2PVYA

Crystal structure of fgf receptor 2 (fgfr2) kinase domain harboring the pathogenic k659n mutation responsible for an unclassified craniosynostosis syndrome.
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
298
structure length
288
Chain Sequence
ELPEDPKWEFPRDKLTLGKPLQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMDINRVPEEQMTFKDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKNTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Fibroblast growth factor receptor 2
publication title A molecular brake in the kinase hinge region regulates the activity of receptor tyrosine kinases.
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 288
sequence length 298
chains with identical sequence B, C, D
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2pvyA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2pvyA01
4KUJA 5AX9A 2W99B 3BLQA 3GI3A 4BIEA 1HCLA 4ZOGA 3R9DA 4DT9A 3D94A 5ACKA 1REJA 5FBNC 4GMYA 2R3GA 2QO7A 3D5VA 3R63A 4XBRA 1RJBA 3RK9A 4CLIA 2C5NA 2YLFA 3UMWA 2DYLA 4X2JA 2B9FA 4F1OA 4EBWA 2JDRA 3P78A 2QOIA 4GK3A 4QQCA 4ZJVA 2ITQA 3FI4A 4J96A 5FP5A 5HZNA 3IO7A 4J53A 4QNYA 3BEAA 4FZDB 5AR4A 4A4LA 4B6LA 5M56A 5HEZA 4U0IA 1Q8TA 2HOGA 4F9AA 4JAIA 4LGGA 3NNXA 3Q04A 4EHEA 3ZO1A 4EJNA 2CKQA 4DHFA 5JFSA 3OS3A 1XWSA 5FG8A 3FKNA 2UVXA 4I20A 2B55A 5HCZA 4RLKA 5H8GA 3DQWA 2WAJA 3LLTA 2QD9A 3ERKA 4QPMA 3EYHA 4WUAA 4DGGA 4DTBA 4RT7A 3VHKA 2PZIA 4I93A 4HVHA 3CLYA 3KMMA 4H36A 3ZZWA 4BDBA 3H9OA 4BGGA 2A1AB 4OTIA 3QLFA 3EQBA 5HO7A 3CQWA 3VF8A 2CJMA 2OXDA 2OO8X 3HV3A 4RIWB 4I5MA 5AR8A 5L2SA 2CGWA 1WAKA 4GEOA 4CMUA 2GS2A 4RSSA 4ANQA 4H3PA 4ASXA 4D28A 2W1ZA 1OBDA 3CGFA 4C4HA 4DTKA 3VBXA 2QOCA 4IBMA 2FSOX 5EKNA 5BNJA 4JOAA 2PE0A 3LM5A 4CT1A 2I0EA 3PG1A 3O8UA 3PPZA 2HZ0A 4UZDA 2QOFA 4GU9A 2PVYA 5HGIA 5IUIA 3QA8A 5CALA 2HXQA 3OTVA 2VUWA 4ACMA 3ZO3A 4C4IA 3ORIA 3M1SA 4XRJA 4AFEA 4O82A 4YJSA 4E7WA 2NO3A 3E92A 3KGAA 5EYDA 4C7TA 4D2VA 1OMWA 4DBNA 3Q9WA 2UZBA 3LFNA 2OJFE 2RFDA 3R7OA 4M13A 2OW3A 5A6OA 4KIKB 4OTHA 2CKEA 4F7NA 3R9NA 3PUPA 4GT5A 3QFVA 3UP2A 4FT7A 2XNOA 4CRLA 1JPAA 1ZYLA 2CN8A 4D4YA 4BDGA 4DCEA 3UJGA 2OJJA 5IMXA 4V04A 2GNIA 4C3PA 2WTJA 3RPRA 4QYYA 5KMMA 2XMYA 3LXLA 5E90A 4C8BA 5IH6A 3D5XA 3IONA 4FK3A 3F5UA 1W83A 4DCAA 3PIYA 2PU8A 2VTAA 2CGUA 3HLLA 4HZSA 3AC4A 2WMQA 2XNNA 3NNUA 5F20A 5CZHA 5IZFA 2XK9A 4XH6A 2VWIA 2C3JA 4FTKA 3BYVA 5B2KA 4ERKA 5E8YA 2QOLA 3UNJA 2GNGA 1ZOGA 3VF9A 1Z9XA 1OPLA 2XKDA 4UMTA 4OTPA 4QP9A 2XK7A 2JGZA 2GTNA 3QTZA 2WB8A 4TNDA 3GQLA 4TPTA 3MN3A 4F6SA 2O2UA 4FVQA 4FEVA 2PPQA 5FUTA 4PWNA 2VD5A 4YMJA 2HZ4A 4OTDA 3V5PA 4O22A 4ZK5A 4AW5A 2A4LA 4EOSA 4PP7A 4ANSA 4NTSA 4TYGA 5JN2A 4ZS4A 1OL5A 3CY3A 4FI1A 2QONA 5E92A 4BIDA 3QKMA 3TDWA 5ETCA 4HYUA 4IWOA 1GZNA 2Z7RA 3QTWA 4FTRA 5AMNA 5KMKA 5AP3A 4W8DA 3NS9A 2CCIA 4BC6A 3CJFA 5K4IA 4J71A 3ACJA 4DEBA 4L53A 1PXKA 4KRDA 1OB3A 1WMKA 3E8NA 4C3RA 5CSHA 3Q96A 3LFFA 3ZC6A 5BYLA 5A6NA 4FKLA 4JDIA 3RM7A 3PA5A 4C4EA 4H58A 3UVQA 4F9BA 2BALA 3F88A 3PXZA 1AGWA 3CTQA 2QKWB 3HVCA 4M97A 3CSVA 4HYIA 2ITZA 2PL0A 3GQIA 5TOZA 2X7FA 2ESMA 3DKFA 4PUZA 3F7WA 3FMMA 3NIZA 4I3ZA 3C9WA 4ZTRA 4D9TA 4L45A 5CAVA 2B9HA 4O0RA 2WEIA 4CMOA 4XX9A 3H9RA 5J8IA 3V6RA 3CEKA 4UYAA 5K5XA 3UO4A 3E7VA 1YI3A 2ERKA 2BIYA 3PJCA 5CEPA 4AACA 4MXYA 4GJ3A 5EM6A 3A7GA 4EH2A 4FVPA 3FDNA 2G2IA 3R1NA 3I0OA 2C0OA 3A7JA 4EOKA 3O51A 3HMPA 3OBJA 4RLLA 3DJ6A 1KOAA 2R3FA 4HCVA 2OFVA 3TZ8A 1H26A 3DB6A 3AQVA 3K2LA 3OW3A 3DY7A 3ORLA 4O6EA 4ALVA 4YTFA 4XJ0A 2QG5A 4FTCA 5ANIA 3ALNA 5CY3A 2X9FA 3OT3A 3BLRA 2QR7A 3ZBFA 1J3HA 4AGUA 2X1NA 5ANOA 2YABA 5B7VA 3NGAA 4YZCA 2GQSA 4L3LA 5KKRB 4KAOA 3DAJA 4Q9ZA 3ZSHA 5LCKA 3PIZA 4DFLA 4IM3A 4OTFA 3NSZA 3BE2A 4RQKA 3OCBA 3TWJA 4YLJA 4AUAA 1PY5A 2XEZA 3R1SA 3C0GA 5IQBA 4MWIA 3F3UA 2C69A 2VTJA 4QOXA 2XK6A 2V0DA 3KEXA 4R5SA 5DN3A 3NVMB 2UZEA 4KBAA 2C6DA 4WNKA 3AC2A 2A27A 1XKKA 4TW9A 5EYKA 3E3BX 2RSVA 1LUFA 4M7IA 5HIDA 1LR4A 2WTCA 3MPAA 3TKUA 3DXNA 5IA3A 4FT0A 2X9EA 3EJ1A 4C33A 2WMSA 4FIJA 5M55A 3N9XA 3ZS5A 3SOCA 3SRVB 1JKKA 4OBPA 3DBFA 4QTEA 3LFEA 3WZKA 5J9ZA 5LOHA 4QMQA 5IEVA 4WRSA 4BGHA 2YCRA 3D7ZA 2HW7A 4TL0A 2WPAA 3KCKA 1VR2A 3KN6A 4GFGA 2QLQA 4Y5QA 5K3YA 4LFIA 4JRNA 3FJQE 3QRTA 3KVXA 3NUXA 5GJDA 5DHJA 4BF2A 3EN4A 3GOKA 1Q3WA 3OW4A 3PVUA 5HG5A 3TV4A 1Q3DA 3MSSA 3L8VA 3Q9XA 4ALWA 4ENXA 3R8UA 2BDJA 1DS5A 2B9IA 3EWHA 4U3YA 4I92A 5FGKA 3UYTA 4ZZNA 3NCZA 4M12A 2B0QA 3T3UA 5BUIA 1GZOA 5AV1A 3GFWA 4AOJA 2VX3A 2X81A 3CP9A 5EDRA 3U9CA 5A9UA 5F95A 4AT5A 2GDOA 1U4DA 2BAJA 2UW3A 3OZ6A 5M57A 4YPSA 4O0WA 4AA0A 4BCPA 3GUBA 3RAHA 3R7IA 3TNPC 2YACA 3BX5A 3CKWA 5CF4A 3V5TA 3L8PA 3EQRA 3H0YA 4I4EA 4O0YA 4TZRA 4AW0A 3FC2A 3LFQA 4RPVA 3VBTA 4ASZA 2CHLA 5E8SA 3GU5A 3SXFA 4UMRA 5JGBA 2PZYA 4C4JA 5IQEA 5J5TA 3QALE 2YWVA 3RNIA 4BZOA 3WIKA 5EFQA 1AQ1A 3CS9A 3ZLXA 1Q62A 3A99A 4U9AA 5CT0A 2BFYA 4JAJA 3A2CA 4X3JA 1QPDA 4DEHA 4JL9A 4AGWA 4CRSA 2I0VA 2WEVA 3K5VA 2FUMA 1Q41A 3JS2A 4QP8A 4U45A 3O17A 2YCSA 4MQ1A 4X0MA 3KRWA 4QMZA 2HWPA 1H1WA 4L46A 2XB7A 4U79A 1G8SA 4QRCA 2HCKA 4U42A 4IX4A 2C47A 3SW7A 3MYGA 2XYNA 3KU2A 4GG5A 1OL6A 3S2PA 4DFXE 1YVJA 4RVKA 1QPEA 1WFCA 2E9VA 4FEUA 3QZGA 5EI6A 5HE3A 5AUTA 3O23A 4BCOA 3MY0A 4L3PA 1IA9A 1W7HA 3ZEWA 5I5ZA 4C2WA 5E8UA 5IUHA 5HE2A 4EOPA 2QG7A 4QTDA 2UW6A 2VTOA 2R3KA 4JI9A 3LCKA 4FV4A 3C0HA 4TYHA 3Q60A 4O86A 3PXKA 3ACKA 4Y73A 4FZ7A 3EZVA 3LZBA 2BDWA 2XM8A 4K1BA 4QYFA 4DN5A 3FMDA 1GZKA 1SMHA 3KXZA 4JS8A 4EK8A 4EQUA 5JH6A 5H3QA 3LLAA 4QP2A 3CKXA 3Q9ZA 4M8TA 2X7GA 2OJ9A 4UWBA 5ICPA 1PXIA 4AP7A 2VNYA 5M51A 2CGVA 3H30A 1WVWA 2BPMA 3FUPA 3RZBA 2EWAA 5F9EA 2AUHA 2J6MA 4PNKA 4TKSA 3N4TA 5HG8A 3EL8A 5JFXA 2ACXA 4JBOA 2VZ6A 3ORXA 3PJ2A 2X39A 3AC5A 3H10A 4IM0A 5CNOA 3FY2A 1K2PA 3NNWA 2J9MA 2ZMCA 2XK4A 4ITJA 4N4SA 3R7EA 4AE9A 1Y8GA 4N6ZA 2O65A 3BQRA 2VTQA 1UNHA 1NXKA 4FNWA 3REPA 1TQIA 4O1PA 4W9WA 5CSXA 4X3FC 4AN9A 4ZLZA 3WF9A 5AA9A 1G5SA 2ITWA 2QNJA 4JDKA 5J7HA 3ROYA 1HOWA 5DEYA 2O8YA 2HY0A 4KB8A 2CKPA 3OWPA 4NW5A 5AADA 3UIUA 2W5HA 4ZZMA 1MQBA 3G15A 3I0QA 4U43A 3QZIA 4PDPA 4XHKB 3KL8A 4CLJA 3NRMA 2E9UA 2JKMA 2WU7A 3RJCA 3QC9A 4EHGA 3LMIA 4AE6A 4K9YA 3MPTA 5TF9A 4RMZA 2X7OA 4EEVA 3PSCA 1MRVA 3BLHA 1DM2A 3KULA 3QTIA 5DGZA 4BKYA 1PMEA 5A54A 2Y4PA 2UW0A 2E9PA 3EN7A 3DBDA 2E9OA 3TNWA 4AA4A 4EHZA 3BBTB 3TM0A 2V62A 2VTSA 1H01A 3TXOA 3VBVA 4RA5A 4N6YA 4AX8A 2XIYA 4YLKA 4GK4A 3JY9A 3KA0A 3OUKA 3QX2A 4NM7A 5CQUA 4G16A 3RWPA 3KREA 5EQEA 4M66A 3ODYX 5AX3A 1PXJA 3OXTA 5HCYA 2ITXA 4I21A 2OJGA 1OKYA 2VWXA 4FTNA 4RGJA 2CNUA 5IQAA 1YRPA 4TWNA 4EORA 5CASA 4TWCA 5HORA 4EZ5A 3A4PA 4E5AX 3BHYA 3O7LB 1XHAA 3R00A 3MIAA 4C34A 3MTFA 3QQGA 4FKVA 4L43A 1JAMA 3MFSA 3SLSA 1CDKA 4BFMA 4QP7A 3RPOA 3ENMA 4XS2A 3BEGA 3CXWA 4N0SA 5IPJA 1YOJA 5KHWA 5A4CA 5CVGA 3U4UA 4EKLA 2ETKA 4WO5A 1YDRE 2C1BA 4II5A 3BGQA 4C37A 4AZWA 2Q0BA 3HRFA 2OU7A 2BVAA 4KIPA 5AAEA 3UOLA 4GU6A 4G6LA 4GCJA 5HHWA 4CZTA 2BCJA 2WZJA 5AP2A 3OC1A 4O2ZA 3I6UA 2IVTA 3GC7A 3W2PA 3HA6A 4RJ6A 2WQBA 5B2LA 5EQPA 3FMNA 3AD4A 5BYZA 3E5AA 4YPDA 4E6AA 3DKCA 4RWKA 1U54B 2BROA 4GK2A 2J5FA 3NX8A 4CEGA 2RF9A 3TT0A 3FLQA 3TACA 4C58A 4DH7A 1FBNA 2A19B 4I6BA 3TN8A 5M44A 3GCVA 2W1HA 2YIRA 2BRHA 1Q61A 4ALUA 3E8CA 4X2GA 3CPCA 3FPMA 4ZEGA 3R9OA 4YTCA 3DKOA 3ANRA 3OG7A 3HKOA 4NKSA 5LMKC 1JSUA 4WT6A 2GTMA 2DWBA 4XLVA 2VAGA 4RX5A 4ZY5A 5FEQA 4CZYB 2YDKA 4E93A 3CR0A 5DMZA 4FSTA 5IQDA 1EH4A 1J1BA 2R3LA 5DR6A 4MXZA 4R7BA 2XJ0A 3E93A 4FKPA 4O91A 1W0XC 5J9YA 3TDVA 3HUBA 3KK9A 1A9UA 3VWAA 3MW1A 3R1QA 3W2RA 2QKRA 2ZM1A 4MNEA 1B38A 1YDSE 3F3VA 4LRJA 4ZTSA 3KRRA 3A8XA 3P7AA 3C4FA 1OIRA 4G3FA 3EHAA 3MH0A 4OUCA 1Y57A 3ZM4A 2XRUA 3HMMA 5DG5A 3PJ3A 3MGYA 1ZY5A 3VS6A 4ERWA 4PMTA 1YOLA 3WF7A 5HLWA 4D2PA 4JR7A 2JC6A 1O6KA 2CLXA 3EN9A 3S4QA 5HBEA 4D1XA 4O21A 3VBQA 3F69A 2GFCA 2BRBA 4FSMA 2IZUA 4BCQA 5K9IA 4V01A 5AUYA 2OLCA 4EWHA 1MRUA 5HLPA 3RAIA 3KXMA 2C0IA 1UWJA 4BZDA 1Q8ZA 4BYIA 3IGOA 5DBXA 1LEWA 4F7LA 1BKXA 2X8EA 3BPRA 3QL8A 4FTIA 3BYSA 3DS6A 1H0WA 3II5A 1TKIA 3FBVA 3PFQA 3A7IA 1DAWA 5TT7A 4F0IA 3RM6A 5HKMA 3LHJA 4DG3E 5LMBA 3G33A 1OM1A 3FZPA 4MBIA 3SAYA 4A4XA 3R7GA 5JRQA 5C4LA 2RGPA 4Z16A 5CLPA 3FXZA 3UP7A 1UNLA 3A4OX 1RW8A 1GY3A 4FTAA 4FT5A 3FQSA 3ULIA 5KMOA 2Z7LA 4H39A 3UC3A 3HV6A 1A48A 1PF8A 4A4OA 3L9PA 2HYYA 2WU6A 3BHTA 2BKKA 1WCCA 2WTKC 4GVJA 1LEZA 3PVGA 2WHBA 4XG3A 3WBLA 2XF0A 3NDMA 2I40A 4YR8A 3MVLA 4FV3A 4GKIA 1X8BA 4XYFA 3LJ0A 2IG7A 5IQHA 4J97A 3CCNA 2Z8CA 5C8MA 4I5HA 4IVAA 4D58A 3SX9A 3DLZA 4PNIA 2PVMA 4XG9A 2QURA 3CY2A 3HL7A 2IVSA 2HZIA 3ZSIA 2PMNX 3AMYA 3U51A 4HGSA 4I6HA 1FMKA 2QLUA 2F2UA 4MBLA 1VZOA 2H34A 3ORPA 3D83A 1GIHA 5M09A 4C61A 5JKGA 4DFYA 5EOBA 4FUXA 2PK9A 3GU7A 3C5IA 2UZLA 5L2WA 1P5EA 2DS1A 3BYUA 4G3CA 4S2ZA 3NAYA 3R8ZA 3BIZA 3NEWA 3FMHA 4H3QA 4MXXA 3FZRA 1H27A 3LCOA 4UXLA 3ZZEA 4CYIA 3WZEA 4IANA 2YZAA 3ZCLA 2WMXA 5M08A 1XH6A 3QYWA 3FLNC 4O7LA 2BTRA 3QTQA 5IUGA 4PP9A 3PP1A 3TIZA 4ZS0A 3WE8A 3COMA 4AQCA 4AU8A 5AV4A 5AP4A 3FHRA 4I6QA 1JSTA 4ZTQA 5HVYA 1IEPA 4BRXA 2F4JA 4HYSA 3IDBA 3DTWA 3ZUTA 2V22A 4QMYA 2OXYA 3V04A 4E1ZA 4HW7A 1Y91A 4NZWB 5ANJA 3QGWA 4GJ2A 1YWVA 4PMMA 2C5OA 2P33A 1PXPA 3KK8A 5E1SA 4IB0A 4EOIA 3ZLYA 3DFAA 3S0OA 3QQHA 3N4VA 5EM5A 4FL1A 4YJOA 4RVMA 2A0CX 4LMUA 1ZYDA 3QLGA 4EUTA 3Q5IA 4DH5A 2ZAZA 3BZ3A 3DOGA 4CFNA 2C30A 1M2QA 5E1EA 3FEGA 4FV9A 3NCGA 5AUXA 3AT2A 3MH2A 4L44A 5ETIA 1OIUA 3E7OA 4CTCA 3WZDA 4OT6A 3Q4ZA 1WBTA 3G9NA 5FQDC 5HD7A 2Z2WA 3A60A 4UZHA 5BUEA 2WQNA 5HLNA 3VW6A 5DT4A 4D1SA 4JXFA 4TWOA 5HIBA 3KXGA 5C1QB 2R64A 5L2IA 4DINA 3FC1X 3L8SA 4CV8A 4FMQA 5A14A 3CC6A 3LCTA 4U80A 5E7RA 4BI2A 4DEGA 5TO8A 5AP7A 5L3AA 4M0ZA 5BVOA 4O7RA 3ETAA 4O7TA 2P4IA 2B53A 2C5XA 2Y6MA 4O7YA 2OK1A 4G6NA 3V8SA 3FLYA 3LFCA 3UG1A 3VAPA 2YERA 4IAZA 1SM2A 4NM0A 4E20A 4EZ7A 4CXAA 1JVPP 3F3WA 3HRBA 3Q4UA 4U3ZA 2R4BA 1NVQA 3C1XA 4WRGA 2FA2A 4MVFA 4JLCA 5EHLA 4CYJA 1FVRA 2P0CA 3HV5A 3S3IA 4JT3A 4NK9A 1OIQA 4P90A 3F6XA 3RMFA 3GXLA 4NUSA 2JIIA 2J0IA 2XVDA 3TZ7A 3D5WA 3DFCB 5M4IA 3LW0A 3QCSA 4HOKA 5K4JA 5CU4A 3QTSA 4KS7A 4M0YA 3F66A 1YW2A 3G0FA 2HELA 3RPSA 3PIXA 2YAAA 4F99A 1H07A 3DB8A 5A4EA 4QMOA 4WNPA 4QNAA 5IH4A 4DH8A 3QWKA 4YJTA 4H3BA 4QQ5A 2QO2A 2J4ZA 2XA4A 4IWQA 3R21A 4M69A 5FD2A 5AA8A 4RC2A 5EG3A 1FQ1B 2W06A 1H1PA 2PSQA 2Y4IB 5DE2A 3PPJA 2FGIA 2YM8A 4UMQA 5G1XA 1BI8A 3E8DA 3KN5A 3NW6A 3V5WA 5DYJA 1XO2B 4ITHA 2EB3A 4JQ8A 4MH7A 4CG9A 1ZMUA 3I60A 2ZYBA 3KVWA 4AN2A 4ZIMA 2ITUA 2VTMA 2R3NA 1YHSA 3BE9A 5F4NA 2CN5A 5LWNA 4BBFA 4F9CA 3WE4A 3F61A 4O0SA 4IX3A 4E3CA 4EH5A 2QOOA 4OW8A 2VX1A 4KKHA 3S95A 1XH7A 5EYMA 3DT1A 4CCUA 1YKRA 2UZVA 2OGVA 2XNBA 1R0EA 2ETRA 2R3RA 3A7FA 4FSZA 4OT5A 3IG7A 1JKTA 5CZIA 3O50A 4JBPA 4O96A 3GOPA 4E5WA 1R3CA 4BCJA 5M07A 4HZRA 4Q5HA 3GC9A 3KY2A 3QXPA 3QWJA 4DAWA 1BLXA 1V1KA 3R6XA 3W8QA 2C1AA 2J50A 5EW9A 3QTUA 4FTTA 2PWLA 3DU8A 5FM2A 2FVDA 2PY3A 5A4LA 3GU4A 3PE1A 5CEKA 3CPBA 2J51A 4O7NA 1YWRA 5CU3A 1PXNA 5JFWA 1OIYA 4DFBA 4BBMA 4R1YA 4RX8A 4UXQA 4BCGA 4ZAUA 4DFUA 4J95A 4ZP5A 4F09A 2WXVA 1YHVA 4M3QA 3LFAA 1TVOA 3FWQA 2OF2A 1U46A 1H4LA 3GCPA 3PYYA 5CVHA 2PZ5A 4ZSJA 3F7ZA 3QD4A 5ANEA 3GFEA 4MCVA 4FTUA 3MVMA 4WBBB 3TUCA 2JITA 3CE3A 3MH3A 4DLJA 2EXMA 4ZSAA 5AM6A 1ZRZA 3MA6A 5ETFA 3VUIA 4P5ZA 4I41A 4LOOA 1NY3A 5HTIA 4UBAA 3BWJA 3EQPA 4YZMA 2F2CB 4NT4A 5ANDA 4BHNA 5E8VA 4C4FA 2R3QA 4D4VA 3BCEA 4FV5A 5L8JA 2ZMDA 3FMKA 2OXXA 4G34A 5CENA 3DBQA 4J7BA 4F0GA 1OBGA 1Q8WA 2XNEA 5FP6A 4PMPA 2R3MA 4RIYB 4AOTA 2G2FA 3TTIA 3F3ZA 3UPZA 2PVFA 5E8TA 4UMPA 1BL6A 2ZV2A 5DT3A 2UUEA 4IH8A 4GYIA 3Q3BA 5C4KA 3PSBA 1ZOEA 3QC4A 4BWXA 4IWDA 4DGMA 2YCFA 3JR1A 3UZTA 2VRXA 3D2IA 4XOYA 3Q9YA 1MP8A 2FSLX 3OD6X 4B4LA 2VWWA 4YO6A 3O2MA 3JYAA 3LCSA 2VU3A 4EKKA 3UIBA 3VQHA 2PYWA 2WGJA 2C6MA 4CVAA 2W05A 5IA4A 1IG1A 2C6TA 3OXIA 4BCIA 4RC4A 4ZSGA 3VHEA 5T6KA 3OEFX 1Q97A 4N70A 4RX7A 3VVHA 4ID7A 4XP3A 5GZ8A 4O83A 3NUAA 1MQ4A 3U55A 1Z5MA 3DNDA 3HX4A 5A4QA 5IA5A 1XBBA 4AW1A 2WMTA 3S00A 1KWPA 3QGYA 5DR9A 5JZNA 2JKQA 4HNIA 2WMAA 4U7ZA 3JUHA 2GQGA 2WTKB 4FOBA 5CWZA 4EBVA 1NW1A 4IWPA 4AA5A 4IAKA 4L9IA 4ENYA 5DA3A 4ZSEA 3BHVA 1M17A 4UWYA 3UYSA 5D12A 3TNIA 4CT2A 4DGNA 2BR1A 5GJFA 3HV7A 4EL9A 2KULA 4YJRA 4A06A 4BTJA 4GKHA 3VQUA 2VWZA 3PJ8A 1F0QA 4ACGA 5HVKA 1OKZA 4S34A 3NWWA 1H1QA 1CM8A 5BQ0A 3IOKA 5DLSA 5HX8A 2Q0NA 4TXCA 3V8TA 2G2HA 2HK5A 4K8AA 4FZFB 5AP0A 1U54A 4IAFA 2J0KA 4AF3A 5KO1A 4RX9A 1CMKE 4F4PA 4XG6A 2ITOA 2VTNA 4NEUA 3HGKA 4RZVA 1G8AA 2R3PA 3A7HA 3AT3A 2VTRA 4E4NA 4RQVA 5E8WA 3Q2JA 4AWIA 4YLLA 2QU6A 2JFLA 4L8MA 3ATTA 4YBJA 3WOWA 1PW2A 4CD0A 4FZ6A 2RFSA 4FIIA 4FODA 3TTJA 3NUNA 4FSRA 2JDOA 3BV2A 4C57A 4O0VA 3CIKA 4GRBA 5CU6A 4MYGA 1SYKA 3IDPA 3ZUUA 2BAQA 2REIA 4ZMEA 3QTRA 4HNFA 4K33A 4K6ZA 3VBWA 3TJCA 3NW5A 3QZHA 1QMZA 5AUZA 3G5DA 2IZTA 4I5PA 3EL7A 4FOCA 3ZONA 4D2TA 4EK6A 1M7NA 4YC6A 4R77A 1PYEA 5C03A 4PDSA 2HAKA 2OZAA 3HDNA 3I5ZA 3FHIA 5EW8A 3TUBA 3NMUF 1YXSA 3R2BA 3QBNA 1UU3A 4QT1A 5AWMA 5C9CA 3TCPA 2NP8A 3QQLA 3RAWA 3QUPA 3TJDA 4YJUA 3DNEA 3LMGA 4KNBA 1YI6A 1YOMA 3E63A 3KXNA 3RWQA 4U40A 3HAVA 4EK3A 4FC0A 2WNTA 3AD5A 2XIXA 4NCTA 3VUMA 1W82A 5A46A 3SVVA 5CU0A 4BBEA 3KFAA 4FSQA 4L7FA 4GV1A 4FK6A 2YEXA 4YBKA 3R04A 3WARA 4WKQA 3U4WA 4IVCA 1HCKA 5BX0A 3D4QA 3FLSA 2I6LA 4DG0E 2CPKE 3U6IA 3ZRMA 3TV7A 3Q6UA 1BL7A 4E5BA 3G6HA 3C4CA 5AR5A 2BRNA 4IZYA 3KMWA 1APME 2VTIA 4ZY6A 3C4EA 2X8DA 4PPBA 3PSDA 1NA7A 2CNQA 2C0TA 3UZRA 1B6CB 3G2FA 2J90A 4PTCA 1CKJA 1XQZA 2QC6A 2YM4A 2Y0AA 5DH3A 5FLFA 4Z3VA 5CI6A 5IA2A 4ZTNA 1OECA 1VYWA 2CMWA 5I9WA 4TYJA 2VWUA 4FIGA 4PL3A 1Q4LA 4XLIA 5AJQA 4DFNA 1E1VA 5FWKK 2QU5A 2R3OA 3WZUA 5KMLA 4BN1A 2BMCA 2ZVAA 4LRKA 4C0TA 3AOXA 3DJ5A 4WHZA 4JR3A 3D7TB 4I24A 4YGAA 4DEAA 2IW6A 3T8OA 5KZ0A 3OUNB 4YZDA 4B7TA 4O84A 3Q32A 3KRLA 3PXQA 3MVHA 3BGZA 2WIPA 2G15A 4KINA 4O38A 2O63A 3C4ZA 3AC1A 3AMAA 1WBSA 2ITNA 2XNPA 3QZFA 4JBVA 1URWA 2BHHA 4RFZA 4WNMA 4O7WA 5I0BA 4YTIA 2X8IA 3UTOA 3FQHA 3FAAA 5ACBC 3VJNA 2CCHA 3MI9A 3QQUA 4BY9E 3A62A 2GCDA 4GSBA 2UW8A 2YIQA 3QF9A 4F64A 5J79A 4LMNA 2BUJA 4AGCA 4RFMA 2SRCA 3JY0A 3R02A 2PULA 2J0LA 3L8XA 3K54A 5C8KA 4YC3A 2JBPA 4NIFA 5B0XA 3VC4A 1PMVA 4FL3A 3V5LA 1BMKA 4Y83A 3BHUA 5F1ZA 3RK7A 2NRUA 3UQFA 3M42A 4E73A 2PUPA 4PF4A 2VGPA 2W7XA 4E26A 3ZU7A 4EYMA 2R9SA 4JNWA 2NPQA 3MS9A 4DH3A 5FXSA 2XK8A 3NAXA 5GHVA 4KABA 3H3CA 4IDTA 5ITAA 3L1SA 4LV8A 2JEDA 2ZJWA 2RKUA 4BCFA 4CCBA 5HX6A 1JWHA 4I6FA 1P4FA 4RIXA 4FIEA 4Q2AA 3M11A 2RL5A 4PL4A 4PL5A 3DQXA 4IDVA 2PVJA 4GS6A 5A3XA 5CT7A 5FEEA 4ORKA 4FKTA 3LM0A 4WBOA 1H8FA 4NL0A 3JPVA 4HCUA 3R73A 3E8EA 1FGKA 3PVBA 1L8TA 4CSVA 5HG9A 3WF8A 3EH9A 3CBLA 5BMMA 4ASEA 4E6DA 3UOHA 1TQPA 3KXHA 1KSWA 3JXWA 3COKA 2UZWE 4QD6A 5AV3A 3T9TA 3N51A 4BDEA 2BZKB 1K9AA 4X2FA 1IASA 3Q2MA 2R7IA 3QQFA 4G3GA 4TWPA 4AZFA 2CSNA 2OFUA 3P4KA 4O1OA 3QD3A 1DI9A 4V0GA 5IF1A 3IDCA 2EU9A 4LGHA 4D5KA 4FSYA 3LFSA 4HGEA 2O3PA 3LXKA 4R3CA 1Q99A 3HMIA 3P9JA 3ZUVA 4MQ2A 4P4CA 2I0YA 1JQHA 2WTDA 4QP3A 3HUCA 4YJNA 3F82A 1I09A 5DT0A 3FI8A 1ZZ2A 3OTUA 5CSVA 2GNJA 3P08A 2XK3A 4P7EA 1W84A 4Y95A 2YISA 5D7AA 3VS1A 1GNGA 4IJPA 4P2KA 4UWCA 5BVFA 2W1EA 3DTCA 3R83A 2FB8A 2QHNA 2XCHA 5FTQA 1S9JA 4NH1A 4BICA 4U41A 5M4UA 3JVRA 2VV9A 4W4WA 3VS3A 3BI6A 3DGKA 3WZJA 3PLSA 3CGOA 5IA0A 1J91A 3OWJA 1RQQA 2YM7A 3OT8A 3NYXA 4QTCA 3VO3A 4G17A 1CKPA 3AD6A 4QP6A 4DGLC 4NYEA 4O7ZA 3I79A 4JJRA 3GU8A 5EH0A 3ZBXA 4MHAA 5D10A 5HE1A 3BRBA 4CNHA 3ZFMA 2UZNA 2XH5A 4FIHA 4JDHA 4QMXA 2F9GA 2W1GA 1ZARA 3FL5A 3VUKA 2C6KA 4MWHA 3IW8A 4LUEA 2W9ZB 4Q9SA 3HEGA 1OPKA 2YHVA 3GT8A 3NPCA 4R6VA 1PMUA 1NVRA 4IIRA 4JX3A 4EI4A 4DA5A 4KD1A 2BZHB 4O7VA 4ZLYA 3O7LD 2F49A 4Z55A 5IDNA 2BRGA 2HZNA 4YSMA 3GP0A 4G6OA 4F65A 3PRFA 4FEXA 4RIWA 5KHXA 2W5AA 2WIHA 3PJ1A 3UQCA 4PDOA 2YJRA 3F3TA 3W2SA 4FG7A 4EK5A 2GHGA 1U5QA 2JAVA 2JIVA 2YIXA 3C50A 3OVVA 5KZIA 4S33A 2JFMA 5BYYA 4L52A 1UKHA 2Z60A 4IEBA 3HDMA 1JNKA 1SNUA 4FR4A 4JG6A 1YI4A 1DAYA 1UV5A 2ONLA 4XV1A 3ZDIA 4AZEA 1JBPE 4E8AA 2XKCA 4FF8A 3GGFA 2VO6A 4F9WA 5I4NA 1FVVA 2IW9A 5DEWA 1LPUA 4FUYA 1KOBA 3SDJA 5FBOA 3PY0A 4HVDA 4PY1A 5CSPA 1M52A 2AC3A 3KRXA 5JSMA 1JKLA 5LVNA 4IZ5A 4PPAA 1UNGA 5DNRA 3R22A 4KIKA 4YUQA 3CJGA 1GIJA 4K0YA 5KBQA 3RP9A 4WG3A 5J7BA 4FEQA 4NKAA 2R0IA 5DRBA 4XG4A 5FM3A 4UX9A 2YM6A 3MIYA 2OSCA 3MV5A 1JSVA 5BVNA 4JQ7A 4LGDA 1KE8A 2UW9A 2ITTA 2VN9A 3RALA 3VS5A 3OWLA 2EB2A 3EKKA 1QPCA 1YDTE 2ITVA 2OI4X 2Y6OA 4YC8A 5KMNA 1YXXA 1OGUA 4G1WA 2VTPA 3OP5A 4EOOA 3QRIA 4CQGA 3LXNA 2UVYA 2GNFA 4W4XA 3RZFA 2ZM4A 3C7QA 5CQWA 4BYJA 5CAUA 3L9LA 4AFJA 5KX8A 2C6EA 4XP2A 5BMSA 5I9YA 3E62A 1SZMA 5M06A 5EYCA 5C01A 3C0IA 3GCUA 2AYPA 4BKZA 4F9YA 2PVHA 3DDQA 3K3IA 3UNZA 4NFMA 3R71A 4YU2A 1P4OA 4FYOA 3KF7A 5J5SA 1R39A 3OCSA 5TE0A 3P86A 4BCMA 3OROA 3WF6A 2RG5A 3C51A 4A9TA 4FEWA 5D11A 5HI2A 2C4GA 3LPBA 4B8LA 3SD0A 4EC9A 4HVSA 2XYUA 4NJ3A 4D4RA 2BKZA 2WTWA 4B8MA 4U5JA 3W1FA 2P3GX 2OIQA 2XNMA 1QCFA 1SVEA 3UODA 4FG9A 2V7AA 4LL0A 4C4GA 1H24A 4O81A 4W4VA 3BBWA 5CEMA 3NW7A 4AS0A 2C68A 3V3VA 3NUUA 4MXOA 3ZLWA 2P55A 4AGDA 5JEBA 4APPA 4XMOA 1Y6AA 3RAKA 2X6DA 3EKNA 1PJKA 3MB6A 4YURA 1M2RA 3NUSA 4KSPA 3DCVA 3FMLA 2WFYA 4FGBA 3VS4A 5AUVA 5L8KA 4G5JA 3QCYA 1Z57A 3F5XA 3G6GA 4G2FA 1SNXA 2W1CA 1T46A 1YXTA 2WKMA 3UDBA 4KBKA 5CTPA 2O64A 5ANKA 2BHEA 2OKRA 2C6LA 3VRZA 3ZEPA 1ZYSA 3PZEA 5DFPA 3VIDA 3W2QA 4WOVA 3LJ2A 3RPYA 1OKVA 1AD5A 3HYHA 2OIBA 3HMNA 2R3HA 4RA4A 3QAME 3DAEA 4X7QA 4FV8A 3PDTA 4DT8A 1QPJA 5GIPE 2X2LA 4G5PA 2QOQA 2W1FA 5EK7A 5CF5A 3B8QA 4GH2A 4UB7A 5JQ5A 1P14A 3P7BA 4I23A 4QMVA 3P1AA 3DPKA 4ZTLA 4MX9A 3EOCA 3G0EA 4MKCA 4RJ8A 2W1DA 2W5BA 3LQ5A 3H4JA 4RC3A 4FX3A 2YDIA 3GCSA 1GIIA 3BU6A 4FKWA 2G1TA 3OFMA 4FTQA 4DLIA 4DEIA 4LI5A 4RVLA 1OKWA 3EQFA 2PVNA 2YJSA 3IGGA 3OCGA 3LJ1A 3U9NA 4IX6A 5IQGA 3PXRA 2V5QA 3DAKA 1H00A 1VEBA 3ZMMA 1U5RA 4USFA 1PXMA 3OXZA 4YZNA 3VNTA 1VYZA 3MY1A 4TY1A 3FY0A 2YAKA 1LP4A 2ZDTA 3KQ7A 4OBOA 4QMSA 3T9IA 1H0VA 4BDJA 1JLUE 3U8WA 3GC8A 4FV7A 5IKWA 3ITZA 2ZM3A 4BDFA 4UALA 4BGQA 4F0FA 3UGCA 2WQOA 2GU8A 3CD8A 2WOUA 4MF0A 3SRVA 3ZRLA 3LKMA 4HCTA 1SVHA 3RCDA 3OHTA 4C59A 2QOHA 4G3DA 3LIJA 5GZ9A 4FG8A 4WG5A 4GUEA 2XBAA 2R3JA 2B4SB 2C3LA 3HP2A 3LOKA 4FKJA 4WSQA 3IW6A 4R7IA 5CAOA 4RWIA 1KE5A 4BIBA 4XV2A 1V0PA 4O2PA 4PQNA 4BKJA 1J7LA 4BHZA 5KNJA 4DITA 4EH3A 3KULB 3PA3A 3V5QA 3ODZX 4JBQA 4OAVB 1ZZLA 4LYNA 2GS6A 2W4JA 2ZV9A 4M67A 4YNOA 4A07A 3UMXA 3E87A 4I0SA 2IO6A 4QQJA 5LVMA 3FXXA 4X3FB 3COIA 5DOSA 3NR9A 2E2BA 4D9UA 3U6JA 2RIOA 3NVKI 4IJ9A 2FSMX 1TQMA 1R78A 5DWRA 2EXEA 3C4XA 2A2AA 3F2NA 2WQMA 4MBJA 3MJ2A 5I9UA 5K0XA 3DZOA 1M7QA 4F70A 4X2KA 2C3KA 4I94A 4PPCA 1MRYA 3MDYA 3FZSA 1IR3A 4YZ9A 4X21A 3F5GA 4RJ5A 4CMTA 4UN0C 1PKDA 2WTIA 3ORNA 4H1MA 3UC4A 3IS5A 4DE4A 4ZMFA 2C6OA 1XH9A 4J99A 4NTTA 4QO9A 2PE1A 3ENHA 4LQMA 4NSTA 3K3JA 5AV0A 4KSQA 2BAKA 4DF3A 4XEYA 3O8TA 1FINA 2IVVA 2R0UA 3QD0A 5AP1A 3V51A 4KIOA 5C26A 3AGMA 4NWMA 4B0GA 4F7JA 2X6EA 4AT4A 3W18A 4XRLA 5HO8A 3SG9A 4FV1A 5CI7A 2BDFA 3ZC5A 3GU6A 4FNYA 4O0XA 3SOAA 4KRCA 3I6WA 3P23A 3HNGA 3QQKA 4FIFA 3MB7A 3OEZA 4PRJA 4CFUA 2QOBA 5CXHA 3W16A 2UZOA 3SGCA 2PE2A 2YM5A 1KV1A 3W55A 2HXLA 3R7UA 3FKLA 5E9EA 1JOWB 4BTFA 3DZQA 2XIZA 5CU2A 5LVPA 2OH0E 2R3IA 4AN3A 1E1XA 4KA3A 3D7TA 3UZPA 5HNGA 4OTRA 4Z9LA 1YXVA 2C5VA 1W98A 1J7UA 5CEOA 4EH7A 3G51A 4IXPA 4PX6A 2UW4A 2HY81 2KTYA 4HYHA 5HCXA 5K5NA 4FA2A 3V6SA 3AG9A 4YJVA 2JDSA 3DLSA 4DC2A 1UU7A 3KF4A 2VTHA 5L8LA 3QU0A 2PTKA 4ITIA 4GL9A 4JG8A 4ZZOA 4TN6A 3ET7A 4WSYA 3TKIA 5L2QA 3WILA 4C38A 4D1ZA 3HZTA 3NUPA 1XH8A 3TIYA 2BILB 1FPUA 4MNEB 2Y9QA 4IB3A 5AIKA 5ETAA 3RKBA 3PTGA 3VUHA 3LQ8A 4BCNA 4I5CA 5I9XA 1OZ1A 4QMTA 4LM5A 2XP2A 3VUTA 3A8WA 3TI1A 2YLEA 4GYGA 2QO9A 5LXMA 2B54A 2J0MB 3LCDA 4MEDA 3EQIA 3RGFA 3BWFA 1XBCA 4QTBA 2ZB1A 3BKBA 4CTBA 4IZAA 4QQTA 3RNYA 4QMPA 1GZ8A 2J0JA 2W17A 5L6OA 2HWOA 4L7SA 4PV0A 5KMIA 2VWVA 4NU1A 3VUGA 5BUJA 4C35A 4D2RA 3BYMA 4AW2A 2P2IA 4EONA 5KCVA 3FV8A 2B1PA 5IEYA 2VO0A 5A4TA 5IQCA 4DFZE 4E4XA 5C8NA 5M4CA 2YITA 3GEQA 5BVWA 5TKDA 4FTMA 5IQIA 5BVDA 3HV4A 1CSNA 3AGLA 4F6UA 5GINE 5AUUA 1M14A 4BTKA 3PZHA 2VNWA 3BU3A 4XBUA 4EZ3A 5GNKA 5HNIX 2LGCA 3PXFA 1KV2A 5LVLA 1L3RE 5KMJA 3OF0A 3W2OA 5EW3A 4IC7A 5AM7A 4W8EA 3R8MA 1ZOHA 3OY1A 3TKHA 2CDZA 4O7SA 4JVGA 4Z7HA 5IU2A 4X6RA 4MTAA 4BB4A 5AV2A 4RWLA 5J1WA 3DA6A 4BI0A 2VTTA 4AZVA 3WIGA 4EUUA 2CNVA 2JDTA 4XG7A 4ANNA 5FXRA 4YHJA 1F5QA 1IA8A 2ERZE 2QOKA 4I0RA 2J7TA 4C02A 2WMVA 5HE0A 2YN8A 3FLZA 5AAFA 3UPXA 1B39A 5AUWA 4CFFA 3B2WA 3QKLA 2RFEA 2XS0A 4XV3A 4W9XA 5H2UA 4YHFA 4ARKA 3QHWA 5D9HA 4BL1A 4EHVA 5I3RA 3M2WA 4L68A 4TYIA 2YFXA 3I4BA 4CKIA 4CG8A 5JGAA 4ZY4A 4FKUA 4HVIA 4JIKA 3RCJA 3IPHA 3W33A 5IH5A 3MWUA 4WA9A 5EM7A 5JZJA 5IQFA 4IW0A 3BGPA 5T68A 4M14A 4V05A 2W1IA 4EQCA 3AC3A 1V0OA 3FE3A 4QYEA 1J7IA 5FTGA 3D15A 2H96A 3RTPA 3V01A 5AP5A 5EOLA 4RWJA 4A9UA 4MD9E 2GHLA 4E6CA 1FMOE 4HPTE 4DTAA 2PVLA 4GT4A 4EH4A 2PVRA 1KE6A 1Q5KA 4AG8A 1OL7A 3PXYA 1XBAA 2UZTA 1KE9A 5H8BA 5IA1A 2QODA 4QMMA 2IW8A 3HP5A 3V5JA 4PTEA 4KKEA 3KKVA 4R1VA 4YNEA 4GIIA 3ZDUA 4D0WA 4E4LA 3ZM9A 2OJIA 4UYNA 2XKEA 4IB5A 3ZYAA 4ONAA 5H9BA 4IC8A 2WO6A 2J2IB 5AR2A 2XJ1A 3QD2B 3TL8A 4PDYA 5CX9A 2H8HA 4USEA 4UEUA 3PWDA 4FKSA 2OICA 4EH6A 5JT2A 1GOLA 5J87A 2IPXA 4TRLA 2W96B 2B7AA 4FSNA 4NM5A 4C36A 2BTSA 2X2KA 3UOJA 3MVJA 3I7BA 3RK5A 5AFVA 2H9VA 4CGAA 4MF1A 4GG7A 4M15A 4YZBA 4YHTA 2C6IA 5LMAA 4XG2A 1V0BA 5L6PA 2OG8A 2FSTX 3A61A 4Y85A 1WBVA 1PYXA 2GNHA 4JDJA 5ANGA 4W4YA 3D2KA 2J5EA 3H0ZA 2WMUA 3R2YA 4GIHA 4BZNA 4NCTC 4G9CA 4KS8A 2NRYA 3DDPA 4J98A 2C5YA 1MUOA 2GMXA 4RJ4A 3VS0A 3W32A 3R9RA 4FTLA 1I44A 3ORTA 5AR7A 3ULZA 2W0JA 4EQMA 5I9VA 1BUHA 1ATPE 3ORMA 4S32A 2RG6A 4AOIA 4EJ7A 1OPJA 3CQEA 5J1VA 4K2RA 1REKA 3WF5A 1SVGA 3FI2A 4TT7A 3BHHA 4FV2A 4GUBA 5CXZA 3KCFA 1VJYA 4R5YA 5HQ0A 3PRIA 3EFJA 3UG2A 3S1HA 3ZFXA 4FYNA 4IVDA 1J1CA 3R1YA 5FRIA 3DXPA 3R0TA 4TTHB 4EOMA 1A06A 2OZOA 1R0PA 3ZRKA 4IM2A 4XUFA 5IMEA 4RG0A 2V7OA 3O96A 4AAAA 3UIMA 3E3PA 2OWBA 1E9HA 2W4OA 3MY5A 4ASDA 4BCKA 3WI6A 4CFVA 4D0XA 1YHWA 5CVFA 4ACHA 3CQUA 3EN6A 3GNIB 4MD8E 4GVAA 2HW6A 2GNLA 3CTHA 2VO7A 4WD5A 4ZSLA 3SKCA 5LVOA 3W2CA 3GENA 2V55A 4MK0A 3R8PA 4QMWA 3I81A 3DK6A 4XOZA 5HU3A 4N57A 4U6RA 2FO0A 3QRKA 3MBLA 2ITPA 3MPMA 3EQHA 5HICA 4F1MA 4YSJA 3MJ1A 3PPKA 2F57A 4LL5A 1Q24A 4QYHA 3T3VA 2W9FB 3AT4A 5L2TA 2OBJA 4A9YA 4ANOA 2HIWA 5BVKA 3PY1A 2UZUE 4OBQA 3NYVA 2XZSA 4LOQA 3ZO4A 2X4FA 3U6HA 4DEEA 4M69B 3QQJA 3BYOA 4BCHA 1BX6A 5IG1A 3LVPA 4L00A 5G6VA 4ZLOA 3VJOA 4EK4A 1ND4A 4H05A 2BRMA 2YIYA 1Q8YA 3UVRA 4APCA 2UW5A 3P5KA 3IQ7A 4FKGA 3NNVA 4D2SA 3B8RA 4ANLA 4RRVA 4B99A 3PP0A 4R3PA 3DK7A 3LQ3A 4DG2E 4U97A 1UKIA 4WUNA 5CF8A 5HVJA 3QXOA 5JQ8A 2IN6A 4QP4A 3IW5A 5CAPA 2IZRA 4DBXA 2B52A 2JBOA 1H08A 3PWYA 4FSUA 4U81A 2PUIA 4CQEA 2XCKA 1WVXA 4EWQA 4FV0A 5IISA 1ZXEA 1K3AA 4J1RA 2XKFA 4JX7A 3KXXA 5AR3A 5CEIA 1PMNA 3TZ9A 4U44A 3SA0A 4ACDA 2F7EE 3ROCA 4CV9A 3VULA 1IAHA 3FKOA 4AZSA 2XNGA 3VS7A 2XM9A 3H9FA 4I0TA 4ANBA 4RFYA 2WMRA 4PMSA 2VGOA 1ZY4A 4BWPA 3SC1A 2GHMA 3PG3A 2WQEA 4CFMA 1WBWA 4LOPA 5KUPA 3QKKA 3ZO2A 5FDXA 3POZA 2PMLX 1G3NA 2YZLA 1U59A 2W4KA 2JD5A 3P79A 1P2AA 5HTCA 4LRMA 2B9JA 2VO3A 4G3EA 5DPVA 3PA4A 4TNBA 4F6WA 4K77A 4HPUE 4QP1A 2F7ZE 2PUUA 1O6YA 4ZJJA 2FYSA 2XJ2A 3NZ0A 3Q5ZA 3I1AA 3FZ1A 1IAJA 2GFSA 3HAMA 3BV3A 3MH1A 2XIRA 5GZAA 3DBEA 4L42A 1H25A 4FT9A 1OUYA 3QTXA 1FGIA 2Y8OA 1H28A 4OLIA 3OOGA 4R8QA 2YCQA 2OIDA 5LARA 3RHXA 1NT2A 4UMUA 5J9LA 4RBLA 4FNXA 4QMNA 1YWNA 4WIHA 1H1RA 3SXRA 3VRYA 1ZLTA 4L3JA 2OH4A 4Y46A 4F63A 4MAOA 4IFGA 3THBA 1DI8A 2Z7SA 4DEDA 3IOPA 4IB1A 3FYJX 4R7HA 2ZB0A 3EQGA 5J95A 3F2RA 2JLDA 5EDQA 1UVRA 4R78A 2YA9A 4FV6A 1BYGA 3DJ7A 4G9RA 2CKOA 1XR1A 1T45A 4X2NA 4EOJA 3PLAE 2E9NA 3KRJA 4I4FA 2UZDA 4BR3A 4HGLA 3C5UA 3D5UA 3EFKA 4C62A 4C2VA 3HECA 2DQ7X 4IAAA 3UIXA 4O0TA 2R5TA 4YTHA 3DBCA 2WOTA 3QRJA 4IAYA 4K11A 3QUDA 3O71A 1ZWSA 4E6QA 3LE6A 1QL6A 2ZV7A 2Q83A 4RIOA 3R9HA 5M53A 4O27B 5I3OA 2Y4IC 4FZAB 2JIUA 4YJPA 4D4SA 3FLWA 4Q5EA 3VBYA 1ZMVA 3UO5A 3ELJA 2ONLC 3FZOA 1RDQE 1NVSA 4UV0A 4X3FA 4YJQA 4L67A 5EM8A 3TZMA 3UQGA 2Y7JA 2QQ7A 2FH9A 2VWBA 1Y8YA 5AEPA 5D1JA 1F3MC 2PZRA 5HNBA 3NIEA 4BDCA 5HD4A 3Q52A 1YXUA 2NNWB 3R8VA 2PUNA 3NUYA 4FKIA 3C13A 2WELA 1PXLA 4CKRA 4GFMA 5JK3A 3ZXTA 3G90X 4EH9A 4EYJA 2P2HA 3SHEA 4MXCA 3FSKA 4D55A 3CTJA 5BPYA 5E8XA 2AC5A 3LXPA 3PVWA 4IVBA 5CS6A 4XP0A 5CAQA 4YO4A 4QTAA 5HTBA 4FKOA 3QA0A 3OCTA 4I1ZA 3F9NA 3ALOA 4CFXA 3R7YA 2VWYA 1ZYJA 3FSFA 3K5UA 1PKGA 5E8ZA 2X2MA 3TNQB 4LG4A 3ZH8A 2JKKA 2YDJA 4KWPA 4MXAA 3UBDA 4BDDA 4M68A 3MFUA 4FBXA 4S31A 2RFNA 4FSWA 4WG4A 5T3QA 3ZSGA 4EC8A 3RPVA 3BELA 4LV5A 2GQRA 4G31A 2I0HA 1JKSA 2H6DA 3EZRA 1KE7A 3UE4A 3GB2A 4WNOA 3NYOA 1O6LA 2JDVA 3IECA 3F2AA 2ZOQA 5K0KA 3LFBA 3UOKA 4ACCA 4H1JA 4IAIA 5EDPA 2BZIB 3C4WA 3NYNA 5IDPA 2XRWA 1PHKA 4NM3A 5KE0A 4XV9A 3U54A 5HU9A 2LAVA 1OL1A 2XEYA 5HO6A 3ZTXA 4RJ7A 4EOLA 3OY3A 3EMGA 3I7CA 4P5QA 3RI1A 1S9IA 3ID6C 3ZHPC 4I22A 1OUKA 1WBPA 3QCXA 3B2TA 4MD7E 3E88A 4R3RA 4B9DA 3QX4A 4KIQA 1STCE 1R1WA 3WYXA 1PRYA 3QYZA 2QR8A 2IZSA 4JIAA 3R7VA 5AAGA 2XIKA 1BI7A 3QRUA 2QCSA 3R30A 1OVEA 1Y6BA 3ORKA 3R28A 4ZTHA 3ATSA 1OITA 3KB7A 3W8LA 3DXQA 5LCJA 3E64A 4D2WA 2PMIA 4Y5HA 5C27A 3EQDA 5EI2A 5L4QA 1URCA 4F08A 3I5NA 1GAGA 4Z7GA 5JMSA 2CGXA 5DRDA 1ZMWA 2ETMA 2EVAA 3FYKX 3UNKA 3AXWA 2R2PA 1FVTA 3ANQA 2R7BA 3FXWA 4OR5A 4IHPA 5EHOA 2X4ZA 3LAUA 3HMOA 4FL2A 4CZUA 3D0EA 4RJ3A 3GBZA 1WZYA 2OZAB 4NFNA 3FI3A 2IWIA 4IFCA 3EQCA 5GJGA 4FVRA 4EOQA 3FMEA 4RVTA 4TYEA 4QMUA 2C3IB 5L6WL 5HIEA 3TUDA 3IW4A 5LMKA 3MA3A 5CSWA 1PXOA 3QHRA 3RINA 1WBNA 2WMWA 3L9NA 2YIWA 3QCQA 1ERKA 4HVGA 4S30A 5H8EA 1CKIA 2ZV8A 4FT3A 3O8PA 5EI8A 5FXQA 2WD1A 4BI1A 4FGRA 3P7CA 3ORZA 2XBJA 5DIAA 3HA8A 4UY9A 5EHYA 5E4HA 2GPHA 4QPSA 4BVUA 3TEIA 4F1TA 3DK3A 2DUVA 4JG7A 3F5PA 3FZTA 4FKQA 5IEXA 4ANMA 3TNHA 1WBOA 4O0UA 4XG8A 5HOAA 4CFWA 2I7QA 4USDA 4RIYA 3EB0A 5LJJA 1CTPE 4J8MA 4OTGA 3ZXZA 4KKGA 3EFWA 5GIOE 2VX0A 2UV2A 3D9VA 1OI9A 2EUFB 4ZTMA 2CLQA 5KBRA 4XNEA 2JAMA 3P0MA 1XH4A 3SW4A 2BIKB 2X0GA 3LMHA 3KC3A 1GJOA 1W8CA 4BDHA 3FL4A 3AMBA 5D41A 4QMLA 5CYIA 3OBGA 3IW7A 4FKRA 5AP6A 3V8WA 3R01A 4AT3A 5I9ZA 5KKRC 2Z02A 2ITYA 2IJMA 5FEDA 4IACA 3ZFYA 4DGOA 4O6LA 5DI1A 5HG7A 5JRSA 4YP8A 5EKOA 5CEQA 5JFVA 2EXCX 4BDIA 2XUUA 4IADA 3NLBA 4OTWA 4QYGA 3L9MA 5M4FA 1ZAOA 4NW6A 3SXSA 3GC0A 3KMUA 4IX5A 4LUDA 2O5KA 4FICA 4MNFA 3ZOSA 5HBHA 4GW8A 5HESA 1ZYCA 4C3FA 4DH1A 4KBCA 4OTQA 4J52A 3QUEA 4ZXTA 3FPQA 3VW8A 2VTLA 4D5HA 4JRVA 2OF4A 3R8LA 3VUDA 4CKJA 5LWMA 4RZWA 1WVYA 3RHKA 3EN5A 4FTOA 5TR6A 4OGRA 3VS2A 5CANA 1XH5A 2QVSE 5JGDA 4TYHB 5LQFA 1H1SA 5FTOA 3SQQA 3FMJA 4BWKA 2ZDUA 4X6QC 1IRKA 4GT3A 5FDPA 4NJDA 3AC8A 2JKOA 3DV3A 4HGTA 4U8ZA 3FQEA 3MFTA 3RVGA 3OMVA 5CNNA 3MESA 2I1MA 2BZJA 1M2PA 3Q4CA 4GFOA 4XCUA 4PTGA 3EIDA 1O9UA 2F7XE 5BVEA 4J8NA 4NIFB 1FOTA 4M84A 4DYMA 4JQEA 4BDKA 1OL2A 2G01A 4A7CA 3LFDA 4L01A 4E4MA 3DKGA 2Z7QA 3COHA 3HRCA 3GVUA 4AZTA 3PE2A 2PMOX 3POOA 4AXAA 2G9XA 2YWPA 1XJDA 3EYGA 3O0GA 2GSFA 4RIXB 4FE2A 1UA2A 4HJOA 2UVZA 3Q53A 4FNZA 5F94A 2PVKA 3D14A 3OOMA 4IE9A 4K18A 4QPAA 5AIRA 4A9SA 3IK3A 1KUTA 3UO6A 1UWHA 3ZLSA 3U87A 4F7SA 3BQCA 3SG8A 4IMYA 2GS7A 4ZJIA 2YM3A 2IVUA 3GCQA 4Y8DA 5B2MA 1YQJA 3G9LX 4IQ6A 1UU8A 3TV6A 4FTJA 3Q6WA 3VN9A 2WMBA 5HBJA 3N4UA 5DR2A 4EH8A 1UU9A 5D7VA 2HENA 3Q4TA 1Q8UA 5DVRA 3JVSA 3UVPA 5E91A 3EFLA 3TG1A 3CD3A 3PY3A 3W10A 3BU5A 2PZPA 4V0GB 3MFRA 3MTLA 3SV0A 2BFXA 2UW7A 3OWKA 4L6QA 1RE8A 4Y72A 3IKAA 4BDAA 3RBWA 3WYYA 2WTVA 4A9RA 4OAUC 5EQYA 4BTMA 2PHKA 2QHMA 2QI8A 4IZ7A 5CF6A 2O0UA
chains in the Genus database with same CATH superfamily
4KUJA 5AX9A 2W99B 3BLQA 3GI3A 4BIEA 4AXCA 1HCLA 4ZOGA 3R9DA 4DT9A 3D94A 5ACKA 1REJA 5FBNC 4GMYA 2R3GA 2QO7A 3D5VA 3R63A 4XBRA 1RJBA 3RK9A 4CLIA 2C5NA 2YLFA 3UMWA 2DYLA 4X2JA 2B9FA 4F1OA 4EBWA 2JDRA 3P78A 2QOIA 4GK3A 4QQCA 4ZJVA 2ITQA 3FI4A 4J96A 5FP5A 5HZNA 3IO7A 4J53A 4QNYA 3BEAA 4FZDB 5AR4A 4A4LA 4B6LA 5M56A 5HEZA 4U0IA 1Q8TA 2HOGA 4F9AA 4JAIA 4LGGA 3NNXA 3Q04A 4EHEA 3ZO1A 4EJNA 2CKQA 4DHFA 1VLRA 5JFSA 3OS3A 1XWSA 5FG8A 3FKNA 2UVXA 4I20A 2B55A 5HCZA 4RLKA 5H8GA 3DQWA 2WAJA 3LLTA 2QD9A 3ERKA 4QPMA 3EYHA 4WUAA 4DGGA 4DTBA 4RT7A 3VHKA 2PZIA 4I93A 4HVHA 3CLYA 3KMMA 4H36A 3ZZWA 4BDBA 3H9OA 4BGGA 2A1AB 4OTIA 3QLFA 3EQBA 5HO7A 3CQWA 3VF8A 2CJMA 2OXDA 2OO8X 3HV3A 4RIWB 4I5MA 5AR8A 5L2SA 2CGWA 1WAKA 4GEOA 4CMUA 2GS2A 4RSSA 4ANQA 4H3PA 4ASXA 4D28A 2W1ZA 1OBDA 3CGFA 4C4HA 4DTKA 4AXEA 3VBXA 2QOCA 4IBMA 2FSOX 5EKNA 5BNJA 4JOAA 2PE0A 3LM5A 4CT1A 2I0EA 3PG1A 3O8UA 3PPZA 2HZ0A 4UZDA 2QOFA 4GU9A 2PVYA 5HGIA 5IUIA 3QA8A 5CALA 2HXQA 3OTVA 2VUWA 4ACMA 3ZO3A 4C4IA 3ORIA 3M1SA 4I6LA 4XRJA 4AFEA 4O82A 4YJSA 4E7WA 2NO3A 3E92A 3KGAA 5EYDA 4C7TA 4D2VA 1OMWA 4DBNA 3Q9WA 2UZBA 3LFNA 3NFGB 2OJFE 2RFDA 3R7OA 4M13A 2OW3A 5A6OA 4KIKB 4OTHA 2CKEA 4F7NA 3R9NA 3PUPA 4GT5A 3QFVA 2XANA 3UP2A 4FT7A 2XNOA 4CRLA 1JPAA 1ZYLA 2CN8A 4D4YA 4BDGA 4DCEA 3UJGA 2OJJA 5IMXA 4V04A 4O4BB 2GNIA 4C3PA 2WTJA 3RPRA 4QYYA 5KMMA 2XMYA 3LXLA 5E90A 4C8BA 5IH6A 3D5XA 3IONA 4FK3A 3F5UA 1W83A 4DCAA 3PIYA 2PU8A 2VTAA 2CGUA 3HLLA 4HZSA 3AC4A 2WMQA 2XNNA 3NNUA 5F20A 5CZHA 5IZFA 4AAYA 2XK9A 4XH6A 2VWIA 2C3JA 4FTKA 3BYVA 5B2KA 4ERKA 5E8YA 2QOLA 3UNJA 2GNGA 1ZOGA 3VF9A 1Z9XA 1OPLA 2XKDA 4UMTA 4OTPA 4QP9A 2XK7A 2JGZA 2GTNA 3QTZA 2WB8A 4TNDA 3GQLA 4TPTA 3MN3A 4F6SA 2O2UA 4FVQA 4FEVA 2PPQA 5FUTA 4PWNA 2VD5A 4YMJA 2HZ4A 4OTDA 3V5PA 4O22A 4ZK5A 4AW5A 2A4LA 4EOSA 4PP7A 4ANSA 4NTSA 4TYGA 5JN2A 4ZS4A 1OL5A 3CY3A 4FI1A 2QONA 5E92A 4BIDA 3QKMA 3TDWA 5ETCA 4HYUA 4IWOA 1GZNA 2Z7RA 3QTWA 4FTRA 5AMNA 5KMKA 5AP3A 4W8DA 3NS9A 2CCIA 4BC6A 3CJFA 5K4IA 4J71A 3ACJA 4DEBA 4L53A 1PXKA 4KRDA 1OB3A 1WMKA 3E8NA 4C3RA 5CSHA 3Q96A 3LFFA 3ZC6A 5BYLA 5A6NA 4FKLA 4JDIA 3RM7A 3PA5A 4C4EA 4H58A 3UVQA 4F9BA 2BALA 3F88A 3PXZA 3O5AA 1AGWA 3CTQA 2QKWB 3HVCA 4M97A 3CSVA 4HYIA 2ITZA 2PL0A 3GQIA 5TOZA 2X7FA 2ESMA 3DKFA 4PUZA 3F7WA 3FMMA 3NIZA 4I3ZA 3C9WA 4ZTRA 4D9TA 4L45A 5CAVA 2B9HA 4O0RA 2WEIA 4CMOA 4XX9A 3H9RA 5J8IA 3V6RA 3CEKA 4UYAA 5K5XA 3UO4A 3E7VA 1YI3A 2ERKA 2BIYA 3PJCA 5CEPA 4AACA 4MXYA 4GJ3A 5EM6A 3A7GA 4EH2A 4FVPA 3FDNA 2G2IA 3R1NA 3I0OA 2C0OA 3A7JA 4EOKA 3O51A 3HMPA 3OBJA 4RLLA 3DJ6A 1KOAA 2R3FA 4HCVA 2OFVA 3TZ8A 1H26A 3DB6A 3AQVA 3K2LA 3OW3A 3DY7A 3ORLA 4O6EA 4ALVA 4YTFA 4XJ0A 2QG5A 4FTCA 5ANIA 3ALNA 5CY3A 2X9FA 3OT3A 3BLRA 2QR7A 3ZBFA 1J3HA 4AGUA 2X1NA 5ANOA 2YABA 5B7VA 3NGAA 4YZCA 2GQSA 4L3LA 5KKRB 4KAOA 3DAJA 4Q9ZA 3ZSHA 5LCKA 3PIZA 4DFLA 4IM3A 4OTFA 3NSZA 3BE2A 4RQKA 3OCBA 3TWJA 4YLJA 4AUAA 1PY5A 2XEZA 3R1SA 3C0GA 5IQBA 4MWIA 3F3UA 2C69A 2VTJA 4QOXA 2NYAA 2XK6A 2V0DA 3KEXA 4R5SA 5DN3A 3NVMB 2UZEA 4KBAA 2C6DA 4WNKA 3AC2A 2A27A 1XKKA 4TW9A 5EYKA 3E3BX 2RSVA 1LUFA 4M7IA 5HIDA 1LR4A 2WTCA 3MPAA 3TKUA 3DXNA 5IA3A 4FT0A 2X9EA 3EJ1A 4C33A 2WMSA 4FIJA 5M55A 3N9XA 3ZS5A 3SOCA 3SRVB 1JKKA 4OBPA 3DBFA 4QTEA 3LFEA 3WZKA 5J9ZA 5LOHA 4QMQA 5IEVA 4WRSA 4BGHA 2YCRA 3D7ZA 2HW7A 4TL0A 2WPAA 3KCKA 1VR2A 3KN6A 4GFGA 2QLQA 4Y5QA 5K3YA 4LFIA 4JRNA 3FJQE 3QRTA 3KVXA 3NUXA 5GJDA 5DHJA 4BF2A 3EN4A 3GOKA 1Q3WA 3OW4A 3PVUA 5HG5A 3TV4A 1Q3DA 3MSSA 3L8VA 3Q9XA 4ALWA 4ENXA 1ST4A 3R8UA 2BDJA 1DS5A 2B9IA 3EWHA 4U3YA 4I92A 5FGKA 3UYTA 4ZZNA 3NCZA 4M12A 2B0QA 3T3UA 5BUIA 1GZOA 5AV1A 3GFWA 4AOJA 2VX3A 2X81A 3CP9A 5EDRA 3U9CA 5A9UA 5F95A 4AT5A 2GDOA 1U4DA 2BAJA 2UW3A 3OZ6A 5M57A 4YPSA 4O0WA 4AA0A 4BCPA 3GUBA 3RAHA 3R7IA 3TNPC 2YACA 3BX5A 3CKWA 5CF4A 3V5TA 3L8PA 3EQRA 3H0YA 4I4EA 4O0YA 4TZRA 4AW0A 3FC2A 3LFQA 4RPVA 3VBTA 4ASZA 2CHLA 5E8SA 3GU5A 3SXFA 4UMRA 5JGBA 2PZYA 4C4JA 5IQEA 5J5TA 3QALE 2YWVA 3RNIA 4BZOA 3WIKA 5EFQA 1AQ1A 3CS9A 3ZLXA 1Q62A 3A99A 4U9AA 5CT0A 2BFYA 4JAJA 3A2CA 4X3JA 3AKLA 1QPDA 4DEHA 4JL9A 4AGWA 4CRSA 2I0VA 2WEVA 3K5VA 5BV3A 2FUMA 1Q41A 3JS2A 4QP8A 4U45A 3O17A 2YCSA 4MQ1A 4X0MA 3KRWA 4QMZA 2HWPA 1H1WA 4L46A 2XB7A 4U79A 1G8SA 4QRCA 2HCKA 4U42A 4IX4A 2C47A 3SW7A 3MYGA 2XYNA 3KU2A 4GG5A 1OL6A 3S2PA 4DFXE 1YVJA 4RVKA 1QPEA 1WFCA 2E9VA 4FEUA 3QZGA 5EI6A 5HE3A 5AUTA 3O23A 4BCOA 3MY0A 4L3PA 1IA9A 1W7HA 3ZEWA 5I5ZA 4C2WA 5E8UA 5IUHA 5HE2A 4EOPA 2QG7A 3PFYA 4QTDA 2UW6A 2VTOA 2R3KA 4JI9A 3LCKA 4FV4A 3C0HA 4TYHA 3Q60A 4O86A 3PXKA 3ACKA 4Y73A 4FZ7A 3EZVA 3LZBA 2BDWA 2XM8A 4K1BA 4QYFA 4DN5A 3FMDA 1GZKA 1SMHA 3KXZA 4JS8A 4EK8A 4EQUA 5JH6A 5H3QA 3LLAA 4QP2A 3CKXA 3Q9ZA 4M8TA 2X7GA 2OJ9A 4UWBA 5ICPA 1PXIA 4AP7A 2VNYA 5M51A 2CGVA 3H30A 1WVWA 2BPMA 3FUPA 3RZBA 2EWAA 5F9EA 2AUHA 2J6MA 4PNKA 4TKSA 3N4TA 5HG8A 3EL8A 5JFXA 2ACXA 4JBOA 2VZ6A 3ORXA 3PJ2A 2X39A 3AC5A 3H10A 4IM0A 5CNOA 3FY2A 1K2PA 3NNWA 2J9MA 2ZMCA 2XK4A 4ITJA 4N4SA 3R7EA 4AE9A 1Y8GA 4N6ZA 2O65A 3BQRA 2VTQA 1UNHA 1NXKA 4FNWA 3REPA 1TQIA 4O1PA 4W9WA 5CSXA 4X3FC 4AN9A 4ZLZA 3WF9A 5AA9A 1G5SA 2ITWA 2QNJA 4JDKA 5J7HA 3ROYA 1HOWA 5DEYA 2O8YA 2HY0A 4KB8A 2CKPA 3OWPA 4NW5A 5AADA 3UIUA 2W5HA 4ZZMA 1MQBA 3G15A 3I0QA 4U43A 3QZIA 4PDPA 4XHKB 3KL8A 4CLJA 3NRMA 2E9UA 2JKMA 2WU7A 4O4EA 3RJCA 3QC9A 4EHGA 3LMIA 4AE6A 4K9YA 3MPTA 5TF9A 4RMZA 2X7OA 4EEVA 3PSCA 1MRVA 3BLHA 1DM2A 3KULA 3QTIA 5DGZA 4BKYA 1PMEA 5A54A 2Y4PA 2UW0A 2E9PA 3EN7A 3DBDA 2E9OA 3TNWA 4AA4A 4EHZA 3BBTB 3TM0A 2V62A 2VTSA 1H01A 3TXOA 3VBVA 4RA5A 4N6YA 4AX8A 2XIYA 4YLKA 4GK4A 3JY9A 3KA0A 3OUKA 3QX2A 4NM7A 5CQUA 4G16A 3RWPA 3KREA 5EQEA 4M66A 3ODYX 5AX3A 1PXJA 3OXTA 5HCYA 2ZFYA 2ITXA 4I21A 2OJGA 1OKYA 2VWXA 4FTNA 4RGJA 2CNUA 5IQAA 1YRPA 4TWNA 4EORA 5CASA 4TWCA 5HORA 4EZ5A 3A4PA 4E5AX 3BHYA 3O7LB 1XHAA 3R00A 3MIAA 4C34A 3MTFA 3QQGA 4FKVA 4L43A 1JAMA 3MFSA 3SLSA 1CDKA 4BFMA 4QP7A 3RPOA 3ENMA 4XS2A 3BEGA 3CXWA 4N0SA 5IPJA 1YOJA 5KHWA 5A4CA 5CVGA 3U4UA 4EKLA 2ETKA 4WO5A 1YDRE 2C1BA 4II5A 3BGQA 4C37A 4AZWA 2Q0BA 3HRFA 2OU7A 2BVAA 4KIPA 5AAEA 3UOLA 4GU6A 4G6LA 4GCJA 5HHWA 4CZTA 2BCJA 2WZJA 5AP2A 3OC1A 4O2ZA 3I6UA 2IVTA 3GC7A 3W2PA 3HA6A 4RJ6A 2WQBA 5B2LA 1XMMA 3FMNA 3AD4A 5EQPA 5BYZA 3E5AA 4YPDA 4E6AA 3DKCA 4RWKA 1U54B 2BROA 4GK2A 2J5FA 3NX8A 4CEGA 2RF9A 3TT0A 3FLQA 3TACA 4C58A 4DH7A 1FBNA 2A19B 4I6BA 3TN8A 5M44A 3GCVA 2W1HA 2YIRA 2BRHA 1Q61A 4ALUA 3E8CA 4X2GA 3CPCA 3FPMA 4ZEGA 3R9OA 4YTCA 3DKOA 3ANRA 3OG7A 3HKOA 4NKSA 4BJJB 5LMKC 1JSUA 4WT6A 2GTMA 2DWBA 4XLVA 2VAGA 4RX5A 4ZY5A 5FEQA 4CZYB 2YDKA 4E93A 3CR0A 5DMZA 4FSTA 5IQDA 1EH4A 1J1BA 2R3LA 5DR6A 4MXZA 4R7BA 2XJ0A 3E93A 4FKPA 4O91A 1W0XC 5J9YA 3TDVA 3HUBA 3KK9A 1A9UA 3VWAA 3MW1A 3R1QA 3W2RA 2QKRA 2ZM1A 4MNEA 1B38A 1YDSE 3F3VA 4LRJA 4ZTSA 3KRRA 3A8XA 3P7AA 3C4FA 1OIRA 4G3FA 3EHAA 3MH0A 4OUCA 1Y57A 3ZM4A 2XRUA 3HMMA 5DG5A 3PJ3A 3MGYA 1ZY5A 3VS6A 4ERWA 4PMTA 1YOLA 3WF7A 5HLWA 4D2PA 4JR7A 2JC6A 1O6KA 2CLXA 3EN9A 3S4QA 5HBEA 4D1XA 4O21A 3VBQA 3F69A 2GFCA 2BRBA 4FSMA 2IZUA 4BCQA 5K9IA 4V01A 1TFFA 5AUYA 2OLCA 4EWHA 1MRUA 5HLPA 3RAIA 3KXMA 2C0IA 1UWJA 4BZDA 1Q8ZA 4BYIA 3IGOA 5DBXA 1LEWA 4F7LA 1BKXA 2X8EA 3BPRA 3QL8A 4FTIA 3BYSA 3DS6A 1H0WA 3II5A 1TKIA 3FBVA 3PFQA 3A7IA 1DAWA 5TT7A 4F0IA 3RM6A 5HKMA 3LHJA 4DG3E 5LMBA 3G33A 1OM1A 3FZPA 4MBIA 3SAYA 4A4XA 3R7GA 5JRQA 5C4LA 2RGPA 4Z16A 3BLAA 5CLPA 3FXZA 3UP7A 1UNLA 3A4OX 1RW8A 1GY3A 4FTAA 4FT5A 3FQSA 3ULIA 5KMOA 2Z7LA 4H39A 3UC3A 3HV6A 1A48A 1PF8A 4A4OA 3L9PA 2HYYA 2WU6A 3BHTA 2BKKA 1WCCA 2WTKC 4GVJA 1LEZA 3PVGA 2WHBA 4XG3A 3WBLA 2XF0A 3NDMA 2I40A 4YR8A 3MVLA 4FV3A 4GKIA 1X8BA 4XYFA 3LJ0A 2IG7A 5IQHA 4J97A 3CCNA 2Z8CA 5C8MA 4I5HA 4IVAA 4D58A 3SX9A 3DLZA 4PNIA 2PVMA 4XG9A 2QURA 3CY2A 3HL7A 2IVSA 2HZIA 3ZSIA 2PMNX 3AMYA 3U51A 4HGSA 4I6HA 1FMKA 4JMQA 2QLUA 1ST0A 2F2UA 4MBLA 1VZOA 2H34A 3ORPA 3D83A 1GIHA 5M09A 4C61A 5JKGA 4DFYA 5EOBA 4FUXA 2PK9A 3GU7A 3C5IA 2UZLA 5L2WA 1P5EA 2DS1A 3BYUA 4G3CA 4S2ZA 3NAYA 3R8ZA 3BIZA 3NEWA 3FMHA 4H3QA 4MXXA 3FZRA 1H27A 3LCOA 4UXLA 3ZZEA 4CYIA 3WZEA 4IANA 2YZAA 3ZCLA 2WMXA 5M08A 1XH6A 3QYWA 3FLNC 4O7LA 2BTRA 3QTQA 4QDVA 5IUGA 4PP9A 3PP1A 3TIZA 4ZS0A 3WE8A 3COMA 4AQCA 4AU8A 5AV4A 5AP4A 3FHRA 4I6QA 1JSTA 4ZTQA 5HVYA 1IEPA 4BRXA 2F4JA 4HYSA 3IDBA 3DTWA 3ZUTA 2V22A 4QMYA 2OXYA 3V04A 4E1ZA 4HW7A 1Y91A 4NZWB 5ANJA 3QGWA 4GJ2A 1YWVA 4PMMA 2C5OA 2P33A 1PXPA 3KK8A 5E1SA 4IB0A 4EOIA 3ZLYA 3DFAA 3S0OA 3QQHA 3N4VA 5EM5A 4FL1A 4YJOA 4RVMA 2A0CX 4LMUA 1ZYDA 3QLGA 4EUTA 3Q5IA 4DH5A 2ZAZA 3BZ3A 2AQXA 3DOGA 4CFNA 2C30A 1M2QA 5E1EA 3FEGA 4FV9A 2IF8A 3NCGA 5AUXA 3AT2A 3MH2A 4L44A 5ETIA 1OIUA 3E7OA 4CTCA 3WZDA 4OT6A 3Q4ZA 1WBTA 3G9NA 5FQDC 5HD7A 2Z2WA 3A60A 2AEGA 4UZHA 5BUEA 2WQNA 5HLNA 3VW6A 5DT4A 4D1SA 4JXFA 4TWOA 3W0NA 5HIBA 3KXGA 5C1QB 2R64A 5L2IA 4DINA 3FC1X 3L8SA 4CV8A 4FMQA 5A14A 3CC6A 3LCTA 4U80A 5E7RA 4BI2A 4DEGA 5TO8A 5AP7A 5L3AA 4M0ZA 5BVOA 4O7RA 3ETAA 4O7TA 2P4IA 2B53A 2C5XA 2Y6MA 4O7YA 2OK1A 4G6NA 3V8SA 3FLYA 3LFCA 3UG1A 3VAPA 2YERA 4IAZA 1SM2A 4NM0A 4E20A 4EZ7A 4CXAA 1JVPP 3F3WA 3HRBA 3Q4UA 4U3ZA 2R4BA 3VONA 1NVQA 3C1XA 4WRGA 2FA2A 4MVFA 4JLCA 5EHLA 4CYJA 1FVRA 2P0CA 3HV5A 3S3IA 4JT3A 4NK9A 1OIQA 4P90A 3F6XA 3RMFA 3GXLA 4NUSA 2JIIA 2J0IA 2XVDA 3TZ7A 3D5WA 3DFCB 5M4IA 3LW0A 3QCSA 4HOKA 5K4JA 5CU4A 3QTSA 4KS7A 4M0YA 3F66A 1YW2A 3G0FA 2HELA 3RPSA 3PIXA 2YAAA 4F99A 1H07A 3DB8A 5A4EA 4QMOA 4WNPA 4QNAA 5IH4A 4DH8A 3QWKA 4YJTA 4H3BA 4QQ5A 2QO2A 2J4ZA 2XA4A 4IWQA 3R21A 4M69A 5FD2A 5AA8A 4RC2A 5EG3A 1FQ1B 2W06A 1H1PA 2PSQA 2Y4IB 5DE2A 3PPJA 2FGIA 3W0SA 2YM8A 4UMQA 5G1XA 1BI8A 3E8DA 3KN5A 3NW6A 3V5WA 5DYJA 1XO2B 4ITHA 2EB3A 4JQ8A 4MH7A 4CG9A 1ZMUA 3I60A 2ZYBA 3KVWA 4AN2A 4ZIMA 2ITUA 2VTMA 2R3NA 1YHSA 3BE9A 5F4NA 2CN5A 5LWNA 4BBFA 4F9CA 3WE4A 3F61A 4O0SA 4IX3A 4E3CA 4EH5A 2QOOA 4OW8A 2VX1A 4KKHA 3S95A 1XH7A 5EYMA 3DT1A 4CCUA 1YKRA 2UZVA 2OGVA 2XNBA 1R0EA 2ETRA 2R3RA 3A7FA 4FSZA 4OT5A 3IG7A 1JKTA 5CZIA 3O50A 4JBPA 4O96A 3GOPA 4E5WA 1R3CA 4BCJA 5M07A 4HZRA 4Q5HA 3GC9A 3KY2A 3QXPA 3QWJA 4DAWA 1BLXA 1V1KA 3R6XA 3W8QA 2C1AA 2J50A 5EW9A 3QTUA 4FTTA 2PWLA 3DU8A 5FM2A 2FVDA 2PY3A 5A4LA 3GU4A 3PE1A 5CEKA 3CPBA 2J51A 4O7NA 2XAMA 1YWRA 5CU3A 1PXNA 5JFWA 1OIYA 4DFBA 4BBMA 4R1YA 4RX8A 3AKKA 4UXQA 4BCGA 4ZAUA 4DFUA 1W2FA 4J95A 4ZP5A 4F09A 2WXVA 1YHVA 4M3QA 3LFAA 1TVOA 3FWQA 2OF2A 1U46A 1H4LA 3GCPA 3PYYA 5CVHA 2PZ5A 4ZSJA 3F7ZA 3QD4A 5ANEA 3GFEA 4MCVA 4FTUA 3MVMA 4WBBB 3TUCA 2JITA 3CE3A 3MH3A 4DLJA 2EXMA 4ZSAA 5AM6A 1ZRZA 3MA6A 5ETFA 3VUIA 4P5ZA 4I41A 4LOOA 1NY3A 5HTIA 4UBAA 3BWJA 3EQPA 4YZMA 2F2CB 4NT4A 5ANDA 4BHNA 5E8VA 4C4FA 2R3QA 4D4VA 3BCEA 4FV5A 5L8JA 2ZMDA 3FMKA 2OXXA 4G34A 5CENA 3DBQA 4J7BA 4F0GA 1OBGA 1Q8WA 2XNEA 4LV7A 5FP6A 4PMPA 2R3MA 4RIYB 4AOTA 2G2FA 3TTIA 3F3ZA 3NFFB 3UPZA 2PVFA 5E8TA 4UMPA 1BL6A 2ZV2A 5DT3A 2UUEA 4IH8A 4GYIA 3Q3BA 5C4KA 3PSBA 1ZOEA 3QC4A 4BWXA 4IWDA 4DGMA 2YCFA 3JR1A 3UZTA 2VRXA 3D2IA 4XOYA 3Q9YA 1MP8A 2FSLX 3OD6X 4B4LA 3W0OA 2VWWA 4YO6A 3W0RA 3O2MA 3JYAA 3LCSA 2VU3A 4EKKA 3UIBA 3VQHA 2PYWA 2WGJA 2C6MA 4CVAA 2W05A 5IA4A 1IG1A 2C6TA 3OXIA 4BCIA 4RC4A 4ZSGA 3VHEA 5T6KA 3OEFX 1Q97A 4N70A 4RX7A 3VVHA 4ID7A 4XP3A 5GZ8A 4O83A 3NUAA 1MQ4A 2XARA 3U55A 1Z5MA 3DNDA 3HX4A 5A4QA 5IA5A 1XBBA 4AW1A 2WMTA 3S00A 1KWPA 3QGYA 5DR9A 5JZNA 2JKQA 4HNIA 2WMAA 4U7ZA 3JUHA 2GQGA 2WTKB 4FOBA 4FRFA 5CWZA 4EBVA 1NW1A 4IWPA 4AA5A 4IAKA 4L9IA 4ENYA 5DA3A 4ZSEA 3BHVA 1M17A 4UWYA 3UYSA 5D12A 3TNIA 4CT2A 4DGNA 2BR1A 5GJFA 3HV7A 4EL9A 2KULA 4YJRA 4A06A 4BTJA 4GKHA 3VQUA 2VWZA 3PJ8A 1F0QA 4ACGA 5HVKA 1OKZA 4S34A 3NWWA 1H1QA 1CM8A 5BQ0A 3IOKA 5DLSA 5HX8A 1OGYA 2Q0NA 4TXCA 3V8TA 2G2HA 2HK5A 4K8AA 4FZFB 5AP0A 1U54A 4IAFA 2J0KA 4AF3A 5KO1A 4RX9A 1CMKE 4F4PA 1XMLA 4XG6A 2ITOA 2VTNA 2X0QA 4NEUA 3HGKA 1TZDA 4RZVA 1G8AA 2R3PA 3A7HA 3AT3A 2VTRA 4DHIB 4E4NA 4RQVA 5E8WA 3Q2JA 4AWIA 4YLLA 2QU6A 2JFLA 4L8MA 3ATTA 4YBJA 3WOWA 1PW2A 4CD0A 4FZ6A 2RFSA 4FIIA 4FODA 3TTJA 3NUNA 4FSRA 2JDOA 3BV2A 4C57A 4O0VA 3CIKA 4GRBA 5CU6A 4MYGA 1SYKA 3IDPA 3ZUUA 4AQKA 2BAQA 2REIA 4ZMEA 3QTRA 4HNFA 4K33A 4K6ZA 3VBWA 3TJCA 3NW5A 3QZHA 1QMZA 5AUZA 3G5DA 2IZTA 4I5PA 3EL7A 4FOCA 3ZONA 4D2TA 3W0PA 4EK6A 1M7NA 4YC6A 4R77A 1PYEA 5C03A 4PDSA 2HAKA 2OZAA 3HDNA 3I5ZA 3FHIA 5EW8A 3TUBA 3NMUF 1YXSA 3R2BA 3QBNA 1UU3A 4QT1A 5AWMA 5C9CA 3TCPA 2NP8A 3QQLA 3RAWA 3QUPA 3TJDA 4YJUA 3DNEA 3LMGA 4KNBA 1YI6A 1YOMA 3E63A 3KXNA 3RWQA 4U40A 3HAVA 4EK3A 4FC0A 2WNTA 3AD5A 2XIXA 4NCTA 3VUMA 1W82A 5A46A 3SVVA 5CU0A 4BBEA 3KFAA 4FSQA 4L7FA 4GV1A 4FK6A 2YEXA 4YBKA 3R04A 3WARA 4WKQA 3U4WA 4IVCA 1HCKA 5BX0A 3D4QA 3FLSA 2I6LA 4DG0E 2CPKE 3U6IA 3ZRMA 3TV7A 3Q6UA 1BL7A 4E5BA 3G6HA 3C4CA 5AR5A 2BRNA 4IZYA 3KMWA 1APME 2VTIA 4ZY6A 3C4EA 2X8DA 4PPBA 3PSDA 1NA7A 2CNQA 2C0TA 3UZRA 1B6CB 3G2FA 2J90A 4PTCA 1CKJA 1XQZA 2QC6A 2YM4A 2Y0AA 5DH3A 5FLFA 4Z3VA 5CI6A 5IA2A 4ZTNA 1OECA 1VYWA 2CMWA 5I9WA 4TYJA 2VWUA 4FIGA 4PL3A 1Q4LA 4XLIA 5AJQA 4DFNA 1E1VA 5FWKK 2QU5A 2R3OA 3WZUA 5KMLA 4BN1A 2BMCA 2ZVAA 4LRKA 4C0TA 3AOXA 3DJ5A 4WHZA 4JR3A 3D7TB 4I24A 4YGAA 4DEAA 2IW6A 3T8OA 5KZ0A 3OUNB 4YZDA 4B7TA 4O84A 3Q32A 3KRLA 3PXQA 3MVHA 3BGZA 2WIPA 2G15A 4KINA 4O38A 2O63A 3C4ZA 3AC1A 3AMAA 1WBSA 2ITNA 2XNPA 3QZFA 4JBVA 1URWA 2BHHA 4RFZA 4WNMA 4O7WA 5I0BA 4YTIA 2X8IA 3UTOA 3FQHA 3FAAA 5ACBC 3VJNA 2CCHA 3MI9A 3QQUA 4BY9E 3A62A 2GCDA 4O4CA 4GSBA 2UW8A 2YIQA 3QF9A 4F64A 5J79A 4LMNA 2BUJA 4AGCA 4RFMA 4DHZA 2SRCA 3JY0A 3R02A 2PULA 2J0LA 3L8XA 3K54A 5C8KA 4YC3A 2JBPA 4NIFA 5B0XA 3VC4A 1PMVA 4FL3A 3V5LA 1BMKA 4Y83A 3BHUA 5F1ZA 3RK7A 2NRUA 3UQFA 3M42A 4E73A 2PUPA 4PF4A 2VGPA 2W7XA 4E26A 3ZU7A 4EYMA 2R9SA 4JNWA 2NPQA 3MS9A 4DH3A 5FXSA 2XK8A 3NAXA 5GHVA 4KABA 3H3CA 4IDTA 5ITAA 3L1SA 4LV8A 2JEDA 2ZJWA 2RKUA 4BCFA 4CCBA 5HX6A 1JWHA 4I6FA 1P4FA 4RIXA 4FIEA 4Q2AA 3M11A 2RL5A 4PL4A 4PL5A 3DQXA 4IDVA 2PVJA 4GS6A