4IANA

Crystal structure of apo human prpf4b kinase domain
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
330
structure length
321
Chain Sequence
b'RVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLREVLKKYGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNESKTILKLCDFGSASHVADNDITPLVSRFYRAPEIIIGKSYDYGIDMWSVGCTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDREKVTVMSTINPTKDLLADLILPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PRP4 homolog
publication title Evaluation of Cancer Dependence and Druggability of PRP4 Kinase Using Cellular, Biochemical, and Structural Approaches.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 100
structure length 321
sequence length 330
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ianA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ianA01
2Y9QA 3FLZA 4PDYA 4Q9ZA 4O81A 4C8BA 4DN5A 4EHZA 2Z2WA 3NW6A 4AZTA 4P5ZA 2BAKA 5T6KA 2XIZA 3KRJA 4TKSA 1GIIA 2XNOA 4NIFA 5T3QA 4D2TA 3V01A 4IZ7A 4DGGA 4TTHB 3W32A 1JKKA 4BBFA 3KQ7A 3UYTA 3KK9A 1PXPA 3DOGA 3Q4CA 2QG5A 4IANA 3O8TA 3TJCA 4EHEA 5I3RA 4MQ1A 5EK7A 3C5IA 3HAMA 4EH9A 3OTUA 4RA5A 3R7YA 4M8TA 4YZDA 4FZAB 4Y5QA 2CCIA 4OT5A 3BV3A 5IISA 1NA7A 2HYYA 1M2QA 3UNJA 2QLUA 2QOOA 4CEGA 1ZOGA 4BGGA 3OMVA 2UZTA 3EHAA 2PVKA 4HYUA 3R7IA 2Z7SA 2HW7A 3RJCA 4JQ8A 1Q8UA 2UZDA 4QQJA 2VO0A 1Q99A 3PJ8A 4ITHA 4ANBA 4XG4A 2P55A 4DLIA 4FKQA 3H10A 4EC8A 4R7HA 2E9PA 4RFYA 3W33A 4FTLA 3D0EA 1HOWA 4LMUA 4EJ7A 2ITWA 2QU6A 2GNGA 3ERKA 4FV4A 4APCA 2WQOA 2P33A 2J4ZA 3DQWA 3JYAA 2IVUA 3BLHA 4O38A 4AGCA 5AEPA 5M06A 4TNBA 4L46A 4PUZA 3FJQE 4WO5A 3TKIA 5FXRA 4JRVA 5C01A 4ALWA 3DB6A 4FGRA 2RKUA 2XK8A 5A9UA 2QOBA 4ZY5A 4EZ5A 3ZS5A 3ENMA 3NGAA 4DINA 4L53A 5DOSA 4EKKA 5IH5A 5KKRB 2H96A 5GZ8A 4BBEA 3LCDA 4W4VA 4EKLA 1J3HA 4DH5A 3L8PA 2QHMA 4L01A 5AR8A 3ANQA 3BIZA 1URCA 1ZOHA 2VUWA 2ETRA 4N70A 1OPLA 4K0YA 1H1SA 2C68A 3COHA 2PWLA 5J87A 5M57A 4Z55A 1O6KA 5HTIA 2OJ9A 3LFCA 4C61A 4NM5A 4YC3A 4F7SA 2O5KA 2UW0A 4GCJA 3R01A 5TKDA 2OK1A 3OC1A 3TM0A 3SXRA 1GIJA 4QMOA 5HLWA 3IOPA 1PMEA 3PZHA 1Q8ZA 1LEWA 3A2CA 3CEKA 3F2AA 5M4CA 4LL5A 2VWZA 3PP0A 3MVHA 4KINA 2IPXA 4FKRA 3LMIA 3O7LD 5EG3A 1X8BA 3QTWA 3LAUA 4FV0A 5L2SA 4G6NA 4TRLA 1W84A 3OHTA 2B52A 4FT5A 1F5QA 2OZAA 3IDPA 4W9WA 4N6ZA 1S9IA 3KKVA 5A4LA 5BYZA 4EH6A 2WMTA 4U3YA 4WKQA 2E9NA 5LCKA 4BYJA 3NYNA 3QAME 2IN6A 5J9YA 1FGIA 3P5KA 1JKSA 4LL0A 4QQCA 2J90A 3R8LA 3FMMA 3P23A 4PMTA 3DTCA 3QTIA 5EOBA 4BKJA 5AAGA 4QD6A 4ZSAA 4FSMA 3AMBA 5IPJA 4I21A 4FOBA 4R8QA 5H9BA 3E63A 4B99A 3TCPA 2CPKE 2XH5A 4FL3A 2HCKA 3GC7A 3HRFA 3LJ2A 4DEBA 4BDKA 1URWA 2ZM4A 3ORPA 4IDVA 4CVAA 3O2MA 2ZM3A 3LOKA 3QC9A 4G9CA 4K77A 4L6QA 1BUHA 4WG3A 2VTQA 4PDSA 5AV0A 4AZSA 2RIOA 3Q9WA 3KXXA 4FZ6A 4OTPA 4IVDA 4DFNA 5CU0A 5HNGA 2QOKA 3FSFA 1PXLA 5CQWA 3TZ8A 5DT4A 2BDJA 5A14A 4CKJA 2VV9A 3DK6A 5EYMA 5B2KA 1WBTA 5ETCA 4LGDA 3DBFA 5FTQA 2DS1A 4K6ZA 4X3FC 3WZDA 1R3CA 5J9LA 4EL9A 3WILA 3VW8A 4UEUA 3BLQA 2ZJWA 4J95A 4I0SA 1Q3WA 5CT0A 4I93A 4JNWA 2YERA 3MIAA 4QTCA 5IMEA 2QCSA 4O82A 3CR0A 2RGPA 2OBJA 3Q52A 4RIXB 2B4SB 5CSHA 2CKQA 3CKWA 3BCEA 1UVRA 3O96A 3VHEA 2A2AA 2W05A 2OFUA 3IW8A 4P90A 3E8DA 3JXWA 4FIEA 3PJ3A 2BMCA 2WO6A 3NUUA 3V04A 3VUIA 4TL0A 3CY2A 5F4NA 1H28A 5EYCA 4ZSLA 2XK4A 4DF3A 3V5PA 3R9NA 3QXPA 3SRVA 4BCPA 2OXYA 2PVJA 4JBQA 4HGSA 3I5ZA 3RBWA 5DLSA 3ATSA 4ZTMA 3WF6A 2YAKA 5HCYA 3CY3A 2FSLX 3F3UA 2RFDA 3NVMB 4FSTA 2YZLA 2X7OA 3N4UA 4DH3A 5L2WA 4DFYA 3P08A 1BI8A 3UIMA 4CFWA 4GRBA 4MXAA 5CSVA 5KBRA 5AWMA 5BVDA 2C69A 1OKZA 1Z9XA 4QTBA 3D83A 4NM3A 2CNUA 1W0XC 4RX9A 2OZOA 2VTPA 3AMAA 5DHJA 3TUBA 5D7AA 4BB4A 2Y8OA 3C4CA 3S1HA 4M14A 3WE8A 3W1FA 3UODA 5J5TA 4O2ZA 2XYNA 4ENXA 3H9FA 4ZMFA 3DS6A 4QTDA 2C6MA 4XV9A 3H0YA 3LCOA 3JVSA 3ELJA 3A62A 4I94A 1W98A 3FZSA 3ZO2A 3T9IA 3EB0A 4YJQA 4OTWA 3NW5A 1WFCA 2PYWA 3PP1A 4BZNA 2FH9A 4ZLYA 4RIOA 3VUTA 2PUNA 4L00A 4C4GA 4GKHA 4EK6A 4FGBA 2B53A 3FLYA 5GZ9A 4ZTSA 4GYIA 1P4FA 5DPVA 2P2HA 4YZNA 3JY0A 4QQ5A 3UOKA 2GMXA 3DTWA 1PW2A 3PSDA 5GHVA 4AN3A 5LVMA 3U4WA 2QOLA 3C0IA 2W4JA 1PXKA 4FC0A 4C4JA 2R3RA 1BLXA 2C1AA 2ZV8A 2Q0BA 4QMPA 5HIBA 1OVEA 4GU9A 4CV9A 3QKLA 2NRYA 4JAIA 4PNIA 3QUEA 5KUPA 4W8DA 4LUDA 3LFQA 3EN9A 5IA5A 4M3QA 2JD5A 2C6IA 4KBKA 2OF2A 3ZLSA 3PXYA 2QHNA 3NIZA 3TNPC 2FYSA 4AX8A 2R3IA 1OECA 3RPVA 3RCDA 5A54A 4FSQA 2XNMA 2VGOA 2XIYA 3E5AA 3PA4A 3PDTA 4I0RA 2WTCA 1I09A 2UW5A 3K2LA 2GQRA 1T45A 2XS0A 3FAAA 4HNIA 3V5TA 3OWKA 1DI8A 3WF9A 2W1CA 1VR2A 3ZXZA 4BDAA 2HOGA 1PYXA 4M67A 4E6CA 2I0YA 3Q4UA 4QT1A 4RIWA 4UX9A 3OCTA 1PJKA 3ZONA 3GFEA 4YJTA 3WIGA 2I6LA 5BPYA 3F5XA 4EQUA 5ANOA 4PY1A 5HD7A 4OR5A 3P78A 5CNNA 3Q9XA 5TF9A 1H1WA 4DG2E 3D2KA 4JIAA 5EDPA 3R71A 3FXWA 1BMKA 1YXVA 1XKKA 3VS5A 3BPRA 5I5ZA 4KUJA 4C38A 3MESA 3IONA 3LXPA 4U79A 4QNYA 4YLJA 1JAMA 4BWXA 2G2HA 3KY2A 4J99A 5L3AA 4M0ZA 4NFNA 4R3CA 1YKRA 4E73A 3A7JA 2WD1A 5DFPA 3POOA 5E4HA 4FOCA 4ACCA 5HNIX 4MX9A 3ORMA 3KXGA 4RGJA 1YOMA 3CP9A 4O7WA 1SZMA 5BVNA 3DXQA 4F65A 4BTKA 5AJQA 3W2CA 1A48A 4IM2A 3CGFA 2GNHA 3KRWA 4YHFA 4BIEA 4F1MA 4WBOA 3OT3A 4DT9A 4DGNA 2E9OA 1OKYA 4E6DA 3UG1A 3A99A 3NNWA 4NTSA 4AGDA 1NT2A 3BGPA 3TKUA 1H4LA 4O0RA 2BRGA 4BBMA 4EQMA 4U3ZA 3TNHA 2Y4IB 3FQEA 4ITIA 3W2RA 5K5XA 3FDNA 4XP2A 5CANA 4AE6A 1BX6A 5HG9A 2ETKA 2HZ4A 3AG9A 2WFYA 4ORKA 3TG1A 1XH4A 3DPKA 3V8TA 3VJOA 2CKPA 2BHEA 3BGQA 5EYDA 4GUEA 1QCFA 1CSNA 5CZIA 1XBBA 3S00A 3BYOA 4XG2A 4IAIA 3RWQA 3Q9ZA 3W8LA 3R8MA 4CGAA 3Q96A 1M17A 3CGOA 3LQ8A 3JPVA 3OF0A 5DR9A 2PVLA 4YZMA 3VS2A 3EFJA 4C2VA 4UXLA 3S4QA 3EL8A 4D4VA 4FEWA 1HCKA 3E93A 4DAWA 1CTPE 5JFSA 3E8NA 1XH5A 4EORA 5HE1A 3FLNC 5B2MA 4FTKA 3KFAA 5TO8A 3PIZA 1JWHA 5KMOA 3RHKA 5K0XA 5HO6A 4F0FA 4YURA 3ZUTA 3HP2A 2GNJA 1RE8A 2XCHA 2VWIA 4XG3A 2XF0A 5IQEA 3H30A 3R9DA 3IW5A 3NVKI 2C3IB 3QA8A 4OAVB 2QKRA 1R0PA 3MV5A 4FE2A 1ZYDA 4JQ7A 3W10A 5M51A 3DNEA 3L9NA 3DGKA 3T8OA 1PF8A 4B4LA 4BDFA 4EOQA 5EDQA 2PMOX 2YABA 4KRDA 4E6QA 3F66A 4JG7A 3CD3A 3U51A 4F70A 4UZDA 5H2UA 3JUHA 3AT4A 2ITQA 2WQEA 3BBTB 3R30A 1K2PA 2GU8A 2F7XE 4OTFA 4PMSA 5IA3A 4JDKA 3RPYA 3UQFA 5EM8A 4GL9A 2GNLA 4XV1A 4QOXA 5CEIA 4XRJA 2R7IA 2BRNA 4FV8A 4JR7A 2Y7JA 5FLFA 3EN5A 2J5EA 3R1QA 3IQ7A 3MPMA 4O7TA 1UU7A 5DN3A 1OIYA 4DG3E 4ASDA 2OI4X 2WTKC 4GK2A 3AC2A 3DBDA 2XK7A 4PPCA 3UIXA 4C34A 1KUTA 2OJFE 4Q5HA 4J52A 3G0FA 3PFQA 2V62A 3WIKA 3OOMA 4AFJA 3SKCA 2XYUA 4I41A 2ONLC 4RVTA 1ZYSA 2UZBA 3QZGA 4G3CA 4O0XA 4OTRA 4BI2A 5CAOA 4F4PA 1ZRZA 1FVRA 2QOHA 4IQ6A 2QR7A 3M1SA 4IVAA 5DVRA 3VUHA 5IU2A 4F1TA 2QI8A 2VD5A 5HVYA 5CEQA 4CT1A 4Y83A 3QC4A 4KA3A 4FV2A 4N6YA 2XRUA 3QLGA 4A9UA 3FC1X 3C4XA 3LE6A 3PG3A 2QC6A 4IB5A 4D9TA 3UOJA 2C6OA 2VTNA 3DXPA 2GQSA 4A4LA 3Q4TA 3ORZA 4FTTA 4Y46A 1GAGA 5K9IA 4G3EA 3SQQA 2ZM1A 4MQ2A 1OL6A 3LQ3A 1UA2A 3RI1A 3JS2A 4FIFA 4WOVA 3M2WA 3R0TA 3PSCA 4CTBA 2B55A 4A4OA 5K4IA 3ORKA 3LCSA 3TIYA 5LOHA 5IQCA 2CGWA 3A7HA 2YIYA 3OUNB 2PULA 1O9UA 4QMXA 5EM5A 4JI9A 5DG5A 3GQLA 3NNVA 4DYMA 3VUDA 3BHVA 4CG8A 3DBQA 4I4EA 4AT3A 3DK3A 4AOJA 3C50A 3EN7A 4U97A 4FMQA 4KIKA 4IM3A 4PQNA 3R21A 4RVKA 3F3WA 3QQGA 5CYIA 3ZH8A 4BDJA 4D55A 5HGIA 4EK3A 2UW3A 3K3JA 2O2UA 4U45A 5KMIA 5LWNA 5DGZA 3UNKA 2R64A 5LMKA 3Q53A 4MVFA 5IQIA 5CXZA 2W1DA 5FTOA 4YC8A 3MY0A 2YZAA 4BHNA 2BKZA 2BZHB 5EHLA 2FSOX 2W5BA 4YTFA 5HORA 2C6EA 3GU5A 2WEVA 4TYHB 1U59A 2JDTA 3WARA 4UZHA 5FXQA 3DY7A 1NW1A 2WTKB 3FYJX 2QNJA 4QMNA 4FZ7A 2X81A 1Y91A 4I20A 4G5JA 3EMGA 3CKXA 2GQGA 5IKWA 5AV3A 1IEPA 4CRSA 1WCCA 4FNWA 3MFTA 5CNOA 5FBOA 4Z9LA 5FXSA 5IQGA 4AW0A 2YCRA 3ZTXA 2XEZA 3JVRA 4LMNA 5IA1A 3NUAA 4X2NA 4RJ5A 3FEGA 4IB3A 5G6VA 3C4EA 3A60A 3EQPA 4A06A 2ITXA 3C4ZA 1R1WA 2I1MA 3C0HA 4TYJA 4RA4A 2OH4A 4XV3A 4AU8A 2C5XA 5FWKK 2X8DA 3KXHA 4U40A 5HU9A 5DR2A 3NYOA 4BCFA 4J7BA 3TXOA 3SC1A 5BUEA 5LCJA 4CRLA 2PE1A 3A7IA 3PA5A 3R1NA 2ONLA 2X8EA 3ID6C 3FXZA 3VS0A 1XBAA 1VJYA 1WAKA 2JITA 3HUBA 2G2IA 4ANQA 4TWCA 1WZYA 3Q6WA 3F5GA 4QO9A 2W5HA 5EI6A 4K1BA 1HCLA 2YISA 3QRUA 2WQMA 3ENHA 3COMA 2JAMA 3E3PA 3COKA 3MPTA 2Z7QA 3G15A 4FG8A 4ZZNA 2JKOA 3LCKA 3EH9A 4TWNA 2VX0A 4B0GA 1IRKA 3T9TA 2UZNA 1PXJA 2FUMA 3I7CA 4TYIA 3ZLXA 4ALUA 2YIXA 5BVWA 1CDKA 4ANSA 4FEUA 5DNRA 3VRYA 3FL5A 4CFNA 4BDGA 4F08A 2B0QA 4MBJA 3QXOA 4JJRA 3WE4A 2ZDUA 4H39A 4BCHA 4XOYA 3R9RA 1XR1A 4R5YA 4ZJIA 2ZB1A 4ZY6A 4H36A 3OXIA 4X6QC 3Q6UA 4OBPA 4UN0C 3R7UA 4E7WA 5CT7A 2Q0NA 4RVMA 1K9AA 4IB0A 5EHYA 2JC6A 4E93A 5IH6A 2PUUA 4FTQA 4S31A 2CGXA 2WEIA 3BU5A 3EJ1A 5F95A 1PMVA 3UO6A 3ZBXA 3MBLA 5HEZA 3HV5A 3VQUA 1NVRA 4AACA 1PKDA 2PMNX 1CMKE 1KOAA 1YI3A 3C0GA 2O0UA 2BVAA 3MH2A 4DHFA 4FTOA 2A1AB 3FI3A 3GNIB 3IDBA 3LM0A 4FTRA 4ACMA 1SYKA 2A0CX 4E5AX 4F9AA 3BLRA 5L8LA 3EFLA 3PVUA 3VF9A 4IADA 3BEAA 5IA4A 4YJVA 5JMSA 1G5SA 3D7ZA 3ZFYA 3HA6A 3EZRA 4IZ5A 4CLJA 1Y8GA 2V22A 4KABA 5EW3A 3VS1A 2X7FA 4O0YA 4V0GA 1YRPA 5JFWA 4D1ZA 1PY5A 3ZYAA 3F9NA 5ANDA 2QURA 5JGAA 3F3ZA 4BN1A 2UW9A 3PE1A 3EL7A 3FMLA 3LPBA 2HZ0A 5DI1A 2W9FB 1U4DA 5D9HA 4BDIA 5FRIA 2X9EA 2XK6A 4GFMA 3P7CA 3PIXA 3RZFA 1SM2A 4TY1A 3RNYA 1G8AA 2WQBA 5JN2A 2FGIA 3GUBA 3LZBA 4U44A 5K4JA 4R77A 2J0JA 4MBIA 2WQNA 3G9NA 4C62A 4YLKA 3WI6A 4O7LA 2A4LA 3B2WA 4WIHA 2G15A 4BTJA 3LFSA 4BHZA 2PSQA 3GU4A 4ZTNA 3C4FA 3TDVA 2QODA 5E8SA 1M52A 1JSTA 4GEOA 5BUIA 4FV3A 4NFMA 5DMZA 2WMSA 5G1XA 1KSWA 2EUFB 2O65A 2REIA 5AR2A 3KXZA 1RJBA 4CYIA 1H8FA 2X6EA 5JGBA 2I0EA 4GFGA 3NW7A 3CCNA 3RK7A 3DKCA 5KKRC 1JNKA 3NEWA 1GOLA 3RINA 2PPQA 4M68A 4YNOA 4DLJA 2UZOA 2YCQA 1OI9A 3VS7A 4CFXA 3RZBA 3SOCA 2J0MB 1AQ1A 4I22A 2QO2A 5DIAA 1H01A 3GI3A 3RTPA 4NUSA 4C58A 1Q8WA 4J8MA 3NUSA 3DJ5A 3NZ0A 4WSQA 1IA8A 3FKOA 2E9UA 1VEBA 4XOZA 2VAGA 1ZMVA 2HWOA 4RG0A 3E8EA 4I6QA 4FTCA 1U54A 5IZFA 3U6JA 4DEHA 3FI8A 4G34A 5EQEA 2X4ZA 3QTSA 2X2LA 3HL7A 3OG7A 5DRDA 3GVUA 5GJGA 1LR4A 3U55A 4JX3A 3QD2B 4L3JA 1JQHA 4KNBA 2BKKA 2R3OA 3CE3A 2R5TA 3ITZA 2CN5A 3OFMA 5AP6A 3IW6A 3CXWA 3LFDA 3SW4A 5EQPA 3VWAA 4A9RA 4I5CA 2CCHA 4NCTC 4D5HA 4USFA 3TNQB 3VUKA 3ZDUA 2JAVA 3GCUA 3IG7A 3I0OA 2PK9A 2WKMA 4NWMA 2OICA 3NAXA 4YUQA 1S9JA 3I4BA 2RSVA 2X2KA 4ANMA 1ZLTA 4AA0A 2R0IA 2IW6A 1JKLA 4Q5EA 3V5JA 5E91A 2JBOA 4GYGA 4USDA 2QOCA 4QYGA 4MBLA 3PJ1A 3ZSIA 5GZAA 2F9GA 4EH5A 2CMWA 3UZRA 3M11A 4FKSA 2C47A 3QFVA 3D94A 5H8BA 2UW8A 1J1CA 3FMEA 3G6GA 4EBWA 2YM3A 4X6RA 3VRZA 4C3RA 1GZOA 5IQBA 1G8SA 3QD4A 4DG0E 4S33A 5JSMA 5DEYA 4FV7A 4D5KA 4YJUA 3KN5A 3QCSA 1B39A 4YPDA 5HCXA 1CM8A 3ALOA 5ETFA 4BFMA 2XJ2A 2W1GA 4L52A 1E9HA 2AC3A 1KE5A 2PVHA 3TZ7A 4ITJA 5HE0A 1SMHA 3AD4A 5I9ZA 1ZMUA 4ANLA 3JY9A 1OL5A 4CTCA 3FI4A 2J50A 3R8ZA 4BVUA 4YO4A 1IAHA 5AM6A 2VWUA 5ICPA 3KEXA 3QALE 5M4FA 2BCJA 2XM9A 2FSTX 3FWQA 1ND4A 2VTLA 3SV0A 4C0TA 3V51A 3HZTA 3FI2A 4ZSGA 4MXYA 5EW8A 4HCTA 3VN9A 4CV8A 4TYEA 4IXPA 2XNBA 3GC9A 3TV7A 1IG1A 2O63A 2OZAB 5AUVA 4YO6A 3DJ6A 3MB7A 4XUFA 2BFYA 4GT3A 2JKKA 4K33A 4AW5A 3QTRA 2R3GA 3DJ7A 2QOFA 4KIQA 4IC8A 4FNYA 4MEDA 3W18A 5E90A 2CGVA 2FVDA 3P7AA 4EI4A 2CNVA 3U8WA 3OXTA 4AN2A 4F6SA 2QD9A 3R22A 5HD4A 4D2PA 5CXHA 3CD8A 4NH1A 4AF3A 1UWJA 3QCQA 1AD5A 4U0IA 5EW9A 4G1WA 4AGUA 4DEIA 3CTQA 3PXFA 1DS5A 2YM8A 2JKMA 1Z5MA 3I81A 4V05A 3DKGA 1JSUA 2C0TA 3QUDA 5EH0A 3DLZA 3V8SA 4RC4A 3ZLWA 3MVJA 1RW8A 1OUYA 2HZNA 4D58A 2C4GA 3FY0A 3NUPA 3M42A 4R3RA 4C4IA 5AP2A 4D28A 3O17A 4EYJA 4V04A 2X4FA 2R4BA 3RALA 4JG6A 3P0MA 3ROYA 5F94A 4O7SA 3UDBA 4EYMA 5CS6A 3TNWA 2HY81 5DA3A 4QNAA 4FTJA 4BCKA 4Z7GA 2OJJA 2DUVA 3D2IA 5I9WA 2W4KA 2YITA 2OO8X 2YM4A 2PHKA 4MTAA 3UYSA 3IPHA 4A9TA 5IQDA 4GSBA 3WF7A 2Y4PA 4EOMA 3UPXA 3I7BA 4ZZMA 4Y8DA 3A4OX 4ASZA 3CQUA 1ZZLA 4XYFA 4IZAA 2W9ZB 4YSJA 3HV6A 4I23A 5J95A 4G3DA 2F2CB 2LGCA 2VTMA 2WOUA 5HIDA 1ZAOA 5IUGA 3QQFA 3E88A 3HMOA 5HI2A 3NYVA 3R2BA 1NVQA 4FK3A 4CFFA 2BR1A 3SRVB 4CMTA 5DH3A 3LFEA 2W1HA 4DA5A 3G51A 4XBUA 4HPUE 4UBAA 2C6DA 1SVGA 1YWNA 2PVMA 3I1AA 3KXMA 4HZRA 4QMUA 2XJ0A 1YI6A 3QTXA 2XIXA 3S2PA 3NCGA 3O50A 5DE2A 2UVZA 4JIKA 5CU2A 1RDQE 5D7VA 2ZV7A 3D9VA 3R00A 3R04A 4XG9A 3EFKA 1H07A 2UZVA 4C02A 4W4XA 3H9RA 3ZOSA 4DTKA 3O23A 1OBDA 1R78A 4S2ZA 2ITYA 2BAQA 4P5QA 5BMMA 2YFXA 3RGFA 3IOKA 4KIOA 3SDJA 3I6UA 3LFBA 4PTEA 3ZO3A 2NNWB 4JL9A 2G2FA 3TNIA 2XKCA 3IW4A 1OB3A 3OUKA 3R8PA 3KF7A 3QHWA 3ORTA 5CVGA 3DXNA 4B7TA 4P2KA 4O6EA 2BILB 3HUCA 3MH1A 4U43A 3R7OA 4YLLA 4BZDA 2OIBA 1FVVA 3PPZA 4I24A 4EK5A 2HK5A 5H3QA 2VX1A 4AZFA 4XG6A 5KZIA 4I3ZA 2WAJA 4LGGA 4DTAA 3OZ6A 3UC3A 4ZSEA 5AUZA 1FMKA 2ERKA 5HTBA 3LM5A 3QA0A 4YJSA 3N4VA 2IO6A 5DYJA 4RBLA 4DEEA 4CT2A 4RZWA 3O0GA 4JBOA 3NUNA 4BRXA 1XJDA 3PY3A 2B7AA 3DZQA 5J7HA 5FQDC 3D15A 2JFMA 4HVSA 4O6LA 5FP5A 2OU7A 1XO2B 2ACXA 1OUKA 4WRGA 4R6VA 1UWHA 4FI1A 3LXLA 2J6MA 3I5NA 1B6CB 4UYNA 5HCZA 2VTAA 1PYEA 4EOSA 2Y4IC 5L6OA 1Q4LA 5E8ZA 5AV1A 4CYJA 3MY1A 3TV4A 4ASEA 4EOKA 4GW8A 2JEDA 3CTHA 4R5SA 3A8XA 1UNLA 4O27B 3K5VA 4L8MA 1XH7A 5FEQA 2UW6A 5AUTA 3VF8A 2EU9A 5HU3A 2XIRA 2VTRA 3QKMA 4FV5A 4FA2A 4PX6A 5M55A 1Q97A 4O2PA 4X3FA 5B7VA 3O51A 5HO7A 4RC3A 1W8CA 3PA3A 4D9UA 2XNNA 2XRWA 4NKAA 2V55A 4O96A 2C3JA 3Q3BA 2VTSA 3BHUA 4WUAA 2IG7A 3BGZA 3V5LA 4UMQA 4RSSA 2XNPA 3EKKA 3MFUA 4GJ2A 4KBCA 1W82A 2OKRA 2W1ZA 4RIWB 3PXZA 3WZJA 5E8XA 2BZIB 4B6LA 2PZIA 3VBWA 5LWMA 3VBYA 3ACJA 3OWLA 5FM3A 3FQHA 3VBVA 4DFXE 5J1WA 4H3QA 5HKMA 2CDZA 3KF4A 3VS3A 4KKGA 4M69B 4KB8A 3L8XA 3QHRA 4ZSJA 3L8SA 3ZRMA 2IJMA 5FDPA 4O91A 4DH8A 4DBNA 2H6DA 5ANEA 3DNDA 3R28A 5A4EA 4S34A 4C4HA 4AOTA 2J2IB 3PIYA 4GUBA 4IZYA 5L8KA 4I4FA 1WVYA 4FUYA 4QP6A 4QP3A 2ZB0A 4NT4A 1SVHA 3OW4A 4R7IA 4X0MA 4A7CA 4F7JA 2R3FA 4MCVA 5LMBA 4QMQA 4FNXA 1A06A 5ETIA 3F69A 3C1XA 2ESMA 2EVAA 4MYGA 4BCQA 5AADA 3O7LB 4UALA 1AGWA 3TIZA 4L9IA 3HV4A 5AUXA 3ZDIA 3MJ2A 4ID7A 4PTCA 1F3MC 4R78A 4FNZA 4QMWA 2QO7A 4RLLA 4ENYA 2PMIA 1PXIA 3UVRA 4GK3A 2OFVA 4YGAA 3U6HA 1ZOEA 4D0WA 3NCZA 4ZTQA 3V8WA 4E4LA 1H1RA 3UZTA 4WG4A 2R3JA 2ITZA 3AMYA 4J8NA 1YXSA 1V0PA 3WF5A 1ZY4A 3WZKA 3PG1A 4BL1A 2NP8A 2QKWB 4YC6A 2OXXA 3TL8A 3GXLA 2JDOA 1IR3A 5EKNA 3VO3A 5JGDA 4XG8A 5HE2A 5KMMA 2B9JA 2NO3A 1YXUA 4HCVA 2GFSA 3W2PA 5BYYA 4BY9E 3UO5A 4PWNA 3C13A 2OSCA 3EKNA 2WMRA 2A27A 4IX6A 4XV2A 2B54A 4L7FA 4I5HA 2JLDA 3G90X 3KN6A 2IVVA 4LQMA 2W7XA 4BTMA 3U54A 3OOGA 3KMUA 4EOPA 4APPA 4MD7E 4GIHA 4DCAA 1LUFA 4MKCA 4IC7A 1DAWA 1MRYA 4G17A 2OH0E 4ALVA 3QL8A 3PWDA 5GJFA 4DH1A 1GJOA 3RK5A 5J9ZA 2YAAA 3FMKA 4AQCA 2XJ1A 3NSZA 5AR5A 1LEZA 4YZCA 3PY1A 3UMWA 2C0OA 4XX9A 4AS0A 2P0CA 2R3LA 4YBKA 1SNUA 2JIUA 5A4TA 4C3FA 4HVIA 2C1BA 2R3MA 5HX6A 1YOLA 4LM5A 2YLEA 3MWUA 4LGHA 3DAKA 2R7BA 4D2WA 1GY3A 3TT0A 4XMOA 3KCFA 3ORLA 1PXNA 3CSVA 2OF4A 2R3NA 1V1KA 3ZRLA 3V5WA 1P2AA 4QPMA 3GGFA 3Q60A 3EFWA 4QMYA 4OBQA 2BDFA 3B8RA 3R1YA 4DGLC 3F88A 1YWVA 2ZV2A 5AA9A 3LLAA 2O64A 5HZNA 2WMAA 4IVCA 1ZARA 5JRSA 2WELA 2BROA 3AGLA 3KRRA 5FBNC 2PVNA 2QR8A 4J53A 4NJDA 4W4WA 5CSXA 1Y8YA 4FG9A 2ZV9A 4I5MA 1RQQA 4CD0A 3GBZA 4XEYA 4JAJA 4RLKA 3WYXA 5BVEA 1Y57A 5ANKA 3MH0A 5AP0A 4RFZA 1FGKA 1JVPP 5LVPA 1FOTA 1OL2A 4JOAA 4B8MA 3NLBA 2IVSA 2CSNA 4LRKA 1DM2A 5CF4A 2PMLX 3PPJA 3RP9A 3TI1A 4AWIA 3OCGA 4BWPA 4CXAA 3RPSA 4G3FA 2AUHA 3FE3A 3ET7A 3BQCA 1PXMA 4I5PA 4BCJA 3ETAA 4JT3A 2PZ5A 4IH8A 4N57A 3HVCA 2R3PA 4NTTA 4GS6A 2E2BA 3ZSGA 2CLQA 4WA9A 2VWWA 2VRXA 3C4WA 5I9YA 1MP8A 3OY3A 1WMKA 3VJNA 5AP3A 5JQ8A 4IWPA 4YJPA 2R9SA 4FTIA 2OJIA 3NR9A 4TYGA 3VBTA 4USEA 2PZRA 2B1PA 2ETMA 2VWXA 4DGMA 5I0BA 4IAFA 1WVWA 4O7RA 3OBGA 3MVLA 3LMHA 3KA0A 3TEIA 1CKJA 4GG5A 4EOJA 2BIYA 4J96A 4NEUA 5LARA 1IASA 3TWJA 4BGQA 1H25A 4TPTA 3DBEA 4RWIA 3VUGA 4DE4A 2JBPA 5HX8A 4KIKB 5CZHA 4X2JA 5J8IA 4YZBA 5K5NA 3P1AA 5EM7A 4XBRA 3WYYA 5KBQA 5BUJA 4J1RA 3QBNA 4AG8A 2Z60A 2YIWA 3V3VA 4ASXA 3HMPA 3DB8A 4IAZA 4KKHA 3DV3A 3NRMA 3QTQA 3LQ5A 3LXNA 3D7TA 4LOOA 4NKSA 4FKUA 4FT7A 4AZVA 4C3PA 4K8AA 1FBNA 3A8WA 1V0OA 5FUTA 4RWLA 2OIQA 3HGKA 5FG8A 2GNIA 1OPKA 3DFAA 3RAKA 3FMDA 3VW6A 4U8ZA 4D2RA 5A4CA 3UQCA 3VAPA 4II5A 4RT7A 5HBJA 2YJSA 3Q04A 3FHIA 5A46A 2RFSA 4MNEA 4J97A 2VGPA 5C03A 5CQUA 1YXXA 4ANNA 1FMOE 3ZLYA 4YHJA 3GT8A 4PP9A 5LJJA 1DAYA 4BCMA 5F1ZA 2BALA 5EQYA 5LQFA 5AM7A 3G5DA 1V0BA 3TUDA 4F63A 4XH6A 2BHHA 4F0IA 3QRKA 4MK0A 4RJ6A 4KBAA 4CFUA 3PJ2A 2WIHA 5EM6A 5A3XA 4MXCA 4O83A 3ODZX 2AC5A 3KRLA 4O0VA 3TACA 3OW3A 4TYHA 1M7QA 3Q2JA 5H8EA 2W99B 3HKOA 3PRFA 4H3BA 4FYNA 4QP8A 1MRUA 2CLXA 1TQMA 2W17A 3FMHA 3MYGA 4YR8A 4I92A 4HGLA 3AXWA 2W1FA 4BDDA 4PDOA 1G3NA 4BI1A 2GTMA 3MJ1A 3ZO4A 5BVFA 5BNJA 3ZZEA 2WMBA 3QYZA 4LV5A 4MH7A 1YHWA 4EOIA 4HYHA 3G33A 3SX9A 5AA8A 4DFLA 3GU8A 2WNTA 3GENA 4FKJA 5ANIA 3VHKA 4CMUA 4EC9A 4UMRA 2CHLA 2UW7A 4K9YA 2IW9A 4KS8A 4L67A 2OXDA 2UZEA 1QPJA 3VS6A 2JIVA 1A9UA 1XH8A 3AQVA 4TT7A 5HIEA 3E7VA 4D4YA 1ATPE 4HGTA 2DQ7X 5IQAA 2VX3A 2YCSA 4O7ZA 4CLIA 5KHWA 5CEKA 1TVOA 1UNGA 3DLSA 3U6IA 4JBPA 2KULA 5M08A 5GIOE 3GCVA 3QD0A 3D14A 3EQBA 2Y0AA 4RQVA 4O84A 2QLQA 4FKLA 1H1PA 2R3QA 1P4OA 4MAOA 5M09A 4ZJVA 3NMUF 3HAVA 4FSWA 3VUMA 5FEEA 4XP3A 3CIKA 4GT5A 2OIDA 3GOKA 3TTJA 4LOQA 1JLUE 4QPSA 3ZUVA 3RMFA 2Q83A 4K2RA 3QQHA 3ALNA 4HPTE 2QVSE 5AV2A 5FP6A 3MI9A 5AUWA 3PRIA 4WNOA 2WTWA 3BE2A 3NX8A 5GJDA 4D1SA 2VNWA 3CTJA 4I1ZA 3HYHA 4EK8A 3C7QA 5GNKA 2ITPA 3GFWA 4BI0A 2GHGA 3H3CA 4YTIA 2FO0A 5L8JA 4QMTA 1U5QA 3TV6A 4FSNA 3V5QA 4FF8A 5AAEA 3RK9A 3GU6A 4U5JA 4FT0A 5KO1A 4KSPA 5C8NA 4LG4A 2B9HA 1PHKA 1OMWA 3DAEA 4ONAA 4FZDB 4Y5HA 3U4UA 3D5XA 5KX8A 3N4TA 2R3HA 4GVAA 3EOCA 3ORIA 2HXQA 2QO9A 4HYIA 3KULA 2EWAA 3KL8A 5BMSA 2X39A 5ANGA 3R73A 3P9JA 4AW1A 3FSKA 3BWFA 4WT6A 5E8WA 3BQRA 4I6HA 2J0IA 2JDSA 2YEXA 3P4KA 4BDCA 2X1NA 3OEFX 4HVDA 3Q5ZA 2JKQA 3RAWA 2HW6A 3WZEA 4LYNA 3UO4A 4RIYA 2ZAZA 5BQ0A 3LLTA 4GVJA 3SLSA 2GDOA 4KKEA 3FY2A 4KRCA 3FYKX 4PL5A 4FR4A 4IFCA 4AT4A 4IB1A 4RX8A 2J0KA 1OL1A 3AD5A 3R7EA 3S95A 3TN8A 4FKPA 3UQGA 4D2SA 5TE0A 4DFUA 3I79A 4ZAUA 5DRBA 3L9MA 3W16A 1VYZA 3DU8A 4AZWA 2YDIA 3QTZA 4EWHA 3ZHPC 5B0XA 3F2RA 5I9UA 3MY5A 3C9WA 3LFFA 2VO7A 4FL1A 4IWOA 4FSUA 3A4PA 1WVXA 5CSWA 5HHWA 3TTIA 4BDEA 2RFEA 5DBXA 3F5PA 3G6HA 3RKBA 4BCOA 4RJ4A 3VS4A 3AC3A 3COIA 3UZPA 2XNGA 4MWHA 4D2VA 4C4EA 2XZSA 4ZP5A 4HCUA 4MXZA 5DEWA 4F6UA 1GZNA 5IUIA 4U41A 2F7EE 4E20A 3EZVA 4FKOA 1ZYCA 1SNXA 1Q62A 1WBWA 3QU0A 3DK7A 3BU3A 3OVVA 3QLFA 3SAYA 2HENA 3UNZA 5LVOA 3D4QA 3NWWA 3NS9A 4AXAA 5LVNA 2HWPA 4RRVA 2X0GA 3EQHA 3MB6A 4RPVA 1U54B 4AGWA 4ZEGA 4KS7A 4DBXA 3Q5IA 3VBXA 1YHVA 4EONA 5IDPA 2V0DA 4C37A 3N51A 4FTMA 3L8VA 3HMIA 3DAJA 4FKGA 3ZM4A 5CF6A 1IA9A 3VC4A 4NIFB 1NXKA 5FEDA 3OS3A 3I6WA 4G5PA 4UXQA 2X6DA 5HICA 3VULA 3AGMA 4YJOA 1UKIA 2WMUA 2PY3A 3AC5A 3IKAA 4NM7A 3H4JA 2YM7A 2WIPA 5K3YA 5DR6A 2FSMX 4Q9SA 2GSFA 3KRXA 1YWRA 5T68A 3U9NA 3RPOA 3ZUUA 5HVKA 2C6KA 3HMMA 1MQBA 5J5SA 3CQWA 3MVMA 2C3LA 2CGUA 3CC6A 3G0EA 3VVHA 3W2SA 3QGYA 5C9CA 2V7OA 3Q32A 4UYAA 4F9YA 3MS9A 2IZTA 1F0QA 3BHTA 4M84A 4ARKA 4LRMA 3D5VA 3SG9A 3SG8A 2O8YA 3BHHA 3MTLA 3UG2A 3WOWA 3I0QA 4IW0A 3BX5A 5HLPA 1K3AA 1YVJA 3WZUA 3IO7A 2X9FA 4JR3A 1WBVA 2UZWE 4FVQA 4EH3A 2JDVA 1MQ4A 2XBAA 2RG5A 3R83A 2ZVAA 3OTVA 5JFXA 4G16A 4U80A 3IECA 4UWBA 1JOWB 3W55A 3DDQA 4K18A 2HY0A 3MIYA 4D4RA 2XEYA 3E3BX 5F20A 2YA9A 3GEQA 4U9AA 1XH9A 2O3PA 1BI7A 4HOKA 4FSYA 2BTSA 3UBDA 5D11A 2IZRA 2BTRA 4CQGA 3EQRA 2Z02A 3PXRA 2WOTA 2WMVA 3QZHA 4W8EA 4JDHA 3KB7A 1W7HA 1KOBA 2W1EA 4IAKA 1E1XA 4J98A 3BBWA 4M7IA 4OW8A 3UE4A 5IEVA 4BF2A 4DITA 2GTNA 4RWJA 4WBBB 2AYPA 1QPDA 2DYLA 4FIHA 3FLQA 3NDMA 3VBQA 2C5VA 3LJ0A 3R63A 4DEGA 5I4NA 5M44A 4ERWA 3QCXA 4CSVA 4WRSA 2WGJA 2F2UA 3UVPA 4DCEA 4BDBA 4FT9A 4NJ3A 2UW4A 3BE9A 4LOPA 5AX9A 5AUYA 4ERKA 4YBJA 5KMLA 1TKIA 1XBCA 3MSSA 4IBMA 3GC8A 3TJDA 2GHLA 4QRCA 2GFCA 5AAFA 4NK9A 2XM8A 2WMWA 2YM5A 2F4JA 4IFGA 3OXZA 3QX4A 4D0XA 5EOLA 3PTGA 4C2WA 3WBLA 3KU2A 3NYXA 5KCVA 4FEXA 3QTUA 1PKGA 4CG9A 4AOIA 5IQFA 4M13A 2R0UA 3LKMA 1T46A 2YDKA 5EHOA 2X7GA 2ITTA 4PL4A 3UGCA 1XH6A 4HVHA 3U9CA 2IZSA 1PRYA 2PVRA 4QQTA 1YI4A 2XVDA 1PMNA 2VWVA 2WTDA 2WTJA 1Q3DA 1PXOA 4IHPA 5CVFA 2ZDTA 4Q2AA 5CEOA 2V7AA 3QD3A 5CF8A 3F82A 1YXTA 3OEZA 5GIPE 3TZ9A 3LFNA 4IX3A 4FL2A 4AZEA 5DT3A 5C4LA 3GCPA 4QMVA 1Q5KA 2YHVA 4JS8A 1H00A 4RZVA 4EOOA 2XIKA 4EZ7A 2W1IA 2QOIA 2UVXA 4X2FA 2Z7LA 3RHXA 2XKFA 4RQKA 5AIRA 4RMZA 5E8VA 4EH8A 1OPJA 3E8CA 4IJ9A 4L3LA 4NCTA 5L2IA 1O6YA 3ZO1A 3MFRA 1Q8YA 3D5WA 4QP1A 4OTQA 5HBHA 4H58A 4PPBA 3W2QA 3EQDA 2VU3A 5D1JA 1Q61A 4DC2A 3ACKA 1KE6A 3KREA 5KE0A 1ERKA 2PZPA 3EN4A 3NUYA 1STCE 4AUAA 4Z16A 2YWPA 4BYIA 2B9FA 3BYUA 5CAPA 4JDJA 3KMWA 3AC4A 3D5UA 3PY0A 4HZSA 4QYEA 4EH2A 4QYHA 1KV2A 4MD8E 4BICA 4EHVA 3SW7A 4ACGA 3I60A 1PMUA 2P4IA 1M2PA 3FMJA 3GC0A 4E4MA 5KMJA 2WHBA 5TT7A 4B8LA 4M0YA 1KWPA 1JBPE 3ZEWA 5L6WL 2WTIA 2BZKB 3ROCA 4BR3A 2IZUA 3R8VA 3IDCA 4TNDA 1YHSA 5B2LA 3OCSA 4GT4A 5BVOA 3SXSA 4BWKA 2QG7A 3DT1A 2VTIA 4O0TA 2ZYBA 4UWYA 2VN9A 4FKVA 5L4QA 4E3CA 2BIKB 3A7GA 3FZPA 3BV2A 1B38A 4MNFA 4WHZA 4X21A 3FUPA 2QU5A 2UVYA 3DBCA 3ZSHA 4DH7A 3RNIA 4XHKB 1ZYJA 1KV1A 4Z3VA 2Y6OA 4I6BA 4LRJA 4UWCA 3EQGA 4OTDA 4RVLA 4FKIA 3W2OA 4EK4A 2YIRA 4RIXA 5M56A 4FIIA 4U42A 5JRQA 3O8UA 4O1OA 4MF1A 5M07A 1Q8TA 3NIEA 3SOAA 2C5NA 4RX5A 3GQIA 2WTVA 4O1PA 4EEVA 3QWKA 2J0LA 3QZIA 3C5UA 1YQJA 4C35A 4NSTA 4UMPA 3ATTA 3EQFA 3UOHA 4S32A 1OM1A 2HIWA 3ZC5A 4WUNA 3L9PA 1H1QA 3DA6A 5AV4A 3P79A 1J1BA 2PTKA 4AA4A 4EUUA 4P7EA 4H3PA 3PPKA 3F3VA 4UMTA 5AP1A 5D10A 1Q41A 4L42A 4TWOA 3DQXA 4CFMA 3KK8A 1YDRE 3LJ1A 4G2FA 1JKTA 4G31A 2Y6MA 3RWPA 4JX7A 3HRBA 3UVQA 5EI8A 5C4KA 1KE7A 4R7BA 5AP5A 4XLIA 1OKWA 2J7TA 2VZ6A 3CPBA 5C8MA 3PVWA 2JFLA 4IAYA 3PZEA 3NNUA 2HXLA 4QPAA 4XRLA 5E92A 4FV1A 3FMNA 4BCIA 4HGEA 5EI2A 2UZLA 4FV9A 2QOQA 3LXKA 3MH3A 3OT8A 1UV5A 4IWQA 1GZ8A 4A07A 4BKYA 1FINA 2OG8A 2EB2A 4GIIA 1Y6BA 4IVBA 3HDMA 4O0SA 4ZTHA 4FSRA 4IE9A 5IA2A 3F61A 2H8HA 2OWBA 2W5AA 4PP7A 2IWIA 2J9MA 2VO3A 3ZU7A 3P86A 4XNEA 4FKTA 2VTTA 3KC3A 5JFVA 2XK9A 4C7TA 5CAVA 3V6RA 4HW7A 4TW9A 5E8YA 3O8PA 4Y73A 1OBGA 1MUOA 5IMXA 2QONA 4R1VA 4X3FB 4CZTA 1UU8A 4ZTLA 3TZMA 2XUUA 3QGWA 3GCSA 4MF0A 4R1YA 5FM2A 4Z7HA 4G3GA 4S30A 4G6LA 3PLSA 2BFXA 3DZOA 3ZMMA 2G9XA 3OWJA 2ZMCA 1VZOA 2GCDA 2GNFA 3IS5A 3KVWA 4KIPA 3GB2A 1P5EA 3QQKA 5CALA 5AFVA 4J71A 4IX5A 3DKFA 5AIKA 3BWJA 3E64A 4GH2A 5C26A 5IA0A 4DTBA 3R7GA 2C5YA 5EDRA 1FVTA 1E1VA 2OJGA 3PWYA 3F2NA 5F9EA 4GG7A 3VIDA 4FODA 3NPCA 1M7NA 5JH6A 4HJOA 5JK3A 3PSBA 4OAUC 5KZ0A 2UUEA 4U6RA 2J5FA 4M12A 3FXXA 2W0JA 4PF4A 5CF5A 3A61A 3QX2A 2KTYA 5AP7A 3AD6A 4O7NA 4O7VA 2F49A 5D12A 5CSPA 4LUEA 5H8GA 5KMNA 2R2PA 2PVFA 5E8UA 3R1SA 4YU2A 3IW7A 1L3RE 5FGKA 3R7VA 2XP2A 1OIUA 1YDSE 4CKRA 4RJ7A 4EWQA 1H0VA 3UMXA 4FBXA 2H9VA 4ZLOA 2F7ZE 4M69A 3BEGA 3RCJA 3NNXA 3DFCB 3HX4A 4NW6A 4ZIMA 4QP2A 3GP0A 4XCUA 2P3GX 4W4YA 3U87A 2I40A 3FZ1A 2XBJA 3PVBA 2C6LA 4O0WA 5A6NA 5C1QB 5CEMA 2CNQA 3MGYA 2P2IA 3SD0A 2UZUE 2XNEA 3QCYA 3LIJA 2EXMA 3V6SA 3DDPA 4QMLA 5A6OA 5CASA 2OGVA 4IEBA 3LVPA 4YP8A 4HVGA 3POZA 2FA2A 4NL0A 4IM0A 3H9OA 4TZRA 4BIBA 5KHXA 3PYYA 3E92A 5CU3A 3FZTA 2UV2A 2QQ7A 3QRTA 5AR7A 2NPQA 3CJFA 2WMQA 4F6WA 4MXXA 3K5UA 5BX0A 3UP7A 3LMGA 3EN6A 3LHJA 2W96B 4FVRA 4OTHA 4E26A 2CKEA 2YCFA 5FD2A 4KWPA 5CEPA 4FG7A 3R9HA 1CKPA 2VNYA 5AR4A 5HOAA 4OBOA 3RVGA 3FL4A 3BELA 3EQCA 4F9CA 4Y85A 1QPEA 3F5UA 5IF1A 2PU8A 4Y95A 3MFSA 4IX4A 4YHTA 4CQEA 1YW2A 1SVEA 2VTOA 2BZJA 3SXFA 3THBA 5A4QA 4F9BA 3UC4A 4ZS0A 1DI9A 4EQCA 3E7OA 4F99A 4OLIA 5IDNA 3OWPA 1TQPA 3MDYA 4IWDA 2WPAA 5D41A 3R9OA 4ACDA 4DFBA 1LPUA 4X2GA 4XP0A 3L1SA 4FK6A 3N9XA 5M53A 4O0UA 4TN6A 5CVHA 3PXKA 3VQHA 4BIDA 3PXQA 1EH4A 4UY9A 4X3JA 1M14A 5LMKC 2GS7A 4XS2A 4AAAA 4BC6A 4CCBA 2PUPA 1YOJA 2YJRA 3MW1A 4MWIA 5AMNA 5ACBC 4F1OA 3IGOA 4ZY4A 1OGUA 1Y6AA 3ULZA 1ZY5A 4BZOA 5IG1A 5E9EA 4GK4A 4CNHA 1OITA 4O7YA 1GZKA 4EH7A 5KNJA 1R39A 1ZXEA 3AT2A 4JRNA 3ZBFA 5AR3A 4WNMA 4GFOA 4I0TA 5GINE 4UV0A 5L2QA 4UMUA 4LV8A 2BRBA 3HMNA 3Q4ZA 4HYSA 5EKOA 4C36A 1M2RA 3E62A 1OIRA 3BZ3A 4PMMA 4PPAA 3BKBA 1Q24A 3K3IA 4L68A 5DWRA 3ZFXA 5CENA 2GS2A 2ZMDA 4YJRA 1GNGA 3NAYA 5LMAA 4H05A 4QTAA 3R6XA 1WBNA 4L3PA 3PE2A 4W9XA 2IW8A 1WBSA 3T3UA 4U81A 3QRJA 4FV6A 3QYWA 4YTCA 4IACA 1QPCA 3GOPA 3KMMA 4AE9A 4ZLZA 4NYEA 3QWJA 1WBPA 4FX3A 2VWYA 4JBVA 4WSYA 3HP5A 2JDRA 1ZMWA 5ITAA 4KD1A 3PLAE 3KXNA 3F3TA 2YWVA 1I44A 2XMYA 1ZYLA 2G01A 4RFMA 1OIQA 3RAHA 5AX3A 4CFVA 2E9VA 2Z8CA 4IDTA 2X2MA 4OT6A 1JSVA 5FDXA 2PZYA 4DFZE 2GPHA 3AT3A 4QP9A 4QYYA 3K54A 4FSZA 1WBOA 5IEXA 2XKEA 4FIJA 2B9IA 2C3KA 2WB8A 3L9LA 4IMYA 4P4CA 3OROA 3SA0A 4FTAA 4O21A 5CWZA 5CAQA 3AOXA 4U7ZA 1QL6A 3II5A 5CI6A 5E1SA 3H0ZA 5I9XA 3PJCA 3ORNA 2DWBA 4BTFA 4C57A 4A9SA 2GS6A 2I0VA 1KE9A 2VO6A 4RC2A 2HAKA 3ULIA 5HLNA 2VTHA 3CLYA 3HNGA 3MA6A 2BRHA 3OD6X 2CN8A 3ZCLA 1TQIA 2C6TA 3F6XA 4H1MA 3FBVA 5ACKA 2LAVA 3ZEPA 2RFNA 5CU6A 4JLCA 4EBVA 2PVYA 5CX9A 3CJGA 3D7TB 3O71A 5IQHA 2I0HA 4L7SA 2XA4A 3F7ZA 3AC8A 4OTIA 2IVTA 2F57A 3HECA 3UJGA 4L44A 3B2TA 2HELA 2ITVA 3PUPA 4V01A 4FTNA 3VNTA 3ZC6A 3S0OA 4GKIA 4FICA 5TOZA 2ZOQA 2YN8A 4MHAA 4GU6A 5CLPA 3SHEA 1BL6A 2WXVA 2A19B 3SVVA 4JG8A 5E7RA 2OLCA 3BU6A 4ANOA 4FIGA 3ZFMA 4CKIA 4MNEB 4A4XA 1J7LA 5L2TA 2PUIA 4PV0A 4BDHA 3ORXA 2J51A 1H27A 2BPMA 2YIQA 3AC1A 4LFIA 5ANJA 1J91A 1MRVA 3MN3A 1L8TA 3FPQA 4JDIA 5JZNA 5JEBA 4X7QA 1REJA 4B9DA 2ITNA 2YLFA 3PVGA 3R8UA 2WU7A 2BAJA 4JQEA 4OUCA 1LP4A 4FYOA 4OTGA 1J7IA 3OBJA 5HO8A 1BYGA 4F0GA 3FHRA 5BVKA 2CJMA 3ZZWA 4ZZOA 2C5OA 1OL7A 4KSQA 5AP4A 2C0IA 2EXEA 4TWPA 4NW5A 1ZZ2A 5J7BA 4ZK5A 1OZ1A 3GCQA 3QQJA 2PE2A 3BHYA 5LVLA 4RJ8A 4CMOA 3TDWA 1UU9A 1XHAA 4O86A 4X2KA 4Y72A 1JPAA 4E6AA 4YMJA 5E1EA 3EIDA 5C8KA 4FZFB 1GIHA 4M15A 5IEYA 3NUXA 4PDPA 4ZXTA 2ITOA 2BRMA 3FC2A 1UU3A 2WZJA 4AP7A 4WNPA 5J1VA 4R3PA 4BCNA 2PE0A 4FVPA 4G9RA 3BI6A 1H26A 4DEDA 4QYFA 4EUTA 4FEQA 5HVJA 5TR6A 4YSMA 3UP2A 3UOLA 1QMZA 3UTOA 3DCVA 3MPAA 1XWSA 4AN9A 2NRUA 3QZFA 4IIRA 1P14A 3CQEA 3KCKA 3BRBA 4BGHA 2RL5A 5ETAA 2EB3A 3UPZA 1NVSA 4F09A 4C59A 3MTFA 4BCGA 1H24A 5EYKA 5L6PA 2BDWA 4RJ3A 4RX7A 4N0SA 1UNHA 4NM0A 4QMZA 2XKDA 3T3VA 3HV3A 4EJNA 5JT2A 3R02A 2JIIA 4AT5A 4FUXA 3WF8A 2BUJA 3R2YA 3RPRA 3ZRKA 3A7FA 3SGCA 4UB7A 4AA5A 3F7WA 4F9WA 4QTEA 4E5BA 3UIUA 4EH4A 3HRCA 4YZ9A 5FTGA 2XK3A 2YDJA 3FZOA 3IGGA 1ZWSA 4XJ0A 5HTCA 3S3IA 2JGZA 5J79A 3Q9YA 2ITUA 3W8QA 4DEAA 1O6LA 4NZWB 4XG7A 5HNBA 3FV8A 3HA8A 1VYWA 5I3OA 5BYLA 2VWBA 1H08A 4DGOA 4EZ3A 2CKOA 4IJPA 3ANRA 5KMKA 3LCTA 2Z7RA 2XB7A 4QP4A 4V0GB 4D4SA 5IH4A 1J7UA 2WMXA 4K11A 4ZMEA 3QKKA 2RF9A 3KULB 3RM6A 2SRCA 4CZUA 1IAJA 4L45A 3FPMA 3EWHA 4M97A 3OY1A 1FQ1B 3EYHA 5JKGA 5M4UA 1REKA 1KE8A 3RAIA 4C33A 3QF9A 3Q2MA 2XCKA 3LW0A 4YTHA 1UKHA 4WNKA 5HBEA 5HESA 1XQZA 4F64A 3JR1A 1OKVA 4A9YA 3TUCA 4RIYB 4DT8A 4G6OA 4ZOGA 4MXOA 2PL0A 3LFAA 4PNKA 4XLVA 5JQ5A 4TXCA 4ZTRA 3B8QA 2G1TA 4PTGA 4YPSA 4M66A 3FQSA 1NY3A 1R0EA 3ZM9A 4NU1A 5C27A 4CZYB 2VTJA 4WG5A 3MA3A 3CBLA 2EXCX 3BYSA 1Z57A 2W4OA 3CS9A 4N4SA 5HQ0A 4BKZA 4PL3A 3BYVA 1U46A 5CAUA 2I7QA 3G9LX 4GMYA 3UIBA 4OGRA 3P7BA 2R3KA 5IUHA 3ZXTA 1U5RA 4D1XA 2V5QA 2WU6A 4JVGA 5K0KA 4EOLA 4LI5A 2YM6A 4GJ3A 5I9VA 4FEVA 1YDTE 1H0WA 3QQLA 4FTUA 4H1JA 4PMPA 3C51A 3DKOA 2GHMA 5CY3A 4C4FA 1CKIA 3EQIA 3OP5A 4JXFA 3OCBA 2OW3A 4CCUA 3REPA 4O22A 5HG7A 5LXMA 4RWKA 4E4XA 2YACA 2W06A 3TKHA 2H34A 4AFEA 4KAOA 5AUUA 4E1ZA 1FPUA 3KGAA 3KVXA 4WD5A 3CPCA 3FKLA 3HV7A 3BYMA 4QP7A 5HG8A 3G2FA 3FLSA 2FB8A 5DT0A 3RM7A 3HLLA 3GU7A 3QUPA 4L43A 5CU4A 5JZJA 5EFQA 2X8IA 4IAAA 4MD9E 4PRJA 4F7NA 3IK3A 3EYGA 4F7LA 2ERZE 4ZS4A 2C30A 1W83A 3HEGA 4YNEA 5CTPA 4E5WA 2HZIA 4I6FA 4YJNA 4ZJJA 5HE3A 4AW2A 2RG6A 4ACHA 4FKWA 3FZRA 5CI7A 1APME 1BKXA 1BL7A 4FT3A 3FKNA 4QMSA 5E8TA 3HDNA 3QQUA 5M4IA 4E4NA 3ODYX 4QMMA 4EHGA 5HG5A 3FLWA 4E8AA 4GV1A 4HNFA 3E87A 3QRIA
chains in the Genus database with same CATH superfamily
2Y9QA 3FLZA 4PDYA 4Q9ZA 4O81A 4C8BA 4DN5A 4EHZA 2Z2WA 3NW6A 4AZTA 4P5ZA 2BAKA 5T6KA 2XIZA 3KRJA 4TKSA 1GIIA 2XNOA 4NIFA 5T3QA 4D2TA 3V01A 4IZ7A 4DGGA 4TTHB 3W32A 1JKKA 4BBFA 3KQ7A 3UYTA 3KK9A 1PXPA 3DOGA 3Q4CA 2QG5A 4IANA 3O8TA 3TJCA 4EHEA 5I3RA 4MQ1A 5EK7A 3C5IA 3HAMA 4EH9A 3OTUA 4RA5A 3R7YA 4M8TA 4YZDA 4FZAB 4Y5QA 2CCIA 4OT5A 3BV3A 5IISA 1NA7A 2HYYA 1M2QA 3UNJA 2QLUA 2QOOA 4CEGA 4O4BB 1ZOGA 4BGGA 3OMVA 2UZTA 3EHAA 2PVKA 4HYUA 3R7IA 2Z7SA 2HW7A 3RJCA 4JQ8A 1Q8UA 2UZDA 4QQJA 2VO0A 1Q99A 3PJ8A 4ITHA 4ANBA 4XG4A 3UDTA 2P55A 4DLIA 4FKQA 3H10A 4EC8A 4R7HA 2E9PA 4RFYA 3W33A 4FTLA 3D0EA 1HOWA 4LMUA 4EJ7A 2ITWA 2QU6A 2GNGA 3ERKA 4FV4A 4APCA 2WQOA 2P33A 2J4ZA 3DQWA 3JYAA 2IVUA 3BLHA 4O38A 4AGCA 5AEPA 5M06A 4TNBA 4L46A 4PUZA 3W0QA 3FJQE 4WO5A 3TKIA 5FXRA 4JRVA 5C01A 4ALWA 3DB6A 4FGRA 2RKUA 2XK8A 5A9UA 2QOBA 4ZY5A 4EZ5A 3ZS5A 3ENMA 3NGAA 4DINA 2X0OA 4L53A 5DOSA 4EKKA 5IH5A 5KKRB 2H96A 5GZ8A 4BBEA 3LCDA 4W4VA 4EKLA 1J3HA 4DH5A 3L8PA 2QHMA 4L01A 5AR8A 3ANQA 3BIZA 1URCA 1ZOHA 2VUWA 2ETRA 4N70A 1OPLA 4K0YA 1H1SA 2C68A 3COHA 2PWLA 5J87A 5M57A 4Z55A 1O6KA 5HTIA 2OJ9A 3LFCA 4C61A 4NM5A 4YC3A 4F7SA 2O5KA 2UW0A 4GCJA 3R01A 5TKDA 2OK1A 3OC1A 3TM0A 3SXRA 1GIJA 4QMOA 5HLWA 3IOPA 1PMEA 3PZHA 1Q8ZA 1LEWA 3A2CA 3CEKA 3F2AA 5M4CA 4LL5A 2VWZA 3PP0A 3MVHA 4KINA 2IPXA 4FKRA 3LMIA 3O7LD 5EG3A 1X8BA 3QTWA 3LAUA 4FV0A 5L2SA 4G6NA 4TRLA 1W84A 3OHTA 2B52A 4FT5A 1F5QA 2OZAA 3IDPA 4W9WA 4N6ZA 1S9IA 3KKVA 5A4LA 5BYZA 4EH6A 2WMTA 4U3YA 4WKQA 2E9NA 5LCKA 4BYJA 3NYNA 3QAME 2IN6A 5J9YA 1FGIA 3P5KA 1JKSA 4LL0A 4QQCA 2J90A 3R8LA 3FMMA 3P23A 4PMTA 3DTCA 3QTIA 5EOBA 4BKJA 5AAGA 4QD6A 4ZSAA 4FSMA 3AMBA 5IPJA 4I21A 4FOBA 4R8QA 5H9BA 3E63A 4B99A 3TCPA 2CPKE 2XH5A 4FL3A 2HCKA 3GC7A 3HRFA 3LJ2A 4DEBA 4BDKA 1URWA 2ZM4A 3ORPA 4IDVA 4CVAA 3O2MA 2ZM3A 3LOKA 3QC9A 4G9CA 4K77A 4L6QA 1BUHA 4WG3A 2VTQA 4PDSA 5AV0A 4O4EA 4AZSA 3KIOC 2RIOA 3Q9WA 3KXXA 4FZ6A 4OTPA 4IVDA 4DFNA 5CU0A 5HNGA 2QOKA 3FSFA 1PXLA 5CQWA 3TZ8A 5DT4A 2BDJA 5A14A 4CKJA 2VV9A 3DK6A 5EYMA 5B2KA 1WBTA 5ETCA 4LGDA 3DBFA 5FTQA 2DS1A 4K6ZA 4X3FC 3WZDA 1R3CA 5J9LA 4EL9A 3WILA 3VW8A 4UEUA 3BLQA 2ZJWA 4J95A 4I0SA 1Q3WA 5CT0A 4I93A 4JNWA 2YERA 3MIAA 4QTCA 5IMEA 2QCSA 4O82A 3CR0A 2RGPA 2OBJA 3Q52A 4RIXB 2B4SB 5CSHA 2CKQA 3CKWA 3BCEA 1UVRA 3O96A 3VHEA 2A2AA 2W05A 2OFUA 3IW8A 4P90A 3E8DA 3JXWA 4FIEA 3PJ3A 2BMCA 2WO6A 3NUUA 3V04A 3VUIA 4TL0A 3CY2A 5F4NA 1H28A 5EYCA 4ZSLA 2XK4A 4DF3A 3V5PA 3R9NA 3QXPA 3SRVA 4BCPA 2OXYA 2PVJA 4JBQA 4HGSA 3I5ZA 3RBWA 5DLSA 3ATSA 4ZTMA 3WF6A 2YAKA 5HCYA 3CY3A 2FSLX 3F3UA 2RFDA 3NVMB 4FSTA 2YZLA 2X7OA 2NYAA 3N4UA 4DH3A 5L2WA 4DFYA 3P08A 1BI8A 3UIMA 4CFWA 4GRBA 4MXAA 5CSVA 5KBRA 5AWMA 5BVDA 1ST4A 2C69A 1OKZA 1Z9XA 4QTBA 3D83A 4NM3A 2CNUA 1W0XC 4BJJB 4RX9A 2OZOA 2VTPA 3AMAA 5DHJA 3TUBA 5D7AA 4BB4A 2Y8OA 3C4CA 3S1HA 4M14A 3WE8A 3W1FA 3UODA 5J5TA 4O2ZA 2XYNA 4ENXA 3NFFB 3H9FA 2XARA 4ZMFA 3DS6A 4QTDA 2C6MA 4XV9A 3H0YA 3LCOA 3JVSA 3ELJA 3A62A 4I94A 1W98A 3FZSA 3ZO2A 3T9IA 3EB0A 4YJQA 4OTWA 3NW5A 1WFCA 2PYWA 3PP1A 4BZNA 2FH9A 4ZLYA 4RIOA 3VUTA 2PUNA 4L00A 4C4GA 4GKHA 4EK6A 4FGBA 2B53A 3FLYA 5GZ9A 4ZTSA 4GYIA 1P4FA 5DPVA 2P2HA 4YZNA 3JY0A 4QQ5A 3UOKA 2GMXA 3DTWA 1PW2A 3PSDA 5GHVA 4AN3A 3TYKA 5LVMA 3U4WA 2QOLA 3C0IA 2W4JA 1PXKA 4FC0A 4C4JA 2R3RA 1BLXA 2C1AA 2ZV8A 2Q0BA 4QMPA 5HIBA 1OVEA 4GU9A 4CV9A 3QKLA 2NRYA 4JAIA 4PNIA 3QUEA 5KUPA 4W8DA 4LUDA 3LFQA 3EN9A 5IA5A 4M3QA 2JD5A 2C6IA 4KBKA 2OF2A 3ZLSA 3PXYA 2QHNA 3NIZA 3TNPC 2FYSA 4AX8A 2R3IA 1OECA 3RPVA 3RCDA 5A54A 4FSQA 2XNMA 2VGOA 2XIYA 3E5AA 3PA4A 3PDTA 4I0RA 2WTCA 1I09A 2UW5A 3K2LA 2GQRA 1T45A 2XS0A 3FAAA 4HNIA 3V5TA 3OWKA 1DI8A 3WF9A 2W1CA 1VR2A 3ZXZA 4BDAA 2HOGA 1PYXA 4M67A 4E6CA 2I0YA 3Q4UA 4QT1A 4RIWA 4UX9A 3OCTA 1PJKA 3ZONA 3GFEA 4YJTA 3WIGA 2I6LA 5BPYA 3F5XA 4EQUA 5ANOA 4PY1A 5HD7A 4OR5A 3P78A 5CNNA 3Q9XA 5TF9A 1H1WA 4DG2E 3D2KA 4JIAA 5EDPA 3R71A 3FXWA 1BMKA 1YXVA 1XKKA 3VS5A 3BPRA 5I5ZA 4KUJA 3W0SA 4C38A 3MESA 3IONA 3LXPA 5BV3A 4U79A 4QNYA 4YLJA 1JAMA 4AXDA 4BWXA 2G2HA 3KY2A 4J99A 5L3AA 4M0ZA 4NFNA 4R3CA 1YKRA 4E73A 3A7JA 2WD1A 5DFPA 3POOA 5E4HA 4FOCA 4ACCA 5HNIX 4MX9A 3ORMA 3KXGA 4RGJA 1YOMA 3CP9A 4O7WA 1SZMA 5BVNA 3DXQA 4F65A 4BTKA 5AJQA 3W2CA 1A48A 4IM2A 3CGFA 2GNHA 3KRWA 4YHFA 4BIEA 4F1MA 4WBOA 3OT3A 4DT9A 4DGNA 2E9OA 1OKYA 4E6DA 3UG1A 3A99A 3NNWA 4NTSA 4AGDA 1NT2A 3BGPA 3TKUA 1H4LA 4O0RA 2BRGA 4BBMA 4EQMA 4U3ZA 3TNHA 2Y4IB 3FQEA 4ITIA 3W2RA 5K5XA 3FDNA 4XP2A 5CANA 4AE6A 1BX6A 5HG9A 2ETKA 2HZ4A 3AG9A 2WFYA 4ORKA 3TG1A 1XH4A 3DPKA 3V8TA 3VJOA 2CKPA 2BHEA 3BGQA 3UDSA 5EYDA 4GUEA 1QCFA 1CSNA 5CZIA 1XBBA 3S00A 3BYOA 4XG2A 4IAIA 3RWQA 3Q9ZA 3W8LA 3R8MA 4CGAA 3Q96A 1M17A 2A98A 3CGOA 3LQ8A 3JPVA 3OF0A 5DR9A 1G8KA 2PVLA 4YZMA 3VS2A 3EFJA 4C2VA 4UXLA 3S4QA 3EL8A 4D4VA 4FEWA 1HCKA 3E93A 4DAWA 1CTPE 5JFSA 3E8NA 1XH5A 4EORA 5HE1A 3FLNC 5B2MA 4FTKA 3KFAA 5TO8A 3PIZA 1JWHA 5KMOA 3W0PA 3RHKA 5K0XA 5HO6A 4F0FA 4YURA 3ZUTA 3HP2A 2GNJA 1RE8A 2XCHA 2VWIA 4XG3A 2XF0A 5IQEA 3H30A 3R9DA 3IW5A 3NVKI 2C3IB 3QA8A 4OAVB 2QKRA 1R0PA 3MV5A 4FE2A 1ZYDA 4JQ7A 3W10A 5M51A 3DNEA 3L9NA 3DGKA 3T8OA 1PF8A 4B4LA 4BDFA 4EOQA 5EDQA 2PMOX 2YABA 4KRDA 4E6QA 3F66A 4JG7A 3CD3A 3U51A 4F70A 4UZDA 5H2UA 3JUHA 3AT4A 2ITQA 2WQEA 3BBTB 3R30A 1K2PA 2GU8A 2F7XE 4OTFA 4PMSA 5IA3A 4JDKA 3RPYA 3UQFA 5EM8A 4GL9A 2GNLA 4XV1A 4QOXA 5CEIA 4XRJA 2R7IA 2BRNA 4FV8A 4JR7A 2Y7JA 5FLFA 3EN5A 2J5EA 3R1QA 3IQ7A 3MPMA 4O7TA 1UU7A 5DN3A 1OIYA 4DG3E 4ASDA 2OI4X 2WTKC 4GK2A 3AC2A 3DBDA 2XK7A 4PPCA 3UIXA 4C34A 1KUTA 2OJFE 4Q5HA 4J52A 3G0FA 3PFQA 2V62A 3WIKA 3OOMA 4AFJA 3SKCA 2XYUA 4I41A 2ONLC 4RVTA 1ZYSA 2UZBA 3QZGA 4G3CA 4O0XA 4OTRA 4BI2A 5CAOA 4F4PA 1ZRZA 1FVRA 2QOHA 4IQ6A 2QR7A 3M1SA 4IVAA 5DVRA 4AXCA 3VUHA 5IU2A 4F1TA 2QI8A 2VD5A 5HVYA 5CEQA 4CT1A 4Y83A 3QC4A 4KA3A 4FV2A 4N6YA 2XRUA 3QLGA 4A9UA 3FC1X 3C4XA 3LE6A 3PG3A 2QC6A 4IB5A 4D9TA 3UOJA 2C6OA 2VTNA 3DXPA 2GQSA 4A4LA 3Q4TA 3ORZA 4FTTA 4Y46A 1GAGA 5K9IA 4G3EA 3SQQA 2ZM1A 4MQ2A 1OL6A 3LQ3A 1UA2A 3RI1A 3JS2A 4FIFA 4WOVA 3M2WA 3R0TA 3PSCA 4CTBA 2B55A 4A4OA 5K4IA 3ORKA 3LCSA 3TIYA 5LOHA 5IQCA 2CGWA 3A7HA 2YIYA 3OUNB 2PULA 1O9UA 4QMXA 5EM5A 4JI9A 5DG5A 3GQLA 3NNVA 4DYMA 3VUDA 3BHVA 4CG8A 3DBQA 4I4EA 4AT3A 3DK3A 4AOJA 3C50A 3EN7A 4U97A 4FMQA 4KIKA 4IM3A 4PQNA 3R21A 4RVKA 3F3WA 3QQGA 5CYIA 3ZH8A 4BDJA 4D55A 5HGIA 4EK3A 2UW3A 3K3JA 2O2UA 4U45A 5KMIA 5LWNA 5DGZA 3UNKA 2R64A 5LMKA 3Q53A 4MVFA 5IQIA 5CXZA 2W1DA 5FTOA 4YC8A 3MY0A 4AQKA 3PUFC 2YZAA 4BHNA 2BKZA 2BZHB 5EHLA 2FSOX 2W5BA 4YTFA 5HORA 2C6EA 3GU5A 2WEVA 4TYHB 1U59A 2JDTA 3WARA 4UZHA 5FXQA 3DY7A 1NW1A 4LDTA 2WTKB 3FYJX 2QNJA 4QMNA 4FZ7A 2X81A 1Y91A 4I20A 4G5JA 3EMGA 3CKXA 2GQGA 5IKWA 5AV3A 1IEPA 4CRSA 1WCCA 4FNWA 3MFTA 5CNOA 5FBOA 4Z9LA 5FXSA 5IQGA 4AW0A 2YCRA 3ZTXA 2XEZA 3JVRA 4LMNA 5IA1A 3AKLA 3NUAA 4X2NA 4RJ5A 3FEGA 4IB3A 5G6VA 3C4EA 3A60A 3EQPA 4A06A 2ITXA 3C4ZA 1R1WA 2I1MA 3C0HA 4TYJA 4RA4A 2OH4A 4XV3A 4AU8A 2C5XA 5FWKK 2X8DA 3KXHA 4U40A 5HU9A 5DR2A 3NYOA 4BCFA 4J7BA 3TXOA 3SC1A 5BUEA 5LCJA 4CRLA 2PE1A 3A7IA 3PA5A 3R1NA 2ONLA 2X8EA 3ID6C 3FXZA 3VS0A 1XBAA 1VJYA 1WAKA 2JITA 3HUBA 2G2IA 4ANQA 4TWCA 1WZYA 3Q6WA 3F5GA 4QO9A 2W5HA 5EI6A 4K1BA 1HCLA 2YISA 3QRUA 2WQMA 3ENHA 3COMA 2JAMA 3E3PA 3COKA 3MPTA 2Z7QA 3G15A 4FG8A 4ZZNA 2JKOA 3LCKA 3EH9A 4TWNA 2VX0A 4B0GA 1IRKA 3T9TA 2XANA 2UZNA 1PXJA 2FUMA 3I7CA 4TYIA 3ZLXA 4ALUA 2YIXA 5BVWA 1CDKA 4ANSA 4FEUA 5DNRA 3VRYA 3FL5A 4CFNA 4BDGA 4F08A 2B0QA 4MBJA 3QXOA 4JJRA 3WE4A 2ZDUA 4H39A 4BCHA 4XOYA 3R9RA 1XR1A 4R5YA 4ZJIA 2ZB1A 4ZY6A 4H36A 3OXIA 4X6QC 3Q6UA 4OBPA 4UN0C 3R7UA 4E7WA 5CT7A 2Q0NA 4RVMA 1K9AA 4IB0A 5EHYA 2JC6A 4E93A 5IH6A 2PUUA 4FTQA 4S31A 2CGXA 2WEIA 3BU5A 3EJ1A 5F95A 1PMVA 3UO6A 3ZBXA 3MBLA 5HEZA 3HV5A 3VQUA 1NVRA 4AACA 1PKDA 2PMNX 1CMKE 1KOAA 1YI3A 3C0GA 2O0UA 2BVAA 3MH2A 4DHFA 4FTOA 3W0RA 2A1AB 3FI3A 3GNIB 3IDBA 3LM0A 4FTRA 4ACMA 1SYKA 2A0CX 4E5AX 4F9AA 3BLRA 5L8LA 3EFLA 3PVUA 3VF9A 4IADA 3BEAA 5IA4A 4YJVA 5JMSA 1G5SA 3D7ZA 3ZFYA 3HA6A 3EZRA 4IZ5A 4CLJA 1Y8GA 2V22A 4KABA 5EW3A 3VS1A 2X7FA 4O0YA 4V0GA 1YRPA 5JFWA 4D1ZA 1PY5A 3ZYAA 3F9NA 5ANDA 2QURA 5JGAA 3F3ZA 4BN1A 2UW9A 3PE1A 3EL7A 3FMLA 3LPBA 2HZ0A 5DI1A 2W9FB 1U4DA 5D9HA 4BDIA 5FRIA 2X9EA 2XK6A 4GFMA 3P7CA 3PIXA 3RZFA 1SM2A 4TY1A 3RNYA 1G8AA 2WQBA 5JN2A 2FGIA 3GUBA 3LZBA 4U44A 5K4JA 4R77A 1G8JA 2J0JA 4MBIA 2WQNA 3G9NA 4C62A 4YLKA 3WI6A 4O7LA 2A4LA 3B2WA 4WIHA 2G15A 4BTJA 3LFSA 4BHZA 2PSQA 3GU4A 4ZTNA 3C4FA 3TDVA 2QODA 5E8SA 1M52A 1JSTA 4GEOA 5BUIA 4FV3A 4NFMA 5DMZA 3W0MA 2WMSA 5G1XA 1KSWA 2EUFB 2O65A 2REIA 5AR2A 3KXZA 1RJBA 4CYIA 1H8FA 2X6EA 5JGBA 2I0EA 4GFGA 3NW7A 3CCNA 3RK7A 3DKCA 5KKRC 1JNKA 3NEWA 1GOLA 3RINA 2PPQA 4M68A 4YNOA 4DLJA 2UZOA 2YCQA 1OI9A 3VS7A 4CFXA 3RZBA 3SOCA 2J0MB 1AQ1A 4I22A 2QO2A 5DIAA 1H01A 3GI3A 3RTPA 4NUSA 4C58A 1Q8WA 4J8MA 3NUSA 3DJ5A 3NZ0A 4WSQA 1IA8A 3FKOA 2E9UA 1VEBA 4XOZA 2VAGA 1ZMVA 2HWOA 4RG0A 3E8EA 4I6QA 4FTCA 1U54A 5IZFA 3U6JA 4DEHA 3FI8A 4G34A 5EQEA 2X4ZA 3QTSA 2X2LA 3HL7A 3OG7A 5DRDA 3GVUA 5GJGA 1LR4A 3U55A 4JX3A 3QD2B 4L3JA 1JQHA 4KNBA 2BKKA 2R3OA 3CE3A 2R5TA 3ITZA 2CN5A 3OFMA 5AP6A 3IW6A 3CXWA 3LFDA 3SW4A 5EQPA 3VWAA 4A9RA 4I5CA 2CCHA 4NCTC 4D5HA 4USFA 3TNQB 3VUKA 3ZDUA 2JAVA 3GCUA 3IG7A 3I0OA 2PK9A 2WKMA 4NWMA 2OICA 3NAXA 4YUQA 1S9JA 3I4BA 2RSVA 2X2KA 4ANMA 1ZLTA 4AA0A 2R0IA 2IW6A 1JKLA 4Q5EA 3V5JA 5E91A 2JBOA 4GYGA 4USDA 2QOCA 4QYGA 4MBLA 3PJ1A 3ZSIA 5GZAA 2F9GA 4EH5A 2CMWA 3UZRA 3M11A 4FKSA 2C47A 3QFVA 3D94A 5H8BA 2UW8A 1J1CA 3FMEA 3G6GA 4EBWA 2YM3A 4X6RA 3VRZA 4C3RA 1GZOA 5IQBA 1G8SA 3QD4A 4DG0E 4S33A 5JSMA 5DEYA 4FV7A 4D5KA 4YJUA 3KN5A 3QCSA 1B39A 4YPDA 5HCXA 1CM8A 3ALOA 5ETFA 4BFMA 2XJ2A 2W1GA 4L52A 1E9HA 2AC3A 1KE5A 2PVHA 3TZ7A 4ITJA 5HE0A 1SMHA 3AD4A 5I9ZA 1ZMUA 4ANLA 3JY9A 1OL5A 4CTCA 3NFGB 3FI4A 2J50A 3R8ZA 4BVUA 4YO4A 1IAHA 5AM6A 2VWUA 5ICPA 3KEXA 3QALE 5M4FA 2BCJA 2XM9A 2FSTX 3FWQA 1ND4A 2VTLA 3SV0A 4C0TA 3V51A 3HZTA 3FI2A 4ZSGA 4MXYA 5EW8A 4O4CA 4HCTA 3VN9A 4CV8A 4TYEA 4IXPA 2XNBA 3GC9A 3BL7A 3TV7A 1IG1A 2O63A 2OZAB 5AUVA 4YO6A 3DJ6A 3MB7A 4XUFA 2BFYA 4GT3A 2JKKA 4K33A 4AW5A 3QTRA 2R3GA 3DJ7A 2QOFA 4KIQA 4IC8A 4FNYA 4MEDA 3W18A 5E90A 2CGVA 2FVDA 3P7AA 4EI4A 2CNVA 3U8WA 3OXTA 4AN2A 4F6SA 2QD9A 3R22A 5HD4A 4D2PA 5CXHA 3CD8A 4NH1A 4AF3A 1UWJA 3QCQA 1AD5A 4U0IA 5EW9A 4G1WA 4AGUA 4DEIA 3CTQA 3PXFA 1DS5A 2YM8A 2JKMA 1Z5MA 3I81A 4V05A 3DKGA 1JSUA 2C0TA 3QUDA 5EH0A 3DLZA 3V8SA 4RC4A 3ZLWA 3MVJA 1RW8A 1OUYA 2HZNA 4D58A 2C4GA 3FY0A 3NUPA 3M42A 4R3RA 4C4IA 5AP2A 4D28A 3O17A 4EYJA 4V04A 2X4FA 2R4BA 3RALA 4JG6A 3P0MA 3ROYA 5F94A 4AAYA 4O7SA 3UDBA 4EYMA 5CS6A 3TNWA 2HY81 5DA3A 4QNAA 4FTJA 4BCKA 4Z7GA 2OJJA 2DUVA 3D2IA 5I9WA 2W4KA 2YITA 2OO8X 2YM4A 2PHKA 4MTAA 3UYSA 3IPHA 4A9TA 5IQDA 4GSBA 3WF7A 2Y4PA 4EOMA 3UPXA 3I7BA 4ZZMA 4Y8DA 3A4OX 4ASZA 3CQUA 1ZZLA 4XYFA 4IZAA 2W9ZB 4YSJA 4QDEA 3HV6A 4I23A 5J95A 4G3DA 2F2CB 2LGCA 2VTMA 2WOUA 5HIDA 1ZAOA 5IUGA 3QQFA 3E88A 3HMOA 5HI2A 3NYVA 3R2BA 1NVQA 4FK3A 4CFFA 2BR1A 3SRVB 4CMTA 5DH3A 3LFEA 2W1HA 4DA5A 3G51A 4XBUA 4HPUE 4UBAA 2C6DA 1SVGA 1YWNA 2PVMA 3I1AA 3KXMA 4HZRA 4QMUA 2XJ0A 1YI6A 3QTXA 2XIXA 3S2PA 3NCGA 3O50A 5DE2A 2UVZA 4JIKA 5CU2A 1RDQE 5D7VA 1OGYA 2ZV7A 3D9VA 3R00A 3R04A 4XG9A 3EFKA 1H07A 2UZVA 4C02A 4W4XA 3H9RA 3ZOSA 4DTKA 3O23A 1OBDA 1R78A 4S2ZA 2ITYA 2BAQA 4P5QA 5BMMA 2YFXA 3RGFA 3IOKA 4KIOA 3SDJA 3I6UA 3LFBA 4PTEA 3ZO3A 2NNWB 4JL9A 2G2FA 3TNIA 2XKCA 2XAMA 3IW4A 1OB3A 3OUKA 3R8PA 3KF7A 3QHWA 3ORTA 5CVGA 3P5JC 3DXNA 4B7TA 4P2KA 4O6EA 2BILB 3HUCA 3MH1A 4U43A 3R7OA 4YLLA 4BZDA 2OIBA 1FVVA 3PPZA 4I24A 4EK5A 2HK5A 5H3QA 2VX1A 4AZFA 4XG6A 5KZIA 4I3ZA 2WAJA 4LGGA 4DTAA 3OZ6A 3UC3A 4ZSEA 5AUZA 1FMKA 2ERKA 5HTBA 3LM5A 3QA0A 4YJSA 3N4VA 2IO6A 5DYJA 4RBLA 4DEEA 4CT2A 4RZWA 3O0GA 4JBOA 3NUNA 4BRXA 1XJDA 3PY3A 2B7AA 3DZQA 5J7HA 5FQDC 3D15A 2JFMA 4HVSA 4MUQA 4O6LA 5FP5A 2OU7A 1XO2B 2ACXA 1OUKA 4WRGA 4R6VA 1UWHA 4FI1A 3LXLA 2J6MA 3I5NA 1B6CB 4UYNA 5HCZA 2VTAA 1PYEA 4EOSA 2Y4IC 5L6OA 1Q4LA 5E8ZA 5AV1A 4CYJA 3MY1A 3TV4A 4ASEA 4EOKA 4GW8A 2JEDA 3CTHA 4R5SA 3A8XA 1UNLA 4O27B 3K5VA 4L8MA 1XH7A 5FEQA 2UW6A 5AUTA 3VF8A 2EU9A 5HU3A 2XIRA 2VTRA 3QKMA 4FV5A 4FA2A 4PX6A 5M55A 1Q97A 4O2PA 4X3FA 1W2FA 3O51A 5B7VA 4RC3A 1W8CA 3PA3A 4D9UA 5HO7A 2XNNA 2XRWA 4NKAA 2V55A 4O96A 2C3JA 3Q3BA 2VTSA 3BHUA 4WUAA 2IG7A 3BGZA 3V5LA 4UMQA 4RSSA 2XNPA 3EKKA 3MFUA 4GJ2A 4KBCA 1W82A 2OKRA 2W1ZA 4RIWB 3PXZA 4FJVA 3WZJA 5E8XA 2BZIB 4B6LA 2PZIA 3VBWA 5LWMA 3VBYA 3ACJA 3OWLA 5FM3A 3FQHA 3VBVA 4DFXE 5J1WA 4H3QA 5HKMA 2CDZA 3KF4A 3VS3A 4KKGA 4M69B 4KB8A 3L8XA 3QHRA 4ZSJA 3L8SA 3ZRMA 2IJMA 5FDPA 4O91A 1TZDA 4DH8A 4DBNA 2H6DA 5ANEA 3DNDA 3R28A 5A4EA 2IEWA 4S34A 4C4HA 4AOTA 2J2IB 3PIYA 4GUBA 4IZYA 5L8KA 4I4FA 1WVYA 4FUYA 4QP6A 4QP3A 2ZB0A 4NT4A 1SVHA 3OW4A 4R7IA 4X0MA 4A7CA 4F7JA 2R3FA 4MCVA 5LMBA 4QMQA 4FNXA 1A06A 5ETIA 3F69A 3C1XA 2ESMA 2EVAA 4MYGA 4BCQA 2XALA 5AADA 3O7LB 4UALA 1AGWA 3TIZA 4L9IA 3HV4A 5AUXA 3ZDIA 3MJ2A 4ID7A 4PTCA 1F3MC 4R78A 4FNZA 4QMWA 2QO7A 4RLLA 4ENYA 2PMIA 1PXIA 3UVRA 3AKJA 4GK3A 2OFVA 4YGAA 3U6HA 1ZOEA 4D0WA 3NCZA 4ZTQA 3V8WA 4E4LA 1H1RA 3UZTA 4WG4A 2R3JA 2ITZA 3AMYA 4J8NA 1YXSA 1V0PA 3WF5A 1ZY4A 3WZKA 3PG1A 4BL1A 2NP8A 2QKWB 4YC6A 2OXXA 3TL8A 3GXLA 2JDOA 1IR3A 5EKNA 3VO3A 5JGDA 4XG8A 5HE2A 5KMMA 2B9JA 2NO3A 1YXUA 4HCVA 2GFSA 3W2PA 5BYYA 4BY9E 3UO5A 2AQXA 4PWNA 3C13A 2OSCA 3EKNA 2WMRA 2A27A 4IX6A 4XV2A 2B54A 4L7FA 4I5HA 2JLDA 3G90X 3KN6A 2IVVA 4LQMA 2W7XA 4BTMA 3U54A 3OOGA 3KMUA 4EOPA 4APPA 4MD7E 4GIHA 2IF8A 4F78A 4DCAA 1LUFA 4MKCA 4IC7A 1DAWA 1MRYA 4G17A 2OH0E 4ALVA 3QL8A 3PWDA 5GJFA 4DH1A 1GJOA 3RK5A 5J9ZA 2YAAA 3FMKA 4AQCA 2XJ1A 3NSZA 5AR5A 1LEZA 4YZCA 3PY1A 3UMWA 2C0OA 4XX9A 4AS0A 2P0CA 2R3LA 4YBKA 1SNUA 2JIUA 5A4TA 4C3FA 4HVIA 2C1BA 2R3MA 5HX6A 1YOLA 4LM5A 2YLEA 3MWUA 4LGHA 3DAKA 2R7BA