4IANA

Crystal structure of apo human prpf4b kinase domain
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
330
structure length
321
Chain Sequence
RVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLREVLKKYGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNESKTILKLCDFGSASHVADNDITPLVSRFYRAPEIIIGKSYDYGIDMWSVGCTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDREKVTVMSTINPTKDLLADLILPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Evaluation of Cancer Dependence and Druggability of PRP4 Kinase Using Cellular, Biochemical, and Structural Approaches.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PRP4 homolog
total genus 100
structure length 321
sequence length 330
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ianA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ianA01
2HWPA 3E3PA 3V6SA 4GKHA 4RX5A 4TNDA 3O23A 2PK9A 1X8BA 3DDQA 4IVCA 1FVVA 4YBKA 4ZY4A 1H1RA 2OXDA 2P2HA 4FG9A 3T9TA 4D2PA 3A8XA 4PL3A 4UWBA 4WSYA 4BIBA 2CGVA 4YJNA 1YWNA 3F61A 4CGAA 2G01A 3BHHA 2HENA 3U6JA 3C4WA 3V8SA 4ACGA 3FZTA 4EQCA 4FNZA 3QX4A 2W7XA 3UVPA 3SGCA 2X6DA 4WBOA 4AZFA 3MVJA 3COKA 4L67A 5L8KA 1YHWA 5J1WA 5HNIX 3BLHA 1IR3A 3AC8A 3PLAE 5A4CA 3ITZA 2GHMA 4JL9A 1M14A 3D2IA 2JDOA 4EOIA 3TZMA 5HBHA 4GJ2A 4MXZA 3TXOA 3KCFA 4RFMA 2X1NA 4PMMA 2X9FA 3V3VA 5CZIA 4AX8A 4EK6A 4CYJA 3ZYAA 5E9EA 4E5AX 2XK6A 3LAUA 4HNFA 4RVKA 3DXPA 4PRJA 3U8WA 3UJGA 2OF4A 5A4EA 5IF1A 1H0WA 3BKBA 3LJ2A 3QRUA 4IM2A 4M14A 4E1ZA 3BU6A 4A4LA 1WFCA 2BIKB 4NIFA 4ACHA 2PYWA 3ZM4A 2AYPA 1HOWA 2UZOA 2WAJA 5CU6A 5C4KA 3IDBA 3QYWA 4LGDA 4FK3A 1FMOE 2IZRA 2ZMDA 3EOCA 5KZIA 2EB3A 4YR8A 3DT1A 3EMGA 4NJ3A 3QZHA 4FZAB 4WG4A 2ZM4A 2VTOA 2F7EE 2ERZE 3PSBA 2YWPA 3L9MA 4BKYA 4FSNA 5EHOA 4JQ8A 2VU3A 5A14A 5KHWA 3LFQA 2KTYA 4I0TA 1K3AA 5E8VA 4FT3A 5AIKA 4AG8A 4YU2A 2X6EA 2C68A 4RWKA 1XH8A 5CQUA 5CEIA 3V5QA 1F3MC 4EH6A 4Y73A 3C0GA 4PMPA 4EWQA 3O8UA 3MVMA 2OZAA 3V8WA 3MV5A 3L9LA 3IQ7A 3W2QA 4DTBA 3PVWA 2WTDA 4FSWA 3ANRA 2CLXA 3SD0A 3HV6A 4FIJA 3WE4A 5EQEA 4L42A 5F1ZA 5BVKA 3Q4UA 3SW7A 3GCPA 2XCKA 3DLZA 4OLIA 5FP5A 5AIRA 1LPUA 4ZJJA 2R3HA 2RFNA 3LCKA 4JT3A 3MESA 1YXTA 4R5SA 4FUYA 2A27A 4EJNA 3U9CA 4BGQA 3UOHA 5AAFA 2QHMA 3C13A 5CI7A 4UBAA 4UYNA 4KIKB 4J71A 2V5QA 3EJ1A 2JEDA 3CC6A 4GUEA 5A54A 4XV2A 4WKQA 5J9ZA 1YXXA 3R8MA 2XM8A 3QALE 4M84A 4I23A 4EH4A 5IDNA 4M69B 4QPSA 2B1PA 2G2IA 3C7QA 2BHEA 3EN7A 3ZZWA 2R4BA 5M07A 4I6HA 2GFSA 4GIIA 5BUEA 3ZO2A 3LFCA 4I5MA 5EHLA 1V0PA 4NM3A 2HY81 5AUZA 4C35A 3ZLYA 3PFQA 3D5VA 4F9BA 2GQSA 4XH6A 5F4NA 3VULA 1F0QA 2G1TA 1CTPE 3Q52A 3TL8A 4F0GA 4FKLA 4MH7A 3OEZA 4RVTA 2BVAA 2VTIA 4E5WA 5B7VA 5ITAA 2JFLA 3E64A 4BI0A 1DM2A 2V7OA 4LGGA 5AP5A 2ACXA 5E1SA 4PNIA 4YO6A 3VAPA 4CZYB 3LFAA 4BCNA 4OGRA 3FY2A 4W8DA 2VZ6A 4KRDA 4ASZA 1TQMA 4ZJIA 3VS3A 3U6HA 3NW7A 1JVPP 4O2ZA 3NVKI 3P79A 1WVWA 2C3KA 1YXUA 4K77A 5BYLA 3MWUA 5AUXA 4X6RA 4G3CA 3PY1A 2PTKA 2BCJA 5B2LA 4D2RA 2WMUA 2QQ7A 3EQIA 1O6KA 4JDJA 1JSTA 3ETAA 3UQGA 3COMA 3P08A 3Q5ZA 3R1QA 3ZOSA 3QQFA 4I6BA 5M06A 2C0TA 4E7WA 1M52A 2I0HA 5ACKA 3RM6A 2W5BA 4UYAA 5HD4A 5LWMA 3R6XA 4G16A 5EW8A 4FSRA 2XH5A 3QC4A 1NVRA 3NIEA 4FI1A 4FSUA 5AR5A 3ULIA 3PRIA 2PHKA 3UMXA 2QI8A 4AZVA 3SG9A 5I9UA 5C8MA 3OW4A 4AT5A 3S95A 4HJOA 3M1SA 5AP1A 3HA6A 3V51A 3IW6A 1OKZA 1P4OA 3DBFA 1YOMA 1NA7A 3SHEA 1H26A 4JBPA 4BTFA 1WBOA 3QUPA 5AP4A 3UO6A 4CXAA 3TZ7A 4DH1A 4LOQA 4AGUA 3UOKA 5ACBC 4BDBA 4NKSA 2XNEA 4NW5A 4R5YA 4YZBA 2JD5A 5D10A 2QOBA 4RX9A 4PPCA 4EHEA 2JIUA 1REKA 3EZVA 4NCTC 4KNBA 2B9HA 2QOIA 2O8YA 2XIZA 5CAPA 4LQMA 4FOBA 3SG8A 2WKMA 2A19B 4FEUA 5C8KA 3REPA 2C47A 4FC0A 3GC0A 3FQHA 5IEVA 2OWBA 2UV2A 5FXQA 4N6YA 1WVYA 2YM8A 1NVSA 2JDSA 3OY1A 4RJ5A 3VQHA 3LMIA 2I40A 2HCKA 3EYGA 2NO3A 3IW8A 3MFTA 4MTAA 4RBLA 4A7CA 4O7VA 4NL0A 4BY9E 2ZV9A 3LCDA 2JAVA 4K6ZA 4TRLA 2VWXA 2XK9A 5DH3A 4FV3A 2HELA 3ERKA 5H3QA 4RWLA 4Y46A 3G15A 2V22A 3GCUA 2E9PA 5HG5A 1NW1A 4FEWA 2WMWA 1GIJA 3VQUA 3RAWA 3NYXA 5E7RA 2QOKA 3IGOA 4FNXA 2UUEA 3IW4A 4BDIA 1O9UA 4FKJA 3VBXA 3NNVA 4D4RA 4OAUC 4BCPA 1WBWA 3Q6UA 5DGZA 3I5NA 4IB1A 4PDOA 2F2UA 3HP5A 4FEVA 3OXTA 3QZGA 4Q9SA 1ERKA 4BCIA 5HNGA 3CY2A 1OVEA 2B55A 3V5TA 2OW3A 3F88A 3QFVA 5AUVA 4LRMA 4IWPA 3FJQE 3LPBA 4R3CA 5BYYA 1ZMVA 4KRCA 1XBBA 1OL5A 3QZIA 4O82A 2J2IB 5H8GA 4E93A 4NYEA 3GI3A 4L3JA 3VS1A 3B8RA 3F3UA 4JJRA 3UZRA 2IZSA 3NUXA 1K2PA 2PVNA 3PRFA 1S9IA 4DCAA 5AX3A 4BRXA 3CP9A 4QMXA 2NPQA 1XH9A 3NZ0A 3EQCA 4G6NA 3TTIA 4CD0A 2W9FB 4IW0A 3DXQA 2BILB 1OPKA 3TKUA 5L2SA 1REJA 1DI9A 4KIOA 2HYYA 3FHRA 4RJ3A 2R0IA 4PPAA 4A9SA 1PMEA 3M42A 4NFMA 1JSUA 2KULA 1SYKA 2WB8A 1Y57A 2UW3A 5T6KA 3RINA 3PSDA 3KXGA 3CTQA 4ZSEA 1Y8GA 5LCJA 3QGWA 3JVSA 2CKEA 2H6DA 2R3GA 1BMKA 4BWKA 4MWIA 1WZYA 2QHNA 3D9VA 4P5QA 4PP9A 3PJCA 1B38A 3TG1A 4BYJA 2DQ7X 3WZUA 2C5NA 3PDTA 1MRUA 2X2LA 5IQDA 1GZOA 3EL8A 1UKHA 3IDCA 4ZY5A 5CENA 4NM0A 2YCRA 3BYVA 5HOAA 4PQNA 2RKUA 4X7QA 2Z60A 3RM7A 3MSSA 3AC1A 3KA0A 4FSQA 4U42A 3RMFA 4P5ZA 4EH2A 5J9LA 5M57A 4CFXA 5CXZA 5A46A 4N0SA 3NAXA 4G3DA 4AGDA 3FMMA 5FM3A 4F6SA 3PTGA 1BI7A 3TWJA 2VTTA 4GU9A 3WF6A 2UZTA 4APCA 5IU2A 2ERKA 5E8SA 4XJ0A 4E8AA 4O96A 1FBNA 3R2YA 3WF7A 4B7TA 4YTHA 4WRSA 3NUNA 4JG6A 4TWCA 4D2SA 1G3NA 3NNXA 3MYGA 2XKDA 4H1MA 4ZLZA 4NM5A 4ZSJA 3RK9A 3S4QA 5A4TA 3HAMA 2X39A 4XP0A 4NSTA 2BZKB 3R01A 5K0XA 3BWJA 4V05A 2VGOA 4AGWA 2X8DA 4W4WA 3LCOA 4QTCA 2YM5A 3R71A 3OXIA 4K33A 5ANKA 1VEBA 3PSCA 5HIEA 3CY3A 3PY0A 5DNRA 4G2FA 5HCYA 5HU9A 3ORPA 4L7SA 3JR1A 1KWPA 4QQCA 4KABA 4BDAA 2OIQA 4GIHA 4M3QA 4J98A 5I9YA 4E4XA 5KMNA 2XB7A 4CTBA 3FLNC 2YJSA 1ATPE 4APPA 3R7EA 3H9OA 2UVZA 3MTFA 2P55A 3QXPA 2XKFA 4LL5A 5CNNA 5FD2A 3T3VA 1M2PA 3OY3A 4AAAA 3QKLA 4Q5HA 4DC2A 1SM2A 3TM0A 2QG5A 3ENHA 5C27A 4QP7A 4C2WA 3H3CA 3TDWA 3T3UA 4NKAA 2C1AA 4FTJA 1JNKA 3AC5A 2ZJWA 1FMKA 4QNAA 3E62A 2VUWA 4FVQA 4TT7A 3VUKA 5AP2A 2R7IA 3F7ZA 3ZXZA 4O7YA 4V01A 3JY9A 3OWJA 4XP2A 2C1BA 4CMTA 4FKIA 1Z9XA 2GNJA 1XR1A 4FIEA 3AD4A 1IAJA 3WARA 4C3PA 1H1WA 4H1JA 5KCVA 2B7AA 2F57A 1WCCA 1NT2A 3GU6A 3Q4ZA 2YABA 2ZDTA 3NS9A 2GS6A 1ZYSA 2BZJA 3GEQA 5LMAA 3HMIA 4BI2A 3A2CA 1R78A 3MJ1A 4MXYA 4AOJA 3W2OA 5GIPE 1M17A 3UYSA 3HMMA 2JC6A 4EZ3A 5KMIA 4C34A 4ANSA 5HVKA 4MXOA 3RPVA 3JUHA 4Q9ZA 4RVLA 1PXIA 4XHKB 5GZ9A 3O71A 5DEYA 1Y91A 4BTMA 4ALVA 1Q4LA 3U51A 4RIYB 2PU8A 3MIYA 2DWBA 5AP7A 4IJ9A 4YJVA 3TIYA 3W2SA 2YITA 4D2WA 5CXHA 4Z3VA 1IG1A 1YVJA 4XCUA 4YMJA 4IM0A 4AOTA 4BHZA 4RX7A 4DGOA 4QO9A 3BCEA 4U43A 1KOAA 2O5KA 2PL0A 4ZZOA 3CJFA 2Z7RA 3VS6A 2WIPA 4D2TA 4WT6A 1J1CA 2C69A 2GNHA 4LOOA 1PMUA 3OOGA 3DDPA 2PZ5A 2WOUA 3BX5A 5AMNA 5H9BA 1YDTE 2GNLA 2VWVA 4QMSA 2YCFA 5HO7A 4FICA 4FKTA 3KEXA 4J96A 4O7NA 4WHZA 2PVMA 4HYUA 3E8DA 2Q0BA 3WZEA 4D0WA 3MH0A 4DH8A 3VIDA 3RPRA 3LFDA 5CSWA 5CANA 1IA9A 4ORKA 1OL6A 4AQCA 2XIYA 2CJMA 3HUBA 4FKRA 5KMMA 2J5FA 3TV7A 2JDRA 2R64A 4M68A 3OCBA 4XEYA 3THBA 4Z7GA 3C0IA 5AV4A 3CE3A 3ROCA 5CVFA 1ZYJA 2WMBA 5M08A 3QU0A 4C4JA 5KO1A 2O65A 2YIWA 5IA3A 2VTRA 2RFDA 2XYNA 4J8MA 4BVUA 1L8TA 2YDKA 3CCNA 5FXSA 4KBCA 4F70A 3S0OA 4AFJA 3BV2A 5FUTA 3CXWA 1ZY4A 3PIZA 3NYVA 2J5EA 5EK7A 3SAYA 4FR4A 1S9JA 4NFNA 5M4FA 1Q62A 1URCA 3SC1A 4RWJA 4MAOA 2VO7A 5JGAA 4KIQA 4QMYA 2QO2A 4CLIA 3DTWA 2UVYA 4ZS4A 3ZUUA 4AZWA 4F7SA 5C01A 4QP8A 4EKKA 4I22A 3LM0A 2IW6A 3DKOA 1W0XC 1CKPA 4JBVA 4XG2A 5HD7A 3WYXA 2GFCA 4NU1A 1ZOHA 4BDEA 3BWFA 3OCGA 4EYJA 3MDYA 4FSYA 4ARKA 2WQMA 3U55A 3OT3A 3DB6A 5J7HA 2YM3A 3WZJA 4UMUA 5D12A 3UG1A 1YOLA 4L8MA 3UTOA 3ZBXA 2YAAA 4JLCA 4FT7A 2P3GX 3KC3A 4OTGA 5CSXA 3NCGA 4LRJA 3G2FA 2QU6A 3ZC5A 4C4GA 3F66A 5LXMA 3Q4CA 2W1DA 2BTRA 3NMUF 3NDMA 3GQLA 5HX8A 3E5AA 4XV9A 4RQKA 1H27A 1YRPA 2OJFE 3NW6A 4IANA 1OM1A 1PKGA 3FC2A 4I5HA 4IVDA 3RNIA 4G1WA 4V0GA 4DFUA 3PPKA 2PMLX 4D5HA 4PTGA 3BHYA 4J1RA 4DFYA 1SNXA 1PYXA 4AZEA 4FVRA 4L01A 1BL6A 5GJDA 5JKGA 4K11A 4GUBA 4DYMA 5IQFA 3KXNA 5D1JA 2OH0E 4FV2A 4G17A 1SVGA 2QLQA 3DKFA 4EBWA 3C5IA 2W1FA 4OUCA 4JX7A 3DNEA 5HX6A 3FPMA 5LMKC 4DEDA 2NRYA 4I20A 5HG9A 3PZEA 4CT1A 3KL8A 3CD8A 3OG7A 1R1WA 2I1MA 2IJMA 4XMOA 5CASA 3MH1A 4QTBA 2A2AA 4F09A 5LOHA 4UMTA 4YLLA 4DGLC 4W4VA 3FMEA 2IPXA 4U81A 4C0TA 3O50A 5HESA 5IA1A 4TYJA 2WEIA 4JVGA 2H34A 3R28A 1MRVA 4CRSA 2YEXA 1H1QA 5E8TA 3I0QA 5AUWA 2BZHB 2CDZA 1ZARA 3EFWA 3UPXA 1WBSA 4FTKA 4IEBA 4DG2E 4EQUA 1YWRA 3AGLA 5ANGA 3ZO1A 4DEGA 2PMOX 3E92A 1F5QA 3SRVB 3FWQA 4C2VA 1VJYA 2W1ZA 5EH0A 2RGPA 3I6WA 4PWNA 5E92A 3R7UA 1A06A 2BAJA 3JVRA 4OBPA 4HVIA 4HVHA 2X7GA 3QTZA 5HGIA 3VF9A 4RLLA 5DRDA 3R00A 4FV7A 4QD6A 3SA0A 3S2PA 4ASXA 4HVSA 4M8TA 4S33A 3R7OA 4CV9A 4ZSAA 4FF8A 1PXMA 4L00A 4LV5A 3LHJA 1YW2A 3QCQA 5TOZA 4BL1A 1HCLA 2X8IA 3AT4A 3LCTA 3NUYA 2BRGA 2J0KA 4HOKA 3P23A 4BI1A 4MF1A 3I81A 4OBQA 3QA0A 5IDPA 4EH5A 4O7RA 1JOWB 3BYSA 5AR2A 2O64A 2J0JA 3FLZA 4FKQA 4WBBB 1G8AA 4C59A 4TYHB 4Y5QA 2B9JA 2PY3A 2VO6A 5DN3A 1K9AA 2BZIB 5J9YA 3AMBA 5CS6A 5JGBA 2WO6A 3FZRA 3FZ1A 3FI3A 4BDDA 4BCMA 3CJGA 4P4CA 4U5JA 3EN4A 4IQ6A 4J99A 3MJ2A 5EDRA 3UIMA 3M2WA 5J7BA 2B52A 4IC8A 5FEQA 5L6PA 5K5NA 3COIA 3DBCA 4EK5A 2IO6A 5IEYA 1PXNA 1TQIA 3C4XA 2EUFB 4K0YA 4NWMA 5E90A 4IH8A 4EHZA 3H30A 4FTIA 3RKBA 1WAKA 4WSQA 4IVAA 5BNJA 3L8VA 2YM4A 3DAEA 5HCXA 4RC2A 1Y6BA 4EUUA 1W82A 2RL5A 3ZRLA 4BGHA 2ONLA 2PUPA 3ET7A 5EW3A 4M69A 4P7EA 3C4FA 4ZAUA 2Y9QA 2GSFA 3LQ5A 2X2MA 4GH2A 3BGPA 1YXSA 5AP3A 3UOLA 3HMOA 4E6AA 5IG1A 4NTTA 1H0VA 2HZ4A 2X7OA 4R3RA 3HP2A 2EWAA 2OFVA 2VNWA 2ZM1A 2O63A 2B9IA 2VTAA 3MFUA 1OL7A 5J95A 5FWKK 3RP9A 3DZOA 4FODA 3KU2A 4PDPA 4AU8A 2X2KA 4LOPA 3ZH8A 2QR7A 2C5VA 2UZUE 4W4YA 5EYKA 3PE1A 4ZJVA 2PUNA 2ZB0A 2BUJA 2ITTA 3OWLA 2Y8OA 5IUIA 3PP1A 4OTRA 2PVJA 3OD6X 4FEQA 3VS0A 3ANQA 3WYYA 4ASDA 5AR4A 2FGIA 2GS7A 3RHKA 4GMYA 3D15A 4RA4A 3UC4A 5HORA 5HKMA 4DN5A 3GBZA 5KZ0A 5KNJA 3HRFA 5JQ5A 4KD1A 4U7ZA 3LXKA 3ORMA 4USFA 5JFVA 2XYUA 4ANLA 2W96B 2Y4IB 2X0GA 3KVWA 4FV4A 5IA4A 1DAYA 1FQ1B 3A99A 3R21A 4MQ1A 2PE2A 1WBVA 4B8LA 4IZ7A 3CTJA 5CLPA 5JMSA 3MFSA 3BU3A 3V5JA 5BMSA 5IH5A 3EFLA 1T46A 3Q9WA 4WA9A 4YPSA 4I94A 3P4KA 4O83A 2W1HA 2WU7A 1H07A 1XJDA 4LUDA 4AFEA 3HKOA 3NUUA 3A4OX 3C4ZA 1H08A 4CEGA 1Q8TA 3PJ1A 2YM7A 4TWPA 3RZFA 2W06A 4YZMA 3ORNA 4ACDA 3BBTB 2PVYA 3Q2MA 2WQOA 4P2KA 3QKKA 5L3AA 2AC5A 5M53A 4EOMA 4R7IA 3L9NA 1Y6AA 2YAKA 1SZMA 3F5XA 3HNGA 4FTMA 4BYIA 3DQWA 5JFWA 5J5SA 3B2WA 2XA4A 4J95A 2Z7QA 4I21A 5LVOA 2BDWA 5LMKA 1OMWA 4FYNA 1M2RA 1GY3A 3LVPA 4UZHA 2OICA 3DKCA 3ODZX 3QBNA 4UY9A 4NEUA 3TEIA 3ZSHA 4BCOA 4O7WA 3DXNA 5K3YA 4CYIA 2VTQA 3D14A 3FPQA 1YDSE 4EOSA 5BVDA 2IZTA 4AE6A 4E5BA 3CEKA 2C6MA 1ZWSA 2C6DA 2NP8A 3GU7A 4YTCA 4F6UA 4BCKA 4C4FA 3OMVA 5JSMA 4X21A 3SV0A 4BR3A 3EYHA 4OTDA 4Z16A 4N4SA 4FV1A 4R1YA 4NTSA 3OS3A 5B2KA 1PKDA 3EN6A 4EJ7A 3V5LA 3BIZA 4JDHA 2ITNA 5AV0A 3DS6A 3AG9A 4MCVA 5CEQA 4F1MA 4JBQA 4RPVA 5GINE 2Z8CA 3VUGA 4OTPA 2OJJA 4O81A 3CTHA 2ZB1A 4AWIA 4HYHA 2F7XE 5FQDC 1MRYA 4JAIA 4PV0A 3V6RA 4F1TA 4M13A 4QMQA 4U79A 2E9OA 4A4OA 3P7CA 2XRUA 3JY0A 4L44A 4LV8A 2VD5A 3HV7A 4ZS0A 2R3FA 3DJ7A 3KVXA 3LMGA 3UG2A 5BVWA 5DOSA 5DPVA 3PA4A 3GCVA 4RG0A 4GEOA 4TXCA 4AN2A 5A6OA 5TT7A 4F9CA 5KKRC 3CPBA 2XK7A 2Z2WA 3ZZEA 1KV2A 2WFYA 5IQBA 4HPUE 4J8NA 3PWDA 3CD3A 4IDVA 4D2VA 3QTQA 2UZNA 5C26A 4ANQA 1L3RE 4N70A 3IO7A 4ZSGA 5IUHA 2WQNA 2BIYA 4Y85A 2A4LA 4RIWA 4AGCA 1R39A 2OIBA 3DFAA 2VWIA 1PMVA 4O91A 4A06A 4RJ6A 5F94A 2A1AB 1G5SA 2YHVA 2XKCA 4M67A 3OXZA 3VRZA 3ID6C 5LARA 2JAMA 3FKLA 2XEYA 4B8MA 1Q3DA 2VTMA 3MBLA 3OW3A 3PPJA 3KMWA 4YHJA 4EKLA 1W84A 3P5KA 5C4LA 3ZFYA 2XJ0A 5AWMA 2XIKA 4H3QA 2XRWA 1OKWA 3A7GA 4HZRA 4AXAA 3NVMB 4TTHB 5IA5A 3FI4A 2GNFA 3TNIA 5EDQA 3V5PA 5HICA 5AX9A 1UWJA 3FL5A 2OF2A 2R7BA 1WBTA 3UOJA 3N4TA 3BE9A 3KXXA 4H58A 3RVGA 1QPDA 1JWHA 3JYAA 1ZRZA 5EYMA 5D7AA 3FV8A 4DEEA 4GT5A 1YQJA 3HLLA 4IC7A 1U5QA 3V04A 3FLSA 1JAMA 3MPAA 2IW9A 3TUDA 3QC9A 5FGKA 5DT4A 3KFAA 3S3IA 4FNWA 4AF3A 1H01A 4EOPA 2ZDUA 4TYEA 2QLUA 4IAZA 4JDIA 2H8HA 4YJUA 4HCUA 3NCZA 4HPTE 4O0VA 4RWIA 4F99A 5KMKA 4KKHA 1E9HA 1DI8A 4R8QA 3D4QA 4AA0A 3I7CA 3QQLA 3SDJA 2BALA 2CCIA 4UWYA 4F7LA 4YNEA 3KMUA 3EQPA 4RSSA 5B0XA 4FSMA 3R8UA 1OI9A 1JKKA 2X4ZA 3OWPA 5IH6A 1Y8YA 4KBAA 4MXAA 3OBJA 4RFZA 3EKNA 4OR5A 5EW9A 3ZCLA 4S2ZA 4YJSA 3LFBA 1Q61A 4J52A 4MBLA 3VO3A 2PULA 2ITYA 4RGJA 4XRJA 5HE1A 4IAIA 3GCQA 5AJQA 4BGGA 4EQMA 1SNUA 5AAEA 3AT2A 3PXRA 4MNFA 4FKWA 4QMVA 5DI1A 2FB8A 4XG6A 4B4LA 4CKJA 2EXEA 2WMSA 4EHVA 5JEBA 3DK6A 4DE4A 2W99B 4OBOA 3KXZA 3OUKA 3W2RA 2CKOA 3DCVA 2YJRA 3EB0A 3UIXA 2R3LA 2R3PA 4TN6A 4BDFA 4NJDA 4F9AA 2ESMA 1UWHA 3NGAA 3W16A 4A9UA 4CTCA 5AV3A 3PJ8A 1OPJA 4MD9E 3K2LA 4MK0A 3VBYA 4DA5A 4MEDA 1W98A 4FX3A 4W9XA 1SVEA 2C3LA 4WG5A 1BI8A 2QO9A 2WNTA 3GFEA 5EYCA 3LMHA 3GOPA 4YSJA 3HL7A 4TYGA 3QRKA 3P7BA 3GNIB 4E6CA 3NNUA 3C51A 5L8LA 1P5EA 4TWOA 2WMXA 3C50A 4JI9A 2C3IB 5AR3A 4WUAA 3QTSA 5DA3A 2YN8A 4ERKA 1I44A 2Y4IC 3A7FA 3FHIA 3K3IA 5I5ZA 5LCKA 3QTRA 4DBNA 4KUJA 4M0ZA 1PY5A 3A4PA 3EWHA 3PXKA 4O21A 5DE2A 4YP8A 2C6OA 3FQEA 4G6OA 3CKXA 4DFZE 3VUMA 3HAVA 3TJCA 1R0EA 5LWNA 4RIYA 4C8BA 5L8JA 3HMNA 3QTXA 4MD7E 3UC3A 2WQEA 4C62A 2CGUA 5L6WL 3F3VA 4GKIA 2YDIA 1KOBA 2ZV7A 3PVUA 5IA0A 1NXKA 5L6OA 2PVRA 5J1VA 1YOJA 2E9NA 2HOGA 3KN6A 1XH6A 4RZWA 4O0WA 4X2JA 4DFBA 5HU3A 2ETRA 4XYFA 4JIKA 2YIXA 3D0EA 1FINA 3F5GA 2R3QA 3MN3A 3MS9A 5DR6A 5IZFA 3A7IA 4ZY6A 4YHFA 5EM6A 2CNQA 2YCQA 4O7SA 1PXJA 3FKNA 2QODA 3P9JA 5K9IA 5AA8A 3A60A 4GVJA 4Y95A 3W33A 1VR2A 2QU5A 3TNHA 3NEWA 3FMKA 4UXLA 4I0SA 4CCBA 4LG4A 3QLGA 1J7LA 1H1SA 5ANJA 4YJRA 4AA5A 2OGVA 4FGRA 4DG3E 5G6VA 1WBNA 4QMTA 2HXLA 4I0RA 4DTKA 2EXCX 3H0ZA 4KAOA 1ZZLA 3IW5A 4XG3A 4EZ5A 5D7VA 1KUTA 4O7TA 4MD8E 4XG4A 2R3IA 3UYTA 5CF5A 4G9RA 3RTPA 3MH2A 5CU2A 4H3BA 3CQUA 4QRCA 2YDJA 5AUTA 1B39A 4AE9A 2OIDA 3QRTA 2VWUA 4FV9A 4WIHA 3OT8A 3A7HA 3BPRA 4PL5A 5IQIA 3WE8A 3ZFXA 4USEA 3NRMA 2W0JA 3Q4TA 5M09A 1V0BA 3RJCA 5BX0A 1GJOA 3PG3A 5ANIA 3DLSA 3HYHA 2GS2A 4XG9A 1LR4A 4EL9A 3R9RA 3LFSA 3DY7A 2Z02A 3C4EA 3MH3A 4USDA 3CBLA 3O51A 2ZOQA 4F65A 4BWXA 5DG5A 1KV1A 4O27B 1AD5A 1P14A 2Y6MA 3NYOA 3HDNA 3F7WA 3OEFX 3P7AA 3RALA 4ENYA 4ZK5A 4DITA 4YZDA 1T45A 2CNUA 2QOCA 1CKIA 3EL7A 3IS5A 4F6WA 5TO8A 5FDPA 2C5YA 2P4IA 2BRMA 3BELA 4D1SA 3LLTA 3SX9A 2J6MA 1QPJA 2OI4X 3MB6A 1GZKA 2WTCA 3QF9A 3VBVA 1PXOA 4GSBA 4EEVA 4R7BA 4OW8A 3HZTA 2HIWA 3LQ8A 4TYHA 5KX8A 4QMLA 3FQSA 2W17A 4BZDA 5HIBA 2Y0AA 5EDPA 3UNKA 5CAOA 3UODA 4KSQA 2VTSA 4O0TA 4RVMA 4ALUA 3WF9A 4HVGA 5FTGA 4HZSA 4YGAA 2W1CA 4XBUA 4AW5A 3DNDA 4FGBA 5EI8A 4YZ9A 2PMIA 3UZPA 3ZUVA 2BKZA 3SKCA 4BBEA 1KE6A 4HNIA 5EFQA 5J8IA 5CVGA 3ELJA 4DGNA 4FK6A 5FXRA 3GENA 4RIWB 2JBPA 3GGFA 5HTIA 1ZLTA 3QD3A 4GW8A 1Q3WA 3VS7A 3R83A 3QAME 5KE0A 4MQ2A 4JRNA 3DTCA 4U44A 2H96A 3CS9A 4F0FA 4FT5A 4ZLYA 3NUPA 3ZSIA 1OKYA 1FPUA 2G2HA 4FZ7A 4UV0A 2YZLA 3IOKA 4QTAA 3C5UA 3OUNB 1Q41A 1UNGA 4C7TA 3RK7A 1O6LA 2GPHA 2XCHA 4CQGA 3I0OA 2WTKC 3KK9A 4RIXA 5FBNC 3TKIA 3GOKA 2EU9A 3DGKA 3ORXA 4D9UA 3CPCA 5F9EA 4D4YA 2XBAA 4IBMA 4FT0A 1KE5A 1YHSA 4EC8A 3LFEA 5IQAA 4I5CA 1UU8A 1HCKA 1M2QA 4UZDA 2GDOA 3TUBA 4ZTMA 2DUVA 4JR7A 3VBWA 4ACMA 3KN5A 3FXZA 1OGUA 1W8CA 1LEZA 1ZYCA 4DFXE 3Q96A 2VWZA 3I6UA 2R3RA 3Q04A 4TZRA 2YZAA 2YIQA 4WD5A 3A61A 1ZYLA 3R9HA 1UNLA 3DPKA 5JH6A 3ZFMA 1AGWA 2ITWA 3EN5A 4YNOA 4C4HA 5CI6A 2J51A 1BUHA 5HE3A 3DK7A 3RBWA 1DAWA 4BCQA 3QCXA 5DFPA 2WIHA 3HV4A 4I93A 4FKSA 4FV5A 5CSVA 4PY1A 3RPSA 4C3RA 4CMUA 3VHKA 3L8PA 1OIUA 3FI2A 3R04A 5DIAA 1LEWA 4D4VA 2GTNA 2RIOA 2RFEA 5LVLA 3P1AA 4PTCA 5E4HA 4XP3A 5AP6A 3ZO3A 3ZBFA 4PMSA 4BCGA 4CKIA 3L1SA 2ITZA 2SRCA 3H4JA 5ETCA 4K18A 3DB8A 3R8LA 2NRUA 3PIXA 1QMZA 4BFMA 2PUIA 1FOTA 4IHPA 4H05A 4X3FC 4GK3A 2IVUA 3FY0A 5EM7A 4MBIA 5E91A 3S1HA 1H24A 2B4SB 4FIFA 4ZTSA 2ITOA 3N4UA 4DHFA 2F9GA 4C02A 2RG6A 3R8PA 2JLDA 1YKRA 2XKEA 3R1NA 1J1BA 3HV3A 4FA2A 4AACA 2ITUA 2WHBA 4D1XA 4G3EA 4KBKA 3HECA 1MQ4A 1Q24A 3W1FA 5BVOA 4CFVA 3FZPA 3QD2B 2XNGA 2I0EA 4KIPA 4IAFA 1H4LA 3BLQA 4WNMA 5GNKA 3G6GA 3LIJA 4G5JA 1MUOA 2J4ZA 3A8WA 3L8SA 4GS6A 2DS1A 2QURA 5E8UA 5I3OA 1VYWA 4X2FA 2UW9A 1OB3A 3U4UA 3UO4A 3WF5A 1RQQA 3P0MA 3FMHA 5HTBA 4KWPA 4DGMA 5HNBA 4JRVA 3V5WA 2YERA 4YLKA 5EG3A 3UO5A 3D94A 3WIKA 2JBOA 4FV6A 2JKQA 4WNOA 4CRLA 1KE8A 2OO8X 5K0KA 3LQ3A 5L4QA 2VV9A 3IPHA 2E9VA 2B53A 4DEAA 2J9MA 5AV2A 5EKOA 4BTJA 1I09A 3ZDUA 4MNEB 4JXFA 2E9UA 4YC6A 2BRBA 1JKSA 4O0UA 3QCYA 4C37A 2QONA 1URWA 3KRLA 4TY1A 2XM9A 3IKAA 2JDVA 3FXXA 4M7IA 3MI9A 4ANOA 4E26A 5KBQA 4QP2A 4FV8A 3T9IA 4FG7A 1Z5MA 3ORKA 4YC3A 4I3ZA 3ZEWA 4FKOA 5BUJA 2XJ2A 2E2BA 4HCVA 5EI2A 4FIGA 1XH5A 4NCTA 3F2AA 3OZ6A 3OCTA 4IADA 3T8OA 1UKIA 4ITHA 2IZUA 4YJQA 4G31A 4B0GA 3QL8A 2ZAZA 1PHKA 5D41A 3ZRKA 4OTFA 4L45A 4JS8A 4FKGA 4QP4A 4RJ8A 1ZY5A 2IVTA 4QMOA 3OP5A 1U5RA 2R3NA 4F9WA 3ORZA 4W8EA 3KXHA 4O38A 2PWLA 2C5XA 3PXQA 3F5UA 3FEGA 2OK1A 3KULA 4M15A 5CU3A 3PPZA 2VO3A 5HBEA 4ANMA 1FGKA 4DFLA 1E1XA 1JKLA 4IWDA 4N6ZA 3C0HA 5ETFA 2YM6A 4NZWB 4PMTA 1MQBA 2WMQA 4R6VA 5AM7A 3O0GA 3DOGA 3NSZA 3R30A 5CF4A 4QT1A 3R9DA 3WZKA 3BE2A 2GMXA 5CZHA 4O1PA 1ZXEA 4G3GA 4OTWA 4HGSA 5AAGA 4O84A 4IZAA 2JITA 3B2TA 3KB7A 3QA8A 4WUNA 1QCFA 1XBCA 3CGFA 1XKKA 3K5VA 5CWZA 1Q8WA 4ID7A 4QYGA 4YJPA 4GV1A 1Z57A 3LW0A 4QP1A 5AA9A 4U45A 4X2KA 1GZNA 5AADA 5KMLA 4E6DA 1U54A 3CIKA 5CNOA 4GT4A 3SOAA 3W2PA 4AZTA 3VNTA 2IVVA 3HRBA 2LAVA 1VYZA 3RCDA 3H9RA 2P2IA 2RSVA 3E7OA 2PMNX 2CSNA 5DYJA 4LL0A 4F4PA 4A9TA 4MWHA 5BVNA 2EXMA 2UW7A 5F20A 4K8AA 5KHXA 3D7TB 4EC9A 1GNGA 1ZMWA 4IX3A 4MXXA 3GXLA 4FEXA 2OFUA 4EOLA 2XNPA 5A4QA 3ALOA 1CKJA 5FBOA 2JKOA 5BMMA 4BDCA 5KMJA 4M12A 4IDTA 1GIIA 2QC6A 1CDKA 4YZCA 3Q60A 4J97A 4LGHA 4FNYA 4DEIA 1PRYA 1Q99A 2VWBA 3H9FA 4CFNA 5JGDA 5CAQA 5K4JA 1KSWA 3I79A 4IX6A 4L43A 4XNEA 4P90A 4EH9A 3KREA 3CKWA 2BROA 2UZBA 4ITIA 5L2QA 4EOKA 1APME 5M56A 4EOJA 3GP0A 3PUPA 3QD4A 3IG7A 1ZMUA 2BAKA 3ZM9A 3QQKA 4FL2A 2I0VA 2QR8A 4I6FA 2VGPA 4ZOGA 3DJ5A 1VZOA 5HG8A 3OBGA 4FG8A 3BEGA 1LP4A 4AN3A 1G8SA 2QNJA 3FYJX 1KE7A 2YFXA 2XUUA 3QX2A 3RGFA 4EH8A 4HYIA 1OIQA 2XNBA 3E3BX 3QXOA 2WELA 4OTQA 3G0EA 4B99A 4KS8A 4JG7A 2C30A 3ZRMA 4PDYA 4EH7A 4WNPA 5BVEA 2VN9A 4X0MA 4M97A 5JRSA 4QYEA 3LJ0A 4D55A 3DQXA 2O3PA 3RWQA 4UEUA 4ITJA 3FAAA 5GHVA 3ZS5A 4E3CA 2YCSA 5FEEA 1P2AA 3QQJA 2NNWB 3QWKA 2R0UA 5J87A 5DVRA 2Y7JA 1H8FA 5HTCA 4FE2A 3QHRA 4BF2A 3IOPA 3LJ1A 5CF6A 2FSLX 3R9OA 3WI6A 2JGZA 5CTPA 5GJFA 2W1EA 2REIA 5CEKA 2OXYA 3ZO4A 5HLWA 3EQFA 5LMBA 3NUAA 2VTNA 1UU3A 4DFNA 3BHUA 3UP2A 5FDXA 5E8ZA 2X4FA 4FTQA 3RPOA 4BCJA 3W32A 3KY2A 4XOZA 2OJ9A 2J50A 2X9EA 3ZONA 5I3RA 3CR0A 5H8EA 2FYSA 2UW4A 1H28A 4LM5A 3ATSA 3GU4A 3BBWA 4S34A 1YWVA 2J0MB 1ZOEA 5LVMA 4ZZMA 3P86A 4O1OA 5HO8A 4RC4A 4L68A 3TZ8A 4WRGA 3E63A 3KRXA 1XWSA 2Z7LA 3UZTA 4R78A 5G1XA 1Q5KA 3PXYA 2FO0A 2QG7A 5IUGA 5JFXA 4WO5A 2BAQA 2VTPA 4C4EA 1A9UA 1OKVA 2HZ0A 4II5A 3PIYA 4ZMEA 4C38A 4UN0C 2CPKE 5BQ0A 3AC3A 3TUCA 3NWWA 3CGOA 4DH7A 3UE4A 2PVFA 3OFMA 1YI6A 2OG8A 2UVXA 5CQWA 5DR9A 2I0YA 5LVNA 3SXSA 2PE1A 4IVBA 2VX0A 5HZNA 2WZJA 4IB3A 4AW2A 3FLYA 4GJ3A 3OOMA 1IEPA 4DCEA 5KBRA 3QQGA 4E73A 5LJJA 2GNGA 4UX9A 3R7VA 5M4CA 2BDJA 3V8TA 5CSPA 3WZDA 3GC7A 1PF8A 2IN6A 3AD6A 4YSMA 2XK4A 4B9DA 1OZ1A 5CEOA 2R3OA 5IISA 3U9NA 4U6RA 3O7LD 4RZVA 3C9WA 3W2CA 3ZLSA 4CVAA 4RC3A 5EQPA 4GRBA 3B8QA 2BRHA 2YISA 3QYZA 3VUDA 1TVOA 4DEHA 3F2RA 4LFIA 4YJTA 2C3JA 2UZDA 2XNMA 5J79A 5DWRA 4OAVB 2BKKA 1H1PA 3ROYA 1FVTA 3IGGA 3UVQA 4A07A 5AFVA 3PYYA 4FOCA 4UALA 1GOLA 1UU9A 4U8ZA 4DH3A 4O22A 2X7FA 3ALNA 3VS2A 4E4LA 3GUBA 1IAHA 4X2GA 3VS4A 2YWVA 5JQ8A 1U4DA 4UWCA 5A6NA 3O8TA 1V0OA 1IRKA 3EQRA 4IZ5A 3PJ3A 4RJ7A 3R8VA 4KS7A 3E88A 1RJBA 3FDNA 2R9SA 5TR6A 5ICPA 3GFWA 3LE6A 3V01A 2W9ZB 5JN2A 4R1VA 1U59A 4D4SA 1Q8ZA 4O7ZA 3D5WA 4QTDA 1XQZA 3VW6A 1FGIA 2GTMA 4CFWA 2BPMA 4N57A 2GQGA 4X6QC 3HDMA 2FVDA 1RDQE 4PDSA 3OCSA 5EOBA 3ACJA 4ENXA 4D1ZA 2C6LA 3POZA 4G3FA 5CX9A 4QQTA 4XRLA 2OBJA 5JZJA 2R5TA 2W1IA 4G34A 3CSVA 2PVLA 4OTHA 3BEAA 3PA5A 4FKUA 5IQGA 4TL0A 1ZZ2A 4RLKA 5IEXA 2VTLA 5AR8A 5DT0A 1R3CA 1J7UA 4IFGA 3DAJA 2PSQA 4O0YA 4YPDA 5FP6A 5EQYA 3ZDIA 4R77A 4FTNA 3MB7A 4EH3A 5E8XA 3FMJA 3NUSA 3SRVA 2CN8A 3D5XA 4WNKA 4EONA 5A4LA 2X8EA 4V04A 5DR2A 3JPVA 3TACA 1XBAA 5CEPA 1OUYA 4E20A 4U40A 2WTJA 1UU7A 4QTEA 2X81A 1STCE 2H9VA 4XBRA 1ZOGA 4BCHA 2UW5A 4TKSA 4UXQA 5IA2A 2XVDA 3RPYA 1OITA 4ANNA 3N51A 3VW8A 4BWPA 3MTLA 4E4MA 4GU6A 4KB8A 5CU4A 2Y4PA 3G0FA 3O96A 4U0IA 3TNQB 4WG3A 3VWAA 2JKKA 3MPMA 2RFSA 2ZV2A 3R7IA 3RHXA 3I5ZA 2OSCA 3Q32A 3HX4A 4PNKA 4GFOA 1SVHA 4BDHA 4O6LA 1U46A 1CM8A 4U3YA 1J91A 2C0IA 2V0DA 4I1ZA 2Q0NA 5IMXA 3GU5A 3E87A 3RAHA 3BV3A 1XH4A 1H00A 1U54B 2HAKA 4RFYA 3I4BA 3F3ZA 3MA3A 1FVRA 2JIIA 3ZC6A 3E7VA 4CT2A 3RWPA 2VO0A 4F7JA 5M51A 2QVSE 3NLBA 3KK8A 4IM3A 2WMTA 3PXFA 4XG7A 2ZMCA 5CY3A 4AZSA 5K4IA 1PXLA 2VTHA 3E8NA 5JFSA 3IW7A 5M4UA 5CYIA 2B54A 4XG8A 4CFMA 5HQ0A 5CU0A 4I92A 4CFFA 4LRKA 4AN9A 1GAGA 3KMMA 5EYDA 1UNHA 3EFKA 4L53A 4ZTNA 2R3KA 2QCSA 5CALA 4HGLA 2UW6A 2W4OA 3VUTA 5IKWA 3UNJA 1ZAOA 4GYGA 4L52A 4FTUA 1PW2A 4TYIA 4Z7HA 4WOVA 4BDJA 4DLJA 2C5OA 3R02A 4ZTLA 4CZTA 2QOFA 1WBPA 1Q8YA 5E8YA 3C1XA 2XNNA 1BLXA 3Q3BA 3I60A 3LCSA 4FUXA 3LXLA 4YLJA 3DBQA 4RIXB 4D58A 5I9ZA 4QQJA 2A0CX 4DAWA 4MYGA 3QLFA 4NIFB 3KKVA 5A9UA 2WPAA 3FL4A 2VTJA 2ETKA 4LYNA 3MVLA 3LLAA 4AT3A 4EZ7A 3UDBA 2FSMX 5CT0A 4BN1A 2WXVA 3EIDA 5DRBA 2HZIA 3R7GA 3LKMA 1ZYDA 4IAAA 2J0IA 4F9YA 2WD1A 4J7BA 3G6HA 3PA3A 2EVAA 5C8NA 5FLFA 2OZOA 5AM6A 4HVDA 3G5DA 4C57A 4FL3A 3GCSA 3BGZA 4Q5EA 3PE2A 4GL9A 4S31A 4C3FA 3HMPA 4CZUA 4IB0A 3AMYA 3UP7A 2C4GA 1JBPE 2XZSA 3NR9A 4JDKA 3WILA 5CEMA 4RRVA 4F0IA 1H25A 3GB2A 3QHWA 4CKRA 1B6CB 3QCSA 5FRIA 3FKOA 2C6TA 4RIOA 1JKTA 4ZP5A 2AC3A 4CCUA 1J3HA 3AXWA 3SQQA 4OT6A 3TV4A 1OBGA 2BFXA 4FSZA 3VJOA 2PZYA 4QYHA 3FLWA 1M7QA 4CQEA 3II5A 2QOQA 3AD5A 3R9NA 4AS0A 1PXPA 1BYGA 4LUEA 5C03A 3FMLA 2RF9A 5A3XA 5CAVA 3R22A 1NY3A 4RT7A 2QKRA 2CGXA 2XBJA 4G9CA 5BPYA 4A4XA 3FMNA 4GK4A 2IG7A 3RNYA 4K2RA 3SW4A 2W4JA 5HHWA 2HY0A 4TWNA 3NIZA 5ANEA 3PJ2A 4GYIA 3MA6A 2XIRA 1QPCA 4TNBA 3UNZA 3PY3A 4XV1A 3MIAA 4L46A 5BYZA 3OTUA 3PVBA 5M55A 4YURA 2QO7A 2OJIA 2VX1A 4HGTA 5DHJA 5HG7A 2CKPA 3TNWA 4Z55A 4JOAA 4O0RA 1JPAA 5DMZA 2F49A 4EUTA 2R2PA 3CQWA 3ODYX 5LVPA 2XNOA 3D7TA 2C6KA 2ITVA 2JDTA 4D9TA 4CLJA 3N4VA 5CSHA 5HVYA 2G2FA 4IE9A 4Y83A 4F64A 2XK3A 4X3FB 5L2WA 2GHGA 3F6XA 4IB5A 1Q97A 4DINA 2QD9A 4YTIA 2UZVA 3KXMA 3NNWA 3QTUA 3ZMMA 4EOOA 3PG1A 3PP0A 4TPTA 3E93A 4YZNA 5FEDA 4R3PA 1J7IA 3U4WA 5EKNA 1R0PA 2ONLC 5EM5A 3NPCA 5AV1A 2HK5A 4O2PA 3G90X 5IQEA 2XK8A 5L2TA 4QMWA 2ITPA 3BYUA 2VNYA 1PMNA 3DBEA 4ZXTA 5IQHA 3QWJA 3QRJA 2OH4A 3WIGA 4XOYA 2ZYBA 4QPAA 4DG0E 3U6IA 5AUUA 3GVUA 4ZSLA 4JR3A 3FSFA 2EB2A 3HRCA 4OTIA 1JSVA 1Q8UA 3HGKA 3TDVA 4FL1A 3ZXTA 4OT5A 5GZAA 1EH4A 2WEVA 3COHA 4GFGA 4ZTQA 4CSVA 3QRIA 5M4IA 4JG8A 3RAKA 1YI4A 2QOLA 1OPLA 4LMNA 4PX6A 5H2UA 3JS2A 3VJNA 4AP7A 4A9YA 2LGCA 1LUFA 4QMZA 2VAGA 1GZ8A 4EYMA 4QP3A 4UMRA 3ZEPA 4MVFA 4R7HA 4EOQA 2YIYA 2WTKB 3AC4A 4DF3A 4BC6A 3P78A 4YC8A 4YUQA 3L8XA 4L9IA 5I9VA 2GHLA 3AGMA 3R63A 5GZ8A 4EBVA 3LXPA 1GIHA 3RAIA 3IK3A 3EHAA 3UVRA 4X2NA 2ZVAA 2UZLA 2JFMA 5I0BA 5C1QB 4I6QA 2HXQA 3QGYA 3K54A 4QYFA 3BI6A 2XIXA 3DJ6A 3F69A 5T68A 2PVHA 2VX3A 4YO4A 4FSTA 3GC8A 3G33A 3LM5A 1OL2A 2F7ZE 4H39A 4ERWA 4W4XA 5EI6A 4EK4A 1KE9A 4FTTA 3O7LB 3NX8A 3FUPA 5HVJA 3EH9A 4BBMA 3O2MA 5DEWA 5IH4A 2V55A 2ZV8A 3ZUTA 3MPTA 3AT3A 4D5KA 4BDKA 5I4NA 5HBJA 4QOXA 4Z9LA 4F08A 1MP8A 3N9XA 3RK5A 2G15A 1UVRA 3BGQA 4XV3A 4BB4A 4FTAA 3TN8A 3SXFA 3OVVA 2ITXA 3KF4A 1NVQA 3VBTA 1QPEA 2Q83A 3HV5A 2PPQA 4K1BA 3AC2A 3KRJA 5HE2A 5TKDA 4AUAA 5L2IA 3MFRA 3VUHA 2WGJA 4AW1A 1DS5A 4PL4A 2YACA 2V62A 3KCKA 3F9NA 4JQEA 2ZM3A 3DAKA 3EQDA 4XUFA 4EHGA 2FH9A 4EORA 3G51A 5C9CA 3NAYA 3H10A 3OTVA 3OWKA 5GIOE 3F3TA 2HW6A 4FKPA 4QYYA 3ZTXA 2I6LA 1OIRA 3KGAA 4GFMA 3D83A 4FIHA 3D7ZA 2YLEA 4EK3A 4O0SA 4C33A 5CVHA 3TI1A 3HEGA 4F1OA 3DBDA 3ZU7A 5JRQA 5DLSA 5T3QA 2W05A 2YIRA 2FA2A 3K5UA 3OROA 4C36A 1YDRE 3QQUA 3GU8A 4U80A 2BMCA 2OU7A 4UMQA 5IQCA 1PXKA 4ALWA 4RQVA 2PUUA 2YA9A 2FUMA 3FE3A 3G9NA 5HIDA 3RZBA 4KKGA 1AQ1A 3ZSGA 5BVFA 3VN9A 3D5UA 5K5XA 3EKKA 2YLFA 4XX9A 4IACA 3H0YA 3ORIA 2CCHA 4C4IA 4K9YA 2UW0A 3A62A 4I41A 2O0UA 3WOWA 5KMOA 1OIYA 1OBDA 2XMYA 2HWOA 5HI2A 4H3PA 3JXWA 3FXWA 4FIIA 3C4CA 3TZ9A 4DT8A 3G9LX 3UIUA 3VUIA 4DLIA 2PZPA 4CG9A 3QUDA 4IAYA 2QOOA 3BQRA 5EM8A 4IIRA 2V7AA 4M66A 4MX9A 4NM7A 3EN9A 4BIEA 5HLPA 3UGCA 4ZTHA 1E1VA 4IZYA 1BL7A 3FI8A 3FZOA 4A9RA 3MY1A 5CF8A 3TV6A 4JAJA 4YBJA 4QMPA 2J0LA 5TE0A 1BX6A 3NW5A 2W5HA 3OF0A 3F82A 4GG7A 2HZNA 4O6EA 4ZZNA 2P0CA 5ANOA 4JNWA 4NUSA 3SLSA 3VBQA 4BZNA 2RG5A 4I4EA 4NT4A 5D11A 2OLCA 4PTEA 3DFCB 3FBVA 3EZRA 3QZFA 4ZEGA 3PLSA 3WF8A 3DV3A 4BICA 2W4KA 4CMOA 3UPZA 2FSOX 2XP2A 4D0XA 4MHAA 2BTSA 4IMYA 4S32A 3RCJA 4BHNA 5IMEA 2Z7SA 3DA6A 4RMZA 3ATTA 4YTFA 2J90A 2WTIA 4GG5A 1IA8A 3DU8A 5B2MA 4C61A 2O2UA 3EQBA 4Q2AA 5FG8A 3GQIA 2WTWA 3Q9ZA 4G6LA 2PZIA 3WBLA 5IPJA 3KULB 1W83A 4IWQA 3D2KA 5D9HA 3CQEA 4BCFA 3QTWA 4CNHA 3S00A 3PWYA 3BHTA 5JT2A 4FZ6A 4EWHA 3GT8A 4XLIA 2W1GA 4H36A 2B0QA 1YI3A 2GU8A 4JQ7A 4GK2A 4YHTA 1QL6A 3BZ3A 3R7YA 5I9WA 3SVVA 4MKCA 4NK9A 2ETMA 2GNIA 3FYKX 4NW6A 2F2CB 3R73A 3SXRA 3MY0A 4RA5A 3W8QA 2WOTA 1TQPA 3UQCA 4IJPA 3VS5A 2R3JA 5FTQA 3KQ7A 4HGEA 4LMUA 2WU6A 4FTOA 3EQHA 2BR1A 5H8BA 1CSNA 3HA8A 5I9XA 2OZAB 4HCTA 2QOHA 2UW8A 3GC9A 3R2BA 5HLNA 2CHLA 1UV5A 4ASEA 1A48A 2CKQA 4IX5A 3W10A 4FMQA 3IONA 1BKXA 2CMWA 2JKMA 2OJGA 4FT9A 4JIAA 3R0TA 2DYLA 4RJ4A 2WQBA 3E8CA 3R1YA 4FZDB 4ZLOA 4B6LA 2GQRA 5GJGA 1WVXA 4PP7A 4ZIMA 3HUCA 3IECA 4QMNA 4NH1A 4DEBA 3R1SA 4W9WA 3QTIA 2BRNA 3FSKA 3TJDA 2ITQA 1XH7A 3LFFA 4KIKA 2IVSA 4AOIA 2CGWA 4BIDA 5M44A 4DH5A 2GCDA 3TKHA 4X3FA 3ZHPC 4CG8A 4F63A 1O6YA 4GVAA 3TTJA 4O86A 2BHHA 4HYSA 3AMAA 4KSPA 5DT3A 3POOA 4IXPA 4KA3A 4QQ5A 3FMDA 4Y72A 2AUHA 4U3ZA 4BTKA 1V1KA 4KKEA 4JX3A 5LQFA 3BYOA 2BFYA 5E8WA 5AEPA 3UQFA 3U87A 1W7HA 3F5PA 2F4JA 3K3JA 4DGGA 4E4NA 3LXNA 4BBFA 4F7NA 4ZMFA 2PE0A 4GCJA 5FM2A 4I24A 4CFUA 2JIVA 5BUIA 3Q9YA 4RX8A 4U9AA 3PVGA 5HCZA 3W18A 4BKJA 4BKZA 3QKMA 4L6QA 2IW8A 2B9FA 4FV0A 4X3JA 4AT4A 4L7FA 5J5TA 4ONAA 4QP9A 1OECA 3O8PA 3ZLWA 2C6EA 3UIBA 2UZEA 4PPBA 3DKGA 2PZRA 4QMUA 4UB7A 3PXZA 2WTVA 2WMRA 3BU5A 2XF0A 3FC1X 3BHVA 2C0OA 5AR7A 4I5PA 4TW9A 3EFJA 2W5AA 4IFCA 5KKRB 3F2NA 2R3MA 3DZQA 4QPMA 4G5PA 2I7QA 1SMHA 3BYMA 3ZLXA 3MY5A 4PF4A 2OKRA 5HO6A 3UBDA 1RW8A 5HE0A 5CT7A 3ENMA 2IWIA 2Y6OA 4L3PA 4V0GB 2XEZA 3FLQA 3AOXA 3Q9XA 4L3LA 4QMMA 4Y5HA 5ANDA 5AUYA 3TIZA 4QNYA 4ANBA 4U97A 4BDGA 4FYOA 3QQHA 4I4FA 1M7NA 3LOKA 4J53A 1XO2B 4IX4A 3ORTA 3AQVA 3TNPC 2J7TA 3IDPA 3TT0A 3VC4A 3BLRA 4UMPA 2VWWA 4DBXA 2C6IA 1YHVA 4GT3A 4S30A 4MXCA 3MW1A 4E6QA 3MVHA 4CV8A 4FZFB 1JLUE 4FBXA 1TKIA 3BQCA 5EOLA 3BRBA 3LFNA 4C58A 4M0YA 5DBXA 3W8LA 3ULZA 4EK8A 3QD0A 4XLVA 3UMWA 3F3WA 4ACCA 3PZHA 5KUPA 4U41A 4XS2A 1P4FA 3CLYA 4DT9A 4O0XA 3MGYA 4FTCA 3KRWA 1CMKE 2G9XA 3RI1A 4EI4A 3HVCA 1YXVA 3TCPA 3Q6WA 1IASA 1OL1A 3OC1A 4FVPA 1PJKA 3VHEA 4IWOA 2QKWB 4KINA 3OHTA 5EHYA 3VF8A 3Q53A 4YJOA 5E1EA 2CLQA 3U54A 3W55A 1JQHA 3M11A 2OXXA 1OUKA 4ZTRA 1RE8A 4LI5A 4MF0A 4HW7A 5JZNA 5JK3A 2BDFA 3ACKA 4IAKA 5F95A 2P33A 1UA2A 4DTAA 2XJ1A 3I7BA 3KRRA 3ORLA 3EQGA 3DK3A 4QP6A 5FTOA 3Q2JA 4PUZA 3SOCA 3E8EA 2CN5A 1XHAA 3VVHA 4JBOA 1ND4A 3QUEA 2CNVA 4FTRA 2WMAA 2PVKA 3LZBA 3NYNA 4AA4A 2XS0A 4O7LA 3A7JA 4Y8DA 5TF9A 5ETAA 3I1AA 4BZOA 1WMKA 5AP0A 4MBJA 1PYEA 4MNEA 5ETIA 3VRYA 3FZSA 4FKVA 2FSTX 2VWYA 4FTLA 3R8ZA 3KF7A 4AW0A 4D28A 2VRXA 2HW7A 3O17A 5HEZA 2UZWE 3Q5IA 5CAUA 2WMVA 3L9PA
chains in the Genus database with same CATH superfamily
2HWPA 3E3PA 3TYKA 3V6SA 4GKHA 4RX5A 4TNDA 3O23A 2PK9A 1X8BA 3DDQA 4IVCA 1FVVA 4YBKA 4ZY4A 1H1RA 2OXDA 2P2HA 4FG9A 3T9TA 4D2PA 3A8XA 4PL3A 4UWBA 4WSYA 4BIBA 2CGVA 4YJNA 1YWNA 3F61A 4CGAA 2G01A 3BHHA 2HENA 4O4BB 3U6JA 3C4WA 3V8SA 4ACGA 3FZTA 4EQCA 4FNZA 3QX4A 2W7XA 3UVPA 3SGCA 2X6DA 4WBOA 4AZFA 3MVJA 3COKA 4L67A 5L8KA 1YHWA 5J1WA 5HNIX 3BLHA 1IR3A 3AC8A 3PLAE 5A4CA 3ITZA 2GHMA 4JL9A 1M14A 3D2IA 1XMLA 2JDOA 4EOIA 3TZMA 5HBHA 2IF8A 4GJ2A 4MXZA 3TXOA 3KCFA 4RFMA 2X1NA 4PMMA 2X9FA 3V3VA 5CZIA 4AX8A 4EK6A 4CYJA 3ZYAA 5E9EA 4E5AX 2XK6A 3LAUA 4HNFA 4RVKA 3DXPA 4PRJA 3U8WA 3UJGA 2OF4A 5A4EA 5IF1A 1H0WA 3BKBA 3LJ2A 3QRUA 4IM2A 4M14A 4E1ZA 3BU6A 4A4LA 1WFCA 2BIKB 4NIFA 3PUFC 4ACHA 2PYWA 3ZM4A 2AYPA 1HOWA 2UZOA 2WAJA 5CU6A 5C4KA 3IDBA 3QYWA 4LGDA 4FK3A 1FMOE 2IZRA 2ZMDA 3EOCA 5KZIA 2EB3A 4YR8A 3DT1A 3EMGA 4NJ3A 3QZHA 4FZAB 4WG4A 2ZM4A 2VTOA 2F7EE 2ERZE 3PSBA 2YWPA 3L9MA 4BKYA 4FSNA 5EHOA 4JQ8A 2VU3A 5A14A 5KHWA 3LFQA 2KTYA 4I0TA 1K3AA 5E8VA 4FT3A 5AIKA 4AG8A 4YU2A 2X6EA 2C68A 4RWKA 1XH8A 5CQUA 5CEIA 3V5QA 1F3MC 4EH6A 4Y73A 3C0GA 4PMPA 4EWQA 3O8UA 3MVMA 2OZAA 3V8WA 3MV5A 3L9LA 3IQ7A 3W2QA 4DTBA 3PVWA 2WTDA 4FSWA 3ANRA 2CLXA 3SD0A 3HV6A 4FIJA 3WE4A 5EQEA 4L42A 5F1ZA 5BVKA 3Q4UA 4BJJB 3SW7A 3GCPA 2XCKA 3DLZA 4OLIA 5FP5A 5AIRA 1LPUA 4ZJJA 2R3HA 2RFNA 3LCKA 4JT3A 3MESA 1YXTA 4R5SA 4FUYA 2A27A 4EJNA 3U9CA 4BGQA 3UOHA 5AAFA 2QHMA 3C13A 5CI7A 4UBAA 4UYNA 4KIKB 4J71A 2V5QA 3EJ1A 2JEDA 3CC6A 4GUEA 5A54A 4XV2A 4WKQA 5J9ZA 1YXXA 3R8MA 2XM8A 3QALE 4M84A 4I23A 4EH4A 5IDNA 4M69B 4QPSA 2B1PA 2G2IA 4MUQA 3C7QA 2BHEA 3EN7A 3ZZWA 2R4BA 5M07A 4I6HA 2GFSA 4GIIA 5BUEA 3ZO2A 3LFCA 4I5MA 5EHLA 1V0PA 4NM3A 2HY81 5AUZA 4C35A 3ZLYA 3PFQA 3D5VA 4F9BA 2GQSA 4XH6A 5F4NA 3VULA 1F0QA 2G1TA 1CTPE 3Q52A 3TL8A 4F0GA 4FKLA 4MH7A 3OEZA 4RVTA 2BVAA 2VTIA 4E5WA 5B7VA 5ITAA 2JFLA 3E64A 4BI0A 1DM2A 2V7OA 4LGGA 5AP5A 2ACXA 5E1SA 4PNIA 4YO6A 3UDZA 3VAPA 4CZYB 3LFAA 4BCNA 4OGRA 3FY2A 4W8DA 2VZ6A 4KRDA 4O4FA 4ASZA 1TQMA 4ZJIA 3VS3A 3U6HA 3AKLA 3NW7A 1JVPP 4O2ZA 3NVKI 3P79A 1WVWA 2C3KA 1YXUA 4K77A 5BYLA 3MWUA 5AUXA 4X6RA 4G3CA 3PY1A 2PTKA 2BCJA 5B2LA 4D2RA 2WMUA 2QQ7A 3EQIA 1O6KA 4JDJA 1JSTA 3ETAA 3UQGA 3COMA 3P08A 3Q5ZA 3R1QA 3ZOSA 3QQFA 4I6BA 5M06A 2C0TA 4E7WA 1M52A 2I0HA 5ACKA 3RM6A 2W5BA 4UYAA 5HD4A 5LWMA 3R6XA 4G16A 5EW8A 4FSRA 2XH5A 3QC4A 1NVRA 3NIEA 4FI1A 4FSUA 5AR5A 3ULIA 3PRIA 2XALA 2PHKA 3UMXA 2QI8A 4AZVA 3SG9A 5I9UA 5C8MA 3OW4A 4AT5A 3S95A 4HJOA 3M1SA 5AP1A 3HA6A 3V51A 3IW6A 1OKZA 1P4OA 3DBFA 1YOMA 1NA7A 3SHEA 1H26A 4JBPA 4BTFA 1WBOA 3QUPA 5AP4A 3UO6A 4CXAA 3TZ7A 4DH1A 4LOQA 4AGUA 3UOKA 5ACBC 4BDBA 4NKSA 2XNEA 4NW5A 4R5YA 4YZBA 2JD5A 5D10A 2QOBA 4RX9A 4PPCA 4EHEA 2JIUA 1REKA 3EZVA 4NCTC 4KNBA 3W0SA 2B9HA 2QOIA 2O8YA 2XIZA 5CAPA 4LQMA 4FOBA 3SG8A 2WKMA 2A19B 4FEUA 5C8KA 3REPA 2C47A 4FC0A 3GC0A 3FQHA 5IEVA 2OWBA 2UV2A 5FXQA 4N6YA 1WVYA 2YM8A 1NVSA 2JDSA 3OY1A 4RJ5A 3VQHA 3LMIA 2I40A 2HCKA 3EYGA 2NO3A 3IW8A 3MFTA 4MTAA 4RBLA 4A7CA 4O7VA 4NL0A 4BY9E 2ZV9A 3LCDA 2JAVA 4K6ZA 4TRLA 2VWXA 2XK9A 5DH3A 4FV3A 2HELA 3ERKA 5H3QA 4RWLA 4Y46A 3G15A 2V22A 3GCUA 2E9PA 5HG5A 1NW1A 4FEWA 2WMWA 1GIJA 3VQUA 3RAWA 3NYXA 5E7RA 2QOKA 3IGOA 4FNXA 2UUEA 3IW4A 4BDIA 1O9UA 4FKJA 3VBXA 3NNVA 4D4RA 4OAUC 4BCPA 1WBWA 3Q6UA 5DGZA 3I5NA 4IB1A 4PDOA 2F2UA 3HP5A 4FEVA 3OXTA 3QZGA 4Q9SA 1ERKA 4BCIA 5HNGA 3CY2A 1OVEA 2B55A 3V5TA 2OW3A 3F88A 3QFVA 5AUVA 4LRMA 4IWPA 3FJQE 3LPBA 4R3CA 5BYYA 1ZMVA 4KRCA 1XBBA 1OL5A 3QZIA 4O82A 2J2IB 5H8GA 4E93A 3VONA 4NYEA 3GI3A 4L3JA 3VS1A 3B8RA 3F3UA 4JJRA 3UZRA 2IZSA 3NUXA 1K2PA 2PVNA 3PRFA 1S9IA 4DCAA 5AX3A 4BRXA 3CP9A 4QMXA 2NPQA 1XH9A 3NZ0A 3EQCA 4G6NA 3TTIA 4CD0A 2W9FB 4IW0A 3DXQA 2BILB 1OPKA 3TKUA 5L2SA 1REJA 1DI9A 4KIOA 2HYYA 3FHRA 4RJ3A 2R0IA 4PPAA 4A9SA 1PMEA 3M42A 4NFMA 1JSUA 2KULA 1SYKA 2WB8A 1Y57A 2UW3A 5T6KA 3RINA 3PSDA 3KXGA 3CTQA 4ZSEA 1Y8GA 3AKKA 5LCJA 3QGWA 3JVSA 2CKEA 2H6DA 2R3GA 1BMKA 4BWKA 4MWIA 1WZYA 2QHNA 3D9VA 4P5QA 4PP9A 3PJCA 1B38A 3TG1A 4BYJA 2DQ7X 3WZUA 2C5NA 3PDTA 1MRUA 2X2LA 5IQDA 1GZOA 3EL8A 1UKHA 3IDCA 4ZY5A 5CENA 4NM0A 2YCRA 3BYVA 5HOAA 4PQNA 2RKUA 4X7QA 2Z60A 3RM7A 3MSSA 3AC1A 3KA0A 4FSQA 4U42A 3RMFA 4P5ZA 4EH2A 5J9LA 5M57A 4CFXA 5CXZA 5A46A 4N0SA 3NAXA 4G3DA 4AGDA 3FMMA 5FM3A 4F6SA 3PTGA 1BI7A 3TWJA 2VTTA 4GU9A 3WF6A 2UZTA 4APCA 5IU2A 2ERKA 5E8SA 4XJ0A 4E8AA 4O96A 1FBNA 3R2YA 3WF7A 4B7TA 4YTHA 4WRSA 3NUNA 4JG6A 4TWCA 4D2SA 1G3NA 3NNXA 3MYGA 2XKDA 4H1MA 4ZLZA 4NM5A 4ZSJA 3RK9A 3S4QA 5A4TA 3HAMA 2X39A 4XP0A 4NSTA 2BZKB 3R01A 5K0XA 3BWJA 4V05A 2VGOA 4AGWA 2X8DA 4W4WA 3LCOA 4QTCA 2YM5A 3R71A 3OXIA 4K33A 5ANKA 1VEBA 3PSCA 5HIEA 3CY3A 3PY0A 5DNRA 4G2FA 5HCYA 5HU9A 4AAYA 3ORPA 4L7SA 3JR1A 1KWPA 4QQCA 4KABA 4BDAA 2OIQA 4GIHA 4M3QA 4J98A 5I9YA 4E4XA 5KMNA 2XANA 2XB7A 4CTBA 3FLNC 2YJSA 1ATPE 4APPA 3R7EA 3H9OA 2UVZA 3MTFA 2P55A 3QXPA 2XKFA 4LL5A 5CNNA 5FD2A 3T3VA 1M2PA 3OY3A 4AAAA 3QKLA 4Q5HA 4DC2A 1SM2A 3TM0A 2QG5A 3ENHA 1W2DA 4QP7A 5C27A 4C2WA 3H3CA 3TDWA 3T3UA 4NKAA 2C1AA 4FTJA 1JNKA 3AC5A 2ZJWA 1FMKA 4QNAA 3E62A 2VUWA 4FVQA 4TT7A 3VUKA 5AP2A 2R7IA 3F7ZA 3ZXZA 4O7YA 4V01A 3JY9A 3OWJA 4XP2A 2C1BA 4CMTA 4FKIA 1Z9XA 2GNJA 1XR1A 4FIEA 3AD4A 1IAJA 3WARA 4C3PA 1H1WA 4H1JA 5KCVA 2B7AA 2F57A 1WCCA 1NT2A 3GU6A 3Q4ZA 2YABA 2ZDTA 3NS9A 2GS6A 1ZYSA 2BZJA 3GEQA 5LMAA 3HMIA 4BI2A 3A2CA 1R78A 3MJ1A 4MXYA 4AOJA 3W2OA 5GIPE 1M17A 3UYSA 3HMMA 2JC6A 4EZ3A 5KMIA 4C34A 4ANSA 5HVKA 4MXOA 3RPVA 3JUHA 4Q9ZA 4RVLA 1PXIA 4XHKB 5GZ9A 3O71A 5DEYA 1Y91A 4BTMA 4ALVA 1Q4LA 3U51A 4RIYB 2PU8A 3MIYA 2DWBA 5AP7A 4IJ9A 4YJVA 3TIYA 3W2SA 2YITA 4D2WA 5CXHA 4Z3VA 1IG1A 1YVJA 4XCUA 4YMJA 4IM0A 4AOTA 4BHZA 4RX7A 4DGOA 4QO9A 3BCEA 4U43A 1KOAA 2O5KA 2PL0A 4ZZOA 3CJFA 2Z7RA 3VS6A 2WIPA 4D2TA 4WT6A 1J1CA 2C69A 2GNHA 4LOOA 1PMUA 3OOGA 3DDPA 2PZ5A 2WOUA 3BX5A 5AMNA 5H9BA 1YDTE 2GNLA 2VWVA 4QMSA 2YCFA 5HO7A 4FICA 4FKTA 3KEXA 4J96A 4O7NA 4WHZA 2PVMA 4HYUA 3E8DA 2Q0BA 3WZEA 4D0WA 3MH0A 4DH8A 3VIDA 3RPRA 3LFDA 5CSWA 5CANA 1IA9A 4ORKA 1OL6A 4AQCA 2AEGA 2XIYA 2CJMA 3HUBA 4FKRA 5KMMA 2J5FA 3TV7A 2JDRA 2R64A 4M68A 3OCBA 4XEYA 3THBA 4Z7GA 3C0IA 5AV4A 3CE3A 3ROCA 5CVFA 1ZYJA 2WMBA 5M08A 3QU0A 4C4JA 5KO1A 2O65A 2YIWA 5IA3A 2VTRA 2RFDA 2XYNA 4J8MA 4BVUA 1L8TA 2YDKA 3CCNA 5FXSA 4KBCA 4F70A 3S0OA 4AFJA 3BV2A 1ST4A 5FUTA 3CXWA 1ZY4A 3PIZA 3NYVA 2J5EA 5EK7A 3SAYA 4FR4A 1S9JA 4NFNA 5M4FA 1Q62A 1URCA 3SC1A 4RWJA 4MAOA 2VO7A 3W0MA 5JGAA 4KIQA 4QMYA 2QO2A 4CLIA 3DTWA 2UVYA 4ZS4A 3ZUUA 4AZWA 4F7SA 5C01A 4QP8A 4EKKA 4I22A 3LM0A 3BL7A 2IW6A 3DKOA 3NFGB 1W0XC 1CKPA 4JBVA 4XG2A 5HD7A 3WYXA 2GFCA 4NU1A 1ZOHA 4BDEA 3BWFA 3OCGA 4EYJA 3MDYA 4FSYA 4ARKA 2WQMA 3U55A 3OT3A 3DB6A 5J7HA 2YM3A 4QDEA 3WZJA 4UMUA 5D12A 3UG1A 1YOLA 4L8MA 3UTOA 3ZBXA 2YAAA 4JLCA 4FT7A 2P3GX 3KC3A 4OTGA 5CSXA 3NCGA 4LRJA 3G2FA 2QU6A 3ZC5A 4C4GA 3F66A 5LXMA 3Q4CA 2W1DA 2BTRA 3NMUF 3NDMA 3GQLA 5HX8A 3E5AA 4XV9A 4RQKA 1H27A 1YRPA 2OJFE 3NW6A 4IANA 1OM1A 1PKGA 3FC2A 4I5HA 4IVDA 3RNIA 4G1WA 4V0GA 4DFUA 3PPKA 2PMLX 4D5HA 4PTGA 3BHYA 4J1RA 4DFYA 1SNXA 1PYXA 4AZEA 4FVRA 4L01A 1BL6A 5GJDA 5JKGA 4K11A 4GUBA 4DYMA 5IQFA 3KXNA 5D1JA 2OH0E 4FV2A 4G17A 1SVGA 2QLQA 3DKFA 4EBWA 3C5IA 2W1FA 4OUCA 4JX7A 3DNEA 5HX6A 3FPMA 5LMKC 4DEDA 2NRYA 4I20A 5HG9A 3PZEA 4CT1A 3KL8A 3CD8A 3OG7A 1R1WA 2I1MA 2IJMA 4XMOA 5CASA 3MH1A 4QTBA 2A2AA 4F09A 5LOHA 4UMTA 4YLLA 4DGLC 4W4VA 3FMEA 2IPXA 4U81A 4C0TA 1G8KA 3O50A 5HESA 5IA1A 4TYJA 2WEIA 4JVGA 2H34A 3R28A 1MRVA 4CRSA 2YEXA 1H1QA 5E8TA 3I0QA 5AUWA 2BZHB 2CDZA 1ZARA 3EFWA 3UPXA 1WBSA 4FTKA 4IEBA 4DG2E 4EQUA 1TZDA 1YWRA 3AGLA 5ANGA 3ZO1A 4DEGA 2PMOX 3E92A 1F5QA 3SRVB 3FWQA 4C2VA 1VJYA 2W1ZA 5EH0A 2RGPA 3I6WA 4PWNA 5E92A 3R7UA 1A06A 2BAJA 3JVRA 4OBPA 4HVIA 4HVHA 2X7GA 3QTZA 5HGIA 3VF9A 4RLLA 5DRDA 3R00A 4FV7A 4QD6A 3SA0A 3S2PA 4ASXA 4HVSA 4M8TA 4S33A 3R7OA 4CV9A 4ZSAA 4FF8A 4QEBA 1PXMA 4L00A 4LV5A 3LHJA 1YW2A 3QCQA 5TOZA 4BL1A 1HCLA 2X8IA 3AT4A 3LCTA 3NUYA 2BRGA 2J0KA 4HOKA 3P23A 4BI1A 4MF1A 3I81A 4OBQA 3QA0A 5IDPA 4EH5A 4O7RA 1JOWB 3BYSA 5AR2A 2O64A 2J0JA 3FLZA 4FKQA 4WBBB 1G8AA 4C59A 4TYHB 4Y5QA 2B9JA 2PY3A 2VO6A 5DN3A 1K9AA 2BZIB 5J9YA 3AMBA 5CS6A 5JGBA 4BJJA 2WO6A 3FZRA 3FZ1A 3FI3A 4BDDA 4BCMA 3CJGA 4P4CA 4U5JA 3EN4A 4IQ6A 4J99A 3MJ2A 5EDRA 3UIMA 3M2WA 5J7BA 2B52A 4IC8A 5FEQA 5L6PA 1XMMA 5K5NA 3COIA 3DBCA 4EK5A 2IO6A 5IEYA 1PXNA 1TQIA 3C4XA 2EUFB 4K0YA 4NWMA 5E90A 4IH8A 4EHZA 3H30A 4FTIA 3RKBA 1WAKA 4WSQA 4IVAA 5BNJA 3L8VA 2YM4A 3DAEA 5HCXA 4RC2A 1Y6BA 4EUUA 1W82A 2RL5A 3ZRLA 4BGHA 2ONLA 2PUPA 3ET7A 5EW3A 3TMOA 4M69A 4P7EA 3C4FA 4ZAUA 2Y9QA 2GSFA 3LQ5A 2X2MA 4GH2A 3BGPA 1YXSA 4O4EA 5AP3A 3HMOA 3UOLA 4E6AA 4NTTA 1H0VA 2HZ4A 2X7OA 4R3RA 3HP2A 5IG1A 2EWAA 2OFVA 2VNWA 2ZM1A 2O63A 2B9IA 2VTAA 3MFUA 1OL7A 5J95A 5FWKK 3RP9A 3DZOA 4FODA 3KU2A 4PDPA 4AU8A 2X2KA 4LOPA 3ZH8A 2QR7A 2C5VA 2UZUE 4W4YA 5EYKA 3PE1A 4ZJVA 2PUNA 2ZB0A 2BUJA 2ITTA 3OWLA 2Y8OA 5IUIA 3PP1A 4O4DA 2PVJA 3OD6X 4FEQA 4OTRA 3ANQA 3WYYA 4ASDA 5AR4A 2FGIA 2GS7A 3RHKA 4GMYA 3D15A 4RA4A 3UC4A 5HORA 5HKMA 4DN5A 3GBZA 5KZ0A 5KNJA 3HRFA 5JQ5A 4KD1A 4U7ZA 3LXKA 3ORMA 4USFA 5JFVA 2XYUA 4ANLA 2W96B 2Y4IB 2X0GA 3KVWA 4FV4A 5IA4A 1DAYA 1FQ1B 3A99A 3R21A 4MQ1A 2PE2A 1WBVA 4B8LA 4IZ7A 3CTJA 5CLPA 5JMSA 3MFSA 3BU3A 3V5JA 5BMSA 5IH5A 3EFLA 1T46A 3Q9WA 4WA9A 4YPSA 4I94A 3P4KA 4O83A 2W1HA 2WU7A 1H07A 1XJDA 4LUDA 4AFEA 4AXFA 3HKOA 3NUUA 3A4OX 3C4ZA 1H08A 4CEGA 1Q8TA 3PJ1A 2YM7A 4TWPA 3RZFA 2W06A 4YZMA 3ORNA 4ACDA 3BBTB 2PVYA 3Q2MA 2WQOA 4P2KA 3QKKA 5L3AA 2AC5A 5M53A 4EOMA 4R7IA 3L9NA 1Y6AA 2YAKA 1SZMA 3F5XA 3HNGA 4FTMA 4BYIA 3DQWA 5JFWA 5J5SA 3B2WA 2XA4A 4J95A 2Z7QA 4I21A 5LVOA 2BDWA 5LMKA 1OMWA 4FYNA 1M2RA 1GY3A 3LVPA 4UZHA 2OICA 3DKCA 3ODZX 3QBNA 4UY9A 4NEUA 3TEIA 3ZSHA 4BCOA 4O7WA 4AXDA 3DXNA 3W0OA 5K3YA 4CYIA 2VTQA 3D14A 3FPQA 1YDSE 4EOSA 5BVDA 2IZTA 4AE6A 4E5BA 3CEKA 2C6MA 1ZWSA 2C6DA 2NP8A 3GU7A 4YTCA 2XARA 4F6UA 4BCKA 4C4FA 3OMVA 5JSMA 4X21A 3SV0A 4BR3A 3EYHA 4OTDA 4Z16A 4N4SA 4FV1A 4R1YA 4NTSA 3OS3A 5B2KA 1PKDA 3EN6A 4EJ7A 3V5LA 3BIZA 4JDHA 2ITNA 5AV0A 3DS6A 3AG9A 4MCVA 5CEQA 4F1MA 4JBQA 4RPVA 5GINE 2Z8CA 3VUGA 4OTPA 2OJJA 4O81A 3CTHA 2ZB1A 4AWIA 4HYHA 2F7XE 5FQDC 1MRYA 4JAIA 4PV0A 3V6RA 4F1TA 4M13A 4QMQA 4U79A 2E9OA 4A4OA 3P7CA 2XRUA 3JY0A 4L44A 4LV8A 2VD5A 3HV7A 4ZS0A 2R3FA 3DJ7A 3KVXA 3LMGA 3UG2A 5BVWA 5DOSA 5DPVA 3PA4A 3GCVA 4RG0A 4GEOA 4TXCA 4AN2A 5A6OA 5TT7A 4F9CA 5KKRC 3CPBA 2XK7A 2Z2WA 3ZZEA 1KV2A 2WFYA 5IQBA 4HPUE 4J8NA 3PWDA 3CD3A 4IDVA 4D2VA 3QTQA 2UZNA 5C26A 4ANQA 1L3RE 4N70A 3IO7A 4ZSGA 5IUHA 2WQNA 2BIYA 4Y85A 2A4LA 4RIWA 4AGCA 1R39A 2OIBA 3DFAA 2VWIA 1PMVA 4O91A 4A06A 4RJ6A 5F94A 2A1AB 1G5SA 2YHVA 2XKCA 4M67A 3OXZA 3VRZA 3ID6C 5LARA 2JAMA 3FKLA 2XEYA 4B8MA 1Q3DA 2VTMA 5BV3A 3MBLA 3OW3A 3PPJA 3KMWA 4YHJA 4EKLA 1W84A 3P5KA 5C4LA 3ZFYA 2XJ0A 5AWMA 2XIKA 4H3QA 2XRWA 1OKWA 2XAMA 4FJVA 3A7GA 4HZRA 4AXAA 3NVMB 4TTHB 5IA5A 3FI4A 2GNFA 3TNIA 5EDQA 3V5PA 5HICA 5AX9A 1UWJA 3BL9A 4DHIB 3FL5A 2OF2A 2R7BA 1WBTA 3UOJA 3N4TA 3BE9A 3KXXA 4H58A 3RVGA 1QPDA 1JWHA 3JYAA 1ZRZA 5EYMA 5D7AA 3FV8A 4DEEA 4GT5A 1YQJA 3HLLA 4IC7A 1U5QA 3V04A 3FLSA 1JAMA 3MPAA 2IW9A 3TUDA 3QC9A 5FGKA 5DT4A 3KFAA 3S3IA 4FNWA 4AF3A 1H01A 4EOPA 2ZDUA 4TYEA 2QLUA 4IAZA 4JDIA 2H8HA 4YJUA 4HCUA 3NCZA 4HPTE 4O0VA 3UDSA 4RWIA 4F99A 5KMKA 4KKHA 1E9HA 1DI8A 4R8QA 3D4QA 4AA0A 3I7CA 3QQLA 3SDJA 2BALA 2CCIA 4UWYA 4F7LA 4YNEA 3KMUA 3EQPA 4RSSA 5B0XA 4FSMA 3R8UA 1OI9A 1JKKA 2X4ZA 3OWPA 5IH6A 1Y8YA 4KBAA 4MXAA 3OBJA 4RFZA 3EKNA 4OR5A 5EW9A 3ZCLA 4S2ZA 4YJSA 3LFBA 1Q61A 4J52A 4MBLA 3VO3A 2PULA 2ITYA 4RGJA 4XRJA 5HE1A 4IAIA 3GCQA 5AJQA 4BGGA 4EQMA 1SNUA 5AAEA 3W0QA 3AT2A 3PXRA 4MNFA 4FKWA 4QMVA 5DI1A 2FB8A 4XG6A 4B4LA 4CKJA 2EXEA 2WMSA 4EHVA 5JEBA 3DK6A 4DE4A 2W99B 4OBOA 3KXZA 3OUKA 3W2RA 2CKOA 3DCVA 2YJRA 3EB0A 3UIXA 2R3LA 2R3PA 4TN6A 4BDFA 4NJDA 4F9AA 2ESMA 1UWHA 3NGAA 3W16A 4A9UA 4CTCA 5AV3A 3PJ8A 1OPJA 4MD9E 3K2LA 4MK0A 3VBYA 4DA5A 4MEDA 1W98A 4FX3A 4W9XA 1SVEA 2C3LA 4WG5A 1BI8A 2QO9A 2WNTA 3GFEA 5EYCA 3LMHA 3GOPA 4YSJA 3HL7A 4TYGA 3QRKA 3P7BA 3GNIB 4E6CA 3NNUA 3C51A 5L8LA 1P5EA 4TWOA 2WMXA 3C50A 4JI9A 2C3IB 5AR3A 4WUAA 3QTSA 5DA3A 2YN8A 4ERKA 1I44A 2Y4IC 3A7FA 3FHIA 3K3IA 5I5ZA 5LCKA 3QTRA 4DBNA 4KUJA 4M0ZA 1PY5A 3A4PA 3EWHA 3PXKA 4O21A 5DE2A 4YP8A 2C6OA 3FQEA 4G6OA 3CKXA 4DFZE 3VUMA 3HAVA 3TJCA 1R0EA 5LWNA 4RIYA 4C8BA 5L8JA 3HMNA 3QTXA 4MD7E 3UC3A 2WQEA 4C62A 2CGUA 5L6WL 3F3VA 4GKIA 2YDIA 1KOBA 2ZV7A 3PVUA 5IA0A 1NXKA 5L6OA 2PVRA 3O5AA 5J1VA 1YOJA 2E9NA 2HOGA 3KN6A 1XH6A 4RZWA 4O0WA 4X2JA 4DFBA 5HU3A 2ETRA 4XYFA 4JIKA 2YIXA 3D0EA 1FINA 3F5GA 2R3QA 3MN3A 3MS9A 5DR6A 5IZFA 3A7IA 4ZY6A 4YHFA 5EM6A 2CNQA 2YCQA 4O7SA 1PXJA 3FKNA 2QODA 3P9JA 5K9IA 5AA8A 3A60A 4GVJA 4Y95A 3W33A 1VR2A 2QU5A 3TNHA 3NEWA 3FMKA 4UXLA 4I0SA 4CCBA 4LG4A 3QLGA 1J7LA 1H1SA 5ANJA 4YJRA 4AA5A 2OGVA 4FGRA 4DG3E 5G6VA 1WBNA 4QMTA 2HXLA 4I0RA 4DTKA 2EXCX 3H0ZA 4KAOA 1ZZLA 3IW5A 4XG3A 4EZ5A 5D7VA 1KUTA 4O7TA 4MD8E 4XG4A 2R3IA 3UYTA 5CF5A 4G9RA 3RTPA 3MH2A 5CU2A 4H3BA 3CQUA 4QRCA 2YDJA 5AUTA 1B39A 4AE9A 2OIDA 3QRTA 3KIOC 2VWUA 4FV9A 4WIHA 3OT8A 3A7HA 3BPRA 4PL5A 5IQIA 3WE8A 3ZFXA 4USEA 3NRMA 2W0JA 3Q4TA 5M09A 1V0BA 3RJCA 5BX0A 1GJOA 3PG3A 5ANIA 3DLSA 3HYHA 2GS2A 4XG9A 1LR4A 4EL9A 3R9RA 3LFSA 3DY7A 2Z02A 3C4EA 3MH3A 4USDA 3CBLA 3O51A 2ZOQA 4F65A 4BWXA 5DG5A 1KV1A 4O27B 1AD5A 1P14A 2Y6MA 3NYOA 3HDNA 3F7WA 3OEFX 3P7AA 3RALA 4ENYA 4ZK5A 4DITA 4YZDA 1T45A 2CNUA 2QOCA 1CKIA 3EL7A 3IS5A 4F6WA 5TO8A 5FDPA 2C5YA 2P4IA 2BRMA 3BELA 4D1SA 3LLTA 3SX9A 2J6MA 1QPJA 2OI4X 3MB6A 1GZKA 2WTCA 3QF9A 3VBVA 1PXOA 4GSBA 4EEVA 3BLAA 4R7BA 4OW8A 3HZTA 2HIWA 3LQ8A 4TYHA 5KX8A 4QMLA 3FQSA 2W17A 4BZDA 5HIBA 2Y0AA 5EDPA 3UNKA 5CAOA 3UODA 4KSQA 2VTSA 4O0TA 4RVMA 4ALUA 3WF9A 4HVGA 5FTGA 4HZSA 4YGAA 2W1CA 4XBUA 4AW5A 3DNDA 4FGBA 5EI8A 4YZ9A 2PMIA