA 2JEDA 2YJSA 3COHA 4G3CA 4MQ2A 3PG1A 1YXTA 3TV6A 3UZTA 2R5TA 4YJUA 2G2HA 3LJ2A 4W8DA 3O71A 3UPZA 4EHGA 4I5HA 3QTSA 2XB7A 5F94A 4IACA 3IDBA 4BHNA 4ACMA 4QYHA 4UYNA 2YM8A 2Z2WA 4KNBA 5HNGA 3L9PA 2PVFA 2YLFA 3FE3A 4Z9LA 1ZOGA 2YHVA 3C4XA 3EMGA 3GNIB 3PA4A 1GY3A 4IZ7A 3FI4A 4ASEA 4JR7A 4G9CA 3WYYA 1OECA 4QMSA 4B0GA 3DTCA 3GEQA 2BILB 4C4IA 4DG3E 4R7IA 5CU6A 1KE7A 1OZ1A 3EN9A 4O0RA 4APCA 4AQCA 3MB7A 4PMSA 3ZUUA 3C5IA 4GUEA 4N57A 4IM2A 3BU3A 4P4CA 3UG1A 1PKDA 2C5OA 3R1QA 5EM6A 5T68A 3LMHA 3QZGA 4FVQA 4W8EA 3SW7A 2PMLX 4G5JA 1UKHA 5HE3A 3LFDA 3F2NA 3F9NA 4NYEA 3PY1A 3VF8A 4C58A 1EH4A 2WKMA 3OXIA 1PMNA 1XBCA 3OW3A 1T46A 4FV1A 4JAJA 4H05A 1A9UA 4AOJA 3LAUA 3HDMA 1JVPP 4WG3A 5EDQA 2XMYA 4FK3A 1HOWA 1G3NA 4O6EA 4EH8A 3W55A 4IJPA 4NM5A 4FSWA 4O7SA 5AJQA 4FEUA 3PP0A 1VEBA 3F7ZA 4FZ7A 3MVLA 4F70A 4XNEA 2OK1A 4RZWA 2J5FA 4OBQA 5C27A 2W1FA 5J9LA 1FOTA 4ZTRA 4O7YA 3TDWA 3F3TA 2P4IA 3PVUA 2OJ9A 2F2CB 4FNYA 4FV2A 1FBNA 2OIBA 4IAFA 4GKHA 1H25A 5EFQA 3ZZEA 2C5XA 4LGDA 2Y6OA 2G2IA 2R3LA 5L6PA 4UMRA 2HXQA 1RW8A 4ASXA 4AE6A 2IW9A 4ACCA 3OCTA 4CFVA 3P08A 2SRCA 3FUPA 4FT5A 2JKOA 3R7VA 3TL8A 3UQCA 1S9IA 4C2WA 2E9VA 2R3JA 2BZHB 3O17A 4KKHA 4NKSA 5KZIA 2WO6A 3MA3A 1J1CA 5EHLA 4ASZA 2CPKE 4RJ6A 2BFXA 1KWPA 4LMUA 5J95A 4LL0A 2X6DA 2BFYA 2W5BA 2XNEA 3BELA 5GJDA 1J7IA 4C2VA 5HHWA 3R8ZA 2OXYA 3VJOA 1OBDA 4FTCA 4LUEA 4S30A 2WMTA 3MY1A 2XJ2A 4XV1A 3ZHPC 4QQTA 5KMNA 1NVRA 3A8WA 2NNWB 1Q3DA 2J4ZA 5HD7A 4FG7A 4NW5A 4HGLA 3SAYA 3NNVA 4L3LA 4F1MA 1WVXA 2BIKB 4Y83A 5IA0A 5AFVA 4F4PA 4L3PA 2WFYA 2BZKB 3ITZA 5AV0A 4XBRA 4TW9A 5HTCA 2PZYA 4PPCA 3OUKA 4R7HA 2XEYA 2VU3A 3QTRA 4QYFA 3E3BX 5CZHA 1NXKA 1WBOA 2DQ7X 4R78A 2QU5A 4BZOA 3ANRA 5L3AA 4E6AA 3LCOA 4AWIA 4EK5A 4LFIA 2PL0A 1Y6AA 4FKSA 5K0KA 3ZYAA 2P2HA 2R3RA 3P86A 2BAJA 1Q3WA 3K5VA 5LCKA 4QMQA 4D2SA 4FUXA 2XH5A 3QCYA 3PWDA 4AU8A 1YI6A 2XUUA 4YJVA 3GUBA 4GJ2A 3FC1X 3S00A 1BI7A 3MH3A 1P14A 4RIOA 4YLJA 4IFCA 2C6TA 4OT6A 4E4NA 3U9NA 3W2CA 4R1VA 3UE4A 4JDKA 1M7QA 3THBA 4XLVA 3TJCA 1JNKA 2F7XE 4M68A 3O0GA 4NEUA 1E9HA 3E92A 3I60A 1U4DA 2G9XA 2OWBA 1LEWA 1Q8WA 3BLRA 3L1SA 2FSLX 2G01A 2ZYBA 4I20A 2IZTA 3ULIA 5EI6A 3MS9A 3QX2A 5J8IA 4WKQA 2XKEA 2QHNA 4QMTA 4QPSA 2XNGA 3VS6A 3QYZA 2OZOA 5EKNA 2QURA 5EYMA 5AV1A 3L8XA 3I0OA 3H3CA 3PVGA 2C6MA 3UP2A 4UBAA 3F5UA 2W0JA 3C7QA 3NIEA 3A7GA 1Q61A 3QKMA 4GSBA 3VF9A 1FVVA 3IDCA 3ZSGA 3L9MA 5L2TA 4G34A 2EB2A 3MI9A 4LQMA 4RLLA 3PFQA 3DDPA 3Q9ZA 5HNIX 3KXHA 1H1WA 2EXCX 4D1ZA 4DH8A 4D4YA 5HLWA 5IPJA 1A06A 3V5QA 4BB4A 3POOA 3QRJA 4FUYA 4FZFB 4AUAA 3UDBA 5AM6A 5EW9A 4FIFA 4ZTLA 4QP2A 3AD6A 4OUCA 3TKIA 4EH2A 4O2ZA 3KREA 4C3PA 4IAZA 1PMVA 1XH9A 5ACBC 2J7TA 5M4FA 3QZFA 3KK9A 3H9FA 1MQ4A 4I93A 1OMWA 2R3GA 4DTKA 4JLCA 2R3KA 1IG1A 4Z16A 4XV2A 5BUJA 4FTUA 3DXQA 4WRSA 3BBWA 3EQGA 3TZ8A 3F5GA 4NM7A 2OFVA 2C6DA 5BNJA 3BE9A 3MGYA 1Q97A 2EVAA 2UZVA 1XH6A 2IVVA 2F49A 4FKIA 4FTIA 4K77A 5FBOA 3VJNA 4BDKA 5A14A 2ZAZA 5LVMA 3IDPA 3ATSA 2OJFE 3KXGA 3DKOA 4APPA 4TNDA 3ATTA 3BU6A 2R3HA 1S9JA 3GU8A 4DEGA 4DA5A 1CMKE 1K9AA 4K11A 4I92A 2XBJA 4ZP5A 2G2FA 4CYJA 4MYGA 2CNQA 5GJFA 4XP3A 4BKJA 2WMQA 4AACA 3LCTA 4F7LA 2UZLA 4RFYA 2X7GA 5KZ0A 4UMTA 3W8LA 3HV3A 5M57A 1G8AA 3TKUA 4N4SA 3MDYA 3VVHA 4R3CA 4GUBA 4LM5A 3ET7A 4O7WA 2C30A 2GFCA 5DYJA 1UNGA 2YAKA 3MSSA 3CD8A 2OBJA 2XEZA 3QTIA 4FT0A 4ZY6A 5I9YA 4I21A 4GT3A 1OI9A 2BTSA 2XCHA 3F88A 5FXQA 4AGDA 2C3LA 5B0XA 5CSPA 4BCFA 1NW1A 3DFAA 4FIEA 3GC0A 3P7AA 5DEWA 4EUUA 5J79A 5M51A 5M56A 5F9EA 2X8EA 4ANBA 4HCUA 3SGCA 2R7BA 3FEGA 2A0CX 4NKAA 4E73A 3FLYA 3LKMA 2E9NA 2V7AA 4F1OA 4MD9E 5FXRA 2PTKA 3EYHA 2XK8A 5HBJA 4RJ3A 5H8EA 4X7QA 5HU3A 2VTMA 5GJGA 2F9GA 4BRXA 4YURA 4J71A 2BZJA 4WSQA 5AEPA 3ZSIA 3FC2A 3FSKA 4X6QC 4ZOGA 4E8AA 2PYWA 4FE2A 2ACXA 4IC7A 4MBLA 3Q60A 4XHKB 5JZJA 4AOTA 4C36A 4I0RA 2W96B 5CU0A 4NK9A 4EOLA 3BLQA 3FHIA 3HKOA 5D11A 5A4EA 5BVOA 1Q41A 5JRSA 4I22A 4O0XA 4UMPA 4HGTA 5EI8A 1ERKA 3OT8A 4JRVA 4RQKA 2ETKA 3CBLA 5E8SA 1VR2A 2PE1A 4HCVA 5CU4A 3KN6A 3FMEA 3SW4A 2B4SB 4S33A 4CFXA 4F65A 4BCNA 3KVXA 4U3YA 4YHTA 4S32A 4WIHA 5CNOA 3QHWA 4E4XA 4J8MA 2QOOA 4AT4A 4KIKB 5CSXA 4BCPA 1ZARA 4FTAA 4FTQA 4MBJA 4IZ5A 2PVMA 3OMVA 1PXNA 3R9RA 1R1WA 2BIYA 4IQ6A 4M69B 2GQRA 4GVJA 5AUXA 3IPHA 3W8QA 4ZSJA 4EHEA 4CZUA 3TDVA 4EH7A 5CWZA 2ITXA 2VRXA 3AQVA 3R71A 3NUSA 4F63A 2GMXA 1V0BA 2X81A 3QXPA 2YCFA 3OTVA 3PA5A 4J97A 2OG8A 5HORA 4AX8A 5AR7A 1V0PA 3FZTA 4J95A 2QHMA 4OTWA 3QALE 3ERKA 3NWWA 4O7LA 3UYSA 2JKKA 4XRJA 2QOQA 4M0YA 3A2CA 3K2LA 1W0XC 2JC6A 2OO8X 4FTTA 2ZJWA 1PW2A 4XMOA 3E8EA 3T3VA 4E5BA 4BI2A 3Q96A 4I5PA 3UBDA 4E20A 2WQOA 3U6HA 3V3VA 4IX5A 1DM2A 4EC9A 3W16A 3TUCA 2CN5A
chains in the Genus database with same CATH superfamily
5AADA 1XHAA 3AGMA 1Y57A 3CQWA 4AW0A 1PKGA 3AD4A 3FQEA 4L7SA 4O4FA 4CFFA 3QD4A 1P4OA 5DNRA 4RIYB 2Q83A 3BLAA 3BQRA 3ACKA 4JBVA 1U5RA 1XBAA 5EG3A 2ITVA 3DK7A 3OW4A 4FYOA 3RM7A 4X21A 2X1NA 3BE2A 3NYXA 4O4DA 5JT2A 5LVPA 1LEZA 2GTNA 4NCTC 3T9IA 4A9RA 3ID6C 4RWIA 5CVGA 2JKMA 3QCSA 2A1AB 3KA0A 4C8BA 4CD0A 3PYYA 1YDRE 4I6QA 3A7IA 4O91A 2CKPA 2IWIA 3GB2A 5BVEA 2X4ZA 4AW5A 3UOHA 4TNBA 3W0RA 3FXZA 1E1XA 4EH3A 5HTBA 3ZMMA 5KNJA 3CD3A 4IEBA 1SNUA 2CJMA 4G6OA 1OIYA 2XIKA 5TF9A 4EZ7A 4YBKA 2J0MB 3TCPA 4YP8A 3PRFA 2EXEA 3W18A 4EH5A 2BHHA 4DG2E 3QF9A 5JGBA 5CASA 1JQHA 2Z8CA 4C0TA 2PWLA 4FTMA 4BIBA 3C0GA 3QC9A 3ZUTA 1YHWA 4TY1A 3LOKA 1IR3A 4M12A 2PY3A 1U54B 5AR3A 3TZ7A 3AC2A 3LZBA 2XK9A 4EOQA 3BI6A 3JY0A 5IQEA 2ZOQA 3FLNC 4GU9A 4A9SA 4YUQA 5FTGA 4FGBA 2AQXA 5FDXA 4AGCA 1TQMA 3G33A 4D4RA 3GCSA 3MVJA 3H10A 4RC4A 3PXRA 2F7EE 1PXKA 4Q5EA 5DOSA 5EH0A 1XJDA 2IZUA 2WMUA 4U81A 3VBWA 4E5AX 3KXMA 1YOMA 1YXVA 2JFLA 1NVSA 5EQYA 4FT9A 2QOHA 2BZIB 4YU2A 4MNEB 2EXMA 1XWSA 2O63A 2OH4A 1PXLA 3BCEA 2V0DA 5AUYA 1W82A 4DEDA 4Z7HA 5KUPA 2IW8A 3CQUA 3O51A 1RE8A 4RMZA 3U51A 2EWAA 3HNGA 3VBTA 2JITA 1BUHA 3KXZA 2ITZA 3BYSA 3II5A 5EW3A 3UMXA 5CAPA 4I1ZA 4FV5A 2I40A 4C3RA 3TNPC 1YOJA 3O7LB 5E8VA 1GNGA 2BMCA 2WOUA 3MWUA 4TPTA 4AZTA 4F0FA 4BWKA 2Y0AA 3GFWA 4KIKA 1OPJA 5IQGA 4MHAA 4Y8DA 5AIRA 4UXQA 4B4LA 4IB5A 4L44A 4QTDA 5AP2A 2FYSA 2OJJA 3HUBA 5CXZA 1F3MC 5IF1A 3QC4A 5C4KA 5T3QA 4RJ5A 2YM5A 4L46A 3U4UA 5IA4A 2YIRA 5HVYA 3OVVA 4G3GA 5AP3A 2W7XA 3LFCA 4FF8A 1QPJA 5JEBA 4JG8A 5K3YA 2PZPA 3NUNA 3MVMA 3KCFA 5FTOA 1SVGA 3OY3A 1UKIA 5EM5A 2PZIA 1JSTA 3FI3A 3CTHA 3O8TA 3TIYA 5A4TA 3VHEA 2AEGA 3DK6A 1SYKA 3NAYA 3V5TA 1U59A 4I3ZA 2VWBA 4QYYA 2YM6A 4EYMA 1YWNA 3I0QA 2WMXA 1B6CB 4NJDA 3LFAA 3ZCLA 4DDGA 3IW7A 2YDKA 1UWJA 2RGPA 4JVGA 5LMKC 3OXTA 2J9MA 2ZM4A 3BHTA 4MX9A 3TTIA 2HELA 5HE1A 5TE0A 4ZSGA 5A4LA 1H0VA 4EI4A 5FUTA 2VAGA 5DMZA 3KQ7A 1ZYSA 2UZOA 2XIRA 3LMGA 5ANIA 4F6SA 5CF6A 2YDIA 3VUKA 2IN6A 3VUIA 3UTOA 2B55A 4FKWA 4U3ZA 2X39A 4OW8A 5CF4A 4IX6A 5GNKA 5IH6A 2E2BA 4A9TA 4DGGA 1G8SA 5EQEA 4BCJA 4K9YA 3GVUA 3M11A 1ATPE 3FSFA 4IMYA 4AA0A 4BCMA 3V6RA 3FQSA 3VS2A 4V01A 3GU6A 1FGKA 4TN6A 5KMIA 3HMMA 5IDPA 3PXKA 2X0GA 4PY1A 4CTCA 4WSYA 1H07A 4P90A 4YTCA 5L2SA 4O0YA 4YPSA 3CKWA 4Q9SA 3AC8A 4QRCA 3TIZA 4E6DA 4FJVA 4KUJA 4ASDA 4DDIA 1M52A 4C62A 2WTWA 3EFWA 3IGGA 4KA3A 4ACGA 3S1HA 2VWZA 3LXLA 3BYVA 4FKQA 4QP7A 2X2MA 4V05A 2C0TA 3R2BA 3HRBA 4FRFA 3V5JA 4A4LA 5M4CA 2HAKA 2XS0A 1UV5A 1RDQE 4PMPA 5IQBA 5CAQA 3IECA 3Q6WA 3WARA 4CMOA 4CZTA 4ZJVA 1CKPA 4NH1A 1YHVA 4FZAB 4QMNA 3QAME 4XG8A 2WMBA 2W05A 5DGZA 1GZOA 2H8HA 1Y6BA 1HCLA 2C6OA 3E63A 2QI8A 3HV6A 3NRMA 3C0IA 2REIA 3T3UA 4DEBA 5GHVA 1YDTE 1AGWA 2GPHA 3C9WA 3DB6A 5EM7A 5LARA 4BFMA 4E5WA 1W83A 3IO7A 5DEYA 4HPTE 3CE3A 3W2SA 3FYKX 4IZYA 2JIIA 5EW8A 5FP6A 5A4QA 2UUEA 2QR8A 3G0EA 3NAXA 4ZZOA 5IG1A 5IISA 5LMBA 1X8BA 3UP7A 2J2IB 3NCZA 3UOLA 4K18A 4XLIA 4ZTHA 4FKOA 1ZLTA 3D9VA 5L6WL 3TI1A 4IVBA 2ITNA 3UNJA 5ICPA 2VWUA 1NA7A 4EONA 3QQFA 3R00A 4OTIA 4RC3A 4E6CA 4XS2A 2JAMA 5CT0A 3UDTA 4CSVA 3PZHA 4XUFA 3O2MA 4F7JA 2JDTA 3C4ZA 4C4GA 5IUHA 3BX5A 5H2UA 3KN5A 3KRLA 4LRMA 5CS6A 3EFJA 2OXDA 3PIZA 4MXOA 4UN0C 1ND4A 1OB3A 4LV7A 2JLDA 3HRCA 3RALA 4V0GA 4GT5A 4ZY4A 4AT5A 5FLFA 5LOHA 5JZNA 4WA9A 2W1HA 2BKZA 4R6VA 3VBQA 4G3EA 5A9UA 4MVFA 3G6GA 2PE0A 2YEXA 1ZMVA 3NNXA 3OP5A 4JL9A 4YHJA 3W32A 3LCKA 4AN3A 5IMXA 5IEVA 3QQGA 4BCGA 2WQMA 4IIRA 1JKTA 1Y8YA 4C61A 3ODYX 3Q53A 3CGFA 1WBTA 3HMNA 4IANA 4JOAA 4QP8A 5ANEA 3HL7A 2A98A 5EOLA 3OWJA 3MN3A 4FSZA 4U7ZA 5HOAA 3AT2A 2GU8A 3F66A 1LP4A 1YDSE 5CU3A 3ETAA 4IM3A 3ZDIA 4DEHA 4QQJA 5LJJA 4C38A 4R8QA 3IOKA 3GC7A 3ORLA 4QNAA 4U8ZA 3POZA 4AXAA 3AKJA 2VO3A 2WEIA 4WD5A 3ZLSA 4TRLA 5LMAA 1G8JA 4HVIA 5CSHA 3GQLA 3QRIA 3P7CA 2WEVA 5JK3A 4GIIA 2ZB1A 2YAAA 3LXPA 5DN3A 4QP6A 3CKXA 1AQ1A 2GNHA 3K3IA 4D5HA 2WMVA 3E7OA 2ZV7A 4D2WA 4NL0A 4FSQA 3VS3A 4NZWB 5G6VA 3ZO2A 3NW6A 4FG8A 4AXFA 1WBNA 3IW5A 1J3HA 1H24A 4Q9ZA 3CSVA 2YIYA 4YHFA 1BLXA 3EZVA 5EHYA 2UW9A 3UC4A 5GZ8A 1OIUA 3QTWA 5D1JA 2CN8A 1XBBA 3RWQA 3R1SA 1BL7A 4U43A 1DI8A 4DCEA 3C4CA 4BR3A 1YXSA 2X6EA 3PWYA 4FKGA 2JFMA 3R8MA 4AFJA 3HUCA 4O0TA 1QMZA 2XK3A 2R3OA 1GZ8A 2LGCA 4YZNA 2JDVA 3QGYA 5BVWA 4YO4A 2WHBA 4J7BA 4OBOA 4X2FA 2VWYA 4ZJJA 4U79A 4EK6A 4DAWA 2C6IA 3NNUA 4BC6A 1ZYCA 1TQIA 2WTJA 4N0SA 2VTLA 3UZRA 5FP5A 2O5KA 5IDNA 2ZMDA 4RSSA 4XOYA 3MTLA 4YGAA 5FGKA 1KV1A 4PF4A 5LVLA 5HCYA 4FV8A 3R83A 3H9OA 4IWQA 4BYIA 5LWMA 4X6RA 3KVWA 4MF1A 3JVRA 3O7LD 4BZNA 4IWOA 4X2KA 1XR1A 4F6UA 1BI8A 4WNKA 1R78A 3WZUA 4FKPA 3ULZA 4KABA 3OWPA 4WOVA 4W9XA 2C5NA 3DKCA 5E91A 3SKCA 4E3CA 4O82A 3ZUVA 1ZRZA 5HG5A 3GC8A 3OCGA 3GENA 5IQFA 2GSFA 4O83A 3SOCA 2QO9A 4GJ3A 4KB8A 5IEYA 3IONA 4ALUA 2QCSA 5ACKA 5C4LA 4F08A 5JQ8A 4QMXA 3UNZA 3SX9A 2P55A 5HI2A 4KIOA 1WBSA 1P5EA 4PDYA 2V22A 2PK9A 4Q5HA 4BGGA 5J5TA 3ML1A 2Q0NA 2W5HA 4UYAA 4WUNA 4RG0A 2O0UA 4WO5A 3FXWA 4NT4A 4U40A 4KRDA 2B9IA 3TG1A 3WILA 3V5LA 3MB6A 5IUGA 1R0PA 5KBQA 2OFUA 3KXNA 3QZHA 4RJ8A 1JAMA 1XKKA 4YZBA 4QO9A 4CV8A 1ZMUA 4KIQA 3OZ6A 3ZBFA 1W98A 5BQ0A 5GINE 4CQGA 3CPCA 3KK8A 5HKMA 4BTKA 4EQUA 5E9EA 2FH9A 2YDJA 4KIPA 4BHZA 4FK6A 4GYGA 3LXNA 3MVHA 2JIUA 1J7UA 2W4JA 5HIDA 2O2UA 3FLQA 3P79A 3R1YA 5CVFA 3WF9A 3BEGA 4YJSA 4YPDA 3F3UA 4TZRA 1PYXA 1YWVA 3IOPA 2C0OA 1F0QA 3FYJX 4JG7A 3FMJA 2QVSE 2GHGA 2A27A 4QMZA 2GNFA 2VWIA 3W2QA 4ITJA 4Z7GA 2R0IA 3V8WA 5HBEA 3I6WA 2UZNA 4EOPA 2XK4A 4DFNA 4O4EA 4I0TA 5FEDA 3CS9A 3MY0A 4AT3A 1JLUE 2B7AA 3TM0A 4UWYA 4FSNA 5CT7A 4IWDA 4OTGA 3ZRKA 3UIUA 4IAYA 4F7NA 2WPAA 3IS5A 4FG9A 3ZH8A 3PJ8A 3KXXA 3T9TA 4BVUA 3S3IA 3FV8A 2CCIA 3R02A 3PJ1A 5HG7A 4CLIA 4EL9A 2CNVA 2PMNX 2Y7JA 1W2DA 4M66A 3R73A 3BGZA 4W4WA 5HLPA 3KMUA 3UC3A 5I0BA 4PP7A 5EYCA 4BDGA 3K5UA 2XNBA 4KKEA 3CTJA 3LQ5A 2B9JA 1ST4A 5IH4A 4O96A 4FKLA 3R9HA 4ITHA 3M1SA 3UNKA 1YHSA 3QCQA 3TACA 5DLSA 4RWKA 2FA2A 5AUTA 5LVNA 5BUEA 5TO8A 3TNWA 3CP9A 4QYEA 5ETFA 5L6OA 2HZ0A 3ZU7A 5TR6A 2F4JA 4USDA 4E7WA 1IA8A 2R64A 1UNLA 5HG8A 4F9AA 3BL9A 5HLNA 3ZS5A 5I9UA 3VAPA 3I5ZA 3KY2A 2DS1A 3KFAA 4GW8A 3WZJA 4O7VA 2UZBA 4Y85A 1JKSA 5ANOA 2E9OA 5FQDC 2UW6A 4YJRA 3E62A 4GS6A 4ANMA 5M4IA 3E93A 4F64A 4HVGA 4GK3A 3WF5A 4EH9A 3TJDA 2OH0E 5HICA 4ACHA 3I6UA 3QWKA 1M14A 3PLSA 2FGIA 4QMMA 2GNJA 2ETRA 4E6QA 2I0YA 5EOBA 2QLUA 4D58A 4P5ZA 2W4KA 3KMMA 4XJ0A 5A6NA 3ZM4A 4AXEA 4L53A 3MW1A 4CFMA 2QOFA 3EKNA 4K0YA 4IB3A 3IG7A 3DXPA 3U55A 3JY9A 2HYYA 4JX7A 4MTAA 4ARKA 4RWJA 3TV4A 3JVSA 3JPVA 4QOXA 4ANNA 2B54A 2WTKC 2G15A 3KRJA 3KU2A 3LLAA 4RJ7A 5C8KA 3AMAA 2G1TA 3BEAA 4DGMA 1H1SA 5AUZA 2R3PA 3Q6UA 4M84A 3MTFA 1OL5A 2HCKA 2VTHA 4JBQA 4UZHA 3RPSA 2B9HA 2VX0A 3COIA 5AM7A 1R3CA 2Y4IB 5AP6A 4EORA 3WBLA 4YNOA 2HENA 4WNOA 2X0QA 4QDEA 3U6JA 2X2KA 5KKRC 3Q4TA 4UY9A 4QPAA 3TN8A 2B53A 5HX6A 3TWJA 4LGHA 4MF0A 3PXYA 4V0GB 5FEEA 1TQPA 3DLZA 3EJ1A 2JBPA 4NM0A 4AW1A 2QG7A 5CZIA 4AGWA 4IH8A 4ONAA 3NVKI 3OHTA 3VO3A 1PJKA 3BYOA 4N70A 3D15A 2NO3A 2E9PA 2CGWA 4U80A 5AIKA 4PWNA 4CQEA 5C8NA 3RNYA 3WZEA 5I4NA 5LQFA 4ENYA 4ZXTA 2UVZA 5E92A 2YIXA 3DU8A 3EQIA 2V55A 2NP8A 1G5SA 4AZVA 2XNMA 3H9RA 5EKOA 5JQ5A 5D41A 3RZFA 3C4FA 5KMLA 1Q5KA 5GZ9A 4RLKA 5C01A 4BYJA 2NRUA 4BWXA 4M67A 1CTPE 4O22A 4QMPA 3O5AA 4U41A 1KSWA 3E7VA 5L8JA 2VGOA 3UGCA 4PDPA 4CZYB 5IA3A 1JKLA 1JWHA 2XJ0A 5L2IA 3R7UA 3R8PA 2V62A 3QTZA 5DRBA 5DWRA 5M09A 4F99A 3JS2A 1LPUA 4B99A 3OBGA 3WOWA 2ERZE 1XQZA 4FBXA 2Y8OA 3QQKA 3BHYA 3R21A 3KIOC 4D2VA 3DK3A 1QPDA 3DNEA 4MWIA 3ZBXA 4D9UA 3KRWA 5AA9A 5F4NA 5TKDA 2WTKB 3E5AA 4FGRA 1UNHA 1GAGA 5AAEA 4IDTA 2IF8A 5IA5A 3VRYA 4AA4A 2PVHA 2WU6A 3PY0A 1PXJA 2UZWE 3F2RA 4PV0A 4TWOA 5FD2A 4BKYA 2HWPA 5EHOA 1ZYDA 2YITA 4NIFA 4OTPA 4UV0A 2BRNA 1PXMA 4N6ZA 3P9JA 4LV8A 4RC2A 2I1MA 3ALOA 5AAFA 2IG7A 1IAHA 3IW6A 4GRBA 3SV0A 4JS8A 2ITTA 3QLFA 1Q24A 1UU3A 3ZFMA 4CVAA 4DH1A 2CLXA 5HO6A 2AC5A 4RT7A 1IA9A 4X2NA 3ORIA 4G6NA 5ETAA 4QNYA 4U42A 2AC3A 4M15A 4O7NA 1PF8A 5DR6A 3LMIA 4I0SA 4ID7A 3FZSA 4AOIA 3LVPA 3MIAA 3R7EA 4IBMA 2P33A 1PYEA 4IVCA 4DFBA 2H9VA 5JFXA 3LCDA 2GS6A 3NNWA 5ETIA 4JDJA 3G9NA 4BCOA 2WTDA 3DCVA 4L52A 3FI8A 3VONA 4ZS0A 3BV3A 4ZSEA 1KE5A 1NVQA 2OIDA 3HMOA 3KCKA 1BX6A 2C47A 2OGVA 2XVDA 3DZQA 4MXCA 3ZLYA 4EK3A 2ZM1A 3DBCA 3FMKA 4H58A 4JIKA 2PVJA 4D5KA 3B8RA 5AP7A 3NYOA 4RX8A 5CSVA 4IB1A 2A4LA 3DBQA 3F7WA 5JFSA 3V6SA 4MXXA 4ZZMA 2IJMA 3BL7A 3PRIA 4L01A 3GP0A 4A07A 3VW6A 2BAQA 2UVXA 3FMHA 4JG6A 1SVEA 2A2AA 2JD5A 3F2AA 4PDSA 4TXCA 3COMA 2VTIA 3G2FA 4JIAA 4L6QA 4OTDA 1Q8ZA 2X8DA 5HIBA 5CEKA 2GS2A 3DOGA 5ITAA 4J52A 4IXPA 4HGSA 2Z7SA 4K33A 4FV4A 3E8DA 2RF9A 2OW3A 4XG2A 3NW7A 1XH5A 1JSVA 2YISA 3ORMA 4FTRA 2C69A 4IJ9A 5D10A 2VTTA 4CT2A 4G5PA 1OL6A 5HO8A 3RCDA 4ZLOA 2OI4X 3FY2A 5AR5A 3MY5A 3ZZWA 4BDBA 4D1XA 5DPVA 2WQNA 4D9TA 5M53A 3KEXA 5H8GA 3HX4A 4JQ7A 4CT1A 1YW2A 4IC8A 3V5WA 1U5QA 2WQEA 3A4OX 4ENXA 3QA0A 4O21A 4M3QA 1Z9XA 4B8MA 5M06A 3D5XA 4NJ3A 2B52A 3G9LX 5D9HA 3HVCA 1H1QA 1WZYA 4QQ5A 2W4OA 4MH7A 3I7CA 4UMUA 4CG9A 3WIGA 4QTCA 3G0FA 4U6RA 2LAVA 4GIHA 2WTCA 1LUFA 5CQWA 1PHKA 4OR5A 5AP1A 4ZIMA 1FQ1B 2HOGA 1OL7A 2JDOA 4IW0A 3UIMA 4D2TA 4MKCA 3PXFA 2RFSA 2XCKA 3C50A 3R01A 1M7NA 4II5A 4RIWA 4V04A 4X3FB 5I9XA 3QD0A 4UWCA 4Y46A 3GU5A 1WFCA 2WTVA 3FL4A 3RGFA 3DS6A 1Y91A 5BPYA 3FL5A 2RG5A 2UW8A 4QMLA 4LRKA 3HAMA 4UEUA 3V01A 2WGJA 5CNNA 4XH6A 3C0HA 4U45A 4BDAA 2CGXA 3ZM9A 3SD0A 3QWJA 3W10A 3QHRA 5M4UA 3EB0A 4X3FC 3RNIA 2C3JA 2I6LA 2VO0A 3MFUA 3AKLA 3UO6A 5DG5A 1R0EA 2ITYA 5T6KA 3LFNA 2UZUE 4K2RA 2Y4IC 2YCQA 2BRMA 3P5JC 4WBOA 2R3QA 4C37A 2VX3A 4IAAA 1U46A 1OUKA 3OXZA 3RPVA 2VWWA 3RPRA 3L8VA 5AUWA 4PL4A 5KKRB 3PTGA 1SZMA 3TYKA 3F3VA 2W1ZA 3A7HA 1ZOEA 4M69A 5EDPA 4A7CA 4DE4A 4EQCA 4U5JA 2X4FA 4JRNA 4Z55A 3CQEA 4FSMA 1F5QA 3MFTA 4L8MA 4IE9A 3VS5A 1MRVA 4YC6A 3QLGA 3E8CA 1BKXA 4M13A 3C1XA 3N51A 3BBTB 4O7TA 1O6KA 2GHMA 4BDJA 4DCAA 4L3JA 3VUGA 4R5SA 4G9RA 5AUVA 3AT3A 2HW7A 2WMRA 3OTUA 5BYZA 4CMUA 2XRUA 2QKWB 2RFEA 1OKZA 3RKBA 4EHZA 1YVJA 2JAVA 4UXLA 1BYGA 1YI3A 4JAIA 4CXAA 4IAKA 3VRZA 4EKKA 5LMKA 3FPQA 4KBKA 1PRYA 2FSOX 3I4BA 2KULA 3NLBA 4OBPA 1H28A 1J91A 3P0MA 2XIYA 4C33A 2PUUA 3ZFYA 5AP4A 4GVAA 3PDTA 3VW8A 4FEVA 4FKVA 3U9CA 1OKVA 1GOLA 2XF0A 4GV1A 3ORTA 4C59A 2YFXA 2PULA 3Q9WA 5CANA 3UIXA 2CSNA 3OEZA 4HCTA 3Q04A 4P2KA 3N9XA 3CR0A 4MD8E 3REPA 4DITA 2DWBA 3ORZA 2QNJA 5FG8A 3P7BA 4IWPA 1UA2A 4BIEA 3FBVA 4WG5A 5EYKA 2YIWA 1HCKA 3NW5A 3FDNA 2IO6A 3MV5A 3GI3A 4RFMA 2XM8A 5DHJA 3RM6A 2B9FA 2V7OA 3BKBA 2ONLC 4A9YA 3DBDA 3OS3A 5GIPE 4W4YA 4BDHA 4OTFA 3RZBA 4BF2A 4FI1A 4E1ZA 1W8CA 5L2WA 4LI5A 3F3ZA 2YWPA 1BMKA 4IDVA 4AAAA 5AR8A 3V04A 1Q4LA 3GU4A 2W17A 2OICA 4QMUA 5J5SA 4F6WA 1OITA 2FUMA 3DQXA 2JKQA 2VD5A 3GT8A 3MA6A 5HCXA 3E87A 3W0NA 2R7IA 4YJPA 3FI2A 4XG3A 5E8XA 4S31A 5DT0A 5E90A 1R39A 4FR4A 4D28A 4PQNA 3UZPA 4YMJA 3A60A 3HMIA 1REKA 2YIQA 2IZSA 3RHXA 4FOCA 4QD6A 2YZAA 4S34A 4DH5A 3G15A 1XH8A 2X0OA 4BDCA 4BL1A 5AUUA 4RGJA 2B0QA 5HVKA 3DZOA 2QO2A 3CEKA 2HZNA 2WTIA 5JFVA 5B2KA 2WMSA 4CMTA 3QKLA 3S0OA 1OUYA 4Y5QA 3NMUF 3AGLA 5J1VA 3FZPA 3QFVA 4IHPA 4JBPA 4QP9A 5KHXA 4QTBA 3ZRLA 2VTRA 5AV4A 1H1RA 4YR8A 5BX0A 3QQHA 2XYUA 3QQUA 5I3OA 2VNWA 4OTRA 5DI1A 5L4QA 1OKWA 2CKEA 3UMWA 4NFNA 1FMOE 4MEDA 4KS7A 2QOKA 3EN5A 3C13A 3UDZA 2XALA 4RQVA 1ZAOA 1V1KA 3KULB 3S4QA 4OTHA 3SOAA 5K9IA 1OBGA 1QPCA 1SM2A 2VO7A 5AV2A 4C7TA 3O8UA 4L67A 2GNGA 1H00A 1M2RA 3DV3A 2BKKA 4DT8A 4PMTA 4NU1A 3ZC5A 1ZOHA 4I23A 4L7FA 3UJGA 4JBOA 3GC9A 3VULA 2VWXA 1KV2A 2Y9QA 3FLZA 4F78A 3A62A 1DI9A 4WNPA 2QOIA 4DHFA 5FBNC 4FIJA 4I24A 4EKLA 2IZRA 1VJYA 3MIYA 3L9LA 4IX3A 3FQHA 3QRUA 1CKJA 4DLJA 4ZS4A 2GTMA 4D2PA 4UB7A 3SC1A 1H01A 4ZZNA 3R9DA 2PZRA 3NUUA 4EH6A 4I6LA 4I6BA 2BTRA 1PMEA 4H36A 5FEQA 4IAIA 4L68A 5LWNA 2ZDTA 3EZRA 5IA2A 1YXUA 5HEZA 1GIJA 3QQLA 4C57A 2C1BA 3ZEWA 4G3DA 2VNYA 4TTHB 4K8AA 3ZXZA 5M44A 4BTJA 1FGIA 3I7BA 3HV4A 4FC0A 4DGLC 5HGIA 3RTPA 3O8PA 3VUDA 3QUDA 2W1DA 4RX7A 5KMOA 4E93A 1NT2A 4DFUA 5I5ZA 3DJ6A 2QG5A 5BMSA 3FY0A 2ZVAA 3CLYA 4UALA 5CAOA 1FVTA 2GCDA 3KF4A 4CCBA 3BYUA 1L8TA 3C4WA 1J1BA 2GNLA 3KRXA 4I41A 3CIKA 1KE6A 3ENMA 3OROA 4LOPA 3PE1A 3WZKA 4AG8A 3VIDA 4F9YA 4YC3A 1QPEA 2BRGA 2YCRA 4IB0A 1ZY4A 5AV3A 2XK6A 4BBEA 4BJJA 4PNIA 2QONA 5AMNA 2ERKA 4G3FA 5F1ZA 3R7OA 3D5UA 3DQWA 3PFYA 2P0CA 4E4LA 3FPMA 5BV3A 4C34A 1O6LA 4XG9A 4FNWA 4MWHA 3NIZA 5K0XA 4W4XA 2ITUA 3ANQA 3PZEA 4XG6A 4NW6A 5BVKA 1IAJA 4AZSA 3HDNA 4PRJA 2XNOA 5K4IA 2DUVA 4ZSAA 2OLCA 2RKUA 1I09A 5EDRA 4F9CA 2J90A 4MXYA 3EN7A 4RFZA 4YBJA 5IA1A 2C3KA 3HP5A 4YZMA 3E8NA 4C02A 3L8SA 2QOCA 3B2WA 4BTFA 3TNHA 4DEAA 3SVVA 4DINA 1VYZA 4QYGA 1WAKA 2C68A 3UQFA 4YLKA 4GFOA 3ZTXA 1H8FA 4EK8A 4DBNA 1KOAA 4PPAA 3LJ1A 1ZY5A 4QP1A 4XV3A 5EI2A 3SXSA 3QD3A 4O27B 4LDTA 4C35A 1GJOA 3C51A 3DBEA 4JI9A 5F95A 4ZLYA 2NPQA 5AR4A 3Q4ZA 3U54A 3GBZA 3ORNA 4M0ZA 2VZ6A 2PMOX 3W0OA 1ST0A 5FTQA 2C5VA 3O50A 4YSJA 5CF8A 2XM9A 3BLHA 2W1IA 3O96A 3P4KA 2UW7A 2XKDA 2HXLA 5BYLA 2VTAA 3MPAA 3Q9XA 3ZO1A 3EN4A 4QTAA 2J5EA 4A9UA 5HG9A 3MPMA 2YZLA 5E8UA 4O7RA 2R3FA 4RZVA 5CEQA 3FMDA 3VS4A 2VTPA 1K3AA 3BGQA 5LXMA 2YN8A 3WIKA 5CEPA 3NFGB 4EZ5A 4RIXB 4HYUA 1UU7A 4YO6A 4FOBA 2GNIA 5E4HA 2VTOA 4DFYA 1K2PA 3W33A 5CALA 5FM2A 5FDPA 3VHKA 3QX4A 1GZNA 1RJBA 2HY0A 4I4EA 4K1BA 4AXDA 2IEWA 4AZFA 3IW8A 2W1EA 1FVRA 4BCQA 3RPYA 2A19B 5H8BA 2O64A 4R7BA 5JGDA 3N4UA 4MNFA 2QLQA 1KE8A 3D7ZA 4YZDA 3QTQA 4IZAA 2UVYA 4O0WA 5DT4A 3V51A 3N4VA 2QOLA 1OPKA 3CJFA 4OAUC 3VUHA 3MESA 3OOMA 4FICA 1NY3A 3CC6A 3TKHA 1UWHA 1XO2B 4ANLA 4BWPA 1KE9A 4D0XA 4F9WA 4AGUA 4KSPA 4U97A 4AW2A 3MYGA 3V8TA 3QCXA 5KHWA 1B38A 3EQPA 5K5XA 4AXCA 3GGFA 4I94A 3RI1A 3OD6X 5JSMA 5AP5A 5J7BA 1WBPA 3LIJA 5IUIA 2C1AA 1ZWSA 2BR1A 4AAYA 3NYNA 4OLIA 3PY3A 4FNZA 4G16A 3EQCA 5L8LA 4DH3A 4FIGA 4DH7A 3OCBA 2YABA 2YERA 3FZOA