4IANA

Crystal structure of apo human prpf4b kinase domain
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
330
structure length
321
Chain Sequence
RVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLREVLKKYGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNESKTILKLCDFGSASHVADNDITPLVSRFYRAPEIIIGKSYDYGIDMWSVGCTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDREKVTVMSTINPTKDLLADLILPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Serine/threonine-protein kinase PRP4 homolog
publication title Evaluation of Cancer Dependence and Druggability of PRP4 Kinase Using Cellular, Biochemical, and Structural Approaches.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 321
sequence length 330
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ianA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ianA01
4FK3A 5FGKA 4YSJA 2YM7A 1GIJA 3ZLYA 4EHGA 4FTAA 4FSUA 2YDIA 3EN7A 5EOBA 1LR4A 3B2WA 4XV9A 2JITA 3MA6A 3ORNA 4R6VA 5KHXA 2XNPA 3GCSA 2QVSE 3QTUA 1NXKA 5IQAA 3GEQA 5GZAA 4DITA 3AC5A 1UVRA 3DV3A 4AQCA 5A54A 3U6JA 2CLQA 2LGCA 5EI2A 3SRVB 2JDRA 3AD5A 3QC4A 4ERWA 2RKUA 4I92A 2HELA 3SQQA 1APME 1FMOE 4C4EA 3P4KA 4M67A 4U5JA 3UQCA 1K2PA 2JC6A 3O0GA 4CT2A 5C1QB 1CDKA 3UIXA 4DN5A 3UOLA 3BX5A 3DJ6A 5IQGA 3D14A 3EQGA 3TZ9A 4LL5A 2GS6A 5CAOA 3E88A 3QTXA 2X8IA 5J8IA 5K4IA 3OY3A 4TNBA 3CY2A 3UO6A 4WG5A 1LPUA 1REJA 3BHHA 1H1RA 3LJ2A 3QZHA 4RLLA 3SHEA 1YI3A 3U6IA 5M53A 3D83A 4YSMA 1AGWA 1FQ1B 3A7HA 2JAVA 4X2NA 2OWBA 4OGRA 1OL2A 5CAVA 4YZMA 3GFWA 2BUJA 4R3RA 1OI9A 4DFLA 2WQEA 3BV2A 3M11A 4UWYA 3UOKA 2HW7A 4BICA 5EW9A 3PIXA 1H26A 2QCSA 3SKCA 4M14A 4E7WA 2VWBA 2WTIA 3R73A 3HMPA 5AP0A 4MXYA 1U54A 2RG5A 4XX9A 4ZOGA 4IC8A 4BRXA 3NUAA 3QD2B 5HQ0A 2H9VA 3SOCA 3VO3A 2ZV7A 4G9RA 5B2KA 3GUBA 3Q5ZA 1OECA 2R3LA 4MHAA 3MBLA 3G51A 4KIKA 3WF6A 3OT3A 1WVYA 2PYWA 4OBQA 1KE5A 3EQBA 1PRYA 2AYPA 3A2CA 1YOJA 4GCJA 4AA5A 5IH4A 2V0DA 5DI1A 2XKEA 4I93A 4LYNA 4MX9A 4K18A 4RIXA 3DLSA 3O23A 5IMXA 5DE2A 5EM5A 4TWCA 1O6KA 3JS2A 2R3PA 4IWPA 3UG1A 4JRVA 4RMZA 3ZSIA 3FWQA 5CVHA 3QHWA 2WZJA 3OUKA 4FF8A 4DFUA 2B7AA 2OSCA 3ZSGA 4AG8A 1YOLA 4K11A 4ZXTA 2VTHA 2IW6A 2O63A 3MY5A 1XH4A 3CD8A 3E8EA 4D4VA 4XRJA 4BKZA 4FZAB 5AUTA 4U43A 2WIPA 2XK7A 4LV8A 3LZBA 4QTDA 5AP6A 5D9HA 3TZMA 3VRZA 3PP1A 4EOMA 2XCHA 1W7HA 4HOKA 2YIWA 3BHUA 4JVGA 4WBOA 3UGCA 4AT4A 2ITZA 2ZOQA 5CAUA 2W06A 4LUDA 1YWVA 2OJGA 2XM9A 1KE9A 2XBAA 4GG7A 4DT9A 4RPVA 1FGKA 3QXOA 5FTGA 3BGZA 5BVEA 3H9RA 4S31A 5GHVA 2H96A 3DNDA 4PTGA 2PE1A 3RM6A 3N9XA 4BWKA 5LVNA 1IG1A 4FKPA 3AMBA 4J52A 4Y85A 3GI3A 3H30A 5L2SA 1Q61A 3EQIA 3PVUA 3CQEA 4G3CA 4AZTA 4DEAA 1JSVA 3W2QA 4YMJA 3VS2A 4G6LA 2IW8A 1OL5A 2WTKC 3R9OA 2C68A 1BLXA 3GQIA 3ZXTA 2XNEA 3LFCA 3D5UA 4EOLA 4XG7A 2C0OA 4O7VA 1NW1A 3FLNC 4H36A 4MCVA 5DEWA 3ZCLA 4I21A 2JKMA 3GOKA 4FI1A 4O86A 4JNWA 4USEA 3AT4A 3Q2MA 5E91A 3E93A 3VUMA 4WRGA 3AMYA 2JLDA 5JQ5A 3PWYA 2ZDUA 3Q9ZA 2R9SA 5CWZA 4ACCA 1SVHA 4EYMA 4FYOA 3L9MA 3NNXA 4O7ZA 2XVDA 4S2ZA 3TACA 2F49A 2G2HA 3L8SA 4P90A 5IA2A 2VTPA 2GS7A 2SRCA 3UQGA 3TUDA 3LMIA 2CGWA 2OW3A 4LRKA 5CEQA 4J7BA 2A19B 3W8LA 4U79A 4QMOA 3WIGA 2VTAA 3KKVA 5DWRA 2CGVA 4QMPA 3THBA 3MS9A 1OPLA 2OJFE 2O2UA 3LJ1A 4BFMA 3V5QA 3RPOA 4O1PA 5HNIX 4O0VA 4A9SA 1FVTA 3BYOA 4X6QC 3MJ2A 3TV4A 2G2FA 3EFWA 3W2RA 1PMUA 3DKCA 4YURA 4ORKA 2E9UA 5CXZA 4FBXA 3VULA 4P7EA 4MXZA 4R78A 4GRBA 3VW6A 4D2PA 4AN3A 4DG2E 4HJOA 4ZMFA 3I7BA 1G8AA 3CPBA 4KBKA 1H8FA 1A48A 3QWJA 5CTPA 4NUSA 4ZLOA 1OL6A 2W0JA 4ASDA 3V5LA 4FSTA 2QOBA 2RFNA 2JKQA 2W9ZB 3CPCA 3R2BA 3ZDIA 3ZLWA 1URCA 3C4EA 5CU3A 5LVPA 4C35A 3MIYA 3WE8A 3V6SA 4MF0A 2GHLA 4FG9A 5K5XA 4HGEA 4MAOA 3MGYA 4CNHA 1ZMWA 5ACKA 4ACMA 4BC6A 4X2FA 1YW2A 2WMVA 5A9UA 4JR7A 2ITWA 2C30A 2QOCA 3Q04A 4O96A 3R8UA 1VR2A 2CJMA 3RHXA 3CE3A 4I0RA 2YDKA 4HPUE 5TOZA 4FV8A 1QMZA 2UV2A 3DBDA 4G6OA 5LXMA 2W1DA 2QLUA 3D5VA 3ZC5A 4CFWA 5JQ8A 3DXQA 2YIYA 4I22A 4IDTA 2FSOX 3PTGA 4PMMA 4QYEA 4YPSA 3R00A 3KXXA 3V6RA 5IDPA 3A8XA 2RIOA 3ENHA 3DBEA 3OY1A 3ZUUA 1UU7A 4MXCA 3EOCA 3UYSA 2F2CB 4ZTSA 4ALUA 5KE0A 3ET7A 3I0QA 3BYVA 4ANSA 4NT4A 5JGAA 2ITTA 2X6EA 4GK4A 3LPBA 3U9NA 4O27B 3MI9A 4EH9A 1H0WA 3U4WA 4DEDA 3EQHA 3NZ0A 3TDVA 4NM0A 3ZO2A 3Q53A 3UJGA 3F7ZA 3V8WA 4B8MA 5KUPA 4UXLA 2B0QA 3KN6A 1ZYSA 4ERKA 2XF0A 5HI2A 2QR7A 4FZFB 4DTAA 2EU9A 4I5HA 2VU3A 3FMEA 3PG1A 4B8LA 1JOWB 4UALA 3U8WA 5AUVA 2R3RA 3NGAA 4A07A 3NUNA 4AW2A 4D5KA 5G1XA 4AF3A 3DA6A 4DG0E 4I6BA 4YJUA 3DK7A 5H3QA 2VWIA 4CCBA 3T3UA 4Q9SA 3D5XA 4GEOA 4UMUA 4IC7A 4XV2A 4WSYA 2VTQA 5JZJA 1FVVA 4GV1A 1OKYA 3L9PA 4OW8A 4UWBA 5GJGA 4ZTMA 3QCQA 4IH8A 5AFVA 1L3RE 3R83A 4O91A 3BHTA 3FLQA 3Q3BA 2YISA 4JBPA 2R7BA 3BPRA 5CT7A 5CYIA 3TNQB 2P2HA 4CFNA 4HPTE 3UO5A 4IEBA 3EHAA 4QPSA 4IACA 3EFJA 2PTKA 3B8QA 4FL1A 1K3AA 3OW4A 2KULA 4TNDA 2YCRA 4FR4A 2XNBA 5AV2A 3AC4A 1B38A 3DK6A 4FOCA 3LLTA 1W98A 3NAYA 2R5TA 1Q8TA 1OVEA 4Y46A 3U55A 3GCQA 2C5VA 3RMFA 4C61A 3A8WA 2XM8A 5KMJA 5FXSA 4XLIA 3SDJA 3ZFXA 3VRYA 4G5JA 4XP3A 2XNOA 3G33A 5BQ0A 4D2TA 3UC4A 3NYVA 5GINE 1ZYDA 5J95A 4DLJA 4U3YA 2G1TA 5CF5A 3BEAA 3MSSA 3LM0A 3ZFMA 1YXVA 4QQJA 4FG8A 5J5TA 1YXSA 5AV4A 2XK4A 3ZOSA 4Y8DA 4YC3A 4E4LA 4ZSGA 1T46A 3BWFA 2HCKA 2JDVA 4GVJA 4YJSA 1XJDA 4H3PA 3T8OA 4BCQA 5DRBA 4BTMA 3OTVA 3ZRLA 4O21A 1ZY4A 5I9WA 1ZMUA 2WMSA 2IVUA 3IDBA 2I0HA 4NW6A 3MWUA 4I6QA 4W4YA 5AR5A 5B7VA 2ZV2A 2QR8A 4G3GA 4H39A 1YQJA 3TV6A 3LFFA 3R28A 4QD6A 2EB3A 3QYZA 4EH7A 4NFNA 4MNFA 4F7JA 2WD1A 1YDTE 3FPQA 4FE2A 3R7YA 3KL8A 3PY1A 2PU8A 4FYNA 3MTLA 5CI7A 3K2LA 5TO8A 4RFZA 3ZHPC 4AZEA 3LXPA 4L67A 4BGQA 3QQUA 5F95A 4GIHA 3SXSA 4W4XA 4AN9A 3QTRA 3IK3A 4BDIA 1BI8A 3ETAA 2JIUA 5ANDA 4WIHA 4DH1A 4J71A 1AD5A 3VUGA 3HDNA 4RSSA 3OC1A 4RC4A 2GTMA 4FEXA 5HG7A 1U59A 3ODYX 5KBQA 4IAAA 2J0JA 1IRKA 2R3QA 3R22A 1ZLTA 2X7OA 4EOQA 4X3FA 1UKHA 3AXWA 5D7AA 3SV0A 4B9DA 2UW8A 4CT1A 2UW7A 4F0FA 2BTSA 2BR1A 3FAAA 4JDIA 2BRBA 4G3DA 2O65A 4L01A 2VZ6A 2R3JA 2JDOA 2QQ7A 2F7EE 3RK5A 3W18A 4NKSA 1KOBA 4BBEA 3CP9A 4XG3A 3UVPA 4IE9A 3IW5A 4JL9A 1NVSA 1Q8UA 5CEPA 4ZJVA 5LQFA 2B52A 4MF1A 2R2PA 3S95A 1KE6A 2G15A 3PWDA 4FTIA 2GNLA 3TWJA 5BMSA 3O2MA 4A9YA 2QURA 4NWMA 5AP4A 4CLJA 2P3GX 3W1FA 4NU1A 4JLCA 4BZDA 2OH4A 4Y5HA 4A06A 2J0MB 5JSMA 2W5HA 3PRIA 3BRBA 2IJMA 4DC2A 3DNEA 1H4LA 4QTEA 5K4JA 4FSRA 4EH3A 4FT7A 4YZ9A 2W7XA 3DKOA 1YXXA 4FV6A 3F6XA 3I4BA 1OPJA 4QP4A 4X2GA 5HTIA 2DUVA 2YDJA 3VBVA 3R02A 4EOSA 3FSKA 1P14A 4E4XA 3BGPA 1BKXA 2JKKA 5KMIA 5EHLA 4R5YA 3W8QA 5BPYA 2HXQA 5CEKA 2ZJWA 1ZYJA 4KS8A 3NUSA 4XUFA 3N4VA 2ITXA 3F66A 5JGBA 2VX3A 4AZVA 5DMZA 1DI8A 1H07A 3TKIA 2BTRA 4YZDA 4RJ4A 5L6OA 2BHHA 2ZAZA 2JDSA 2FSTX 3UNJA 1SNXA 5H8EA 3F2AA 3NEWA 1GY3A 4BR3A 3MB6A 3LJ0A 2DS1A 2VTIA 4FGBA 3IW4A 4EQCA 4A9TA 1WBOA 4ALVA 4ENXA 4FSYA 1IASA 3BE9A 5BVFA 1XH7A 3OCGA 4MNEA 4OBPA 4PL5A 3TG1A 5HX6A 2XBJA 3WF5A 3UPZA 3RAWA 5LARA 2GDOA 3BI6A 3EZRA 3IW7A 5HCYA 4TW9A 3RAHA 2FO0A 3CGFA 4OLIA 3LQ3A 3IGOA 4EZ5A 3PY3A 3CTHA 4KSQA 4UY9A 3DDPA 5K0KA 3R8MA 4EHEA 2VO7A 3PE1A 4YLKA 4HNIA 2WKMA 3ENMA 3GNIB 3D7ZA 2CGXA 5DNRA 4C37A 4CFVA 2O5KA 4GT4A 4WO5A 4DT8A 3F5PA 3QGYA 4MQ2A 4I4FA 4NCTC 3FLZA 2C5OA 1JKLA 1URWA 1OKZA 4UEUA 4D5HA 2HWOA 2RFEA 2OF4A 4M68A 5KMNA 3BYSA 3E92A 4IX5A 4EH2A 4FKRA 2XIKA 5ITAA 4EWQA 4D1XA 4H58A 4NJ3A 4F7NA 4P5ZA 2OIQA 3D94A 5JFSA 2PZYA 4FUYA 1Y8GA 4FSNA 3S2PA 3RM7A 1Q4LA 1ZWSA 5EYKA 2BHEA 3O96A 4MD8E 2B9IA 3V01A 4ITJA 2CNVA 2ZMDA 1PKGA 4ACHA 3EQPA 1NVRA 4X6RA 5HVYA 3UVQA 1TVOA 3U51A 4QP7A 4AZSA 4IWDA 1H25A 4ASZA 4FEWA 1Y57A 4G3FA 3VS3A 4MBJA 2W1HA 2PVJA 3QRJA 4FKWA 3R01A 4L9IA 4FZ7A 4KABA 4OAVB 3IS5A 4E5AX 3SG9A 4M84A 3CIKA 2UZDA 1Q5KA 4BCJA 2J7TA 3BYMA 2UVZA 1MUOA 2BKZA 3E64A 5J9ZA 2QOQA 3HL7A 2J4ZA 3N51A 4RX7A 3P23A 3HV6A 4PDPA 2R3MA 4GJ2A 4L53A 4O6EA 2WMQA 1CMKE 2JIVA 4J8NA 4D1SA 4CFUA 4RT7A 5J79A 1PXOA 3L1SA 5FBOA 4BF2A 2Z2WA 3LXKA 4AGCA 4U42A 5IEXA 4E73A 2Q0BA 2XP2A 4QP9A 4RJ7A 3MYGA 2OIBA 1OIYA 3OMVA 4LMUA 4TYEA 3ERKA 4WG3A 4JIKA 3QLGA 3RPYA 4ZS4A 2PZPA 4TRLA 3HV7A 1JLUE 3PA5A 3MH0A 4FICA 5CF4A 3IO7A 4IQ6A 5GZ8A 2VWVA 3NAXA 4ANOA 4IM2A 5B2MA 2X8DA 3W55A 2VWXA 4C02A 4YTHA 3QD3A 4HZSA 4Y5QA 4GU6A 1LP4A 1GOLA 3AMAA 3PXZA 4FKTA 4Q5HA 5C03A 1DAYA 5HLPA 4XG8A 2C69A 2XIYA 4QNAA 2Y6OA 4LOOA 5I9YA 2X7GA 3DLZA 4PMSA 4AT5A 5LVLA 5A4CA 5DG5A 3R7VA 3K54A 4DCEA 2XIZA 1T45A 2JIIA 3GCPA 4ANQA 1FBNA 4PX6A 4QYHA 1CKIA 3R8VA 5A4QA 3TCPA 4BDFA 3BIZA 3EYHA 4W8EA 4ZY4A 3FKLA 4FK6A 4PTCA 4CFXA 3CR0A 2OI4X 3MPAA 5L6PA 2OBJA 3DKGA 5BUJA 5CZIA 4F64A 3MY1A 4BCIA 1IAHA 1CSNA 2WEVA 3R8PA 1QPJA 4I6FA 5ICPA 3PVBA 4AFJA 4ACDA 3CJFA 4AXAA 3LCSA 4YTCA 4R3PA 5CZHA 1VEBA 4JG7A 3C50A 2C0TA 4Q2AA 1M2QA 2VAGA 3GGFA 4JAJA 4LGDA 2YIQA 5CSWA 2WTVA 2ZV9A 4AU8A 3W33A 5FP5A 5J1WA 3F88A 4XP0A 5EHYA 4HCUA 4BDKA 3QGWA 4GVAA 4CV8A 4FSMA 3GU4A 1ZYLA 3R1YA 3V8SA 3PJ8A 2QD9A 1IEPA 2A4LA 1V0OA 3P86A 4QTCA 1FINA 4L3PA 1P4OA 4IAKA 4LFIA 4Y83A 4LUEA 4IDVA 2UW5A 3T9IA 5C8MA 2WGJA 4FV1A 1SVEA 4WSQA 4M3QA 2OGVA 4UV0A 3VHEA 4HVGA 4LRMA 4CZUA 1H0VA 3DTCA 4OR5A 1XO2B 5FG8A 4BBFA 4C34A 3V04A 5HBHA 2QKWB 4NEUA 5F20A 3QTWA 3KCKA 3BLRA 3OUNB 4XNEA 4NL0A 1QCFA 3SA0A 4Z3VA 4FT9A 1OZ1A 3F69A 2QI8A 4RWKA 1YWNA 5DHJA 1IR3A 3MY0A 1YOMA 5FXQA 2GU8A 4I3ZA 4X2JA 2R3HA 2XKDA 2Z7SA 4N4SA 4EC8A 4HVHA 2REIA 4F4PA 3QZIA 4RJ8A 3S1HA 2O3PA 3FXXA 2QODA 1GIIA 2B9FA 3SXFA 3GC8A 3WYYA 4IVCA 2WMXA 3NR9A 1KE8A 2BFXA 2ITOA 4M69A 5IEYA 2IVSA 2VV9A 2GQSA 4IB1A 4ASEA 2VGOA 5F94A 3LFSA 3C51A 3TJDA 4M97A 2UW3A 3R9RA 1WBVA 3GENA 4O83A 2OZAB 3A62A 3EKKA 3PPZA 4FZ6A 2JKOA 4UYAA 4XG9A 4EBVA 4CG8A 4E20A 2OXXA 4FV9A 3A7IA 1HCKA 2F7ZE 3IW8A 3BU6A 3CCNA 5HO8A 4O7NA 4UB7A 2W96B 4W9WA 3R9DA 1ZARA 1K9AA 1OBDA 5DOSA 2PY3A 2RG6A 2IO6A 2XMYA 5F9EA 4FODA 3FMNA 3RINA 4I4EA 4O82A 2WELA 1MQBA 3COMA 4UMQA 4AA0A 2WIHA 4WNMA 3EL7A 1MP8A 5FEDA 1PXMA 4DFZE 5GZ9A 1PKDA 3SVVA 5H9BA 4YJQA 2I7QA 4L46A 3KMUA 2W1ZA 2VTJA 3MPMA 3GVUA 1WBNA 3R9NA 3PY0A 5I0BA 4EH4A 2CLXA 2X2KA 5HKMA 2ETKA 1NY3A 4QQCA 4IXPA 4C3PA 3HEGA 4C57A 1ZOEA 4WUAA 4FG7A 5HG5A 5HCZA 4EL9A 1KUTA 4HYHA 3K5VA 3R21A 4D0XA 4EK6A 2X4FA 3TV7A 1ATPE 3ORTA 3FXWA 5HE0A 5HTBA 5HZNA 3DFCB 4I1ZA 4YUQA 3BQRA 5M44A 2ZM4A 2BDFA 4M69B 2VX0A 3QFVA 5E7RA 4BWPA 4KKHA 4NIFA 2WQOA 3E3PA 4DTBA 5D10A 3TZ7A 2B53A 1BL6A 2GHMA 3VC4A 4L3JA 5M4CA 1ZAOA 1VZOA 1ZRZA 4ZEGA 4L00A 4YJTA 1J7IA 1H24A 3MFUA 4R7HA 4TPTA 5CQUA 3ZRMA 1PXKA 4EUTA 4YR8A 3ALNA 4CYJA 3IPHA 2UVYA 3B8RA 4ZZNA 3TNIA 3I60A 3RCDA 3HMMA 3DOGA 4S30A 3HNGA 5EDQA 2C0IA 3VS0A 2O8YA 4C8BA 5I4NA 3VF8A 4FNZA 5AP3A 5IUHA 2XCKA 3C9WA 4WOVA 3ZM9A 3NIEA 3EN6A 3CKWA 4FIIA 5CVFA 5HIBA 5AV1A 4DCAA 4IB3A 1I44A 3Q4UA 3POOA 3L8VA 3DKFA 3W16A 2UZNA 2WQNA 1R0EA 4XBUA 3VJOA 5EM7A 4PUZA 3LCOA 4LG4A 4X7QA 3VWAA 4CZTA 3ZO4A 3DGKA 2XA4A 3R8ZA 2ZM1A 4EK4A 5IKWA 5ETAA 3UNKA 2C1BA 3ANQA 3KK9A 2WTDA 3R8LA 1ZMVA 3FV8A 5EM8A 3COIA 4DBNA 2HZNA 4L44A 3NWWA 3NSZA 4L45A 5AX9A 5I9XA 1MRVA 2PZRA 1YXTA 4DFXE 3CSVA 5HEZA 4EUUA 2C6OA 4DG3E 5FM2A 4B4LA 3JVRA 4NIFB 4QOXA 4EBWA 2X1NA 4ZIMA 1M2PA 5EW3A 4Y95A 5HNBA 3FMMA 1YKRA 4EWHA 2UW0A 2OJ9A 3PA3A 3ITZA 4OTQA 1PXPA 3AGLA 4MXOA 4PV0A 5AX3A 3RP9A 3V5JA 3EN4A 4DEHA 4RX5A 3ZBXA 3BU3A 3R7IA 5TKDA 3JR1A 2GFSA 1E1XA 3CD3A 3VNTA 4I5MA 5LWNA 4IJPA 3EN5A 3RAIA 5HD7A 3UOHA 3DT1A 4YZCA 2C5YA 4E4NA 5AAEA 3FYKX 3FBVA 5IUGA 2B4SB 3QUEA 4QP2A 3VBYA 3PXKA 2R3KA 3RZBA 4USFA 3FMHA 3QKMA 4BCPA 3G0FA 3HECA 4MWIA 3QRKA 3PXYA 3UODA 5M4UA 2PL0A 3JY0A 3EZVA 4K2RA 5DA3A 5LOHA 1ZY5A 3OVVA 4XG6A 1TQMA 4JQ7A 3KVWA 4N6ZA 3FEGA 4FIJA 1R3CA 3A7GA 5CANA 4O81A 3OF0A 1OKVA 4WA9A 3ZZEA 5LCKA 4F65A 1KV1A 3SW4A 2R3IA 1UA2A 5IQBA 4ZS0A 3HAVA 2WMTA 3O50A 3QL8A 3TL8A 3KY2A 3FY2A 2QNJA 2WOTA 3VUDA 4BGGA 2XYUA 4Z7GA 3Q6WA 1JAMA 3ZLSA 3VS7A 5KX8A 4GT3A 5J9YA 3WARA 4BN1A 2WTCA 2PK9A 1OIQA 3V3VA 4IHPA 3UQFA 3NUPA 2IZSA 4K0YA 4K9YA 1W82A 4BCGA 3CTJA 2Y7JA 2C4GA 3V5PA 4BDAA 1H1WA 4Q5EA 1NT2A 3HX4A 1O9UA 3QKKA 2GMXA 4C3RA 4E5BA 2X7FA 3FL5A 4I20A 4ID7A 3BELA 4BZOA 2C6KA 3CC6A 3D15A 1UNHA 3PXFA 4QP1A 4QP8A 4RWIA 3FZSA 4OTDA 2FYSA 3MFSA 1UWHA 4RVMA 1VJYA 3RHKA 4APPA 3RK9A 5KHWA 1UV5A 3I1AA 3ORMA 3PLSA 5HOAA 3AC1A 4F1TA 3FQEA 3KRRA 3RPRA 5JFWA 1UU3A 3NUUA 4W4WA 3VUHA 4C4FA 3SD0A 3LCKA 4G2FA 3ZUTA 3AGMA 3H9FA 2XKCA 4C4HA 5KKRB 4KIOA 4O7YA 4ZY6A 2PVFA 3I79A 4G1WA 3PPJA 3PG3A 4CSVA 3EJ1A 3O51A 3U9CA 2CKOA 4F9BA 4PDYA 3UMWA 2XNGA 4FX3A 3FQSA 4U8ZA 5K3YA 3LVPA 4JQEA 3OS3A 4M12A 5IA3A 4R5SA 3MVJA 5IA0A 3KRLA 3MFTA 4FTCA 3PLAE 2YM3A 2EXCX 4F9WA 3OFMA 4QP3A 5CU0A 4CMUA 3KREA 2B54A 3QWKA 5HIDA 4AW1A 3NUYA 5CASA 2PUIA 3DBCA 4I6HA 1BYGA 1WMKA 4FIFA 4FV5A 3Q5IA 4H05A 2RL5A 4NM5A 3ZM4A 4EOJA 2VTNA 5M51A 3DB6A 5LCJA 4AS0A 2PVYA 1ZYCA 3OOMA 3R63A 3ATSA 5DRDA 3QX4A 4X3FC 3UZTA 3HP2A 4FVQA 1Y8YA 3FMJA 4KKEA 4KS7A 4MQ1A 4C38A 4YU2A 3OCBA 3IDCA 5M57A 1RDQE 4QQ5A 4YO4A 3QQFA 3KRWA 4FV3A 4YGAA 4YHJA 3ORXA 3ORLA 4LMNA 5AR2A 2PHKA 3R04A 3LOKA 3C4XA 3UMXA 3QQJA 3Q4CA 4F0IA 5DYJA 3VHKA 4RFYA 4EOIA 2JEDA 3K3JA 5GJFA 3FYJX 2VTSA 4P4CA 2W1GA 5K5NA 3GU7A 2Y9QA 3E8DA 2YCSA 1Q24A 5E8WA 4RIYA 5M4IA 1W83A 1STCE 4KRCA 3WZJA 3ZXZA 4ZSJA 2ACXA 4JOAA 3NW5A 4UWCA 1TQIA 2BMCA 2PVKA 4FV4A 4A4XA 5CI6A 4BBMA 3H0ZA 3PYYA 4BKYA 5FRIA 4J99A 3IONA 3TNWA 5M06A 3ZO1A 2E9VA 2BZIB 3MVHA 4E4MA 3M1SA 1QPEA 4EK8A 3DTWA 4GL9A 4X0MA 4CKIA 1UWJA 3KEXA 3KCFA 3UVRA 1R1WA 1O6YA 2HY0A 4PWNA 4FIHA 4JS8A 1F5QA 3NX8A 4FC0A 4D9TA 3CJGA 5HCXA 4GKIA 4DA5A 2OIDA 2WOUA 3R6XA 3WZEA 5HTCA 5CT0A 3U87A 2FSMX 2PMIA 4OTRA 3ZONA 4GT5A 3WF7A 3U6HA 4ITIA 4JBOA 1JVPP 1LUFA 2DYLA 2CMWA 3GCUA 3ZC6A 3FC1X 1XBCA 1CKJA 3A60A 4WHZA 3CQUA 4DGLC 3P9JA 5FXRA 4IX3A 5E8TA 1JSUA 4EOKA 3HV4A 1VYWA 3ORZA 4PDSA 4KIQA 3QHRA 3PJ1A 5HVKA 2WQMA 1GIHA 3I5NA 1JSTA 4MBLA 3HRCA 4O0TA 1Q8WA 4PL3A 4C33A 4EQUA 3DY7A 3EQRA 3ZDUA 4YLJA 5CY3A 3P5KA 3M2WA 5TT7A 5AAGA 4RIYB 4YNEA 4FZDB 3ZRKA 2IPXA 4LM5A 4M66A 4FT0A 3VN9A 4E93A 2ONLA 3T3VA 2QO9A 2YLEA 4Q9ZA 5EQPA 3OZ6A 4HGLA 2WMBA 5EHOA 4FA2A 2QOFA 2F2UA 3PJ3A 4XEYA 5I9ZA 3PDTA 4CRSA 5GIOE 1S9IA 3C4FA 2OJJA 4R8QA 4FNYA 3AOXA 2F57A 3OP5A 4OAUC 4ZK5A 4O0YA 1FOTA 3R1QA 3ZFYA 4U45A 2AUHA 4EORA 4ITHA 3NRMA 4U40A 3GOPA 3AQVA 4FTKA 2QHMA 1PY5A 2ZV8A 1YVJA 1Q41A 3I0OA 4D28A 2VTLA 3NUXA 4RJ6A 3F7WA 2PVLA 3N4TA 1M2RA 4K77A 1DS5A 3TTIA 3RBWA 4AX8A 2YABA 2EXEA 2ITNA 4CTCA 3QTSA 5AA9A 4XMOA 4JG8A 3C4CA 3UO4A 4FL2A 4TYHA 5E1SA 4D9UA 3E7VA 4FKVA 3QA8A 3VVHA 2ITQA 4R7BA 5EDRA 3QC9A 3GT8A 2HZ4A 2GNJA 4H1JA 2JGZA 2OFVA 3BU5A 4FSWA 4AW5A 2H34A 3DJ7A 2GNGA 4GK3A 4F6UA 4ANBA 1F0QA 4FUXA 4QTAA 1WCCA 4YTIA 4BCMA 2J50A 3NPCA 5C4KA 5IQEA 4X2KA 5IA1A 5FDPA 4O7TA 4OT5A 4S32A 5JEBA 4L42A 3KQ7A 2OG8A 1OGUA 1YDRE 3FZRA 4EI4A 5ACBC 4D4YA 2P0CA 1BI7A 3SOAA 4BDEA 5AA8A 3I81A 4D1ZA 4G6NA 5JK3A 3GU5A 1DI9A 2FH9A 2QOOA 4O84A 5HX8A 3UC3A 2HOGA 4O1OA 3R7OA 3EH9A 4BTJA 3KGAA 5TE0A 1PXIA 4BCHA 3SG8A 1MRUA 1JQHA 1V0PA 3ZUVA 1WBPA 4FSQA 2GPHA 4UBAA 5IA4A 1HOWA 2ZYBA 5T6KA 1Q3DA 4DAWA 4KUJA 3UP2A 4C2WA 3W10A 3KRJA 3OWKA 5JZNA 3R7EA 3GC0A 5AIRA 3HA8A 1J91A 3FZOA 1SMHA 2BAJA 3R7GA 4OBOA 1KSWA 2PMOX 2PVNA 3G9LX 5D1JA 4AOTA 2P2IA 4EH5A 4O2ZA 3O8UA 5JRQA 3ACKA 3O17A 5ETCA 2CN8A 4NTSA 3F2NA 1OMWA 2QKRA 3Q4TA 4H3QA 5HBEA 4TYHB 4FVRA 4O6LA 5BNJA 3LHJA 5J7BA 2JDTA 4TWPA 3FI3A 2PUUA 2E2BA 4ZSAA 1QL6A 5HIEA 3ATTA 2Z8CA 3REPA 5ETIA 3RNIA 3PXRA 3UDBA 3FLSA 2J51A 3K5UA 3MA3A 1M14A 2BKKA 3UZRA 1M7NA 2PWLA 5BVOA 5E90A 4EHZA 5K9IA 5IEVA 5L8LA 4JAIA 5L3AA 1PMEA 4ZTQA 3NLBA 3FE3A 3MTFA 4DEEA 3FJQE 3RAKA 2HZ0A 3JY9A 3FI2A 5CNOA 3LMGA 4AOJA 4A4OA 2VWYA 1G5SA 2QC6A 3R0TA 4XRLA 4GIIA 5E1EA 5CF6A 5IH5A 5J5SA 4Z55A 3LMHA 4USDA 2Q0NA 3IQ7A 2C5NA 5HGIA 2BPMA 1DM2A 4QMLA 3TTJA 3AT2A 4K8AA 4QPMA 3POZA 2Y4PA 4IAFA 3DBFA 2BRHA 4HCTA 4L7FA 2BROA 2R0UA 3JYAA 3OROA 4RG0A 4ZZMA 5CU2A 2PE2A 3RPVA 4AGUA 2IWIA 4K1BA 4BI0A 2NRYA 2WMAA 1L8TA 4UX9A 3BBWA 2BDWA 5HE3A 5A46A 2KTYA 5A14A 2IVVA 4EH8A 2ZM3A 1OIRA 3MESA 2XB7A 4O0UA 1UU9A 5AWMA 2XIXA 4GU9A 5IQIA 2W99B 2YACA 3BYUA 3OW3A 4F09A 2ITVA 1O6LA 4MBIA 4EZ3A 4NKAA 3O8TA 3R7UA 4UMRA 5LMKA 4IW0A 1OL7A 5CALA 5TF9A 2XJ0A 4F9CA 5M4FA 2BDJA 4JDJA 4LOQA 5HORA 4BDJA 4LI5A 1JNKA 1REKA 3G6GA 4GW8A 4E3CA 2VN9A 3C0IA 1QPDA 1W0XC 1J7LA 3RK7A 2QLQA 3OWLA 4PPAA 4NZWB 3BKBA 2W1FA 4RIWB 4XYFA 4BKJA 4P2KA 3VS6A 4JDKA 2Z7RA 3QUDA 4AFEA 4WBBB 4C59A 2UW4A 4NYEA 1ZOHA 5CLPA 5AM7A 2HYYA 3IOKA 5JH6A 4QMUA 3AD6A 3OBJA 1TQPA 3VBXA 2X8EA 1JKSA 2ZDTA 2YZLA 4NH1A 5HBJA 2OJIA 2WTJA 4YJRA 4DGNA 5JGDA 5FUTA 2ZMCA 3D5WA 4L43A 5CSPA 3LFNA 4OT6A 4XBRA 3UIBA 1SNUA 3FPMA 4GFOA 3EL8A 3FI8A 3O7LD 2IN6A 1XWSA 1Q62A 2JBPA 2XUUA 3NNVA 4G31A 4M8TA 4PY1A 4X21A 1OPKA 3WYXA 5A4LA 3NVMB 3DAEA 4YJNA 1UKIA 4JR3A 4QYFA 4FNWA 4XS2A 3K3IA 3EIDA 1XBBA 5DR9A 2CCHA 4J98A 4S34A 4ZTLA 3FZPA 2HENA 4KRDA 1XH5A 5L2QA 4UXQA 4DFNA 2CN5A 5KMMA 1PMVA 3BLHA 5KCVA 1OUKA 1JBPE 4C2VA 2GHGA 4CMTA 4RQKA 3SXRA 4O0WA 3RWPA 3JPVA 4IZ7A 5CSHA 5L2WA 3FUPA 5A6OA 2WB8A 4RFMA 3QQGA 3SX9A 4HZRA 1A9UA 4YJVA 4IX4A 2GNFA 3FC2A 4FTTA 4H3BA 5CNNA 4CTBA 4ZMEA 3MN3A 1YRPA 2QOHA 2UZTA 4QMSA 4PF4A 3KFAA 3QLFA 5IPJA 5T3QA 3BV3A 3EB0A 4L3LA 4RBLA 2RFDA 2VWZA 3PJCA 4QPAA 4YPDA 4F0GA 5LVMA 4WKQA 4ZTNA 3VUTA 4F6WA 4MKCA 3UIMA 4DH5A 4PQNA 3RALA 4O38A 2UZWE 5C27A 4LL0A 3E63A 2J2IB 3KMMA 3MPTA 2VTMA 3I6WA 3JUHA 3ALOA 2C3IB 2XIRA 4GJ3A 4JBQA 4WG4A 4U81A 1S9JA 1YI6A 2PMNX 4NJDA 4APCA 5C9CA 1H01A 3MH1A 1H1PA 1V0BA 4FMQA 3PP0A 3ULZA 4OUCA 5CSXA 4CKRA 3F3UA 4FT5A 5KMOA 2DQ7X 4XG4A 4O7RA 4FKLA 3G5DA 3IW6A 2YM6A 1IA9A 3FZTA 3M42A 3P78A 4F1OA 4TTHB 2ZVAA 5GIPE 3UG2A 2OZAA 3D2KA 4KKGA 3BHYA 5L2IA 1J1CA 5FQDC 3DU8A 1BMKA 1GJOA 2WU7A 2QO7A 1ZZLA 2CPKE 2RFSA 2H6DA 3HP5A 4U6RA 3U4UA 3TUCA 3N4UA 1G3NA 2NP8A 3UPXA 4BI1A 5M07A 4R1VA 4UYNA 3TNHA 5CXHA 3Q9YA 3F61A 5J87A 4C58A 3PE2A 3GFEA 3UIUA 4BDBA 5B0XA 2VNYA 2QU6A 4KA3A 1E1VA 2WMRA 4AUAA 2XK3A 3PA4A 3TZ8A 4G34A 3ZZWA 4HVDA 3QTZA 4RZVA 3COHA 1KOAA 2WO6A 5AP7A 4D58A 5D41A 2V22A 3HYHA 4Y72A 4EONA 4CQGA 4IZYA 5DN3A 3H9OA 2C6MA 2ITYA 3PVGA 4UZHA 3GBZA 5ANGA 4A7CA 2J0IA 4JXFA 2QOIA 5C8NA 3S00A 3GP0A 4FKJA 5FWKK 3BEGA 2R3GA 3F82A 2BRNA 3ZS5A 4C3FA 2Y4IB 5HU9A 2UZVA 3C1XA 3NVKI 5CS6A 1SYKA 1WZYA 5LVOA 2W4KA 3ZO3A 2I0YA 4ANMA 4BIEA 3HV5A 3G90X 5AAFA 4ZLYA 1BUHA 4YTFA 2VO3A 3OWPA 5IDNA 2LAVA 2AC3A 2V5QA 2YEXA 3JXWA 4XG2A 3HA6A 1XH8A 5D11A 5HICA 4C4IA 3QRTA 3R30A 4BDCA 3R9HA 5FBNC 2BVAA 4DFYA 4HW7A 5DT3A 4FTOA 4BWXA 2F9GA 4OTHA 4LGGA 5E8SA 5HLWA 3P08A 4GYIA 1PF8A 5CEIA 2OF2A 3D7TA 4G9CA 3QYWA 5IH6A 3QQLA 4ZY5A 3VBQA 1IAJA 4IBMA 4TWNA 1M7QA 2CHLA 4GMYA 5AUXA 5IA5A 3W32A 3HLLA 4EK3A 3Q32A 2BILB 2H8HA 5M09A 4EYJA 4RA5A 4GUEA 1WBWA 4FV2A 3LFQA 1OITA 5KO1A 5DPVA 4L6QA 4U0IA 5BYZA 2WMUA 2FGIA 3QAME 4QMWA 4TYJA 3WBLA 5E8UA 4A4LA 2FA2A 2YERA 3ZYAA 1YXUA 2BAKA 1R78A 2C3KA 2XK6A 4IZAA 3LCTA 4IANA 4HVIA 3D4QA 2BRMA 4PP7A 5BUEA 4YHFA 4BGHA 3RCJA 2B9HA 4U80A 5EFQA 5FDXA 2P4IA 5IF1A 4DE4A 3AT3A 1JPAA 1JWHA 5AJQA 4MK0A 3A99A 3AC3A 3EYGA 2WFYA 4FV0A 5CU4A 5FEEA 4DYMA 4FEUA 4CEGA 3BBTB 2XS0A 4CKJA 3KXNA 1WVXA 4EHVA 2PVRA 4KINA 3UYTA 4AW0A 5BX0A 3CLYA 3JVSA 1VYZA 3SGCA 4OTFA 3DBQA 3RNYA 3KC3A 4JQ8A 1PXJA 2ESMA 5LJJA 3IECA 1H1SA 4EJNA 5H8GA 1XH6A 3ROYA 5AMNA 1GZOA 4BCOA 3L9LA 4DGMA 5D12A 4Z9LA 5J7HA 3FDNA 3LFBA 5HD4A 4FSZA 4BYIA 2W5AA 5EI8A 3IGGA 3QRIA 4FKOA 3SLSA 3D7TB 3GC9A 4R7IA 5AV3A 4EC9A 2HK5A 3HVCA 3ODZX 4UZDA 5EH0A 4IM0A 4QQTA 1XHAA 4NTTA 3BLQA 3S0OA 2Z02A 3G15A 2HWPA 4M7IA 3P79A 2GFCA 3UZPA 4YC6A 5AUWA 3P7CA 5EYMA 5EYDA 2YITA 2DWBA 2OH0E 3VS4A 2VWWA 3C0GA 2PE0A 3OBGA 4ZJIA 4II5A 3DK3A 5BVNA 3V5TA 4B7TA 3D2IA 5DT0A 2CKEA 5A3XA 2YCQA 4L7SA 3DCVA 5I9UA 2BFYA 2YA9A 5A6NA 2E9OA 4I94A 4DHFA 5LMBA 3DDQA 3KB7A 3KU2A 2WQBA 4GFMA 4AAAA 4RVKA 4ZTRA 1Q99A 4IM3A 4O0RA 2J90A 3FHIA 4GK2A 5KZIA 3QQHA 1GNGA 3LW0A 5C01A 2IW9A 3TIZA 2WMWA 3FL4A 2UW9A 2QOLA 3QD4A 3Q2JA 4QP6A 3KXZA 1SZMA 5E8XA 2EUFB 4YJPA 4RGJA 2XYNA 3LE6A 3ZBFA 1CKPA 2C6TA 4NSTA 4MD9E 4C4GA 2GTNA 3LFDA 3SC1A 2HZIA 3G9NA 3VF9A 3VBWA 5AM6A 4IIRA 2PPQA 2X39A 3KA0A 3VW8A 1BL7A 4V04A 4J97A 2ETMA 1ZZ2A 1YI4A 3ELJA 5CQWA 3MW1A 4TN6A 2VUWA 5CX9A 4B6LA 4TYIA 3E62A 2EWAA 4H1MA 2JFMA 2XJ1A 2GCDA 4FTUA 4YLLA 3VS5A 1UU8A 2PUNA 4BI2A 3R1NA 4WNOA 3CTQA 1SM2A 5GNKA 4EOPA 2ERZE 3BCEA 3TN8A 3L9NA 4FNXA 4ASXA 5DR6A 5K0XA 4JX7A 2ETRA 1GZ8A 5ANKA 3UNZA 3NW7A 4F08A 4QMMA 2I1MA 4M0ZA 4N0SA 2R7IA 3LXNA 1U54B 2XZSA 5AIKA 5HESA 3PRFA 1R0PA 3SW7A 3KMWA 3R1SA 4BHZA 4CXAA 4IADA 1Y6AA 2E9NA 4XCUA 4Y73A 4KIKB 4QNYA 4KD1A 3PVWA 4U3ZA 1QPCA 3O7LB 4IX6A 3MV5A 3MVMA 3W2PA 3DXNA 4FV7A 1AQ1A 4AZWA 3C5IA 4WT6A 4EH6A 2YCFA 4Z16A 3Q52A 3DZQA 4RIXB 5ANJA 3HMOA 5B2LA 3FKOA 4RIOA 5FEQA 4NW5A 4O2PA 5DR2A 4KWPA 4RX8A 4FEVA 3ZH8A 2IZRA 3E87A 4RJ5A 2HIWA 4IAZA 5F4NA 1JKKA 1OBGA 2ONLC 1PHKA 2XEYA 4U44A 2HY81 4KBCA 2R4BA 1J7UA 4O0XA 3G6HA 3QKLA 3QD0A 4XV3A 3PSBA 3RJCA 3QA0A 3FKNA 4KBAA 4E6AA 4FKGA 4NK9A 2X81A 3P7AA 2YHVA 3OXIA 3OT8A 3P0MA 2WPAA 2VO0A 4MH7A 2CSNA 4M0YA 4PTEA 2WNTA 3HMIA 5EYCA 4HYIA 4IZ5A 4C62A 4QMXA 4LOPA 3TJCA 3NYXA 4E8AA 4D55A 5J1VA 3CEKA 2OXDA 3O8PA 5HNGA 3TXOA 5E9EA 4DTKA 4AN2A 4GS6A 4ZSEA 5G6VA 4IJ9A 3RTPA 3VQHA 3E5AA 5EOLA 2X0GA 2VX1A 3RPSA 2X9FA 1GZNA 3CGOA 3NCZA 3D0EA 4D4RA 4EQMA 5AUYA 4HGTA 2RSVA 3KXMA 4UMTA 4E26A 2R3OA 4E5WA 2NPQA 2XRWA 3QTIA 4HVSA 3KRXA 2R3FA 4WUNA 5BUIA 1B6CB 2PZ5A 1WFCA 3QCXA 5H8BA 2CDZA 5AR7A 3NNWA 3DB8A 5CF8A 2YZAA 3PUPA 3R2YA 3OCSA 5AADA 4JBVA 3FSFA 4JIAA 3LCDA 3PIZA 4B99A 2PULA 3LM5A 3NMUF 1NA7A 1RW8A 2WU6A 5FD2A 4AGDA 3TEIA 5CVGA 5AP1A 3T9TA 2I6LA 4R3CA 4WNKA 3V8TA 3CKXA 2ITPA 4FT3A 4JX3A 1WBTA 5EK7A 1WAKA 2R64A 4CLIA 2W17A 4O7SA 2OU7A 3RWQA 2VNWA 4PNIA 1XKKA 2BIYA 2X4ZA 3ORPA 4RZWA 5LMAA 4AWIA 4ANLA 5BYYA 5A4EA 4CRLA 5EQEA 3FZ1A 4HGSA 4QMZA 4RX9A 2Z60A 4AE6A 2OFUA 1WBSA 3FLYA 3RGFA 5KMKA 1H27A 3ANRA 1KV2A 1SVGA 3DAKA 3E8NA 3KULA 3LXLA 4BYJA 1GAGA 1Q8YA 4XP2A 3BQCA 3QXPA 3WILA 3A4OX 2IZUA 2YM5A 3LFAA 4MWHA 3DAJA 4YZBA 3NS9A 2GSFA 3DQXA 4IMYA 4KNBA 4PRJA 2JD5A 3QCYA 4CVAA 3C4ZA 2G01A 2GS2A 3LFEA 5AR8A 3OHTA 4ZTHA 3W2OA 3RI1A 3Q9WA 3MVLA 5AR3A 3VIDA 5CAQA 3I7CA 1CM8A 2J0LA 3OG7A 5AV0A 5CAPA 1PXLA 3HRFA 4EKLA 3AC2A 2XEZA 3B2TA 2W1CA 5CSVA 3RVGA 2NO3A 4PMPA 4QMQA 3DS6A 3NYNA 2X2LA 3MIAA 5JT2A 3H0YA 4WRSA 3DFAA 4C7TA 4IVBA 3C13A 4QT1A 3ACJA 4GUBA 4CZYB 5IQHA 2FB8A 3QBNA 4F99A 3EFLA 4ONAA 4XV1A 4U41A 3TKHA 2UZEA 5CEMA 5I5ZA 3UE4A 4D2VA 1YHVA 2G2IA 3HZTA 4UMPA 4YO6A 5HE1A 3ROCA 3KN5A 1FGIA 2QONA 3FQHA 3LQ5A 4F6SA 3PXQA 5L8KA 3U54A 2RGPA 3OEFX 2GNIA 2R0IA 1JKTA 2A0CX 3GC7A 4FKUA 4NM7A 5FM3A 3A7JA 3W2SA 5FTQA 2GNHA 3QZGA 5E8YA 3EFKA 5JFVA 3H4JA 2BZKB 3KULB 4ANNA 2YAKA 4YC8A 1YHSA 5EM6A 2VTTA 2JBOA 5EW8A 1OB3A 4IB5A 5AUZA 2J9MA 5DGZA 3G2FA 4AA4A 5J9LA 4JDHA 4J96A 2PMLX 3DQWA 4EK5A 1OM1A 2YFXA 1G8SA 1P4FA 3FLWA 3E3BX 2FVDA 4LRJA 3GU6A 3VAPA 5DIAA 2C3JA 3PSDA 4BIBA 3ZSHA 2I40A 2B9JA 5E8VA 3CS9A 4HCVA 4FTJA 1U4DA 1LEWA 2C5XA 4G3EA 4IFGA 5TR6A 5M08A 3F3VA 2WEIA 2PZIA 1PMNA 2GQGA 5LMKC 1EH4A 2YLFA 2P55A 2AC5A 3F9NA 4RRVA 2J5FA 4FTQA 5IZFA 3ZLXA 5HO7A 4NFMA 4YZNA 3EKNA 1ZOGA 1TKIA 5DH3A 5ANOA 2CKQA 4IVDA 4TXCA 4G5PA 1Q97A 3W2CA 3S4QA 2OICA 3PSCA 3PZEA 2VTOA 4WD5A 2I0VA 4PPBA 2C6DA 3EN9A 4CGAA 3WE4A 3CXWA 2F4JA 3NDMA 3V51A 1Z5MA 4ZJJA 2IZTA 3HKOA 2Y6MA 4B0GA 4F9YA 3L8XA 2WTKB 1PYXA 2C1AA 5E92A 4DEBA 1U46A 2VGPA 4M13A 4CFFA 2NRUA 2HAKA 3Q6UA 3HAMA 3EQFA 2ZB1A 4I0SA 2YAAA 4M15A 5BVDA 5JN2A 3KK8A 2PSQA 4JG6A 5KNJA 1FPUA 4BVUA 3TNPC 2VRXA 5IU2A 5I3OA 4QMVA 1ERKA 5HHWA 5JMSA 4IWQA 4FTLA 3FHRA 4UN0C 5FP6A 4I5PA 2RF9A 3WI6A 4BCNA 4BL1A 4AP7A 1OUYA 1XH9A 5ANIA 4BDHA 2YIXA 1PJKA 1A06A 4DEGA 4ENYA 2X6DA 5E4HA 2PUPA 3DPKA 1ZXEA 5DLSA 3OCTA 3TT0A 4DH3A 4TKSA 2VD5A 3FMKA 3FMDA 5C4LA 4W4VA 3A7FA 3Q9XA 1F3MC 3IOPA 4ZLZA 4BDDA 4CQEA 4CYIA 2XJ2A 3TIYA 2G9XA 2J6MA 3HUBA 2R3NA 4TT7A 2EB2A 4BIDA 2FUMA 3F3TA 3LIJA 4RVLA 2ZB0A 4JRNA 4AOIA 5DVRA 3COKA 5C26A 3E8CA 2J5EA 2JFLA 3ZEPA 5CU6A 4ALWA 2E9PA 4ACGA 3F3ZA 2V7OA 4C4JA 4F9AA 3UBDA 4PNKA 1J3HA 4FTRA 4LV5A 5EDPA 3OXZA 2YWVA 4DGOA 3PFQA 3C7QA 2CGUA 5HO6A 3VJNA 4QO9A 1CTPE 4YHTA 3NW6A 2A1AB 2YM4A 4D2WA 3WIKA 2I0EA 1XBAA 2V62A 3VBTA 3ID6C 4FIEA 3C5UA 4GG5A 5DBXA 2PVMA 5DT4A 3UTOA 3ZMMA 5IMEA 3HV3A 5GJDA 3F3WA 2ITUA 4L68A 3ORKA 5E8ZA 1Z9XA 2C47A 2EXMA 2Y4IC 1KE7A 2WAJA 4IAIA 3WZDA 5L8JA 4U7ZA 2OO8X 1UNGA 4I23A 3ORIA 4RIWA 4NM3A 4YBKA 5F1ZA 2QHNA 3HGKA 4XJ0A 4F1MA 4DBXA 5IQCA 4BB4A 4D2SA 3LAUA 3KVXA 4OTWA 5KBRA 4P5QA 3ULIA 2QG7A 1YHWA 2UVXA 3P7BA 1R39A 4PP9A 1P5EA 4RQVA 2C6IA 5KZ0A 5M55A 4F7SA 4JJRA 4BCKA 4IFCA 1MRYA 3PIYA 3WF8A 4J95A 3TM0A 3QQKA 4FGRA 3BWJA 4GSBA 2V7AA 2IVTA 3IKAA 5HG9A 3NIZA 4FTMA 4ZZOA 4PL4A 4X3FB 4KIPA 2OLCA 3F5UA 1YDSE 2C6LA 3C0HA 5AP2A 3VS1A 1X8BA 2FSLX 2Z7LA 4E6CA 4HYUA 4MXXA 5A4TA 4BCFA 4N57A 3QUPA 4L52A 5BVWA 4F7LA 1GZKA 3GQLA 1YWRA 3MFRA 4J1RA 2UZUE 4E1ZA 3KF7A 3Q96A 4RJ3A 4PDOA 2BIKB 4K33A 4RVTA 4I5CA 5HG8A 3NYOA 2W1EA 1PW2A 2UZBA 1RE8A 1Y91A 3RKBA 1Q8ZA 4MTAA 3V5WA 2Q83A 3EQCA 4XOZA 2W4OA 4C36A 3AC8A 3OEZA 3QALE 2C3LA 3VQUA 5JFXA 4DFBA 4QMYA 2OXYA 2Y8OA 4RC2A 1FVRA 3HDMA 2Y0AA 3FY0A 3QCSA 4YJOA 4YNOA 4FKIA 4BTKA 3VUIA 2VTRA 5HVJA 3L8PA 4TY1A 2IG7A 1WVWA 3R71A 1NVQA 5I9VA 3GU8A 4Z7HA 1V1KA 4W8DA 1H08A 1XQZA 3HMNA 5HLNA 2CNUA 2VWUA 2BZJA 2X9EA 2XNMA 4GFGA 4I0TA 4WNPA 2OKRA 5L4QA 5IQFA 3GCVA 4FL3A 4YP8A 3LLAA 3AD4A 2BRGA 1Q3WA 2PVHA 1W84A 3BHVA 4QMTA 1U5RA 3RZFA 4W9XA 5M56A 3TI1A 1MQ4A 1Z57A 4ARKA 3OOGA 2YN8A 1PXNA 2EVAA 3HRBA 3WF9A 3WZKA 4DH7A 5AEPA 4XLVA 5EKNA 3F2RA 3A61A 2UZOA 2BCJA 4MNEB 4I24A 2HW6A 1OKWA 2VO6A 2YJSA 5EG3A 2A2AA 3QF9A 4FEQA 1OL1A 1DAWA 2HXLA 3EQDA 4YBJA 2XH5A 2ERKA 4EKKA 2F7XE 3GXLA 5EI6A 1H1QA 4DLIA 2QG5A 1LEZA 4KB8A 2WHBA 3EMGA 4IWOA 4E6QA 1W8CA 4MD7E 5JRSA 5LWMA 2OK1A 4O7WA 4FOBA 3TDWA 3KXHA 5HU3A 1M52A 4O22A 4QMNA 4OTIA 4ZSLA 2W1IA 1H00A 4DEIA 4KSPA 4CD0A 3PJ2A 2WXVA 4XH6A 3PPKA 4FIGA 3TUBA 5CEOA 4E6DA 3NNUA 2NNWB 4LGHA 4AZFA 3KF4A 3MH3A 5IUIA 5ETFA 4XHKB 3I6UA 2XK8A 1BX6A 3FXZA 3FMLA 4D2RA 1P2AA 2J0KA 5IISA 2OZOA 3S3IA 4RC3A 3KXGA 4C0TA 4S33A 2QU5A 4I41A 2W4JA 3D9VA 4HYSA 4JT3A 4U9AA 5AR4A 4OTGA 1M17A 2YIRA 4FKQA 3H3CA 4GYGA 4EZ7A 4AACA 3EWHA 1FMKA 4EEVA 4ZAUA 3UOJA 2QO2A 3CQWA 4JI9A 4F63A 3PZHA 3C4WA 3NCGA 4FTNA 5AP5A 2XRUA 2WTWA 2W9FB 2P33A 3E7OA 4O7LA 1RJBA 4V0GA 2Z7QA 3OXTA 4MYGA 4R1YA 5I3RA 3IDPA 3MB7A 4RLKA 2QOKA 3G0EA 4CV9A 3QZFA 4CFMA 4K6ZA 5T68A 4G16A 1RQQA 2B1PA 4GKHA 5H2UA 1HCLA 5DFPA 5BMMA 3DXPA 3I5ZA 4D0WA 2BZHB 3GB2A 2V55A 5FTOA 3MH2A 3QX2A 3BGQA 3II5A 4PPCA 3VUKA 4CG9A 3LKMA 4AGWA 3QU0A 1XR1A 4LQMA 4N6YA 2JAMA 4RWJA 4R77A 5L6WL 2O0UA 3OD6X 4U97A 3LQ8A 4O0SA 2UZLA 5ANEA 2B55A 3HUCA 4DGGA 4MVFA 4IB0A 5HE2A 3O71A 4BHNA 2CCIA 2A27A 2UUEA 3BE2A 3FI4A 5EQYA 4MEDA 4TZRA 4RWLA 4TYGA 2C6EA 4XOYA 1IA8A 3MDYA 2BAQA 4KAOA 3UP7A 4J53A 4TL0A 3WOWA 2XNNA 1B39A 4CMOA 3DZOA 4PMTA 5IG1A 4F70A 1H28A 4IAYA 4RA4A 2O64A 1U5QA 4J8MA 4D4SA 5IQDA 2W5BA 3Q60A 3BZ3A 4G17A 2UW6A 4QYGA 4NCTA 4OTPA 1J1BA 4QYYA 4X3JA 5D7VA 5FLFA 1UNLA 3SRVA 4TWOA 4DINA 3TKUA 4V0GB 2YWPA 1Y6BA 2CKPA 4CCUA 3Q4ZA 1KWPA 5BVKA 5L2TA 3F5GA 3H10A 3F5XA 4AE9A 5KKRC 5BYLA 4V05A 3CY3A 2XKFA 4QRCA 4QTBA 4EJ7A 2YM8A 3QTQA 4ZP5A 1ND4A 3OTUA 4HNFA 4A9RA 4BDGA 4MXAA 4V01A 5EKOA 2XK9A 4GH2A 1I09A 3DJ5A 3SAYA 3WZUA 4AT3A 4N70A 4BTFA 3OWJA 3ZEWA 3P1AA 4EOOA 3MJ1A 1E9HA 5CENA 4DH8A 4FVPA 4BY9E 3A4PA 2GQRA 4FKSA 3IG7A 5KMLA 4A9UA 5C8KA 4DF3A 2BALA 3AG9A 4L8MA 1OIUA 3CBLA 4BZNA 5DEYA 5AUUA 5JKGA 2W05A 2X2MA 2CNQA 3ZU7A 1PYEA 4IVAA 3QRUA 3ZTXA 2YJRA
chains in the Genus database with same CATH superfamily
4FK3A 5FGKA 4YSJA 2YM7A 1GIJA 3ZLYA 4EHGA 4FTAA 4FSUA 2YDIA 3EN7A 5EOBA 1LR4A 3B2WA 4XV9A 2JITA 3MA6A 3ORNA 4R6VA 5KHXA 2XNPA 3GCSA 2QVSE 3QTUA 1NXKA 5IQAA 3GEQA 5GZAA 4DITA 3AC5A 1UVRA 3DV3A 4AQCA 5A54A 3U6JA 2CLQA 2LGCA 5EI2A 3SRVB 2JDRA 3AD5A 3QC4A 4ERWA 2RKUA 4I92A 2HELA 3SQQA 1APME 1FMOE 4C4EA 3P4KA 4M67A 4U5JA 3UQCA 1K2PA 2JC6A 3O0GA 4CT2A 5C1QB 1CDKA 3UIXA 4DN5A 3UOLA 3BX5A 3DJ6A 5IQGA 3D14A 3EQGA 3TZ9A 4LL5A 2GS6A 5CAOA 3E88A 3QTXA 2X8IA 5J8IA 5K4IA 3OY3A 4TNBA 3CY2A 3UO6A 4WG5A 1LPUA 1REJA 3BHHA 1H1RA 3LJ2A 3QZHA 4DDGA 4RLLA 3SHEA 1YI3A 3U6IA 5M53A 3D83A 4YSMA 1AGWA 1FQ1B 3A7HA 2JAVA 4X2NA 2OWBA 4OGRA 1OL2A 5CAVA 4YZMA 3GFWA 2BUJA 4R3RA 1OI9A 4DFLA 2WQEA 3BV2A 3M11A 4UWYA 3UOKA 2HW7A 4BICA 5EW9A 3PIXA 1H26A 2QCSA 3SKCA 4M14A 4E7WA 2VWBA 2WTIA 3R73A 3HMPA 5AP0A 4MXYA 1U54A 2RG5A 4XX9A 4ZOGA 4IC8A 4BRXA 3NUAA 3QD2B 5HQ0A 2H9VA 3SOCA 3VO3A 2ZV7A 4G9RA 5B2KA 3GUBA 3Q5ZA 1OECA 2R3LA 4MHAA 3MBLA 3G51A 4KIKA 3WF6A 3OT3A 1WVYA 2PYWA 4OBQA 1KE5A 3EQBA 1PRYA 2AYPA 3A2CA 1YOJA 4GCJA 4AA5A 2ZFYA 5IH4A 2V0DA 5DI1A 2XKEA 4I93A 4LYNA 4MX9A 4K18A 4RIXA 3DLSA 3O23A 5IMXA 5DE2A 5EM5A 4TWCA 1O6KA 3JS2A 2R3PA 4IWPA 3UG1A 4JRVA 4RMZA 3ZSIA 3FWQA 5CVHA 3QHWA 4QDEA 2WZJA 3OUKA 4FF8A 4DFUA 2B7AA 2OSCA 3ZSGA 4AG8A 1YOLA 4K11A 4ZXTA 2VTHA 2IW6A 2O63A 3MY5A 1XH4A 3CD8A 3E8EA 4D4VA 4XRJA 4BKZA 4FZAB 5AUTA 4U43A 2WIPA 2XK7A 4LV8A 3LZBA 4QTDA 5AP6A 5D9HA 3TZMA 4BJJA 3VRZA 3PP1A 4EOMA 2XCHA 1W7HA 4HOKA 2YIWA 3BHUA 4JVGA 4WBOA 3UGCA 4AT4A 2ITZA 2ZOQA 5CAUA 2W06A 4LUDA 1YWVA 2OJGA 2XM9A 1KE9A 2XBAA 4GG7A 4DT9A 4RPVA 1FGKA 3QXOA 5FTGA 3BGZA 5BVEA 3H9RA 4S31A 5GHVA 2H96A 3DNDA 4PTGA 2PE1A 3RM6A 3N9XA 4BWKA 5LVNA 1IG1A 4FKPA 3AMBA 4J52A 4Y85A 3GI3A 3H30A 5L2SA 1Q61A 3EQIA 3PVUA 3CQEA 4G3CA 4AZTA 4DEAA 1JSVA 3W2QA 4YMJA 3VS2A 4G6LA 2IW8A 1OL5A 2WTKC 3R9OA 2C68A 1BLXA 3GQIA 3ZXTA 2XNEA 3LFCA 3D5UA 4EOLA 4XG7A 2C0OA 4O7VA 1NW1A 3FLNC 3VONA 1OGYA 4H36A 4MCVA 5DEWA 3ZCLA 4I21A 2JKMA 3GOKA 4FI1A 1VLRA 4JNWA 4O86A 4USEA 3AT4A 3Q2MA 5E91A 3E93A 3VUMA 4WRGA 3AMYA 2JLDA 5JQ5A 3PWYA 2ZDUA 3Q9ZA 2R9SA 5CWZA 4ACCA 1SVHA 4EYMA 4FYOA 3L9MA 3NNXA 4O7ZA 2XVDA 4S2ZA 3TACA 2F49A 2G2HA 3L8SA 4P90A 5IA2A 4BJJB 2VTPA 2GS7A 2SRCA 3UQGA 3TUDA 3LMIA 2CGWA 2OW3A 4LRKA 3W0PA 5CEQA 4J7BA 2A19B 3W8LA 4U79A 4QMOA 3WIGA 2VTAA 3KKVA 5DWRA 2CGVA 4O4BB 4QMPA 3THBA 3MS9A 1OPLA 2OJFE 2O2UA 3LJ1A 4BFMA 3V5QA 3RPOA 4O1PA 5HNIX 4O0VA 4A9SA 1FVTA 3BYOA 4X6QC 3MJ2A 3TV4A 2G2FA 3EFWA 3W2RA 1PMUA 3W0MA 3DKCA 4YURA 4ORKA 3TYKA 2E9UA 5CXZA 4FBXA 3VULA 4P7EA 4MXZA 4R78A 4GRBA 3VW6A 4D2PA 4AN3A 4DG2E 4HJOA 4ZMFA 3I7BA 1G8AA 3KIOC 3CPBA 4KBKA 1H8FA 1A48A 3QWJA 5CTPA 4NUSA 4ZLOA 1OL6A 2W0JA 4ASDA 3V5LA 4FSTA 2QOBA 2RFNA 2JKQA 2W9ZB 3CPCA 3R2BA 3ZDIA 3ZLWA 1URCA 3C4EA 5CU3A 5LVPA 4C35A 3MIYA 3WE8A 3V6SA 4MF0A 2GHLA 4FG9A 5K5XA 4HGEA 4MAOA 3MGYA 4CNHA 1ZMWA 5ACKA 4ACMA 1G8KA 4BC6A 4X2FA 1YW2A 2WMVA 5A9UA 4JR7A 2ITWA 2C30A 2QOCA 3Q04A 4O96A 3R8UA 1VR2A 2CJMA 3RHXA 3CE3A 4I0RA 2YDKA 4HPUE 5TOZA 4FV8A 1QMZA 2UV2A 3DBDA 4G6OA 5LXMA 2W1DA 2QLUA 3D5VA 3ZC5A 4CFWA 5JQ8A 3DXQA 2YIYA 4I22A 4IDTA 2FSOX 3PTGA 4PMMA 4QYEA 4YPSA 3R00A 3KXXA 3V6RA 5IDPA 3A8XA 2RIOA 3ENHA 3DBEA 3OY1A 3ZUUA 1UU7A 4MXCA 3EOCA 3UYSA 2F2CB 4ZTSA 4ALUA 5KE0A 3ET7A 3I0QA 3BYVA 4ANSA 4NT4A 5JGAA 2ITTA 2X6EA 4GK4A 3LPBA 3U9NA 4O27B 3MI9A 4EH9A 1H0WA 3U4WA 4DEDA 3EQHA 3NZ0A 3TDVA 4NM0A 3ZO2A 3Q53A 3UJGA 4AAYA 3F7ZA 3V8WA 4B8MA 5KUPA 4UXLA 2B0QA 3KN6A 1ZYSA 4ERKA 2XF0A 5HI2A 2QR7A 4FZFB 4DTAA 2EU9A 4I5HA 2VU3A 3FMEA 3PG1A 4B8LA 1JOWB 4UALA 3U8WA 5AUVA 2R3RA 3NGAA 4A07A 3NUNA 4AW2A 4D5KA 5G1XA 4AF3A 3DA6A 4DG0E 4I6BA 4YJUA 3DK7A 5H3QA 2VWIA 4CCBA 3T3UA 4Q9SA 3D5XA 4GEOA 4UMUA 4IC7A 4XV2A 4WSYA 2VTQA 5JZJA 1FVVA 4GV1A 1OKYA 3L9PA 4OW8A 4UWBA 5GJGA 4ZTMA 3QCQA 4IH8A 5AFVA 3PUFC 1L3RE 3R83A 4O91A 3BHTA 3FLQA 3Q3BA 2YISA 4JBPA 4AXCA 2R7BA 3BPRA 5CT7A 5CYIA 3TNQB 2P2HA 4CFNA 4HPTE 3UO5A 4IEBA 3EHAA 4QPSA 4IACA 3EFJA 2PTKA 3B8QA 4FL1A 1K3AA 3OW4A 2KULA 4TNDA 2YCRA 4FR4A 2XNBA 5AV2A 3AC4A 1B38A 3DK6A 4FOCA 3LLTA 1W98A 3NAYA 2R5TA 1Q8TA 1OVEA 4Y46A 3U55A 3GCQA 2C5VA 3RMFA 4C61A 3UDZA 3A8WA 2XM8A 5KMJA 5FXSA 4XLIA 3SDJA 3ZFXA 3VRYA 4G5JA 4XP3A 2XNOA 3G33A 5BQ0A 4D2TA 3UC4A 3ML1A 3NYVA 5GINE 1ZYDA 5J95A 4DLJA 4U3YA 2G1TA 5CF5A 3BEAA 3MSSA 3LM0A 3ZFMA 1YXVA 4QQJA 4FG8A 5J5TA 1YXSA 5AV4A 2XK4A 3ZOSA 4Y8DA 4YC3A 4E4LA 4ZSGA 1T46A 3BWFA 2HCKA 2JDVA 4GVJA 4YJSA 1XJDA 4H3PA 3T8OA 4BCQA 5DRBA 4BTMA 3OTVA 3ZRLA 4O21A 1ZY4A 5I9WA 1ZMUA 2WMSA 2IVUA 3IDBA 2I0HA 4NW6A 3MWUA 4I6QA 4W4YA 5AR5A 5B7VA 2ZV2A 2QR8A 4G3GA 4H39A 1YQJA 3TV6A 3LFFA 3R28A 4QD6A 2EB3A 3QYZA 4EH7A 4NFNA 4MNFA 4F7JA 2WD1A 1YDTE 3FPQA 4FE2A 3R7YA 3KL8A 3PY1A 2PU8A 4FYNA 3MTLA 5CI7A 3K2LA 5TO8A 4RFZA 3ZHPC 4AZEA 3LXPA 4L67A 4BGQA 3QQUA 5F95A 4GIHA 3SXSA 4W4XA 4AN9A 3QTRA 3IK3A 4BDIA 1BI8A 3ETAA 2JIUA 5ANDA 4WIHA 4DH1A 4J71A 1AD5A 3VUGA 3HDNA 4RSSA 3OC1A 4RC4A 2GTMA 4FEXA 5HG7A 1U59A 3ODYX 5KBQA 4IAAA 2J0JA 1IRKA 2R3QA 3R22A 1ZLTA 2X7OA 4EOQA 4X3FA 1UKHA 3AXWA 5D7AA 3SV0A 4B9DA 2UW8A 4CT1A 2UW7A 4F0FA 2BTSA 2BR1A 3FAAA 4JDIA 2BRBA 4G3DA 2O65A 4L01A 2VZ6A 2R3JA 2JDOA 2QQ7A 3W0QA 2F7EE 3RK5A 3W18A 4NKSA 1KOBA 4BBEA 3CP9A 4XG3A 3UVPA 4IE9A 3IW5A 4JL9A 1NVSA 1Q8UA 5CEPA 4ZJVA 5LQFA 2B52A 4MF1A 2R2PA 3S95A 1KE6A 2G15A 3PWDA 4FTIA 2GNLA 3TWJA 5BMSA 3O2MA 4A9YA 2QURA 4NWMA 5AP4A 4CLJA 2P3GX 3W1FA 4NU1A 4JLCA 4BZDA 2OH4A 4AXEA 4Y5HA 4A06A 2J0MB 5JSMA 2W5HA 3PRIA 3BRBA 2IJMA 4DC2A 3DNEA 1H4LA 4QTEA 5K4JA 4FSRA 4EH3A 4FT7A 4YZ9A 2W7XA 3DKOA 1YXXA 4FV6A 3F6XA 3I4BA 1OPJA 4QP4A 4X2GA 5HTIA 2DUVA 2YDJA 3VBVA 3R02A 4EOSA 3FSKA 1P14A 4E4XA 3BGPA 1BKXA 2JKKA 5KMIA 5EHLA 4R5YA 3W8QA 5BPYA 2HXQA 5CEKA 2ZJWA 1ZYJA 4KS8A 3NUSA 4XUFA 3N4VA 2ITXA 3F66A 5JGBA 2VX3A 4AZVA 5DMZA 1DI8A 1H07A 3UDSA 3TKIA 2BTRA 4YZDA 4RJ4A 5L6OA 2BHHA 2ZAZA 2JDSA 2FSTX 3UNJA 1SNXA 5H8EA 3F2AA 3NEWA 1GY3A 4BR3A 3MB6A 3LJ0A 2DS1A 2VTIA 4FGBA 3IW4A 4EQCA 4A9TA 1WBOA 4ALVA 4ENXA 4FSYA 1IASA 3BE9A 5BVFA 1XH7A 3OCGA 4MNEA 4OBPA 4PL5A 3TG1A 5HX6A 2XBJA 3WF5A 3UPZA 3RAWA 5LARA 2GDOA 3BI6A 3EZRA 3IW7A 5HCYA 4TW9A 3RAHA 2FO0A 3CGFA 4OLIA 3LQ3A 3IGOA 4EZ5A 3PY3A 3CTHA 4KSQA 4UY9A 3DDPA 5K0KA 3R8MA 4EHEA 2VO7A 3PE1A 4YLKA 4HNIA 2WKMA 3ENMA 3GNIB 3D7ZA 3P5JC 2CGXA 2X0PA 5DNRA 4C37A 4CFVA 2O5KA 4GT4A 4WO5A 4DT8A 3F5PA 3QGYA 4MQ2A 4I4FA 4NCTC 3FLZA 2C5OA 1JKLA 1URWA 1OKZA 4UEUA 4O4FA 4D5HA 2HWOA 2RFEA 2OF4A 4M68A 5KMNA 3BYSA 3E92A 4IX5A 4EH2A 4FKRA 2XIKA 3BL7A 5ITAA 4EWQA 4D1XA 4H58A 4NJ3A 4F7NA 4P5ZA 2OIQA 3D94A 5JFSA 2PZYA 4FUYA 1Y8GA 4FSNA 3S2PA 3RM7A 1Q4LA 1ZWSA 5EYKA 2BHEA 3O96A 4MD8E 2B9IA 3V01A 4ITJA 2CNVA 2ZMDA 1PKGA 4ACHA 3EQPA 1NVRA 4X6RA 5HVYA 3UVQA 1TVOA 1ST4A 3U51A 4QP7A 4AZSA 4IWDA 1H25A 4ASZA 4FEWA 1Y57A 4G3FA 3VS3A 4MBJA 2W1HA 2PVJA 3QRJA 4FKWA 3R01A 4L9IA 4FZ7A 4KABA 4OAVB 3IS5A 4FRFA 4E5AX 3SG9A 4M84A 3CIKA 2UZDA 1Q5KA 4BCJA 2J7TA 3BYMA 2UVZA 1MUOA 2BKZA 3E64A 5J9ZA 2QOQA 3HL7A 2J4ZA 3N51A 4RX7A 3P23A 3HV6A 4PDPA 2R3MA 4GJ2A 4L53A 4O6EA 2WMQA 1CMKE 2JIVA 4J8NA 4D1SA 4CFUA 4RT7A 5J79A 1PXOA 3L1SA 5FBOA 4BF2A 2Z2WA 3LXKA 4AGCA 4U42A 3NFFB 5IEXA 4E73A 2Q0BA 2XP2A 4QP9A 4RJ7A 3MYGA 2OIBA 1OIYA 3OMVA 4LMUA 4TYEA 3ERKA 4WG3A 4JIKA 3QLGA 3RPYA 4ZS4A 2PZPA 4TRLA 3HV7A 1JLUE 3PA5A 3MH0A 4FICA 5CF4A 3IO7A 4IQ6A 5GZ8A 2VWVA 3NAXA 4ANOA 4IM2A 5B2MA 2X8DA 3W55A 2VWXA 4C02A 4YTHA 3QD3A 4HZSA 4Y5QA 4GU6A 1LP4A 1GOLA 3AMAA 3PXZA 4FKTA 4Q5HA 5C03A 1DAYA 5HLPA 4XG8A 2C69A 2XIYA 4QNAA 2Y6OA 4LOOA 5I9YA 2X7GA 3DLZA 4PMSA 4AT5A 5LVLA 5A4CA 5DG5A 3R7VA 3K54A 4DCEA 2XIZA 1T45A 2JIIA 3GCPA 4ANQA 1FBNA 4PX6A 4QYHA 1CKIA 3R8VA 5A4QA 3TCPA 4BDFA 3BIZA 3EYHA 4W8EA 4ZY4A 3FKLA 4FK6A 4PTCA 4CFXA 3CR0A 2OI4X 3MPAA 5L6PA 2OBJA 3DKGA 5BUJA 5CZIA 4F64A 3MY1A 4BCIA 1IAHA 1CSNA 2WEVA 3R8PA 1QPJA 4I6FA 5ICPA 3PVBA 4AFJA 4ACDA 3CJFA 4AXAA 3LCSA 4YTCA 4R3PA 5CZHA 1VEBA 4JG7A 3C50A 2C0TA 4Q2AA 3W0RA 1M2QA 2VAGA 3GGFA 4JAJA 4LGDA 2YIQA 5CSWA 2WTVA 2ZV9A 4AU8A 3W33A 5FP5A 5J1WA 3F88A 4XP0A 5EHYA 4HCUA 4BDKA 3QGWA 4GVAA 4CV8A 4FSMA 3GU4A 1ZYLA 3R1YA 3V8SA 3PJ8A 2QD9A 1IEPA 2A4LA 1V0OA 3P86A 4QTCA 1FINA 4L3PA 1P4OA 4IAKA 4LFIA 4Y83A 4LUEA 4IDVA 2UW5A 3T9IA 5C8MA 3UDTA 2WGJA 4FV1A 1SVEA 4WSQA 4M3QA 2OGVA 4UV0A 3VHEA 4HVGA 4LRMA 4CZUA 1H0VA 3DTCA 4OR5A 1XO2B 5FG8A 4BBFA 4C34A 3V04A 5HBHA 2QKWB 4NEUA 5F20A 3QTWA 3KCKA 3BLRA 3OUNB 4XNEA 4NL0A 1QCFA 3SA0A 4Z3VA 4FT9A 1OZ1A 3F69A 2QI8A 4RWKA 1YWNA 5DHJA 1IR3A 3MY0A 1YOMA 5FXQA 2GU8A 4I3ZA 4X2JA 2R3HA 2XKDA 2Z7SA 4N4SA 4EC8A 4HVHA 2REIA 4F4PA 3QZIA 4RJ8A 3S1HA 2O3PA 4DHZA 3FXXA 2QODA 1GIIA 2B9FA 3SXFA 3GC8A 3WYYA 4IVCA 2WMXA 3NR9A 1KE8A 2BFXA 2ITOA 4M69A 5IEYA 2IVSA 2VV9A 2GQSA 4IB1A 4ASEA 2VGOA 5F94A 3LFSA 3C51A 3TJDA 4M97A 2UW3A 3R9RA 1WBVA 3GENA 4O83A 2OZAB 3A62A 3EKKA 3PPZA 4FZ6A 2JKOA 4UYAA 4XG9A 4EBVA 4CG8A 4E20A 2OXXA 4FV9A 3A7IA 1HCKA 2F7ZE 3IW8A 3BU6A 3CCNA 5HO8A 4O7NA 4UB7A 2W96B 4W9WA 4DDIA 3R9DA 1ZARA 1K9AA 1OBDA 5DOSA 2PY3A 2RG6A 2IO6A 2XMYA 5F9EA 4FODA 3FMNA 3RINA 4I4EA 4O82A 2WELA 1MQBA 3COMA 4UMQA 4AA0A 2WIHA 4WNMA 3EL7A 1MP8A 5FEDA 1PXMA 4DFZE 5GZ9A 1PKDA 3SVVA 5H9BA 4YJQA 2I7QA 4L46A 3KMUA 2W1ZA 2VTJA 3MPMA 3GVUA 1WBNA 3R9NA 3PY0A 5I0BA 4EH4A 2CLXA 2X2KA 5HKMA 2ETKA 1NY3A 2X0QA 4IXPA 4QQCA 3HEGA 4C3PA 4C57A 1ZOEA 4WUAA 4FG7A 5HG5A 5HCZA 4EL9A 1KUTA 4HYHA 3K5VA 3R21A 4D0XA 4EK6A 2X4FA 3TV7A 1ATPE 3ORTA 3FXWA 5HE0A 5HTBA 5HZNA 3DFCB 4I1ZA 4YUQA 3BQRA 5M44A 2ZM4A 2BDFA 4M69B 2VX0A 3QFVA 5E7RA 4BWPA 4KKHA 4NIFA 2WQOA 3E3PA 4DTBA 5D10A 3TZ7A 2B53A 4F78A 1BL6A 2GHMA 3VC4A 4L3JA 5M4CA 1ZAOA 1VZOA 1ZRZA 4ZEGA 4L00A 4YJTA 1J7IA 1H24A 3MFUA 4R7HA 4TPTA 5CQUA 3ZRMA 1PXKA 4EUTA 4YR8A 3ALNA 4CYJA 3IPHA 2UVYA 3B8RA 4ZZNA 3TNIA 3I60A 3RCDA 3HMMA 3DOGA 4S30A 3HNGA 5EDQA 2C0IA 3VS0A 2O8YA 4C8BA 5I4NA 3VF8A 4FNZA 5AP3A 5IUHA 2XCKA 3C9WA 4WOVA 3ZM9A 3NIEA 3EN6A 3CKWA 4FIIA 5CVFA 5HIBA 5AV1A 4DCAA 4IB3A 1I44A 3Q4UA 3POOA 3L8VA 3DKFA 3W16A 2UZNA 2WQNA 1R0EA 4XBUA 1TZDA 3VJOA 5EM7A 4PUZA 3LCOA 4LG4A 4X7QA 3VWAA 4CZTA 3ZO4A 3DGKA 2XA4A 3R8ZA 2ZM1A 4EK4A 5IKWA 5ETAA 3UNKA 2C1BA 3ANQA 3KK9A 2WTDA 3R8LA 1ZMVA 3FV8A 5EM8A 3COIA 4DBNA 2HZNA 4L44A 3NWWA 3NSZA 4L45A 5AX9A 5I9XA 1MRVA 2PZRA 1YXTA 4DFXE 3CSVA 5HEZA 4EUUA 2C6OA 4DG3E 5FM2A 4B4LA 3JVRA 4NIFB 4QOXA 4EBWA 2X1NA 4ZIMA 1M2PA 5EW3A 4Y95A 5HNBA 3FMMA 1YKRA 4EWHA 2UW0A 2OJ9A 3PA3A 3ITZA 4OTQA 1PXPA 3AGLA 4MXOA 4PV0A 5AX3A 3RP9A 3V5JA 3EN4A 4DEHA 4RX5A 3ZBXA 3BU3A 3R7IA 5TKDA 3JR1A 2GFSA 1E1XA 3CD3A 3VNTA 4I5MA 5LWNA 4IJPA 3EN5A 3RAIA 5HD7A 3UOHA 3DT1A 4YZCA 2C5YA 4E4NA 5AAEA 3FYKX 2A98A 3FBVA 5IUGA 2B4SB 3QUEA 4QP2A 3VBYA 3PXKA 2R3KA 3RZBA 4USFA 3FMHA 3QKMA 4BCPA 3G0FA 3HECA 4MWIA 3QRKA 3PXYA 3UODA 5M4UA 2PL0A 3JY0A 3EZVA 4K2RA 5DA3A 5LOHA 1ZY5A 3OVVA 4XG6A 1TQMA 4JQ7A 3KVWA 4N6ZA 3FEGA 4FIJA 1R3CA 3A7GA 5CANA 4I6LA 4O81A 3OF0A 1OKVA 4WA9A 3ZZEA 5LCKA 4F65A 1KV1A 3SW4A 2R3IA 1UA2A 5IQBA 4ZS0A 3HAVA 2WMTA 3O50A 3QL8A 3TL8A 3KY2A 3FY2A 2QNJA 2WOTA 3VUDA 4BGGA 2XYUA 4Z7GA 3Q6WA 1JAMA 3ZLSA 3VS7A 5KX8A 4GT3A 5J9YA 3WARA 5BV3A 4BN1A 2WTCA 2PK9A 1OIQA 3V3VA 4IHPA 3UQFA 3NUPA 2IZSA 4K0YA 4K9YA 1W82A 4BCGA 3CTJA 2Y7JA 2C4GA 3V5PA 4BDAA 1H1WA 4Q5EA 1NT2A 3HX4A 1O9UA 3QKKA 2GMXA 4C3RA 3TMOA 4E5BA 2X7FA 3FL5A 4I20A 4ID7A 3BELA 4BZOA 2C6KA 3CC6A 3D15A 1UNHA 3PXFA 4QP1A 4QP8A 4RWIA 3FZSA 4OTDA 4DHJA 2FYSA 3MFSA 1UWHA 4RVMA 1VJYA 3RHKA 4APPA 3RK9A 5KHWA 1UV5A 3I1AA 3ORMA 3PLSA 5HOAA 3AC1A 4F1TA 3FQEA 3KRRA 3RPRA 5JFWA 1UU3A 3NUUA 4W4WA 3VUHA 4C4FA 3SD0A 3LCKA 4G2FA 3ZUTA 3AGMA 3H9FA 2XKCA 4C4HA 5KKRB 4KIOA 4O7YA 4ZY6A 2PVFA 3I79A 4G1WA 3PPJA 3PG3A 4CSVA 3EJ1A 2IF8A 3O51A 3U9CA 2CKOA 4F9BA 4PDYA 3UMWA 2XNGA 4FX3A 3FQSA 4U8ZA 5K3YA 3LVPA 4JQEA 3OS3A 4M12A 5IA3A 4R5SA 3MVJA 5IA0A 3KRLA 3MFTA 4FTCA 3PLAE 2YM3A 2EXCX 4F9WA 3OFMA 4QP3A 5CU0A 4CMUA 3KREA 2B54A 3QWKA 5HIDA 4AW1A 3NUYA 5CASA 2PUIA 3DBCA 4I6HA 1BYGA 1WMKA 4FIFA 4FV5A 3Q5IA 4H05A 2RL5A 4NM5A 3ZM4A 4EOJA 2VTNA 5M51A 3DB6A 5LCJA 4AS0A 2PVYA 1ZYCA 3OOMA 3R63A 3ATSA 5DRDA 3QX4A 4X3FC 3UZTA 3HP2A 4FVQA 1Y8YA 3FMJA 4KKEA 4KS7A 4MQ1A 4C38A 4YU2A 3OCBA 3IDCA 5M57A 1RDQE 4QQ5A 4YO4A 3QQFA 3KRWA 4FV3A 4YGAA 4YHJA 3ORXA 3ORLA 4LMNA 5AR2A 2PHKA 3R04A 3LOKA 3C4XA 3UMXA 3QQJA 3Q4CA 4F0IA 5DYJA 3VHKA 4RFYA 4EOIA 2JEDA 3K3JA 5GJFA 3FYJX 2VTSA 4P4CA 2W1GA 5K5NA 3GU7A 2Y9QA 3E8DA 2YCSA 1Q24A 5E8WA 4RIYA 5M4IA 1W83A 1STCE 4KRCA 3WZJA 3ZXZA 4ZSJA 2ACXA 4JOAA 3NW5A 4UWCA 1TQIA 2BMCA 2PVKA 4FV4A 4A4XA 5CI6A 4BBMA 3H0ZA 3PYYA 4BKYA 5FRIA 4J99A 3IONA 3TNWA 5M06A 3ZO1A 2E9VA 2BZIB 3MVHA 4E4MA 3M1SA 1QPEA 4EK8A 3DTWA 4GL9A 4X0MA 4CKIA 1UWJA 3KEXA 3KCFA 3UVRA 1R1WA 1O6YA 2HY0A 4PWNA 4FIHA 4JS8A 1F5QA 3NX8A 4FC0A 4D9TA 3CJGA 5HCXA 4GKIA 4DA5A 2OIDA 2WOUA 3R6XA 3WZEA 5HTCA 5CT0A 3U87A 2FSMX 2PMIA 4OTRA 3ZONA 4GT5A 3WF7A 3U6HA 4ITIA 4JBOA 1JVPP 1LUFA 1W2CA 2CMWA 2DYLA 3GCUA 3FC1X 3ZC6A 1XBCA 1CKJA 3A60A 4WHZA 3CQUA 4DGLC 3P9JA 5FXRA 4IX3A 5E8TA 1JSUA 4EOKA 3HV4A 1VYWA 3ORZA 4PDSA 4KIQA 1ST0A 3QHRA 3PJ1A 5HVKA 2WQMA 1GIHA 3I5NA 1JSTA 4MBLA 3HRCA 4O0TA 1Q8WA 4PL3A 4C33A 4EQUA 3DY7A 3EQRA 3ZDUA 4YLJA 5CY3A 3P5KA 3M2WA 5TT7A 5AAGA 4RIYB 4YNEA 4FZDB 3ZRKA 2IPXA 4LM5A 4M66A 4FT0A 3VN9A 4E93A 4QEBA 2ONLA 3T3VA 2QO9A 2YLEA 4Q9ZA 5EQPA 3OZ6A 4HGLA 2WMBA 5EHOA 4FA2A 2QOFA 2F2UA 3PJ3A 4XEYA 5I9ZA 3PDTA 4CRSA 5GIOE 1S9IA 3C4FA 2OJJA 4R8QA 4FNYA 3AOXA 2F57A 3OP5A 4OAUC 4ZK5A 4O0YA 1FOTA 3R1QA 3ZFYA 4U45A 2AUHA 4EORA 4ITHA 3NRMA 4U40A 3GOPA 3AQVA 4FTKA 2QHMA 1PY5A 2ZV8A 1YVJA 1Q41A 3I0OA 4D28A 2VTLA 3NUXA 4RJ6A 3F7WA 2PVLA 3N4TA 1M2RA 4K77A 1DS5A 3TTIA 3RBWA 4AX8A 2YABA 2EXEA 2ITNA 4CTCA 3QTSA 5AA9A 4XMOA 4JG8A 3C4CA 3UO4A 4FL2A 4TYHA 5E1SA 4D9UA 3E7VA 4FKVA 3QA8A 3VVHA 2ITQA 4R7BA 5EDRA 3QC9A 3GT8A 2HZ4A 2GNJA 4H1JA 2JGZA 2OFVA 3BU5A 4FSWA