4IANA

Crystal structure of apo human prpf4b kinase domain
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
330
structure length
321
Chain Sequence
RVNIGEVLDKRYNVYGYTGQGVFSNVVRARDNARANQEVAVKIIRNNELMQKTGLKELEFLKKLNDADPDDKFHCLRLFRHFYHKQHLCLVFEPLSMNLREVLKKYGKDVGLHIKAVRSYSQQLFLALKLLKRCNILHADIKPDNILVNESKTILKLCDFGSASHVADNDITPLVSRFYRAPEIIIGKSYDYGIDMWSVGCTLYELYTGKILFPGKTNNHMLKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDREKVTVMSTINPTKDLLADLILPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase PRP4 homolog
publication title Evaluation of Cancer Dependence and Druggability of PRP4 Kinase Using Cellular, Biochemical, and Structural Approaches.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 100
structure length 321
sequence length 330
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2012-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ianA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ianA01
5ANKA 3IPHA 1JPAA 5AIKA 1G5SA 4HZRA 4KB8A 4TYHB 3CJFA 2X8DA 3MH0A 3SLSA 4QQ5A 1DI8A 2YA9A 2GTMA 5DOSA 5CAUA 3ZUVA 3DAJA 3LCOA 2FGIA 5HEZA 2GNFA 2ZAZA 4JDKA 3RI1A 4D1SA 4Q2AA 4XG3A 5CF5A 5IQGA 4CRSA 3LFAA 2JC6A 4FTNA 5IH6A 3TNWA 3P23A 1XH5A 4TTHB 3UQCA 3MGYA 4I5PA 3RAKA 4OTQA 5LWNA 3FZRA 3OCBA 4ZEGA 3R7IA 3BELA 5HG5A 3HLLA 2GFSA 2Z2WA 4OT6A 1ZOGA 5FDXA 2YAAA 3E88A 4MWIA 3N4VA 4X2JA 3PA4A 3MPMA 1PXPA 1YXXA 2OIQA 4CZUA 4HVSA 3A4OX 4D4VA 4ACCA 2WGJA 5E92A 4RZVA 4C36A 4GIHA 4G16A 3UIMA 1XH9A 3ELJA 3F5UA 2UW3A 4E5AX 3H3CA 4FBXA 2A27A 2WD1A 2JKMA 3ORTA 5HX8A 3ZDIA 4YLLA 3MY5A 4FNYA 4MNFA 1GZOA 1ZYLA 4MF0A 4RIOA 4W4YA 3L9LA 2WTJA 3PE1A 4WIHA 5D10A 3OWKA 4GT4A 4ZIMA 4RVMA 2VRXA 4XS2A 3ZO4A 4D2SA 3F2NA 1OBDA 3EYHA 4YZMA 4KD1A 3CXWA 4X3FB 5AR5A 5HNIX 4PRJA 4MXZA 4QP9A 1M7NA 4X6QC 2XNPA 4GK2A 5TT7A 3EQBA 5K0XA 2Y7JA 3MTFA 3EN5A 3IGOA 1MQ4A 3ZU7A 4ZLOA 1H01A 3ZMMA 3UGCA 3EZVA 4EOOA 5HVYA 1BMKA 3FI4A 3QZFA 4PTCA 3D94A 4KS8A 1R78A 2GQGA 4KABA 1NVRA 3MN3A 2WTIA 5CS6A 5KE0A 3RHKA 4C33A 2JIUA 4E4MA 4M68A 2OWBA 5FD2A 2C6DA 5FEEA 4M3QA 5HE3A 4F4PA 3F5GA 3BGPA 5AWMA 4AT4A 1KOBA 1U54A 1KE8A 3KN5A 2R0UA 5DLSA 3V8SA 2O3PA 1OECA 4BDFA 5AX9A 3RTPA 4GFGA 3ZEPA 1OIRA 4O0VA 3HA6A 3VBWA 3U55A 3ZM4A 4PP7A 3NYVA 3AG9A 2R3RA 5DH3A 3UP2A 5H9BA 5DFPA 1PXNA 1QL6A 5DRBA 3EQFA 3OROA 3MVMA 5KZIA 4F0GA 2XRUA 3NYNA 2WELA 3VUMA 3NNWA 4DFXE 4P90A 2GMXA 4X2KA 2J0IA 3TV6A 4D4SA 3E5AA 4DC2A 1XWSA 2J2IB 2WZJA 5M09A 1V0PA 4L7FA 4QPMA 4WRSA 2GQSA 5IQCA 1CSNA 2C0OA 4BDHA 4ZTSA 3NAYA 4OTWA 4QMNA 4IB3A 3IW8A 5EHLA 5M53A 2R3FA 4MCVA 3SGCA 4AF3A 5AP7A 2O8YA 4NM5A 2VX3A 2CDZA 2CGXA 2JKKA 2UW7A 2WOUA 3PTGA 3SRVB 3TDWA 4GKIA 3BHYA 5L2WA 3R9DA 3PRFA 3KCFA 4CFXA 5C8NA 2B53A 1BL7A 3GENA 3ORPA 4BCFA 5CF4A 5J7BA 1ZYDA 2H9VA 4BGHA 2R7IA 1PKGA 4EOLA 3F5PA 5AAFA 1ZARA 5DVRA 2KTYA 4EBWA 1ZYCA 2H96A 4E1ZA 4O0RA 4IXPA 1SZMA 3ZBXA 1P5EA 5IMXA 4X3JA 1R0PA 2PMNX 3JPVA 2ZMCA 3FZ1A 3ZH8A 3FV8A 1WAKA 4I20A 3C4EA 4NT4A 5CSWA 4XH6A 4Y72A 3VBTA 4F6SA 2Q83A 3NDMA 2CJMA 5DWRA 3EQGA 5LWMA 3UC4A 4II5A 3MESA 3OW3A 2HZ0A 2W9FB 2XK9A 3Q52A 4UALA 2QG5A 5AP0A 2J7TA 4XOYA 2XNMA 3Q4CA 4BDGA 2WB8A 2WTWA 2HW6A 5LMKC 4AZWA 3OW4A 3OVVA 5CASA 4X0MA 4B0GA 5BYYA 4GFMA 2C6IA 2WMRA 4FSNA 4AGDA 3UNKA 2XJ1A 4AN9A 4H58A 4I6HA 2PVFA 4BI1A 4M0YA 2OXDA 4QYYA 1KOAA 5DR9A 3SG8A 4YJNA 3HDMA 3UZPA 4WNMA 2CMWA 2XA4A 4JJRA 4C59A 4ENXA 4NJDA 5FWKK 4DH8A 2C0TA 3MVHA 3CTQA 2WTKC 4JT3A 2QLQA 4LOOA 2VTHA 2XMYA 4RLLA 5M4FA 5H3QA 2BZIB 2OJ9A 2OH0E 1WBPA 4F7JA 1I09A 2XBJA 3PP0A 4XOZA 3E8EA 3KK8A 4FSMA 4ZOGA 2WMAA 3ORZA 1H1SA 2PE0A 2BAKA 4IX6A 4IC8A 4LL5A 5HTBA 4MNEA 4XV1A 4EOJA 4EQCA 3QRTA 5D1JA 2WMQA 3HMPA 5CEKA 4BCOA 2X39A 3D5UA 3ENHA 2OW3A 3QUDA 3VF9A 5DNRA 2ITNA 3FI3A 3LFQA 4D55A 3FC1X 4ARKA 2G1TA 4EZ7A 1XR1A 4MH7A 4IAKA 4PPBA 4AA5A 2CKQA 4NYEA 4BN1A 1CM8A 4CMUA 3NUAA 4W4XA 5IQHA 1P14A 4DEHA 4MBJA 4JI9A 5A9UA 3DK3A 3DZOA 2P2IA 1YQJA 3JY9A 2IZSA 4ACGA 1BYGA 4IM3A 3MFUA 4OGRA 3NW5A 2B9FA 1UWJA 2VTQA 4YZBA 4O27B 5C8MA 5A14A 4KIKB 4S33A 4LOPA 4FE2A 5DGZA 4Y73A 4QYHA 2YM7A 4CSVA 5CVGA 2UW4A 3DQXA 4ONAA 3FXZA 4R77A 4W4WA 4C4HA 4RIXB 2PE1A 2WFYA 4Z3VA 3CPCA 4GKHA 4QPSA 2BDFA 3HYHA 1FVRA 4DEEA 4YC3A 3Q32A 2AUHA 4FIJA 4EYJA 5HCZA 3BHTA 5CAPA 2CNQA 2YM3A 3NUPA 4WNOA 3Q6UA 2QR8A 3R63A 4RFZA 3KKVA 3OOMA 4WT6A 4KKHA 3C1XA 4AQCA 4UX9A 3RPSA 3DK6A 4DFBA 1VYZA 2IW9A 3QF9A 3F2RA 5LMKA 5E8SA 3LLAA 2O63A 5BMSA 5ITAA 3WZJA 4QYEA 4CZYB 4QD6A 4EEVA 3CQWA 4RC4A 3WF6A 5B2LA 4OBOA 4CFWA 2QOOA 3RWPA 3PYYA 4FC0A 4PUZA 1BI7A 2ITPA 5H2UA 4Y46A 2CCIA 4JAJA 3DKCA 1Y8YA 4RVTA 4YJQA 3W2PA 2V7AA 2QURA 3IO7A 4O22A 4FKIA 3UVQA 1Q8TA 4DFUA 3H30A 4QP1A 4DTKA 4GVAA 5JSMA 4AS0A 1ZLTA 1XO2B 2W05A 3OF0A 5GNKA 1XQZA 4M14A 4LMNA 4DGMA 2XKFA 2R64A 3TWJA 5AFVA 3EZRA 5BMMA 4ZSAA 2R3HA 1TQPA 3F88A 2BZHB 3W55A 5C4LA 3QQUA 1H26A 2PVKA 2P55A 3E93A 3R7YA 5J9ZA 3OTUA 5H8GA 5M56A 1M52A 2NRUA 5AUZA 4IDVA 4IVDA 4HYUA 3O2MA 3UZTA 4DFYA 3UPZA 1SYKA 5CVHA 2YIWA 5A54A 4CFFA 3MTLA 4IB0A 1I44A 4BC6A 2G2FA 2J0LA 4JBPA 5AIRA 3C5UA 3EQRA 3L9NA 3WYYA 1R39A 4JL9A 1K3AA 2GNJA 3W1FA 4ANNA 1B6CB 4X21A 3AMBA 3R8VA 4DCEA 3BU5A 3GXLA 2RSVA 5HG9A 5HKMA 3FQHA 1UWHA 4U0IA 4UWBA 4CQGA 3MV5A 5AEPA 2BTRA 1ZAOA 1J1BA 4O6LA 4BCIA 4YMJA 3ZXZA 3GQIA 3I79A 4CNHA 5IQIA 1KE9A 4WNKA 4WG3A 4KBAA 3HAMA 2R0IA 4I0TA 4NKSA 4IVAA 2CGWA 3FMLA 3FSKA 4YTIA 5IA0A 4FKGA 3LM5A 3QWJA 2F2UA 4QMVA 4RRVA 4USEA 4K33A 5HCYA 5AMNA 3DA6A 3BKBA 2X2MA 3FLQA 4S30A 1JSTA 4XBUA 2X4ZA 1FGIA 2C30A 5FLFA 4AZFA 4ZTHA 4BF2A 3AD5A 5L2TA 3E64A 1IR3A 2OJIA 3VUIA 3PUPA 4IAYA 2PY3A 2VTMA 3F3UA 5BYLA 4G3GA 4FT3A 4BHZA 5B7VA 3PSBA 3RPOA 3A7HA 5KKRB 1YHWA 2CGVA 4IWPA 5LMAA 3UVRA 1IA9A 3GGFA 5KMMA 4JBOA 2ZV2A 3BBWA 3DDPA 3E8NA 3V51A 4AN3A 3ALNA 5AUTA 3F6XA 4O0WA 4XP2A 3BYSA 1UNLA 1Q3DA 3GU5A 2GTNA 4ZTRA 4PF4A 4NEUA 4XV9A 4E4XA 4K9YA 5C27A 4XJ0A 2X7FA 2W7XA 2WKMA 2QKRA 4RJ8A 3QKKA 4K1BA 2GNHA 3D2IA 4FSRA 4QMSA 4I94A 4FSYA 4Q5EA 4EOMA 2VTLA 2YLEA 3KF4A 4M12A 3ZLXA 4F9BA 1R1WA 4R5YA 1H1QA 5E8UA 3SXFA 2V62A 2XB7A 3CKXA 4ALWA 4FEWA 1W8CA 5TF9A 5JRQA 2W4KA 4L01A 4NTSA 3DT1A 1ZMUA 2GNIA 2QOIA 2X8EA 2OG8A 4RZWA 2JFLA 1W7HA 3WARA 4QMQA 1WBTA 2Z7RA 4IW0A 4U41A 4X6RA 4D9TA 3CBLA 4FODA 4TYEA 3QQKA 4QP8A 5HO8A 3NWWA 4AW0A 3LHJA 4DGLC 1U59A 5BVDA 4ENYA 1ZOHA 3QLGA 4O7YA 1U4DA 2G15A 2ACXA 4NFMA 2I0VA 1KWPA 1UV5A 5CU2A 4AZEA 1ZMWA 2ZVAA 2BFYA 3SHEA 1Y57A 4L3JA 5HG7A 3W33A 5A4CA 5KBRA 4AGCA 3QC9A 4J98A 4M66A 4IWOA 3ZRKA 3QD2B 4QTAA 1OUYA 4G9RA 3RCDA 3UYTA 4AW2A 4UN0C 5A6OA 3UMXA 2XP2A 1OZ1A 1ZZLA 3AGLA 3FDNA 4ZTNA 5KNJA 4QMMA 4BDIA 1B38A 3MA3A 4FG8A 3NUUA 3RM6A 1NA7A 2YITA 3L8XA 1SMHA 2ZJWA 4CD0A 4RVKA 4D58A 3PVWA 5CAVA 4R6VA 4FV2A 3F69A 4GK4A 1T45A 5IQFA 4U80A 3QUEA 2VWUA 3R30A 3TDVA 2PMOX 1U5RA 2P2HA 4N0SA 1G3NA 1YOLA 2C3LA 2VTAA 4AA4A 4FIFA 2ZM3A 1XJDA 1M2RA 4QMUA 1OVEA 5G6VA 4HCTA 5FBOA 3GU4A 3EQHA 4MEDA 5HIEA 3R21A 2BDJA 4HNFA 5KMOA 5BVEA 4H3QA 1ZOEA 4QTCA 2J0JA 2PZ5A 3GQLA 3O71A 4KRDA 1AQ1A 4EHGA 2OK1A 3EQDA 3DTWA 5AV3A 5HVKA 3P79A 5JFXA 4S34A 5HGIA 5M55A 4U7ZA 4WG5A 1F0QA 3GT8A 4PL3A 2QR7A 4QP7A 4ZZOA 4O81A 2JDOA 2CLXA 2CKEA 4U79A 4DEDA 3V5PA 3OHTA 4EUUA 3FI2A 4AG8A 4JG7A 4O84A 4W4VA 3GFEA 4NK9A 1YKRA 3S00A 5JT2A 4XG7A 3CGOA 3BYUA 4LUEA 3AC5A 4AXAA 3ULIA 2OIDA 3UG1A 4JVGA 3RINA 4FKOA 5EOBA 3LAUA 1YW2A 3HL7A 2JBPA 4GJ2A 2JLDA 4R1VA 3R8UA 1W0XC 4JBQA 2X7OA 3IG7A 4KAOA 3VRYA 2OZAA 4GH2A 2W5HA 5FM2A 4M0ZA 4O21A 2HW7A 1J3HA 5CSHA 2QONA 3ZRLA 1YI3A 3LXKA 2EXCX 4HW7A 3Q9YA 4QYFA 4YHFA 2PU8A 3REPA 4QMTA 4TKSA 3BYVA 1GZKA 3G0FA 3GCSA 4YLKA 2XNGA 4O0UA 4WUAA 2YFXA 4YJVA 3A8XA 4J99A 2HY0A 3F82A 5J79A 3ROYA 4RIWA 4TZRA 4L8MA 4CKIA 3SDJA 2QO9A 3NYXA 5DYJA 3LFSA 3I4BA 4FIEA 3FLWA 5M57A 3F9NA 3W18A 4FV0A 4C3PA 5M06A 5L8KA 2IZUA 3BGQA 3ZLYA 4C35A 1QMZA 3PPZA 2XCHA 1S9JA 4JOAA 5CQWA 2O0UA 4A9TA 5JGDA 4YU2A 5A4QA 4UWCA 3SW4A 5E8ZA 5ANGA 2QQ7A 2W06A 5E91A 4IQ6A 2VWWA 3CE3A 2B1PA 1SNXA 4RSSA 2X81A 3VBXA 5H8BA 3IW4A 1Q3WA 1KSWA 2ZMDA 4R1YA 3DGKA 4EUTA 4ORKA 2A1AB 5HVJA 5E7RA 1SVGA 2QOLA 2BROA 1M2QA 3JXWA 4L00A 3W2CA 4IX4A 3ZUUA 1YWNA 2B9JA 3A7JA 1IA8A 1XHAA 3KXMA 3ET7A 1PYXA 4M97A 4WUNA 4XBRA 3Q9WA 4G3FA 2GFCA 2IZTA 4QMOA 5GJDA 5ETCA 5EW3A 4C4GA 5ICPA 2UUEA 1LP4A 3RK9A 4EHVA 4IACA 3L8SA 3VULA 2DQ7X 4BVUA 4FTIA 4OTDA 3D7ZA 2PULA 4FV1A 4FV4A 4GJ3A 4MK0A 1PHKA 4V0GB 3T9TA 3FEGA 4HJOA 4F99A 4DA5A 4FZDB 3F7ZA 4IIRA 3TNHA 4X3FC 4N57A 3WF7A 1MRVA 2YIQA 3HMNA 3R73A 3IK3A 4FSWA 4NUSA 4ANSA 5AR2A 5E4HA 5KMNA 4QPAA 4ZSGA 1YWRA 2OIBA 1RW8A 2JDRA 3PVUA 1O6KA 3LE6A 4PY1A 5CI6A 3DPKA 2PUPA 4BDCA 4U9AA 4RQVA 1P4FA 2UZWE 3VUDA 4BHNA 3R9RA 4YURA 4LRJA 4K0YA 4GYGA 1E1VA 2WMVA 2GQRA 3FLSA 3OWLA 1OI9A 3MFRA 3F3TA 3HMOA 5C03A 2WMBA 1ZY5A 3Q2JA 2OH4A 3T3UA 4DG3E 2FA2A 2W0JA 3UC3A 5HICA 2JKOA 1YI6A 1LPUA 4M67A 2VTNA 1A9UA 2EXMA 3PVGA 3SOCA 4CMOA 5ETAA 2QHMA 2XYNA 2UW0A 5LVNA 3FHRA 2A2AA 2C6LA 1YXSA 2EWAA 5BUJA 2QOFA 1PY5A 3CS9A 4HNIA 3SOAA 3UODA 2PZPA 4J1RA 4BCQA 4W8EA 4OTPA 2XKEA 4X2FA 3C0HA 4U97A 1YHSA 1ATPE 3IOKA 2ZV9A 4AOIA 5DA3A 1G8AA 3NUYA 4TYHA 2W4OA 5IA5A 4ANBA 3MVLA 3VHEA 4C38A 3RPVA 3TNPC 4WO5A 5EHOA 2FH9A 2BRBA 2VTJA 4JQEA 5B0XA 4NIFA 5KMKA 4GVJA 3PY3A 3PVBA 3RVGA 1YXVA 4LGHA 5GZ8A 2JD5A 4QT1A 5ANOA 3BCEA 3T8OA 4MBLA 5HO6A 2IG7A 5AV2A 5FXSA 5HG8A 2B54A 4RX8A 4E3CA 2XCKA 2XK8A 3QTSA 4U3ZA 3N51A 3FMNA 3LFBA 5DT3A 4QQCA 3HUBA 4BWXA 4I93A 4RWLA 4KKEA 1DAYA 1OB3A 3DKOA 3L8VA 2B52A 4NW6A 1CKIA 1Q8WA 3QTIA 3RALA 2XVDA 4HYSA 4A06A 4EBVA 4ZAUA 3KVXA 4J97A 2PVYA 4FNWA 4C4IA 5KHWA 3QL8A 4FIHA 4G6OA 3C4XA 2XF0A 5HOAA 5IDNA 5KCVA 4IJ9A 3PLSA 4XG6A 3H4JA 3DKGA 4JS8A 3E3PA 3KXNA 5AP4A 5L8LA 3PA5A 5K4IA 4LOQA 4FYOA 4PTEA 2B0QA 2RKUA 1NY3A 2QC6A 2VO0A 3DNDA 3G9LX 4L3PA 3BE2A 3F3ZA 5F94A 1FOTA 4FKUA 4C7TA 4D2WA 5FXRA 4X3FA 4D2RA 4CEGA 3VS3A 4QQJA 2VX0A 2XIZA 3FAAA 3Q3BA 4FZAB 4UZDA 4DG2E 3QGWA 2VTPA 1WMKA 3BLQA 4RIYB 3VWAA 2A4LA 2W1DA 2PK9A 4LGGA 4D5HA 5I4NA 4BCHA 4I4FA 3CKWA 3TXOA 1FVTA 5HU3A 1H1RA 4FV7A 2AC5A 3IS5A 1WZYA 4TWPA 2B7AA 3EFJA 5B2KA 4A7CA 4OTGA 4LRMA 2UZLA 3V5WA 2VWIA 3M1SA 3BV3A 3VS5A 4BDJA 2HYYA 2Y6MA 3MDYA 4FV3A 3N4TA 1PXOA 4AFJA 4ZMFA 3BYMA 3TN8A 2XK7A 2IVTA 1K2PA 3CC6A 3O23A 4WHZA 4RX7A 4KUJA 2WEIA 4R8QA 3PPKA 2NP8A 5AR8A 5CAQA 1MQBA 3KB7A 4O7TA 3QX2A 2Y0AA 4XCUA 5EDQA 5HTIA 2HXLA 2OJJA 4ACMA 1CKJA 4UEUA 3U6IA 4JQ7A 4E4NA 3DZQA 4P5QA 2PVJA 4DLIA 5AR4A 4CTBA 3EFKA 1A48A 2OICA 3TUBA 4IH8A 2J0MB 3RCJA 3KA0A 4LG4A 4TWCA 5IQAA 3SW7A 5CU0A 1OL7A 3LW0A 3NW6A 2GHLA 4G34A 4TN6A 4TNBA 1FBNA 3EL8A 4YO6A 4O0XA 3CY2A 4BTFA 4QP6A 4BDEA 1PMNA 5BQ0A 1T46A 4DT9A 2G2IA 4U3YA 5EQEA 2UVZA 4IM2A 3BYOA 2JIIA 4ZS4A 4ZZNA 4KIQA 5AV0A 5J8IA 3A7FA 5BYZA 4PL5A 3SRVA 2PZIA 3ITZA 4EKKA 4EOQA 3OD6X 2ZYBA 4FL2A 4JDJA 3UYSA 1PYEA 4KNBA 4B99A 4JX7A 1NXKA 5HNGA 4A9UA 3SX9A 4YZCA 4F65A 2R7BA 3FYJX 3KEXA 4FKTA 2H34A 3QXOA 4XG2A 5L2IA 3R04A 3NYOA 4I41A 2UZBA 2CSNA 1H00A 1OPKA 4FT5A 2RG6A 3BU6A 3AGMA 2I0HA 3WIKA 3B8QA 4IZYA 4E6AA 3E92A 5HBEA 3FPMA 5FBNC 5JH6A 2VX1A 3RAWA 3BGZA 4J71A 4APCA 5C4KA 4CQEA 5CYIA 5L2QA 3DTCA 4TWNA 3PZEA 5EI6A 5AAEA 4IMYA 4OBQA 5F20A 3SVVA 2NO3A 3AC8A 4FOBA 2PVLA 5FG8A 3A8WA 2PVRA 5BX0A 4CLJA 3UIUA 4ASDA 3QCSA 4IC7A 4K18A 4IZ7A 2OGVA 2ZV8A 1OL2A 4G6NA 4A9RA 2Y9QA 3UP7A 3QTZA 5L3AA 4RC2A 3RZFA 3QYWA 3KCKA 5CEPA 3NUXA 3WI6A 5F9EA 3CP9A 2C1AA 4AACA 3COIA 4J52A 3NGAA 3V01A 4TY1A 3KULB 3QQHA 5CVFA 3HKOA 4AWIA 2XBAA 4XNEA 4F9YA 4QTDA 5LVLA 1LEZA 3QQJA 4G3EA 5IEVA 4TPTA 5JFWA 5CQUA 4ZSEA 3NNXA 2RFDA 4BDAA 4D2VA 2BRHA 2VTTA 4IBMA 3WIGA 4ASXA 4FTQA 5JFVA 5LJJA 3W2SA 3BWJA 1GIIA 2FUMA 3VS6A 2J50A 4AA0A 3S1HA 4EQMA 3UVPA 3B8RA 4QQTA 3R1YA 4HCVA 4EOPA 5KMIA 2YCQA 5FTQA 3UTOA 2W4JA 1TVOA 2BRNA 1JOWB 4ZSLA 5CEMA 5KMLA 3BHVA 5D7AA 3GP0A 3BU3A 5HU9A 3FUPA 3E7VA 2BIYA 4ERKA 4BBFA 5IA1A 2V7OA 2GS2A 3CY3A 4JDHA 4JR3A 4PMMA 1Q24A 1Q62A 3UNZA 4D4YA 3MH1A 4FI1A 5M4IA 3G6HA 3MJ2A 3QBNA 4ZZMA 5TKDA 3ZOSA 3TJDA 2Y4PA 2YCFA 5CXZA 3QYZA 1ZRZA 3NUNA 3DFCB 5IA2A 5DN3A 3IGGA 4YR8A 5HO7A 3AT4A 1JSUA 4KIKA 4LV5A 3V6RA 2IW8A 2VUWA 3KRJA 3NNUA 4FK6A 2WQNA 2R3OA 4FK3A 4YC8A 3VQHA 4E26A 1ND4A 5G1XA 3GU7A 3QD0A 4H05A 2ERZE 3P7AA 3HECA 3UPXA 3O8UA 4IX5A 2C5XA 5AA8A 2UW5A 4CZTA 3LKMA 3P08A 2PYWA 1FMKA 2X6DA 1H0WA 3UOLA 3ZCLA 2C6TA 4M13A 5IEYA 4UMPA 3BEAA 4L3LA 3G0EA 4AOTA 3GCQA 4FSUA 3MFSA 4BZNA 2I0YA 4V04A 5KHXA 1Y6AA 4BWKA 5L2SA 3NNVA 5ETIA 5M51A 3ENMA 1H0VA 3QRIA 3MH3A 3CQEA 5EW8A 4Y5QA 3EWHA 4E8AA 3RM7A 4EK3A 2J6MA 5EQPA 4BKYA 4GIIA 3CEKA 1IRKA 2XZSA 3FKLA 3FLZA 4L9IA 5BUEA 1PKDA 5FEQA 5LMBA 3SV0A 4UB7A 4O1PA 4PV0A 5CWZA 5KKRC 3RNYA 3IDCA 3ORNA 4B7TA 2BUJA 3L9PA 5I9VA 5EYMA 4ZY4A 4C2VA 5JEBA 3UZRA 3LJ1A 3KF7A 4IVCA 4M69B 5K3YA 1PXIA 2P0CA 5C8KA 3OWJA 4F7NA 5H8EA 4YNEA 4IWDA 4NM7A 1IG1A 3OOGA 2YHVA 3LQ8A 2BRGA 3E8DA 4YP8A 2HOGA 4G2FA 3TACA 2HENA 3TZ8A 4EKLA 3AD6A 5HD7A 2OFVA 2XJ2A 2UZUE 1MRYA 3C50A 1F5QA 3BX5A 5DHJA 4RVLA 3UG2A 2B9IA 3QRUA 1WVXA 2J9MA 4ZK5A 2W1ZA 3C0GA 2CGUA 2ITXA 2WU6A 3EJ1A 4LYNA 3Q4ZA 4G6LA 4Z7GA 2YM5A 3QU0A 4PNKA 5TO8A 2PMLX 2X4FA 2XKDA 3P7BA 4BZDA 2XK6A 2YEXA 2C6KA 3TIYA 4YBKA 4H39A 4BI2A 1YXTA 5IH5A 4JNWA 4Q9SA 1OL5A 4FKJA 2C0IA 5AUYA 1LUFA 2W5BA 5K4JA 2DUVA 4WBOA 2C6OA 5CEIA 3FI8A 4ZTMA 4KWPA 1JKTA 3D5VA 4QMWA 5I9WA 4A9SA 3COMA 4UXQA 2XIKA 2YIYA 4IJPA 1GY3A 4PDPA 4TW9A 4RA4A 4ZP5A 4OBPA 3DBFA 3MW1A 3TIZA 2QNJA 3QQGA 4FNXA 1P4OA 5BVKA 4F7LA 4MXOA 3EHAA 5AUVA 4B9DA 4EH2A 3AT3A 2XRWA 2FYSA 3D4QA 5FGKA 1Z5MA 4AP7A 1Z57A 3D83A 1W82A 3E62A 1GOLA 3QCXA 4BCKA 4D1XA 4NH1A 2BFXA 2Y8OA 3RHXA 2VV9A 4E6DA 3HP5A 3CPBA 3SC1A 5EI2A 2OO8X 3D14A 3IQ7A 4FNZA 1H25A 1W98A 4YZNA 5BVWA 2B4SB 5JZJA 4CG9A 4DGNA 4EH4A 2VO7A 3Q53A 3KRXA 2R3NA 3O96A 4JAIA 3OZ6A 3MWUA 4XV3A 5FM3A 3U6JA 1Q97A 2OLCA 4FV6A 1TKIA 5HE2A 5AP3A 3TL8A 4I22A 5LCJA 5DG5A 2Y6OA 4DEIA 3QQLA 4C37A 4IDTA 5LOHA 3G90X 4FA2A 2W1GA 5ANIA 4FEUA 2QD9A 2QO2A 3OT8A 3OTVA 2C5VA 3CSVA 4JG6A 3HNGA 2C5NA 4XP0A 4O7RA 4FTMA 5DEYA 1JQHA 3DBEA 3OP5A 4FT9A 4GW8A 4JG8A 5CU6A 4A4XA 4YTFA 3P4KA 5ANEA 5EYKA 2BHEA 3FC2A 4IANA 4I24A 4AW5A 3PJ3A 5CSXA 2XS0A 3PXYA 5AUXA 3A61A 1F3MC 1GIHA 3PPJA 5TR6A 2QCSA 2EVAA 2OKRA 3P9JA 1JKLA 3R2YA 4R3RA 4BCPA 5HLNA 3C0IA 5HNBA 2CNUA 4PTGA 1W83A 4I6QA 5J9YA 2VO3A 3OS3A 3UO6A 3GCUA 3SA0A 2BAJA 4FVRA 5DMZA 3I0OA 4TYGA 2OSCA 4BCGA 5IQBA 1CKPA 3MS9A 2C4GA 4NKAA 4FV8A 4NSTA 2ITTA 1BI8A 3HV3A 4KSPA 5LXMA 5EYCA 4DE4A 4UXLA 4DCAA 1J7LA 3B2TA 1YI4A 3OUNB 3R9HA 3LJ0A 3T3VA 3OMVA 4IB5A 4BCMA 4DHFA 3U9CA 5FP6A 4DH3A 2Z02A 4Z9LA 3LXNA 3D5XA 2BMCA 3R7UA 2XM9A 3I7CA 4F9AA 2XK4A 5L4QA 3FMKA 3IW5A 4M84A 3EH9A 2WTKB 3R22A 3UIBA 2XNOA 1KE5A 3F61A 3FLYA 1WBVA 1VJYA 1O9UA 2IPXA 5DPVA 4FX3A 2F7ZE 2RF9A 3DAKA 3QZHA 4YJRA 4HVIA 4MBIA 1H07A 2FSLX 3HX4A 4AZTA 1A06A 1YXUA 2XUUA 2Z7LA 3SAYA 5IUIA 2F7EE 3ODYX 3RJCA 3QGYA 3PXZA 2CNVA 2RG5A 2J90A 3HV4A 5K5XA 3IW7A 4IAZA 1AD5A 3FSFA 4PPCA 1OIQA 3AC1A 2QU5A 1UU8A 3AD4A 3LFFA 3PLAE 4OW8A 1XBAA 2JFMA 4A4LA 3FQSA 3N9XA 4XG4A 3MSSA 3RP9A 3Q04A 1PMEA 3VJNA 4BB4A 4GL9A 3WZKA 1RQQA 5EM6A 2QO7A 2ZM4A 3FKNA 4J96A 4F1OA 2YWVA 4ZY6A 3FMHA 3CD3A 5HLWA 4ANMA 4BRXA 1GIJA 3GC7A 1UU7A 4KSQA 4BKZA 4LFIA 4FL3A 3EKKA 4NZWB 1FGKA 3PZHA 4DEAA 1XKKA 4LRKA 3D7TB 4YZ9A 3THBA 4C4JA 2P4IA 3ACJA 1J91A 2YDKA 4JR7A 2HZ4A 4GU6A 3NPCA 5DR2A 3QKMA 1GZ8A 3ZFYA 3DBQA 1ZYSA 4I0SA 4QO9A 2JBOA 3DBCA 3WYXA 4I5MA 2Z8CA 1PF8A 2CKPA 4DF3A 4EQUA 1FPUA 4DEBA 5BVFA 5C01A 3KL8A 4EK8A 5A4EA 3CR0A 3BPRA 4YTHA 1QPJA 4ANQA 5HCXA 4IFCA 3VNTA 2YABA 3TTIA 3VQUA 4EORA 3FL4A 3CLYA 4RLKA 4UY9A 4BCNA 4EH7A 3RNIA 4HYHA 4NL0A 4CYIA 5KO1A 4P7EA 1XBCA 5D12A 5F1ZA 2XEZA 4XRJA 5D9HA 5CT0A 4YHJA 4C62A 2I40A 3C51A 2J5FA 3EMGA 1JNKA 3K54A 3ZUTA 2FSMX 2QU6A 3KGAA 4XX9A 2E9NA 2JGZA 4YHTA 4D0XA 4FMQA 2R3IA 4BYIA 5EK7A 2HIWA 2W1HA 3IECA 4MQ1A 3MBLA 3BLRA 3B2WA 4Y95A 2PSQA 3PSCA 1NVQA 2IW6A 2WEVA 4EZ5A 4BDBA 4NFNA 3DS6A 3KMUA 3KXHA 4C3RA 2WHBA 2VZ6A 5HBJA 5FXQA 2WTCA 4C34A 5D41A 1MP8A 2G01A 2UVYA 3NCGA 4FYNA 3TG1A 2QVSE 5D7VA 5ETFA 3FMJA 4UMUA 5M4UA 3A2CA 4YPSA 4I21A 2BDWA 5IQEA 4E73A 3KXXA 2YDIA 4HYIA 3D0EA 4YC6A 1FQ1B 2VNWA 3P86A 4IAFA 3UE4A 4LQMA 3UIXA 5CSPA 4K8AA 1YWVA 3PJCA 3POOA 2EXEA 3ZSHA 5A46A 3LJ2A 4FIGA 3TEIA 2W1FA 3SXRA 1O6LA 4PQNA 3NSZA 3A99A 4YUQA 3HRFA 4DFNA 4IZ5A 4NWMA 4QMYA 5E8TA 4FSZA 4V0GA 2ITWA 5T68A 4EZ3A 4PL4A 5T6KA 4F09A 4DBXA 2R3KA 3DXNA 3QWKA 4YJPA 1IASA 2JEDA 3LM0A 2Y4IB 5F4NA 5I9UA 4GK3A 2YACA 3MB7A 3ERKA 4FICA 4H3BA 1TQIA 3TZMA 5DI1A 3IDBA 3P78A 4O82A 3I60A 2LGCA 4FKWA 4U45A 2GS6A 4PPAA 5HQ0A 4ACDA 4EK4A 3BZ3A 2FO0A 2H6DA 1OM1A 5ANDA 4MTAA 3VHKA 3Q4UA 4F0IA 5CSVA 3EQIA 1Q99A 4K77A 3ORKA 4G31A 3SKCA 2R9SA 3PFQA 2WQMA 5J7HA 2CCHA 5CNNA 4CMTA 4R7BA 5LVMA 3FJQE 2HZNA 3LFDA 2W9ZB 4EH6A 4RWIA 3VVHA 4U8ZA 3G9NA 3FXWA 3UDBA 3IW6A 3FZPA 1WBNA 3QTXA 3QUPA 4KINA 4HGTA 3RPYA 4XMOA 3DXQA 3R01A 4L43A 3KRRA 4WOVA 2YAKA 4QTBA 3Q2MA 3QCQA 2IVSA 5CLPA 1OBGA 4DT8A 3ANRA 2YCRA 4FL1A 4MAOA 4EH3A 5AAGA 3Q5ZA 3LZBA 4G3CA 2YWPA 3AMAA 3R7VA 2O2UA 2ZM1A 3R00A 1GNGA 3MA6A 4EOKA 2H8HA 1S9IA 3IONA 4L44A 1UKHA 1PMUA 3G51A 4IX3A 4U40A 1QPEA 2OF2A 4QMLA 3I81A 3PRIA 3BIZA 4QNAA 5HLPA 5EDRA 1WVYA 2X7GA 3DY7A 3GNIB 2PVNA 2XJ0A 2W99B 1YRPA 2PMIA 2PVMA 2QOCA 3KMWA 4S31A 5BVNA 5L6WL 5I3RA 4IM0A 5LVOA 3G2FA 4AZSA 5C9CA 3KXGA 3DDQA 3EB0A 4BBEA 3GU8A 3DJ6A 2V0DA 3V5QA 3QFVA 4ZLYA 2VTOA 3WILA 5CTPA 4X2NA 3MJ1A 3R7EA 2A19B 5EM8A 3TI1A 2WMSA 2C5OA 4PWNA 3ZLSA 3ZYAA 4RIYA 3R9OA 3K2LA 3Q6WA 4FTLA 3U4UA 3H9FA 4Y85A 5AV1A 5A6NA 1YDTE 2AC3A 4MX9A 4OTRA 5AM7A 2QKWB 4GRBA 5L8JA 5DIAA 3S3IA 1JSVA 3VUHA 2W1IA 4IAIA 3HP2A 4BTJA 2R4BA 4OTHA 3K5VA 3JYAA 4LGDA 4MYGA 5IF1A 2VWZA 4HGSA 5I9XA 3EIDA 1DS5A 3AMYA 4JIAA 4RJ4A 4W8DA 3BHHA 4TXCA 4BZOA 4D1ZA 3LFEA 3M11A 3CIKA 3NW7A 4E7WA 2I6LA 2OXXA 2UZTA 1BUHA 4YJSA 3MIYA 2VO6A 5HIBA 4XP3A 2CHLA 4U6RA 3QTRA 1B39A 1OIYA 4PMTA 3P5KA 4RX9A 3BE9A 4TYJA 3PXKA 2I1MA 3KRWA 3PIYA 3ZFMA 3OCSA 4OLIA 3Q9ZA 2WU7A 3HMIA 4R78A 5EHYA 2QODA 4FZ7A 3UMWA 2VD5A 3C13A 4RQKA 2NPQA 5E8WA 4AUAA 4EC8A 4F1TA 5CENA 4U43A 4D28A 2BRMA 2DWBA 2C3JA 1OL6A 3U54A 3OWPA 4NTTA 1ERKA 1STCE 5JGBA 3LPBA 4MXXA 5AP6A 4QMZA 5CXHA 5T3QA 1U46A 3V04A 2WOTA 3AXWA 3ORLA 5CANA 4O7LA 2AYPA 5FTGA 4USFA 4F70A 2WQOA 4O0YA 4K6ZA 3FWQA 3U51A 3VJOA 3FZSA 3RK7A 3LFCA 4R7IA 2ITOA 4RJ6A 4DLJA 4EJNA 4O86A 1YOMA 2GCDA 3KVWA 3A7IA 5GIPE 5TE0A 4BTMA 3DLZA 5HD4A 3G33A 2X6EA 3WE8A 2P33A 2QOQA 3V5JA 4BDKA 3VBVA 5HHWA 5HE1A 5JKGA 3E8CA 2IWIA 3H10A 3K3JA 3RZBA 2F2CB 3GUBA 4U42A 3LQ3A 3ORMA 1OIUA 3BQCA 3HUCA 5HE0A 3CCNA 2W96B 3PP1A 1WCCA 1KE6A 3LFNA 4FSTA 4KA3A 2HY81 1OKVA 4FEQA 3GOKA 4FT0A 3UO5A 3HDNA 1URWA 4BWPA 4D4RA 4JDIA 4ZJIA 1NW1A 4MD8E 3C7QA 2GU8A 3R2BA 5M4CA 2BR1A 5AJQA 2OJGA 3DB6A 4HPTE 2EUFB 4NIFB 5DBXA 4O7VA 2VU3A 4I4EA 5CX9A 1OKYA 4CV9A 2PVHA 2BVAA 3QRKA 5F95A 3F2AA 1ZYJA 3KREA 3SG9A 4KS7A 3RAHA 5JGAA 1UNHA 1Q41A 5FTOA 3L9MA 4GFOA 4C61A 4P2KA 1M17A 2W17A 3KULA 4X2GA 4B8LA 4RT7A 3ZRMA 4CFNA 1XH4A 4CTCA 4UYAA 3CGFA 4BIDA 2Z7QA 4H1JA 3RAIA 3EQCA 3QTUA 2OXYA 4AZVA 5K0KA 5I9ZA 2C6MA 5JK3A 3PDTA 4YGAA 4OAUC 1E9HA 5FP5A 3HV5A 4GUBA 1APME 4QTEA 4L52A 4TL0A 2IJMA 1SM2A 5A4LA 3GC8A 2CN8A 5IKWA 3W8LA 4YNOA 2WQBA 3WE4A 4RG0A 4RJ5A 2X0GA 3NRMA 2X8IA 1KV2A 2OI4X 2PL0A 3LXLA 4D2TA 4GEOA 3NEWA 4R5SA 2E2BA 3DFAA 3ODZX 1UU3A 2VGOA 5K9IA 3MVJA 3TCPA 4J95A 5AM6A 5AUUA 3QX4A 5LQFA 4MD7E 3MPAA 2NRYA 4DH5A 3FHIA 4NM3A 4BCJA 3R8LA 3KXZA 3C9WA 3EFLA 4Z55A 4FGRA 2X1NA 3MFTA 1HCKA 3MY1A 5CF6A 4EJ7A 5BVOA 3Q5IA 2VTRA 3MPTA 2WPAA 4GG5A 4GS6A 4I3ZA 1HCLA 5CNOA 1SVEA 3VS1A 4BGQA 3I5NA 3R6XA 4XG8A 1AGWA 5C26A 2VWYA 4CT1A 4TWOA 2RFEA 2FSOX 1FINA 2UZEA 3ZXTA 2PZYA 3RBWA 4DGOA 2VWXA 3HGKA 4CVAA 3COKA 4GT3A 4LUDA 3EN4A 3DAEA 3EN6A 4RFYA 3HEGA 4O38A 4CFVA 3FKOA 3TUCA 1CDKA 2ETMA 5CEQA 4A07A 4FTJA 5HI2A 2F49A 4J8NA 3R9NA 3W2RA 1Q8ZA 4JRVA 2UW6A 1FMOE 4DAWA 4F08A 4Q9ZA 3ZSGA 3FZOA 4NM0A 4X7QA 1FVVA 1SNUA 4R3CA 2UZNA 3NUSA 3ZHPC 4BTKA 2P3GX 4FTCA 4U44A 1DI9A 4B6LA 2CLQA 3PXRA 3BV2A 3Q96A 5HESA 4PNIA 3P7CA 4L46A 2FVDA 5LARA 4FKPA 5GJGA 3PXQA 3M2WA 5B2MA 5GZAA 4JQ8A 2YERA 3RKBA 3GCPA 5KX8A 4K11A 1UVRA 2QG7A 4H36A 3EKNA 4E6CA 4D9UA 1ZWSA 5IG1A 4XRLA 3V5TA 4WNPA 4HZSA 5HTCA 4Z7HA 2HWOA 2XNBA 5AP5A 3S0OA 3EFWA 4C8BA 2R3MA 4M69A 4NW5A 3JUHA 4FZ6A 3DOGA 3JVSA 3V3VA 2JIVA 3HMMA 5EFQA 3VC4A 3G15A 2WQEA 4EWQA 3PIZA 4GV1A 2RFNA 4EH5A 4KIPA 4EL9A 2C1BA 3IDPA 4ZTQA 3VW6A 3UOHA 4I5CA 4RFMA 2J51A 3W2OA 4C3FA 4RC3A 4TRLA 2YIRA 3DJ7A 2Z7SA 3F66A 4FKRA 4MKCA 4MQ2A 1RDQE 3E3BX 3E7OA 4FUYA 4DGGA 3FL5A 3GOPA 4RIXA 1U54B 1VZOA 3SXSA 2O64A 4EK6A 1OITA 2WMWA 3LCTA 3LVPA 2C6EA 2VTIA 2BTSA 2HELA 3QA0A 4CYJA 4G9CA 5FQDC 3R8ZA 5CEOA 4L53A 1UA2A 5CI7A 2ERKA 4IVBA 4ZJJA 3BI6A 1R0EA 1JKSA 3C4CA 1WVWA 1OL1A 3BWFA 4C2WA 1XBBA 1OUKA 4XV2A 4E93A 4DINA 2WNTA 2HCKA 1YDSE 2E9VA 3W32A 4F9WA 1OPLA 4O6EA 4LL0A 1ZXEA 5CT7A 4FF8A 5EQYA 4UYNA 2OU7A 1MRUA 1VYWA 3NLBA 4I6BA 4Y83A 1BX6A 2ETKA 4ID7A 4RBLA 3CTJA 2IVUA 3T9IA 4NCTC 1NT2A 1DM2A 2EB3A 4B4LA 4BICA 2B55A 3ZFXA 4GMYA 4ANLA 3V6SA 4XLVA 4BL1A 1OKZA 3TNQB 4O96A 5EDPA 3JY0A 4OUCA 4PDYA 4Q5HA 4V01A 3QCYA 4CFUA 2XIYA 3WF9A 5HORA 5E8XA 4EOIA 2PTKA 3VAPA 3O17A 4I23A 2HXQA 1BLXA 4F6UA 5DT0A 5HZNA 3UO4A 1GJOA 3U87A 1IEPA 3GCVA 4EYMA 4JBVA 1PJKA 3FQEA 3GEQA 3SD0A 3ORIA 4GCJA 2QOKA 5I9YA 3VS0A 2C68A 3I5ZA 3FMDA 4AU8A 3PA3A 4BKJA 3MIAA 4I1ZA 3JVRA 5BUIA 4O7WA 3QZGA 3O8TA 3NMUF 5GZ9A 2UVXA 3W2QA 3VUTA 1JLUE 4BYJA 2CPKE 4UMRA 3R7GA 2HWPA 5EG3A 3F3WA 4QP3A 4HVDA 4YSJA 4YZDA 4JRNA 5CZHA 3VUGA 2V22A 5EI8A 4DTBA 3FE3A 4ERWA 3ZTXA 3UBDA 4WKQA 4F7SA 3ATSA 3PIXA 3OXZA 3P0MA 3V8WA 5FDPA 2WTVA 2VTSA 5AP2A 5EKNA 3CD8A 4HPUE 4APPA 1NVSA 2O5KA 3PG1A 3ALOA 3WF5A 2GSFA 3EN7A 1JAMA 3ETAA 4FVQA 5FUTA 4PMSA 2XM8A 3R71A 5CY3A 1VR2A 2RGPA 3DNEA 4FTOA 4RWKA 2YISA 4C4EA 4AOJA 2XNNA 4N6ZA 4RJ3A 4DFZE 3O51A 5GHVA 2C69A 4DEGA 3F7WA 2XIXA 4GG7A 4ZTLA 2R3GA 4A9YA 3NIEA 4M8TA 3O8PA 2IZRA 5IMEA 4WG4A 3ZEWA 4ASEA 3AQVA 4ZY5A 4MNEB 2OFUA 5IDPA 4ZLZA 3TT0A 4FTRA 2J5EA 3R1QA 4FV5A 3OCTA 4YTCA 4ZJVA 4WSYA 1ZZ2A 3JS2A 5EM7A 5I0BA 2YZLA 1V0BA 1W84A 3LQ5A 1JWHA 4YLJA 1U5QA 2WIPA 2XEYA 4AT3A 4C0TA 3LCSA 2VWVA 5KMJA 3QLFA 5JQ5A 3ZONA 2HAKA 3A60A 3VO3A 2BZJA 4CCBA 3C5IA 4YSMA 5DE2A 4EC9A 3FY2A 3I1AA 4NU1A 4NCTA 3HRBA 3OT3A 5TOZA 4AFEA 2C3IB 3GC9A 3EL7A 3R1SA 3PY1A 3ZZEA 4CRLA 3II5A 4MWHA 3AT2A 5CALA 3GFWA 4A4OA 1L3RE 4ZS0A 5IA3A 3E87A 3A4PA 5CU3A 1UNGA 3AC4A 4LMUA 2WXVA 1RE8A 4FV9A 3DQWA 2ONLC 2A0CX 3MB6A 4ACHA 2IO6A 4HVGA 3LCDA 1Q61A 4CCUA 5KUPA 1YHVA 2BIKB 2JAVA 5IEXA 4Y5HA 2OZOA 3UJGA 5EKOA 3QTQA 2VGPA 4CGAA 3R83A 2W5AA 4WRGA 1XH7A 4FKQA 4E20A 4ITHA 5J5SA 4EH9A 1CMKE 3DLSA 3DU8A 5LVPA 2EB2A 3OXTA 2REIA 3OG7A 4R3PA 1H4LA 2JDVA 4QMPA 5EM5A 4DYMA 2GNGA 3UOJA 5E90A 3EOCA 3I6WA 5L6OA 4LM5A 2XKCA 3HV7A 2YM8A 2YDJA 2RFSA 3M42A 3U4WA 2O65A 5CF8A 2ITUA 1OMWA 3QD3A 3D7TA 2Y4IC 4FR4A 3W8QA 1H08A 3JR1A 3ROCA 3HZTA 4HOKA 1M2PA 3UNJA 3OEZA 3QA8A 3W16A 4GT5A 2PE2A 4BFMA 4EOSA 3G6GA 1XH6A 3ZO1A 4IZAA 4RWJA 2W1CA 4FZFB 3KQ7A 2PZRA 5IUHA 1O6YA 5JRSA 1X8BA 2ZB1A 4O91A 4V05A 4RGJA 2GDOA 4O0SA 3MH2A 3GC0A 4DTAA 4JIKA 2R3LA 5BPYA 2B9HA 3GVUA 4GYIA 2OBJA 3PJ1A 4G3DA 2ITQA 4N70A 4AN2A 1KUTA 1PMVA 4L67A 4FKLA 3DB8A 3D15A 3WZUA 4YJUA 5D11A 3TZ7A 3GI3A 4RMZA 1RJBA 4I6FA 2YCSA 3OCGA 4JXFA 1Q5KA 1OPJA 5M08A 3A7GA 3ZO3A 3BHUA 4J53A 5A3XA 3DCVA 2ETRA 4PDOA 3L1SA 2HK5A 4L68A 2HZIA 2JKQA 4DFLA 2IVVA 3KFAA 1Z9XA 5DT4A 3KRLA 5FRIA 3TUDA 1Q8YA 3L8PA 4M15A 3OXIA 3TTJA 3GU6A 3EYGA 5EW9A 3NR9A 4U81A 3O50A 2GS7A 5E8YA 3VRZA 4J7BA 4ITIA 3I6UA 3I7BA 3MY0A 5LCKA 3KN6A 2Q0BA 3NVKI 2R3QA 2ZB0A 5J1WA 4OT5A 3RWQA 4QNYA 3HAVA 4UWYA 1IAHA 2SRCA 2WO6A 1LR4A 4PMPA 4XYFA 1YDRE 2ONLA 2Z60A 4MXCA 4MVFA 3ZDUA 5AA9A 4P5ZA 4EI4A 2PPQA 4FKVA 2E9UA 3HRCA 3LIJA 1QCFA 3GBZA 4AE9A 3OY1A 3DK7A 3O7LD 4G5JA 3U6HA 4FT7A 5J9LA 1V1KA 1GZNA 3LMGA 3PE2A 3ORXA 1M7QA 1K9AA 2C5YA 5ACBC 4O83A 1URCA 3S2PA 2ZDUA 4DITA 4FTAA 4AGUA 2I0EA 3V8TA 5IA4A 2GHGA 5E1SA 4P4CA 3EN9A 4O0TA 3WZDA 1PW2A 3OFMA 1CTPE 2Q0NA 3PY0A 3TKUA 1H28A 4H3PA 3F5XA 3TKIA 3ZM9A 3ANQA 4ZMEA 3VBQA 4C02A 3VN9A 5E9EA 3ZC5A 3C4WA 4IADA 3QRJA 4OTFA 4WBBB 3VS2A 4IEBA 2F57A 3AOXA 3BLHA 5EYDA 2C3KA 4OTIA 4UZHA 4ANOA 4IB1A 3C4FA 4EWHA 4G17A 2X2KA 2LAVA 3K5UA 4LI5A 4RJ7A 3WZEA 4FUXA 2QI8A 2XNEA 1L8TA 3QZIA 2DYLA 2PWLA 5DRDA 4BIEA 4OR5A 2XK3A 1M14A 2BAQA 3KC3A 4GSBA 4QOXA 3FPQA 3QALE 2BPMA 1XH8A 2UV2A 3HV6A 4H1MA 1WBWA 3QTWA 2YZAA 4YJTA 4QMXA 4UMTA 4O2ZA 3TM0A 4F1MA 3UQFA 5GIOE 5J87A 2F7XE 4KRCA 4RA5A 4O1OA 1E1XA 1H1PA 1DAWA 3PWYA 4AE6A 4I92A 2YLFA 5L6PA 4C4FA 4WSQA 5FEDA 4QYGA 3ZS5A 3R28A 3NCZA 2BCJA 1J7IA 4MHAA 5IU2A 3QKLA 4FVPA 3BBTB 4G5PA 3A62A 2RIOA 2IN6A 3NAXA 2WMXA 4EONA 5DEWA 4BR3A 4FTUA 3VIDA 5M07A 3S4QA 2JAMA 2YM6A 1R3CA 2ITYA 2XH5A 3LMIA 4BY9E 4I0RA 3ZO2A 3LMHA 1QPDA 4FOCA 1QPCA 5JQ8A 1PXKA 1Q8UA 2YM4A 1JVPP 4KKGA 3VS7A 3NX8A 4WA9A 5CU4A 2JDTA 4RX5A 1V0OA 5IISA 2J4ZA 3VS4A 5IQDA 2R3PA 3O0GA 3V5LA 2ZDTA 2F9GA 2VAGA 3F3VA 3TNIA 3WF8A 4EK5A 4W9WA 1H27A 4ZSJA 4O7NA 1OGUA 3AC2A 3R7OA 2PUNA 4XLIA 3ZLWA 3Q9XA 3PG3A 2ZV7A 4FIIA 4HGLA 3ZC6A 4M7IA 4FG7A 3RGFA 5A4TA 3H9RA 3QD4A 5GJFA 3SQQA 4YJOA 3ID6C 2VNYA 3GB2A 2I7QA 2UZDA 4CXAA 4TNDA 3NS9A 4FG9A 3ZZWA 3QC4A 5AX3A 4EHEA 3OEFX 3NIZA 2XIRA 4XEYA 4ASZA 3TV7A 4F6WA 4CKJA 4TT7A 4CFMA 1PXLA 2DS1A 3OY3A 3IKAA 4W9XA 3TJCA 3VF8A 4J8MA 3WOWA 5BNJA 3KU2A 1IAJA 5JZNA 3FXXA 3LLTA 3UQGA 4YBJA 3CQUA 4EHZA 2BHHA 2PUUA 2WMTA 2UW8A 4L45A 1SVHA 5IH4A 4QP2A 5AV4A 2X2LA 3R8MA 5EH0A 1PRYA 3H0ZA 1JBPE 4MXYA 3MI9A 4YPDA 5HX6A 1EH4A 2V5QA 2GNLA 3BRBA 2CKOA 1MUOA 3O7LB 5ACKA 3CJGA 4K2RA 5GINE 3FY0A 3ATTA 3FZTA 3DKFA 2OJFE 3ACKA 5DR6A 4KBCA 4GU9A 1LEWA 2CN5A 3COHA 3POZA 2UZVA 1VEBA 2X9EA 2BILB 4D0WA 3KK9A 3FLNC 4CT2A 1PXJA 2PHKA 3QAME 3KY2A 4IWQA 4MD9E 3CTHA 1PXMA 4F64A 1UU9A 4L7SA 3I0QA 1BKXA 3PSDA 4FKSA 4IAAA 3VBYA 4DBNA 3C4ZA 2YJRA 4D5KA 5JMSA 2ESMA 1P2AA 3PJ2A 2E9PA 2FSTX 2PUIA 1ZMVA 1KV1A 2W1EA 5J1VA 4AX8A 2OZAB 3LXPA 3IOPA 4R7HA 5CAOA 3NVMB 3R02A 4WD5A 1J7UA 4FTKA 3U9NA 1H1WA 1G8SA 2WTDA 5AP1A 4I5HA 2UZOA 4BI0A 4L6QA 4HCUA 3N4UA 4CG8A 5AADA 2BALA 4XUFA 2C47A 2KULA 4AW1A 4YO4A 3D2KA 2QLUA 5E8VA 4USDA 5J5TA 4ZXTA 3TZ9A 4E5WA 5EOLA 3QHRA 4UBAA 2BKKA 4DH1A 3FYKX 3D5WA 3DBDA 4RIWB 1J1CA 2EU9A 3PWDA 3RK5A 3WBLA 5K5NA 4N6YA 4DN5A 1ZY4A 3BQRA 4FGBA 4FTTA 4MXAA 5IUGA 3S95A 1OKWA 3Q4TA 5HIDA 2G9XA 3R1NA 4FEXA 3E63A 3AC3A 2ITZA 3QQFA 4FSQA 4GUEA 4S2ZA 3OBJA 5I3OA 3R8PA 5JFSA 3PJ8A 4B8MA 3ULZA 1WBSA 2VWBA 4MF1A 2JITA 4Z16A 3G5DA 1REKA 1Y6BA 1GAGA 3LCKA 4F0FA 4RPVA 2QOHA 3D9VA 3DV3A 3FMMA 2R2PA 4LV8A 2WIHA 1WFCA 4FEVA 2G2HA 3OC1A 3VW8A 2GHMA 4E6QA 1WBOA 3RMFA 4Y8DA 1REJA 2NNWB 4O7ZA 2WMUA 1BL6A 5J95A 2YN8A 4XHKB 3BEGA 4PP9A 2XYUA 3OBGA 3TV4A 1JKKA 2E9OA 3H9OA 3R0TA 4C57A 5IZFA 4S32A 2F4JA 4C58A 3H0YA 2BKZA 5E1EA 1UKIA 1YOJA 1TQMA 3P1AA 2ZOQA 4E5BA 2OF4A 5KZ0A 2JDSA 5M44A 3VUKA 2YJSA 3HA8A 4CLIA 4HGEA 1Y91A 1H24A 2R5TA 4AGWA 4BDDA 4CKRA 4G1WA 2ITVA 5JN2A 2BZKB 1H8FA 2QOBA 1Q4LA 2V55A 3FMEA 4UV0A 3W10A 4ALVA 4F63A 3QXPA 4XG9A 4PX6A 5KBQA 3NZ0A 5I5ZA 3DJ5A 4E4LA 4OAVB 4AT5A 1YVJA 3HVCA 4QRCA 4D2PA 3DXPA 5CZIA 4JLCA 2R3JA 4DH7A 4QP4A 1HOWA 4CV8A 1Y8GA 3EQPA 2VN9A 5C1QB 3LOKA 3ZSIA 4AAAA 3KMMA 4IE9A 5AR3A 5AUWA 4ALUA 4O2PA 4BIBA 4NJ3A 3TKHA 2WAJA 4DG0E 4IHPA 5AR7A 3UOKA 2FB8A 1KE7A 2UW9A 5ANJA 4L42A 4N4SA 4U5JA 3MYGA 4PDSA 4HVHA 4BBMA 2YIXA 2GPHA 2X9FA 4F9CA 4O7SA 2QHNA 4UMQA 3QHWA 3U8WA 4KBKA 4JX3A 5IPJA 2RL5A 4KIOA 5HBHA 3PXFA 4ITJA 3RPRA 3OUKA 4EH8A 4BGGA 4TYIA 3FBVA 3Q60A 3K3IA 4IFGA 2J0KA 3ZBFA
chains in the Genus database with same CATH superfamily
5ANKA 3IPHA 1JPAA 5AIKA 1G5SA 4HZRA 4KB8A 4TYHB 3CJFA 2X8DA 3MH0A 3SLSA 4QQ5A 1DI8A 2YA9A 2GTMA 5DOSA 5CAUA 3ZUVA 3DAJA 3LCOA 2FGIA 5HEZA 2GNFA 2ZAZA 4JDKA 3RI1A 4D1SA 4Q2AA 4XG3A 5CF5A 5IQGA 4CRSA 3LFAA 2JC6A 4FTNA 5IH6A 3TNWA 3P23A 1XH5A 4TTHB 3UQCA 3MGYA 4I5PA 3RAKA 4OTQA 5LWNA 3FZRA 3OCBA 4ZEGA 3R7IA 3BELA 5HG5A 3BLAA 3HLLA 2GFSA 2Z2WA 4OT6A 1ZOGA 5FDXA 2YAAA 3E88A 4MWIA 3N4VA 4X2JA 3PA4A 3MPMA 1PXPA 1YXXA 2OIQA 4CZUA 4HVSA 3A4OX 4D4VA 4ACCA 2WGJA 5E92A 4RZVA 4C36A 4GIHA 4G16A 3UIMA 1XH9A 3ELJA 3F5UA 2UW3A 3BL9A 4E5AX 3H3CA 4FBXA 2A27A 2WD1A 2JKMA 3ORTA 5HX8A 3ZDIA 4YLLA 3MY5A 4FNYA 4MNFA 1GZOA 1ZYLA 4MF0A 4RIOA 4W4YA 3L9LA 2WTJA 3PE1A 4WIHA 5D10A 4QEBA 3OWKA 4GT4A 4ZIMA 4RVMA 2VRXA 4XS2A 3ZO4A 4D2SA 3F2NA 1OBDA 3EYHA 4YZMA 4KD1A 3CXWA 4X3FB 5AR5A 5HNIX 4PRJA 4MXZA 4QP9A 1M7NA 4X6QC 2XNPA 4GK2A 5TT7A 3EQBA 5K0XA 2Y7JA 3MTFA 3EN5A 3IGOA 1MQ4A 3ZU7A 4ZLOA 1H01A 3ZMMA 3UGCA 3EZVA 4EOOA 5HVYA 1BMKA 3FI4A 3QZFA 4PTCA 3D94A 4KS8A 1R78A 2GQGA 4KABA 1NVRA 3MN3A 2WTIA 5CS6A 5KE0A 3RHKA 4C33A 2JIUA 4E4MA 4M68A 2OWBA 5FD2A 2C6DA 5FEEA 4M3QA 5HE3A 4F4PA 4BJJB 3F5GA 3BGPA 5AWMA 4AT4A 1KOBA 1U54A 1KE8A 3KN5A 2R0UA 5DLSA 3V8SA 2O3PA 1OECA 4BDFA 5AX9A 3RTPA 4GFGA 3ZEPA 1OIRA 4O0VA 3HA6A 3VBWA 3U55A 3ZM4A 4PP7A 3NYVA 3AG9A 2R3RA 5DH3A 3UP2A 5H9BA 5DFPA 1PXNA 1QL6A 5DRBA 3EQFA 3OROA 3MVMA 5KZIA 4F0GA 2XRUA 3NYNA 2WELA 3VUMA 3NNWA 4DFXE 4P90A 2GMXA 4X2KA 2J0IA 3TV6A 4D4SA 3E5AA 4DC2A 1XWSA 2J2IB 2WZJA 5M09A 1V0PA 4L7FA 4QPMA 4WRSA 2GQSA 5IQCA 1CSNA 2C0OA 4BDHA 4ZTSA 3NAYA 4OTWA 4QMNA 4IB3A 3IW8A 5EHLA 5M53A 2R3FA 4MCVA 3SGCA 4AF3A 5AP7A 2O8YA 4NM5A 2VX3A 2CDZA 2CGXA 2JKKA 2UW7A 2WOUA 3PTGA 3SRVB 3TDWA 4GKIA 3BHYA 5L2WA 3R9DA 3PRFA 3KCFA 4CFXA 5C8NA 2B53A 1BL7A 3GENA 3ORPA 4BCFA 5CF4A 5J7BA 1ZYDA 2H9VA 4BGHA 2R7IA 1PKGA 4EOLA 3F5PA 5AAFA 1ZARA 5DVRA 2KTYA 4EBWA 1ZYCA 2H96A 4E1ZA 4O0RA 4IXPA 1SZMA 3ZBXA 1P5EA 5IMXA 4X3JA 1R0PA 2PMNX 3JPVA 2ZMCA 3FZ1A 3ZH8A 3FV8A 1WAKA 4I20A 3C4EA 4NT4A 5CSWA 4XH6A 4Y72A 3VBTA 4F6SA 2Q83A 3NDMA 3W0QA 2CJMA 5DWRA 3EQGA 5LWMA 3UC4A 4II5A 3MESA 3OW3A 3O5AA 2HZ0A 2W9FB 2XK9A 3Q52A 4UALA 2QG5A 5AP0A 2J7TA 4XOYA 2XNMA 3Q4CA 4BDGA 2WB8A 2WTWA 2HW6A 5LMKC 4AZWA 1W2FA 3OW4A 3OVVA 5CASA 4X0MA 4B0GA 2IEWA 5BYYA 4GFMA 2C6IA 2WMRA 4FSNA 4AGDA 3UNKA 3UDSA 2XJ1A 4AN9A 4H58A 4I6HA 2PVFA 4BI1A 4M0YA 2OXDA 4QYYA 1KOAA 5DR9A 3SG8A 4YJNA 3HDMA 3UZPA 4WNMA 2CMWA 2XA4A 4JJRA 4C59A 4ENXA 4NJDA 5FWKK 4DH8A 2C0TA 3MVHA 3CTQA 2WTKC 4JT3A 2QLQA 4LOOA 2VTHA 2XMYA 4RLLA 5M4FA 5H3QA 2BZIB 2OJ9A 2OH0E 1WBPA 4F7JA 1I09A 2XBJA 3PP0A 4XOZA 3E8EA 3KK8A 4FSMA 4ZOGA 2WMAA 3ORZA 1H1SA 2PE0A 2BAKA 4IX6A 4IC8A 4LL5A 5HTBA 4MNEA 4XV1A 4EOJA 4EQCA 3QRTA 5D1JA 2WMQA 3HMPA 5CEKA 4BCOA 2X39A 3D5UA 3ENHA 2OW3A 3QUDA 3VF9A 5DNRA 2ITNA 3FI3A 3LFQA 4D55A 3FC1X 4ARKA 2G1TA 4EZ7A 1XR1A 4MH7A 4IAKA 4PPBA 4AA5A 2CKQA 4NYEA 4BN1A 1CM8A 4CMUA 3NUAA 4W4XA 5IQHA 1P14A 4DEHA 4MBJA 4JI9A 5A9UA 3DK3A 3DZOA 2P2IA 1YQJA 3JY9A 2IZSA 4ACGA 1BYGA 4IM3A 3MFUA 4OGRA 3NW5A 2B9FA 1UWJA 2VTQA 4YZBA 4O27B 5C8MA 5A14A 4KIKB 4S33A 4LOPA 4FE2A 5DGZA 4Y73A 4QYHA 2YM7A 4CSVA 5CVGA 2UW4A 3DQXA 4ONAA 3FXZA 4R77A 4W4WA 4C4HA 4RIXB 2PE1A 2WFYA 4Z3VA 3CPCA 4GKHA 4QPSA 2BDFA 3HYHA 1FVRA 4DEEA 4YC3A 3Q32A 2AUHA 4FIJA 4EYJA 5HCZA 3BHTA 5CAPA 2CNQA 2YM3A 3NUPA 4WNOA 3Q6UA 2QR8A 3R63A 4RFZA 3KKVA 3OOMA 4WT6A 4KKHA 3C1XA 4AQCA 4UX9A 3RPSA 3DK6A 4DFBA 1VYZA 2IW9A 3QF9A 3F2RA 5LMKA 5E8SA 3LLAA 2O63A 5BMSA 5ITAA 3WZJA 4QYEA 4CZYB 4QD6A 4EEVA 3CQWA 4RC4A 3WF6A 5B2LA 4OBOA 4CFWA 2QOOA 3RWPA 1TZDA 3PYYA 4FC0A 4PUZA 3W0OA 1BI7A 2ITPA 5H2UA 4Y46A 2CCIA 4JAJA 3DKCA 1Y8YA 4FJVA 4RVTA 4YJQA 3W2PA 2V7AA 2QURA 3IO7A 4O22A 4FKIA 3UVQA 1Q8TA 4DFUA 3H30A 4QP1A 4DTKA 4GVAA 5JSMA 4AS0A 1ZLTA 1XO2B 2W05A 3OF0A 5GNKA 1XQZA 4M14A 4LMNA 4DGMA 2XKFA 2R64A 3TWJA 5AFVA 3EZRA 5BMMA 4ZSAA 2R3HA 1TQPA 3F88A 2BZHB 3W55A 5C4LA 3QQUA 1H26A 2PVKA 2P55A 3E93A 3R7YA 5J9ZA 3OTUA 5H8GA 5M56A 1M52A 2NRUA 5AUZA 4IDVA 4IVDA 4HYUA 3O2MA 3UZTA 4DFYA 3UPZA 1SYKA 1G8KA 5CVHA 2YIWA 5A54A 4CFFA 3MTLA 4IB0A 1I44A 4BC6A 2G2FA 2J0LA 4JBPA 5AIRA 3C5UA 3EQRA 3L9NA 3WYYA 1R39A 4JL9A 1K3AA 2GNJA 3W1FA 4ANNA 1B6CB 4X21A 3AMBA 3R8VA 4DCEA 3BU5A 3GXLA 2RSVA 5HG9A 5HKMA 3FQHA 1UWHA 4U0IA 4UWBA 4CQGA 3MV5A 5AEPA 2BTRA 1ZAOA 1J1BA 4O6LA 4BCIA 4YMJA 3ZXZA 3GQIA 3I79A 4CNHA 5IQIA 1KE9A 4WNKA 2XARA 4WG3A 4KBAA 3HAMA 2R0IA 4I0TA 4NKSA 4IVAA 2CGWA 3FMLA 3FSKA 4YTIA 5IA0A 4FKGA 3LM5A 3QWJA 2F2UA 4QMVA 4RRVA 4USEA 4K33A 5HCYA 5AMNA 3DA6A 3BKBA 2X2MA 3FLQA 4S30A 1JSTA 4XBUA 2X4ZA 1FGIA 2C30A 5FLFA 4AZFA 4ZTHA 4BF2A 3AD5A 5L2TA 3E64A 1IR3A 2OJIA 3VUIA 3PUPA 4IAYA 2PY3A 2VTMA 3F3UA 5BYLA 4G3GA 4FT3A 4BHZA 5B7VA 3PSBA 3RPOA 3A7HA 5KKRB 1YHWA 2CGVA 4IWPA 5LMAA 3UVRA 1IA9A 3GGFA 5KMMA 4JBOA 1TFFA 2ZV2A 3BBWA 3DDPA 3E8NA 3V51A 4AN3A 3ALNA 5AUTA 3F6XA 4O0WA 4XP2A 3BYSA 1UNLA 1Q3DA 3GU5A 2GTNA 4ZTRA 4PF4A 4NEUA 4XV9A 4E4XA 4K9YA 5C27A 4XJ0A 2X7FA 2W7XA 2WKMA 2QKRA 4RJ8A 3QKKA 4K1BA 3ML1A 2GNHA 3D2IA 4FSRA 4QMSA 4I94A 4FSYA 4Q5EA 4EOMA 2VTLA 2YLEA 3KF4A 4M12A 4I6LA 3ZLXA 4F9BA 1R1WA 4R5YA 1H1QA 5E8UA 3SXFA 2V62A 2XB7A 3CKXA 4ALWA 4FEWA 1W8CA 5TF9A 5JRQA 2ZFYA 2W4KA 4L01A 4NTSA 3DT1A 1ZMUA 2GNIA 2QOIA 2X8EA 2OG8A 4RZWA 2JFLA 1W7HA 3WARA 4QMQA 1WBTA 2Z7RA 4IW0A 4U41A 4X6RA 4D9TA 3CBLA 4FODA 4TYEA 3QQKA 4QP8A 5HO8A 3NWWA 4AW0A 3LHJA 4DGLC 1U59A 5BVDA 4ENYA 1ZOHA 3QLGA 4O7YA 1U4DA 2G15A 2ACXA 4NFMA 2I0VA 1KWPA 1UV5A 5CU2A 4AZEA 1ZMWA 2ZVAA 2BFYA 3SHEA 1Y57A 4L3JA 5HG7A 3W33A 5A4CA 5KBRA 4AGCA 3QC9A 4J98A 4M66A 4IWOA 3ZRKA 3QD2B 4QTAA 1OUYA 4G9RA 3RCDA 3UYTA 4AW2A 4UN0C 5A6OA 3UMXA 2XP2A 1OZ1A 1ZZLA 3AGLA 3FDNA 4ZTNA 5KNJA 4QMMA 4BDIA 1B38A 3MA3A 4FG8A 3NUUA 3RM6A 1NA7A 2YITA 3L8XA 1SMHA 2ZJWA 4CD0A 4RVKA 4D58A 3PVWA 5CAVA 4R6VA 4FV2A 3F69A 4GK4A 1T45A 5IQFA 4U80A 3QUEA 2VWUA 3R30A 3TDVA 2PMOX 1U5RA 2P2HA 4N0SA 1G3NA 1YOLA 2C3LA 2VTAA 4AA4A 4FIFA 2ZM3A 1XJDA 1M2RA 4QMUA 1OVEA 5G6VA 4HCTA 5FBOA 3GU4A 3EQHA 4MEDA 5HIEA 3R21A 2BDJA 4DDIA 4HNFA 1G8JA 5KMOA 5BVEA 4H3QA 1ZOEA 4QTCA 2J0JA 2PZ5A 3GQLA 3O71A 4KRDA 1AQ1A 4EHGA 2OK1A 3EQDA 3DTWA 5AV3A 5HVKA 3P79A 5JFXA 4S34A 5HGIA 5M55A 4U7ZA 4WG5A 1F0QA 3GT8A 4PL3A 2QR7A 4QP7A 4ZZOA 4O81A 2JDOA 2CLXA 2CKEA 4U79A 4DEDA 3V5PA 3OHTA 4EUUA 3FI2A 4AG8A 4JG7A 4O84A 4W4VA 3GFEA 4NK9A 1YKRA 3S00A 5JT2A 4XG7A 3CGOA 3BYUA 4LUEA 3AC5A 4AXAA 3ULIA 2OIDA 3UG1A 4JVGA 3RINA 4FKOA 5EOBA 3LAUA 1YW2A 3HL7A 2JBPA 4GJ2A 2JLDA 4R1VA 3R8UA 1W0XC 4JBQA 2X7OA 3IG7A 4KAOA 3VRYA 2OZAA 4GH2A 2W5HA 5FM2A 4M0ZA 4O21A 2HW7A 1J3HA 5CSHA 2QONA 3ZRLA 1YI3A 3LXKA 2EXCX 4HW7A 3Q9YA 4QYFA 4YHFA 2PU8A 3REPA 4QMTA 4TKSA 3BYVA 1GZKA 3G0FA 3GCSA 4YLKA 2XNGA 4O0UA 4WUAA 2YFXA 4YJVA 3A8XA 4J99A 2HY0A 3F82A 5J79A 3ROYA 4RIWA 4TZRA 4L8MA 4CKIA 3SDJA 2QO9A 3NYXA 5DYJA 3LFSA 3I4BA 4FIEA 3FLWA 5M57A 3F9NA 3W18A 4FV0A 4C3PA 5M06A 5L8KA 2IZUA 3BGQA 3ZLYA 4C35A 1QMZA 3PPZA 2XCHA 1S9JA 4JOAA 5CQWA 2O0UA 4A9TA 5JGDA 4YU2A 5A4QA 4UWCA 3SW4A 5E8ZA 5ANGA 2QQ7A 2W06A 5E91A 4IQ6A 2VWWA 3CE3A 2B1PA 1SNXA 4RSSA 2X81A 3VBXA 5H8BA 3IW4A 1Q3WA 1KSWA 2ZMDA 4R1YA 3DGKA 4EUTA 4ORKA 2A1AB 5HVJA 5E7RA 1SVGA 2QOLA 2BROA 1M2QA 3JXWA 4L00A 3W2CA 4IX4A 3ZUUA 1YWNA 2B9JA 3A7JA 1IA8A 1XHAA 3KXMA 3ET7A 1PYXA 4M97A 4WUNA 4XBRA 3Q9WA 4G3FA 2GFCA 2IZTA 4QMOA 5GJDA 5ETCA 5EW3A 4C4GA 5ICPA 2UUEA 1LP4A 3RK9A 4EHVA 4IACA 3L8SA 3VULA 2DQ7X 4BVUA 4FTIA 4OTDA 3D7ZA 2PULA 4FV1A 4FV4A 4GJ3A 4MK0A 1PHKA 4V0GB 3T9TA 3FEGA 4HJOA 4F99A 4DA5A 4FZDB 3F7ZA 4IIRA 3TNHA 4X3FC 4N57A 3WF7A 1MRVA 2YIQA 3HMNA 3R73A 3IK3A 4FSWA 4NUSA 4ANSA 5AR2A 5E4HA 5KMNA 4QPAA 4ZSGA 1YWRA 2OIBA 1RW8A 2JDRA 3PVUA 1O6KA 3LE6A 4PY1A 5CI6A 3DPKA 2PUPA 4BDCA 4U9AA 4RQVA 1P4FA 2UZWE 3VUDA 4BHNA 3R9RA 4YURA 4LRJA 4K0YA 4GYGA 1E1VA 2IF8A 2WMVA 2GQRA 3FLSA 3OWLA 1OI9A 3MFRA 3F3TA 3HMOA 5C03A 2WMBA 1ZY5A 3Q2JA 2OH4A 3T3UA 4DG3E 2FA2A 2W0JA 3UC3A 5HICA 2JKOA 1YI6A 1LPUA 4M67A 2VTNA 1A9UA 2EXMA 3PVGA 3SOCA 4CMOA 5ETAA 2QHMA 2XYNA 2UW0A 5LVNA 3FHRA 2A2AA 2C6LA 1YXSA 2EWAA 5BUJA 2QOFA 1PY5A 3CS9A 4HNIA 3SOAA 3UODA 2PZPA 4J1RA 4BCQA 4W8EA 4OTPA 2XKEA 4X2FA 3C0HA 4U97A 1YHSA 3VONA 1ATPE 3IOKA 2ZV9A 4AOIA 3P5JC 5DA3A 1G8AA 3NUYA 4TYHA 2W4OA 5IA5A 4ANBA 3MVLA 3VHEA 4C38A 3RPVA 3TNPC 4WO5A 5EHOA 2FH9A 2BRBA 2VTJA 4JQEA 5B0XA 4NIFA 5KMKA 4GVJA 3PY3A 3PVBA 3RVGA 1YXVA 4LGHA 5GZ8A 2JD5A 4QT1A 5ANOA 3BCEA 3T8OA 4MBLA 5HO6A 2IG7A 5AV2A 5FXSA 5HG8A 2B54A 4RX8A 2X0QA 2XCKA 2XK8A 3QTSA 4U3ZA 4E3CA 3N51A 3FMNA 3LFBA 5DT3A 4QQCA 3HUBA 4BWXA 4I93A 4RWLA 4KKEA 1DAYA 1OB3A 3DKOA 3L8VA 2B52A 4NW6A 1CKIA 1Q8WA 3QTIA 3RALA 2XVDA 4HYSA 4A06A 4EBVA 4ZAUA 3KVXA 4J97A 2PVYA 4FNWA 4C4IA 5KHWA 3QL8A 4FIHA 4G6OA 3C4XA 2XF0A 5HOAA 5IDNA 5KCVA 4IJ9A 3PLSA 4XG6A 3H4JA 3DKGA 4JS8A 3E3PA 3KXNA 5AP4A 5L8LA 3PA5A 5K4IA 4LOQA 4FYOA 4PTEA 2B0QA 2RKUA 1NY3A 2QC6A 2VO0A 3DNDA 3G9LX 4L3PA 3BE2A 3F3ZA 5F94A 1FOTA 4FKUA 4C7TA 4D2WA 5FXRA 4X3FA 4D2RA 4CEGA 3VS3A 4QQJA 2VX0A 2XIZA 3FAAA 3Q3BA 4FZAB 4UZDA 4DG2E 3QGWA 2VTPA 1WMKA 3BLQA 4RIYB 3VWAA 2A4LA 2W1DA 2PK9A 4LGGA 4D5HA 5I4NA 4BCHA 4I4FA 3CKWA 3TXOA 1FVTA 5HU3A 1H1RA 4FV7A 2AC5A 3IS5A 1WZYA 4TWPA 2B7AA 3EFJA 5B2KA 4A7CA 4OTGA 4LRMA 2UZLA 3V5WA 2VWIA 3M1SA 3BV3A 3VS5A 4BDJA 2HYYA 2Y6MA 3MDYA 4FV3A 4BJJA 3N4TA 1PXOA 4AFJA 4ZMFA 3BYMA 3TN8A 2XK7A 2IVTA 1K2PA 3CC6A 3O23A 4WHZA 4RX7A 4KUJA 2WEIA 4R8QA 3PPKA 2NP8A 5AR8A 5CAQA 1MQBA 3KB7A 4O7TA 3QX2A 2Y0AA 4XCUA 5EDQA 5HTIA 2HXLA 2OJJA 4ACMA 1CKJA 4UEUA 3U6IA 4JQ7A 4E4NA 3DZQA 4P5QA 2PVJA 4DLIA 5AR4A 4CTBA 3EFKA 1A48A 2OICA 3TUBA 4IH8A 4AXCA 2J0MB 3RCJA 3KA0A 4LG4A 4TWCA 5IQAA 3SW7A 5CU0A 4QDVA 1OL7A 3LW0A 3NW6A 2GHLA 4G34A 4TN6A 4TNBA 1FBNA 3EL8A 4YO6A 4O0XA 2X0PA 3CY2A 4BTFA 4QP6A 4BDEA 1PMNA 5BQ0A 1T46A 4DT9A 2G2IA 4U3YA 5EQEA 2UVZA 4IM2A 3BYOA 2JIIA 4ZS4A 4ZZNA 4KIQA 5AV0A 5J8IA 3A7FA 5BYZA 4PL5A 3SRVA 2PZIA 3ITZA 4O4EA 4EKKA 2X0OA 4EOQA 3OD6X 2ZYBA 4FL2A 4JDJA 3UYSA 1PYEA 4KNBA 4B99A 4JX7A 1NXKA 5HNGA 4A9UA 3SX9A 4YZCA 4F65A 2R7BA 3FYJX 3KEXA 4FKTA 2H34A 3QXOA 4XG2A 5L2IA 3R04A 3NYOA 4I41A 4JMQA 2UZBA 2CSNA 1H00A 1OPKA 4FT5A 2RG6A 3BU6A 3AGMA 2I0HA 3WIKA 3B8QA 4IZYA 4E6AA 3E92A 5HBEA 3FPMA 5FBNC 5JH6A 2VX1A 3RAWA 3BGZA 4J71A 4APCA 5C4KA 4CQEA 5CYIA 5L2QA 3DTCA 4TWNA 3PZEA 5EI6A 5AAEA 4IMYA 4OBQA 5F20A 3SVVA 2NO3A 3AC8A 4FOBA 2PVLA 5FG8A 3A8WA 2PVRA 5BX0A 4CLJA 3UIUA 4ASDA 3QCSA 4IC7A 4K18A 4IZ7A 2OGVA 2ZV8A 1OL2A 4G6NA 4A9RA 2Y9QA 3UP7A 3QTZA 5L3AA 4RC2A 3RZFA 3QYWA 3KCKA 5CEPA 3NUXA 3WI6A 5F9EA 3CP9A 2C1AA 4AACA 3COIA 4J52A 3NGAA 3V01A 4TY1A 3KULB 3QQHA 5CVFA 3HKOA 4AWIA 2XBAA 4XNEA 4F9YA 1ST0A 4QTDA 5LVLA 3W0RA 1LEZA 3QQJA 4G3EA 5IEVA 4TPTA 5JFWA 5CQUA 4ZSEA 3NNXA 2RFDA 4BDAA 4D2VA 2BRHA 2VTTA 4IBMA 3WIGA 4ASXA 4FTQA 5JFVA 5LJJA 3W2SA 3BWJA 1GIIA 2FUMA 3VS6A 2J50A 4AA0A 3S1HA 4EQMA 3UVPA 3B8RA 4QQTA 5BV3A 3R1YA 4HCVA 4EOPA 5KMIA 2YCQA 5FTQA 3UTOA 2W4JA 1TVOA 2BRNA 1JOWB 4ZSLA 5CEMA 5KMLA 3BHVA 5D7AA 3GP0A 3BU3A 5HU9A 3FUPA 3E7VA 2BIYA 4ERKA 4BBFA 5IA1A 2V7OA 2GS2A 3CY3A 4JDHA 4JR3A 4PMMA 1Q24A 1Q62A 3UNZA 4D4YA 3MH1A 4FI1A 5M4IA 3G6HA 3MJ2A 3QBNA 4ZZMA 5TKDA 3ZOSA 3TJDA 2Y4PA 2YCFA 5CXZA 3QYZA 1ZRZA 3NUNA 3DFCB 5IA2A 5DN3A 3IGGA 4YR8A 5HO7A 3AT4A 1JSUA 4KIKA 4LV5A 3V6RA 2IW8A 2VUWA 3KRJA 3NNUA 4FK6A 2WQNA 2R3OA 4FK3A 4YC8A 3VQHA 4E26A 1ND4A 5G1XA 3GU7A 3QD0A 4H05A 2ERZE 3P7AA 3HECA 3UPXA 3O8UA 4IX5A 2C5XA 5AA8A 2UW5A 4CZTA 3LKMA 3P08A 2PYWA 1FMKA 2X6DA 1H0WA 3UOLA 3ZCLA 2C6TA 4M13A 5IEYA 4UMPA 3BEAA 4L3LA 4AXFA 3G0EA 4AOTA 3GCQA 4FSUA 3MFSA 4BZNA 2I0YA 4V04A 5KHXA 1Y6AA 4BWKA 5L2SA 3NNVA 5ETIA 5M51A 3ENMA 1H0VA 3QRIA 3MH3A 3CQEA 5EW8A 4Y5QA 3EWHA 4E8AA 3RM7A 4EK3A 2J6MA 5EQPA 4BKYA 4GIIA 3CEKA 1IRKA 2XZSA 3FKLA 3FLZA 4L9IA 5BUEA 3AKJA 1PKDA 5FEQA 5LMBA 3SV0A 4UB7A 4O1PA 4PV0A 5CWZA 5KKRC 3RNYA 3IDCA 3ORNA 4B7TA 2BUJA 3L9PA 5I9VA 5EYMA 4ZY4A 4C2VA 5JEBA 3UZRA 3LJ1A 3KF7A 4IVCA 4M69B 5K3YA 1PXIA 2P0CA 5C8KA 3OWJA 4F7NA 5H8EA 4YNEA 4IWDA 4NM7A 1IG1A 3OOGA 2YHVA 3LQ8A 2BRGA 3E8DA 4O4FA 2HOGA 4G2FA 4YP8A 2HENA 3TACA 3TZ8A 4EKLA 3AD6A 5HD7A 2OFVA 2XJ2A 2UZUE 1MRYA 3C50A 1F5QA 3BX5A 5DHJA 4RVLA 3UG2A 2B9IA 3QRUA 1WVXA 2J9MA 4ZK5A 2W1ZA 3C0GA 2CGUA 2ITXA 2WU6A 3EJ1A 4LYNA 3Q4ZA 4G6LA 4Z7GA 2YM5A 3QU0A 4PNKA 5TO8A 2PMLX 2X4FA 2XKDA 3P7BA 4BZDA 2XK6A 2YEXA 2C6KA 3TIYA 4YBKA 4H39A 4BI2A 1YXTA 5IH5A 4JNWA 4Q9SA 1OL5A 4FKJA 2C0IA 5AUYA 1LUFA 2W5BA 5K4JA 2DUVA 4WBOA 2C6OA 5CEIA 3FI8A 4ZTMA 4KWPA 1JKTA 3D5VA 4QMWA 5I9WA 4A9SA 3COMA 4UXQA 2XIKA 2YIYA 4IJPA 1GY3A 4PDPA 4TW9A 4RA4A 4ZP5A 4OBPA 3DBFA 3MW1A 3TIZA 2QNJA 3QQGA 4FNXA 1P4OA 5BVKA 4F7LA 4MXOA 3EHAA 5AUVA 4B9DA 4EH2A 3AT3A 2XRWA 2FYSA 3D4QA 5FGKA 1Z5MA 4AP7A 1Z57A 3D83A 1W82A 3E62A 1GOLA 3QCXA 4BCKA 4D1XA 4NH1A 2BFXA 2Y8OA 3RHXA 2VV9A 4E6DA 3HP5A 3CPBA 3SC1A 5EI2A 2OO8X 3D14A 3IQ7A 4FNZA 1H25A 1W98A 4YZNA 5BVWA 2B4SB 5JZJA 4CG9A 4DGNA 4EH4A 2VO7A 3Q53A 3KRXA 2R3NA 3O96A 4JAIA 3OZ6A 3MWUA 4XV3A 5FM3A 3U6JA 1Q97A 2OLCA 4FV6A 1TKIA 5HE2A 5AP3A 3TL8A 4I22A 5LCJA 5DG5A 2Y6OA 4DEIA 3QQLA 4C37A 4IDTA 5LOHA 3G90X 4FA2A 2W1GA 2XALA 5ANIA 4FEUA 2QD9A 2QO2A 3OT8A 3OTVA 2C5VA 3CSVA 4JG6A 3HNGA 2C5NA 4XP0A 4O7RA 4FTMA 5DEYA 1JQHA 3DBEA 3OP5A 4FT9A 4GW8A 4JG8A 5CU6A 4A4XA 4YTFA 3P4KA 5ANEA 5EYKA 2BHEA 3FC2A 4IANA 4I24A 4MUQA 4AW5A 3PJ3A 5CSXA 4O7ZA 2XS0A 3PXYA 5AUXA 3A61A 1F3MC 1GIHA 3PPJA 5TR6A 2QCSA 2EVAA 2OKRA 3P9JA 1JKLA 3R2YA 4R3RA 4BCPA 5HLNA 3C0IA 5HNBA 2CNUA 4PTGA 1W83A 4I6QA 5J9YA 2VO3A 3OS3A 3UO6A 3GCUA 3SA0A 2BAJA 4FVRA 5DMZA 3I0OA 4TYGA 2OSCA 4BCGA 5IQBA 1CKPA 3MS9A 2C4GA 4NKAA 4FV8A 4NSTA 2ITTA 1BI8A 3HV3A 4KSPA 5LXMA 5EYCA 4DE4A 4DHIB 4UXLA 4DCAA 1J7LA 3B2TA 1YI4A 3OUNB 3R9HA 3LJ0A 3T3VA 3OMVA 4IB5A 4BCMA 4DHFA 3U9CA 5FP6A 4DH3A 2Z02A 4Z9LA 3LXNA 3D5XA 2BMCA 3R7UA 2XM9A 3I7CA 4F9AA 2XK4A 2NYAA 5L4QA