5K0XA

Crystal structure of the catalytic domain of the proto-oncogene tyrosine-protein kinase mer in complex with inhibitor unc2541
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
288
structure length
258
Chain Sequence
KLEDVVIDRNLLILGKILGEGSVMEGNLKQEDGTSLKVAVKTMKLDNSSQIEEFLSEAACMKDFSHPNVIRLLGVCIEPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of Macrocyclic Pyrimidines as MerTK-Specific Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase Mer
total genus 74
structure length 258
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5k0xA02
1IG1A 5F1ZA 4DEAA 5K4JA 3NW6A 2W5BA 3AMBA 2VU3A 3OOMA 1YI4A 3R21A 4JRVA 4W9XA 1UKHA 3PIXA 2WQMA 4X6QC 5DOSA 3QTIA 4CMUA 3VN9A 5IPJA 5JFVA 3G5DA 2OH4A 2W1ZA 3WYYA 4V04A 4RA5A 1PXNA 2J51A 3HDNA 4WRSA 4ASXA 5BVEA 4G9RA 2UZEA 3KU2A 5AR7A 3FKLA 4L68A 3WF7A 4QMQA 2OXXA 3D14A 3JUHA 4NUSA 5E8YA 1H4LA 4U45A 3A7HA 4O0XA 4PY1A 4TWPA 2F7ZE 4NSTA 4ZZNA 4YURA 3PPJA 4D5HA 4YO6A 4DYMA 3BU6A 3ORXA 4JBQA 3LFQA 3IW5A 4O21A 2QQ7A 5HE0A 1P14A 4YSMA 4KRCA 5KX8A 4IM0A 3S95A 3EHAA 4E6QA 4FVPA 1BX6A 1AGWA 3QGWA 3GOPA 2C6TA 5D1JA 4D58A 4BZOA 3WZEA 4OTQA 4YC8A 2J9MA 4DH3A 4TY1A 3D4QA 4BDIA 1W7HA 3IONA 3P7BA 4FI1A 5AWMA 5I9VA 4P2KA 4HGEA 4XBRA 5EK7A 2BUJA 4A7CA 3PPZA 5CY3A 3JY0A 4ACMA 3RP9A 4YLJA 4QMLA 5L2WA 3LCDA 4FKVA 4FTOA 4PDSA 3RM6A 2R3IA 1M52A 2XZSA 2BRMA 4XV3A 2WQEA 4XJ0A 5D7AA 1BLXA 2Z60A 4C36A 3Q4UA 1REKA 2IZTA 3KMUA 5CU2A 4JDHA 2JDRA 4JX7A 4QMSA 3VNTA 1YOJA 2E9NA 4O0RA 4HZSA 2ZMCA 3POZA 3U9NA 3WARA 4C4GA 3LFDA 3FQSA 4WNPA 3TUCA 5HIBA 1Q3DA 2QKRA 2X7OA 2UW0A 3NX8A 1STCE 3AD4A 4RIXB 3ZRMA 3DAEA 4LFIA 2FVDA 3BV3A 4RWIA 5HEZA 1MQBA 1QPDA 3HDMA 4OBPA 2VX1A 2JEDA 5LVPA 3IGOA 3FV8A 1R0EA 4RVLA 1JNKA 5IUIA 1QL6A 4FG9A 4YJRA 4UZHA 4YJOA 4CRSA 1GY3A 3I4BA 4O1PA 4U3ZA 4I94A 3E8EA 3FYJX 1IRKA 3C9WA 3PE1A 3PXKA 1PMUA 4MEDA 1B39A 1SNUA 3UOKA 5HG5A 4Z16A 2HENA 1R39A 2C0OA 2ITXA 4GYGA 2F2UA 4ZTNA 3OP5A 5HO8A 4FEQA 3W1FA 1VR2A 2R3QA 4HNFA 5TF9A 2ZB1A 4WG4A 2G2IA 3H30A 5L6WL 4M8TA 3UVPA 3GQIA 1DS5A 3VHEA 3VUHA 4ZY4A 4AGDA 4C0TA 1LP4A 2J0LA 1P4OA 5AIKA 4M84A 4QPSA 3JVRA 2WTKC 1H1QA 4KBAA 1V0OA 4AA5A 1M7QA 1WBTA 4O27B 2PK9A 5HBHA 1F0QA 1ZYLA 2VTOA 2IW8A 5EKNA 2QVSE 4FV9A 3C4CA 4GK3A 4GK4A 3ZUUA 1Q61A 2QR8A 5AX9A 4IJPA 2XJ0A 4HVSA 4JVGA 5HE3A 1XH7A 3AC3A 1SMHA 2OI4X 3QKKA 3TKHA 2CJMA 5D7VA 1SVHA 4HCVA 3FMKA 3LM5A 4Y5QA 3R8ZA 5AAGA 3PYYA 5HVKA 5JT2A 1FMKA 2W4KA 5FEQA 2R4BA 4BZDA 2W0JA 1PYXA 5GZ9A 5DHJA 1UWJA 4QYHA 4QTCA 4TL0A 2YM4A 4EH6A 1V0BA 4B6LA 2UW4A 2VO3A 4Z3VA 4M69B 4F0GA 1BUHA 3Q4CA 2C6IA 2JAMA 1S9IA 4G3EA 2CN8A 1NVQA 3COHA 4J52A 3WOWA 4AZSA 4LGHA 4C35A 2X8EA 4BI0A 3QTZA 2XBAA 3ODZX 2QR7A 4GW8A 5HIDA 3MV5A 1W82A 4DLIA 4BDFA 4ZZOA 3TV7A 1W84A 2QU6A 4A07A 4F65A 4MVFA 5AP4A 2R3PA 3FPMA 3VS0A 3OWPA 2VWZA 1PMEA 2OFVA 2WO6A 2VTNA 3BCEA 2W06A 2X9EA 5IDNA 4I3ZA 4F9CA 5JH6A 4E3CA 2BAKA 3KXHA 3IS5A 3P0MA 2XIKA 2WTDA 2BDJA 4TYIA 3MH1A 2WTCA 1OVEA 2OWBA 4FKUA 5IF1A 5C8MA 3UP7A 1O6KA 3FL4A 4O0TA 2UZWE 2YJSA 3Q6UA 4LGGA 4NKSA 4ALUA 5IG1A 2UUEA 4ITHA 4P5ZA 3UYSA 4KABA 2R3LA 5E8ZA 1FGKA 4YR8A 4UB7A 3E5AA 3TTIA 5A9UA 3T9IA 1WMKA 4HJOA 1KE9A 2PZRA 1J1BA 3GCUA 2R3OA 3G6GA 3BYOA 5AP2A 4CT1A 2W1HA 3FMLA 5DMZA 5E90A 4WBOA 3I7BA 4GT3A 1SVGA 4MD7E 3UC4A 4A4LA 3MJ2A 2ZYBA 4BCQA 2XMYA 1V1KA 3I79A 3RHKA 4CZYB 4E4XA 1SNXA 3MA6A 4E6CA 1H0VA 3C0IA 4MAOA 4YC3A 2X4ZA 4CLJA 1ZOGA 3UYTA 1R1WA 4E20A 2GDOA 1XBBA 5H8EA 3O17A 4HVDA 2WKMA 3IOKA 5HI2A 1MP8A 5CS6A 1SM2A 3PE2A 3QQUA 4BBFA 4YBKA 4UMPA 4PMPA 1YKRA 3D83A 5BVKA 4EQCA 3PY1A 3MH2A 5CQWA 4OR5A 5DA3A 3ZU7A 4EBWA 3WYXA 3ZLYA 5JQ8A 5LVNA 1JQHA 3QBNA 4D4RA 3P23A 4FTMA 2BHEA 4IVDA 4AGWA 4MBLA 4PQNA 2A27A 5EFQA 5E7RA 4E5WA 1KOBA 3VBVA 3HRBA 4U43A 3EKNA 5KMLA 3FXZA 2RSVA 1UNGA 3BI6A 2VNWA 5AP5A 4N6ZA 3VS4A 5CU0A 3NDMA 3QXPA 5T6KA 3VUTA 4CT2A 1XR1A 3KCKA 4ZTLA 4H36A 2BMCA 5DN3A 2XCKA 4J96A 4QPMA 4WG5A 3OD6X 3KQ7A 2Y7JA 4YZBA 1J91A 5GJFA 4AN3A 3NUXA 3ALNA 2VN9A 2R7BA 3D5WA 3SV0A 4D1SA 5A14A 5LMBA 1Q99A 2YABA 3L9NA 4G3CA 4I5CA 4BL1A 2C47A 4D9TA 3GENA 3QTRA 3SC1A 4EK5A 1Q24A 2CDZA 3QTSA 2C30A 4EQMA 3HLLA 3CQEA 4RQVA 3QCXA 2GNHA 4C02A 4IAYA 4Y73A 4HVHA 4GYIA 2OBJA 3ET7A 2OW3A 5IUHA 5D9HA 3PJ8A 5EW9A 2WMUA 5CF6A 2YWPA 4CFVA 4U80A 2JBPA 4W4WA 3KN6A 4QMOA 3V01A 4I6QA 5CYIA 4OBQA 3FE3A 2W17A 1H27A 5EI8A 5DNRA 4S30A 4DEIA 5HTBA 4TNDA 3MJ1A 4ZSLA 2RF9A 5AUYA 4D0WA 3D7TA 2HZ4A 3ZEWA 3FHRA 2YCQA 3NYOA 2WMSA 4A06A 4ZLOA 3UNZA 3R9OA 4I21A 4FUYA 4DH1A 4KB8A 4AZWA 4FIGA 3A2CA 4BYIA 1M2RA 2CLXA 3WZDA 5AV1A 4FMQA 4RBLA 5AAFA 2VO6A 4U6RA 3WIKA 5M4FA 3GT8A 4AW2A 4RIYB 2BVAA 1VYZA 2UVYA 3QC9A 2B54A 2C5VA 2R3NA 3A8XA 3FAAA 4JDIA 1Q4LA 4YZNA 3DNEA 3DLZA 3NCZA 4FV3A 5HX6A 3FLSA 3PWDA 2BFYA 4X6RA 4U97A 5L2TA 4QMVA 5CEKA 4JNWA 3QZIA 4X0MA 4C3PA 4D1XA 2WHBA 2GNFA 2QO2A 2WD1A 3R9HA 4S34A 4UMUA 3PJCA 2XM9A 3ZFYA 4DINA 2W1DA 2OXDA 3DJ7A 3FZ1A 4I41A 4MNEB 3BHHA 3LFSA 4EH9A 4RIOA 4BF2A 2IVUA 4FZDB 4E5BA 1JSVA 2W9ZB 5KMOA 3OUKA 4IAFA 3ZM4A 4XX9A 2HXLA 1K3AA 3LW0A 4ZSGA 2ZV7A 4CCUA 2X81A 2XEYA 3R02A 5EW8A 5EDQA 3VO3A 4R3CA 4Y95A 1U5QA 3DB6A 2WB8A 2J50A 2WMAA 3ZZEA 1GZNA 4M69A 3TUBA 4V0GA 2B9FA 5FDPA 4XRLA 2BZHB 3F5GA 5AP1A 4GIHA 5AP7A 3TUDA 1GAGA 4EOJA 4IB5A 4FV8A 4FZ6A 2B9IA 2J5EA 5HU3A 1B38A 3LXNA 4P7EA 3NR9A 4L8MA 1URWA 4RFZA 4RX9A 5T3QA 3UP2A 3VAPA 5KO1A 4ZY6A 2G1TA 5J95A 4BTMA 4TKSA 4V01A 3W2OA 3ZEPA 2Y6MA 3DAKA 2WQBA 2UW3A 4K18A 2W7XA 2AC5A 2JGZA 2ZM3A 3DKCA 3VS6A 4QMZA 4C4IA 1YXXA 4O22A 2ZMDA 4RC2A 5CF8A 1OL6A 2QOOA 3OCTA 2VGPA 4JLCA 2A1AB 2R3JA 4GMYA 4GFMA 1NVRA 4UWCA 3UG1A 2ITZA 2J6MA 5C01A 4QT1A 1YXSA 4O2PA 3IW4A 3FMMA 4PL3A 2WMTA 4K77A 1FMOE 3QCQA 4EHGA 5A3XA 5AR5A 4D4VA 2YZAA 4EOQA 3I7CA 2V62A 3SRVA 2C6EA 3E8CA 3O0GA 4J71A 2YLEA 3O23A 4G6LA 4YJSA 1CKPA 1U59A 3K3IA 4KA3A 3RZBA 3E8NA 3GCPA 1OUKA 4NCTA 3PLSA 4L52A 4BCGA 5D41A 4BDBA 2V0DA 3PTGA 4BWXA 4EUUA 2JD5A 3GFWA 3D15A 4F0IA 5IISA 3RK5A 3IKAA 4QQJA 1W83A 3NEWA 3QC4A 4I23A 2X7GA 3DK6A 3RAKA 5F4NA 3EMGA 1RQQA 3DBEA 4PMMA 4BYJA 4XLIA 4N0SA 4F99A 4G3FA 3NIZA 2JC6A 5FP5A 3SXFA 4K9YA 2YACA 2O0UA 2AUHA 4U8ZA 4I93A 4RC4A 3FKNA 5I0BA 1FVRA 3V5PA 4BCFA 5I9UA 3LFFA 5EHYA 4QMPA 5AM6A 5A46A 4ZS0A 5BYYA 2WMRA 3UMWA 4C61A 2VWUA 4ANSA 4CD0A 5G1XA 3JXWA 4WUNA 3RTPA 1JSTA 4EK3A 4BIEA 4TWCA 1OECA 3ALOA 4XNEA 5ANDA 4D9UA 3UZTA 5HTIA 1O6YA 4DFYA 1U54A 4M15A 3D2IA 2ERZE 4FT9A 2W05A 4AE9A 2NP8A 2X1NA 2JFMA 5I3OA 2GU8A 5BVNA 4JBOA 4ANMA 2EXMA 3QKLA 3R63A 4ACCA 2C6KA 4RZVA 3JS2A 5B2MA 4Y83A 4E26A 4K8AA 2H9VA 3F61A 3V6RA 2RKUA 2ITWA 3KRXA 3BRBA 3ORNA 3PJ1A 4HVIA 4AE6A 4CRLA 3A7IA 1Q8TA 3H4JA 2PE0A 4J8NA 1JPAA 1Q8WA 5AR3A 5F20A 5J87A 4UYNA 5A4CA 3AC5A 3BYUA 2Z7RA 3MVMA 4DH7A 1KOAA 1ZARA 4FSMA 4M0ZA 4BCIA 4I6BA 2QG5A 3AT2A 3QYZA 4ZOGA 3FBVA 3NNXA 4D2WA 1YDRE 5L2SA 1XBAA 3GBZA 4GFGA 4MXXA 3WZKA 1A06A 3OBGA 3I6WA 1ZMVA 1JOWB 2XK6A 3AT3A 4W9WA 2P33A 3H0ZA 2WELA 3MVJA 1ZYDA 2XA4A 4IBMA 3FKOA 4F08A 5L3AA 3A4PA 4LRKA 2VTRA 2HYYA 4YHFA 3ORKA 3PVGA 5DRBA 3MDYA 1XKKA 3EQRA 1OITA 4DG2E 3AXWA 4DTKA 2BDFA 4PNKA 2UVXA 4IWOA 4E93A 5D10A 2JIVA 2Z7QA 2JIIA 4BVUA 3QRUA 2CGXA 4BIDA 4MNEA 2F57A 3CP9A 2R2PA 2YLFA 2HZIA 3K2LA 3MBLA 4IWQA 3QD3A 3O7LD 4PL4A 4PTCA 3HV3A 4ZTQA 5IA2A 4WSQA 3MGYA 4JJRA 4XG3A 4I0TA 2BROA 3ULIA 5JEBA 4EL9A 1XH4A 2OZAA 2PVHA 4AFEA 4RIYA 4BKJA 4CYIA 2J0KA 4BTKA 5JQ5A 1OZ1A 2QOKA 4OT6A 5J9LA 5I5ZA 3QD4A 5IZFA 3ZO1A 4FZAB 2BRGA 4RWJA 5DWRA 4FVQA 5K4IA 4LL5A 1QMZA 5M56A 3FLWA 5E8XA 5HESA 3DT1A 1H28A 1CM8A 2GS2A 3PIZA 3QA8A 3RHXA 4L3PA 2YCSA 2PVMA 3H9OA 3VUMA 2JAVA 4MWIA 4DEGA 3JYAA 4YZDA 3FSKA 2V7AA 3V5WA 5CENA 5HLWA 2VWVA 2YM7A 5AUVA 2ETRA 3PXQA 3D5XA 3HA6A 3KK8A 3TZMA 3ZBFA 3FQHA 4CVAA 3BE9A 2W9FB 3MY1A 3VBWA 2A0CX 3GU7A 2YCRA 4TRLA 4BGGA 4FKWA 2ITNA 3TJCA 3ZS5A 2IW9A 4CFXA 4EYJA 3FYKX 4L44A 5J9YA 4FV4A 4C7TA 4L01A 4PMSA 4TPTA 4CSVA 3F7WA 4YMJA 4RJ8A 2JKMA 3C4FA 2BAQA 3R30A 5EYDA 3I1AA 4F1TA 3M1SA 4XH6A 1G3NA 5IH5A 4FTAA 1GIJA 3NAXA 4L7FA 5HKMA 2FSLX 4IWDA 1W0XC 3BGPA 4MXCA 2HZNA 4YTFA 4ACHA 2F49A 1H8FA 3KULA 1PKDA 3O51A 4QMMA 3ELJA 4RWKA 1UNLA 1XHAA 5CNNA 5HO7A 4DHFA 2ZAZA 4RJ7A 4AX8A 3G9NA 5BX0A 2ZV2A 2QCSA 3FI4A 3GQLA 3H9RA 4IDTA 2PMLX 4C58A 2BHHA 3W2CA 2R3RA 4PL5A 1O6LA 4D2TA 4LRMA 2XRUA 4EH3A 2BFXA 4AG8A 1XQZA 4GL9A 5I4NA 4O91A 2WOTA 1IASA 1Y6BA 5KUPA 4BHZA 1R78A 3CBLA 4MXZA 5FLFA 1OKZA 3HECA 4ALVA 3Q5ZA 4OTGA 3F5UA 3UE4A 4DC2A 1M14A 2E2BA 4EOIA 2UW6A 4AZTA 3HV7A 4NM0A 3FZRA 2IJMA 3QTQA 2XNMA 4IZ5A 2OU7A 5E91A 5JK3A 5BUEA 3S4QA 4F9AA 1YHVA 1YVJA 3NNWA 2UZVA 4FTKA 3RPRA 5AJQA 1IA8A 2VTIA 3CPBA 2P3GX 1CDKA 3OCSA 4AOJA 4DFZE 3C4EA 5HTCA 2V5QA 4Y46A 3UODA 3D2KA 4GUEA 2IVTA 1CKIA 3EFJA 4J53A 2R3MA 3UGCA 2XF0A 2VWIA 3DKOA 3R00A 5DRDA 5A4EA 4OT5A 5FTQA 3VRZA 3ZUTA 2H96A 4FT3A 1BI7A 1DAWA 5CU6A 3K54A 3NLBA 2PVRA 2I0HA 2WTWA 4R5SA 5J5TA 4NFMA 3A61A 5FEEA 1PJKA 3FWQA 2WTVA 2YCFA 4KKHA 4TYGA 5AAEA 4CKJA 2ERKA 2V22A 3PSBA 3CTJA 2Y9QA 2CMWA 4OTFA 1GIHA 3O8PA 5CF4A 5EG3A 4PP7A 5CEIA 4FT5A 5H8BA 2F4JA 3VJOA 1Q62A 2WMBA 1QPJA 3Q04A 5CAUA 1UNHA 2I0YA 3O71A 2O3PA 1H25A 2HIWA 4UV0A 4O2ZA 3VS7A 1YDTE 2W96B 5TE0A 3O96A 4XYFA 5DEYA 1MRVA 5A4QA 5EHOA 1PHKA 2IVSA 1PF8A 1W8CA 4DN5A 4AT5A 4YJPA 3BYSA 4RFYA 3ZDIA 4GV1A 5J9ZA 2RG6A 4J97A 2P0CA 3TV6A 4KIKA 4U42A 2JDTA 4LRJA 4BCOA 3QZHA 3VVHA 5LMAA 4QQTA 2PE1A 3RVGA 4IEBA 3B8QA 3NUPA 4FYOA 2B9JA 4MTAA 4EHVA 4EZ5A 5I9XA 2X0GA 2QO9A 1H07A 4FGBA 4EEVA 3WBLA 4CTBA 5GJGA 3NUNA 1UU3A 3K5VA 3CQWA 4QYYA 4YPDA 3QTXA 5HNBA 3E62A 3C50A 5DG5A 4YJUA 2AYPA 3DZQA 2I40A 1Y8YA 2W1FA 2WZJA 3K5UA 1H01A 1DI9A 2C5OA 4G16A 4AS0A 4U44A 1GZ8A 3EYGA 4PMTA 4QTAA 4CKIA 2JBOA 3PSDA 1FPUA 2YIWA 5EDRA 3EFWA 2J0MB 4ZEGA 1FQ1B 5ANOA 4IANA 4IC8A 4MXOA 4OAVB 5IA3A 1ZY5A 2VTPA 3PP1A 4M13A 4D4YA 3UOJA 3MY5A 4ZK5A 3EB0A 3OFMA 3CC6A 3F88A 3UIMA 4RZWA 2Q0BA 4K0YA 4K1BA 5HLNA 4BDHA 5TR6A 5IKWA 4IX6A 1U4DA 2CGVA 3M42A 3PVUA 3TIZA 2VWXA 2O65A 4JL9A 4LMNA 4E4LA 2RL5A 2Z7SA 1K2PA 2YDKA 3N51A 2GHLA 2W1IA 2PZYA 3ZUVA 4AA4A 4H1JA 1AQ1A 2QHNA 3ZO2A 4DLJA 3HYHA 3HZTA 4GSBA 4MX9A 4WA9A 5IU2A 5JGAA 4KRDA 3LQ8A 2WAJA 4KD1A 3F3UA 4OLIA 3W2RA 2OIBA 3HEGA 3R1QA 5HICA 3DY7A 4FV7A 4XLVA 2XK4A 3Q53A 2WQNA 3E64A 5CQUA 4L3JA 4KSPA 3LMGA 5EI6A 4TW9A 3WE4A 3ZFMA 3UVQA 5CSXA 1M2PA 3CY3A 4M97A 2NPQA 4CFMA 4EK6A 1KV2A 5M57A 2R0IA 3UBDA 4EOMA 4MNFA 4FTLA 4WSYA 4WRGA 3RAIA 3P5KA 3V3VA 3EFKA 2GS7A 2ITTA 3M2WA 4QD6A 3RMFA 1E1XA 1RE8A 3VS5A 4EBVA 4ZY5A 4I5MA 1PY5A 3GC7A 4U0IA 3R04A 3BV2A 2GPHA 2F2CB 4U3YA 5H2UA 4Z55A 1YWNA 1RJBA 4HVGA 4IB1A 1ZRZA 4FKLA 4QRCA 5HZNA 4G2FA 3AMYA 5ANJA 3UPXA 3UQFA 3KXGA 2XK3A 3PVWA 4I0SA 2QURA 5LWNA 2Z7LA 5TO8A 5FP6A 2VX0A 3R22A 4Y85A 5AX3A 3UIBA 2E9UA 4R5YA 2FSTX 3DJ6A 5ACBC 3TZ7A 3MN3A 3W8LA 3ANQA 3F82A 5A6NA 5HCZA 1Y57A 2XK8A 5CAPA 2GTNA 3ZTXA 4QMUA 5L8LA 1NY3A 4USEA 1XBCA 4BWPA 5CXZA 1WFCA 3MSSA 2FO0A 3W8QA 4O0VA 3E63A 5KBRA 5KKRC 5I9ZA 4LL0A 2FH9A 2UV2A 5CVGA 4CKRA 4J95A 4TYHB 3G33A 5FQDC 1OIUA 2XIYA 2I6LA 3R7OA 4GS6A 3OG7A 2HW7A 3VIDA 1S9JA 3R1SA 5H9BA 3RPYA 3DNDA 4BC6A 4CNHA 3R9NA 3I5NA 4RIWB 3G51A 3QQGA 4PWNA 3EQIA 3LFBA 4W4YA 4B4LA 3KRLA 1Y91A 4YU2A 5JMSA 2OIDA 4K33A 2I0VA 4G3GA 4GT5A 4RJ4A 5HE2A 4DAWA 1ZXEA 5GHVA 1WAKA 5DLSA 3ACJA 3M11A 4KIKB 3VUKA 5EYCA 3BBTB 4YLLA 4G31A 4CZTA 5M4UA 5HGIA 2PZPA 2QOFA 4E5AX 2XNNA 3KXMA 4YHTA 4OTHA 2BZKB 4FTCA 2XNGA 3C13A 3HNGA 4YP8A 4Y5HA 2VX3A 2BIYA 5HU9A 1NXKA 4G1WA 3S00A 2ZVAA 4AXAA 4F0FA 4EH5A 2DUVA 2XP2A 3D5VA 5M44A 3QQHA 4NFNA 5JFXA 3LM0A 1WBOA 1PXPA 3B2WA 3Q2MA 3R83A 4BBMA 5M53A 4LUEA 3PWYA 2X6EA 5J1VA 3ZXTA 2OG8A 4CEGA 2RFSA 3VBQA 4QTDA 5CSWA 4AW5A 1GZKA 2ETMA 2BTRA 3WILA 5KNJA 4PF4A 2G01A 1H08A 4FL1A 4I1ZA 1KE6A 3OUNB 1JWHA 5KCVA 3PXRA 3HL7A 5AR8A 4TT7A 5LARA 2VO0A 4CZUA 3UNJA 3SW7A 4HGSA 4ITIA 1NVSA 4BKYA 3LPBA 4IX3A 2NO3A 3GVUA 4JRNA 4BHNA 4C4EA 4ONAA 3FC1X 3BLQA 5B2KA 4QOXA 3R0TA 1FINA 1PXLA 3AC1A 4CXAA 2BR1A 3WZJA 1PW2A 1O9UA 2GQGA 4NM7A 3ENMA 4FTJA 4DGGA 3R2BA 5HNGA 5FXRA 3VC4A 3BLRA 2P55A 4RLKA 4O96A 2YIQA 4I22A 2A19B 4KSQA 3GB2A 1YHSA 4D2RA 4I6FA 3Q4ZA 4NCTC 3PJ2A 5FDXA 4GG7A 4D2PA 1R3CA 4AZEA 1CKJA 3BELA 4FTQA 4PV0A 3UIXA 2XYUA 4M3QA 2ZDTA 4ZAUA 4EUTA 2E9OA 4ZZMA 3RM7A 4CFFA 3AD6A 2FSOX 3DB8A 4N70A 4EORA 2C4GA 2UZTA 4TN6A 4E6DA 3OXIA 4M12A 3QGYA 2HY81 3I6UA 4RVKA 4AZVA 5BVOA 4J98A 2C1BA 2C1AA 4I4FA 2UW9A 3BQRA 3V5LA 2Y4IC 3CLYA 4FIEA 3FUPA 4QMWA 4KS7A 3REPA 2C3IB 4XP2A 2ITVA 3VQHA 4DH8A 2CSNA 3EL7A 5AMNA 1KSWA 2PL0A 3QX4A 1QPCA 4NM5A 4M68A 5JGDA 3MB7A 5HHWA 4IAZA 4L46A 4EI4A 2GMXA 3QUPA 4E6AA 3UTOA 4GK2A 4AOTA 5HD4A 3ZH8A 4R1YA 1ATPE 2B52A 5GZ8A 4UMRA 3C0HA 5CAVA 2C3JA 1Z9XA 3Q96A 3LE6A 2Y6OA 5AR2A 5AR4A 4Z7HA 3GCVA 3OEZA 4V0GB 3DFAA 2O8YA 5K3YA 4LG4A 4EZ7A 2UW5A 3Q9WA 4AGUA 3FLQA 4QYGA 5J1WA 3NWWA 5BYZA 4AW1A 3QHRA 2BKZA 2BRBA 3U6JA 2VTQA 4JAJA 3R8PA 4FK3A 5JN2A 4A4XA 2XK7A 4O0SA 2W4OA 4ZSJA 3BYMA 4ASEA 3AC4A 3W33A 4CMOA 3DU8A 2CPKE 3TZ8A 4Q9ZA 2GNJA 3EQFA 3L1SA 5HG8A 3GNIB 1UWHA 2YISA 3EQHA 3P9JA 4JR7A 4JX3A 4FNZA 4HCTA 4EWQA 1XO2B 4MF0A 3VJNA 3EQCA 4S31A 3U8WA 4ASDA 3CR0A 2XNEA 3ZFXA 4QMXA 3ORLA 2EXEA 3DLSA 3SHEA 2FUMA 3W18A 2PVKA 5KZ0A 3LQ5A 1WZYA 2YFXA 4MQ1A 2ITYA 3DKGA 3DBCA 1E9HA 2A4LA 3W2SA 2GS6A 4DFXE 2J0IA 3IW8A 4CMTA 3GU8A 5C8KA 2HK5A 4TXCA 2XM8A 5EYMA 1TQMA 3OY1A 1ZLTA 4IVCA 5AP0A 2BDWA 2PMOX 4BDKA 4LQMA 3ZDUA 4DITA 2YDJA 4I5PA 2OSCA 3KKVA 1J3HA 4UWBA 3SRVB 3ORPA 5CAOA 5DIAA 3MH0A 3GC0A 4A9UA 3PIYA 2Y8OA 3P79A 4XCUA 3UO4A 5E1SA 4FKGA 4KWPA 3G0EA 3HUBA 5KMKA 3I0QA 3FZPA 1Q3WA 1UU9A 2J4ZA 4IZ7A 4ZIMA 1Z57A 4AU8A 4ZLZA 3GI3A 3ROYA 4J1RA 5HBEA 5AP6A 4AF3A 4D2SA 5DR2A 5EKOA 3A99A 4KINA 3ZZWA 4AAAA 3F5XA 2CLQA 2XRWA 3R1YA 4QNYA 3TJDA 3AC2A 3OMVA 4UWYA 3RNIA 4RPVA 5ETCA 4F9YA 4OTDA 3GU5A 4M14A 3EQPA 3FLNC 3TCPA 5E8VA 4NEUA 4B7TA 4PUZA 2WMVA 3OBJA 3BGZA 4Y72A 5HORA 4Z9LA 2FSMX 3O7LB 4F4PA 3PPKA 4N4SA 4JOAA 5J7BA 1VZOA 4S33A 5F94A 3QALE 3UQCA 4CQGA 2YITA 1KE7A 1Y6AA 3FZOA 3C1XA 2XKDA 2DYLA 4ANOA 2ZB0A 3LOKA 2HY0A 3PXFA 4OUCA 4IH8A 3UMXA 2BALA 4DGOA 4YHJA 2H8HA 2JFLA 3JY9A 4QO9A 1OL1A 2B53A 3EQBA 2R5TA 4W4XA 1YXVA 1VEBA 1UU7A 1DAYA 4I4EA 4IZYA 4X3FC 5DGZA 3V8TA 2RG5A 3LFCA 4MK0A 5HO6A 5LXMA 1H1PA 3PXZA 4HNIA 5AV3A 4DFNA 3OY3A 1PMNA 5ACKA 3TIYA 4ACDA 5L2IA 1P2AA 2CCHA 3DV3A 1U46A 3DPKA 2C6LA 2OICA 2LAVA 4O0WA 3COKA 1M2QA 4NIFB 1LEWA 4X7QA 2XVDA 1I09A 2G2FA 3G9LX 1YI6A 3MPTA 2GHMA 2WOUA 5E8WA 2B9HA 3LLTA 2JKOA 4L6QA 3NGAA 2C5XA 5K0KA 3OF0A 4Q5HA 4JDJA 4S2ZA 4GJ3A 4IM2A 3ACKA 5JRQA 4IX5A 4EH8A 1G5SA 4FL2A 3V5QA 2UW7A 4XMOA 4W8DA 5CZHA 5ETIA 3SXSA 4FSNA 4BDAA 4EC8A 3ZC6A 3O8UA 4FKIA 3ORIA 4F09A 2Y0AA 1ZY4A 4TTHB 4CFUA 3IDBA 4O38A 3U6HA 3E92A 4GT4A 4NIFA 4ZTSA 3WF5A 4KBCA 1PMVA 2KULA 3HRFA 3FL5A 3O2MA 5CVHA 2R0UA 1APME 3SDJA 1X8BA 5IA0A 2X8DA 3DS6A 4ERKA 3DBFA 5CXHA 3V8WA 4BIBA 2WIHA 3DAJA 4ASZA 2WMXA 3GC9A 4RG0A 4F63A 2RIOA 3IDCA 1WBPA 3IQ7A 2OK1A 3CD8A 3HX4A 5FM3A 4G5JA 3I81A 4KNBA 4RWLA 3DOGA 2IO6A 2YEXA 4C59A 2V55A 2QOHA 3QZGA 4DEBA 3QAME 4ZJIA 2QLQA 4UYAA 3HV5A 4EOSA 4F6SA 4Z7GA 3SLSA 3GCQA 3VUIA 4RX8A 4NJDA 1AD5A 2GNGA 2VGOA 4UY9A 3UVRA 3HUCA 4TWOA 1JLUE 5DT4A 5KBQA 5AM7A 2R3GA 2HAKA 2PMIA 3BQCA 3HRCA 1VJYA 3OROA 2QKWB 5E8UA 4NU1A 5AP3A 5HCXA 4BFMA 4I6HA 3UDBA 1ZOHA 3E3PA 5DH3A 3EZVA 1ZYSA 4EK8A 2YM8A 3RK7A 4A9SA 1OIYA 3AQVA 5M55A 4MCVA 1JSUA 2ZOQA 2WEVA 2HWOA 5LVOA 2B7AA 5AA9A 4BDCA 1TQPA 2NRUA 3AT4A 4YBJA 4JAIA 4XG8A 3TV4A 4X3FA 2J5FA 4F7LA 4FNWA 5CT7A 3TZ9A 4PX6A 2OO8X 3OVVA 2XH5A 2EB2A 4M0YA 5CU3A 3G90X 4CYJA 4G3DA 1RW8A 1JVPP 5AV2A 4IAIA 2HWPA 5I9WA 2R3HA 1JBPE 1OUYA 2HELA 4AZFA 3PUPA 4HPTE 4NT4A 3F2NA 1OL7A 2I0EA 3P4KA 4FT7A 4RMZA 3QKMA 3R7EA 5TKDA 4HGTA 1WBSA 2XUUA 3E3BX 4G34A 3KFAA 5LVMA 4ACGA 5CALA 2OXYA 4PPBA 3IDPA 1H00A 2KTYA 2O5KA 4C38A 1A9UA 1YRPA 4JI9A 1H1WA 2GFCA 2QNJA 3R71A 4FSTA 4RC3A 3IPHA 4FZ7A 4L43A 3FJQE 1Q41A 1H1RA 2P2IA 3LJ1A 4Q9SA 2PVFA 3FMNA 2XKCA 2R3KA 4FOBA 4R7HA 1REJA 4E73A 3Q52A 4LOQA 2G2HA 4DBNA 1VYWA 4BGQA 2QOIA 3V5TA 2QLUA 5LMKA 4X2JA 4XEYA 2C68A 4AFJA 4AA0A 4RIXA 5CI7A 4UZDA 4BI2A 2QOBA 4BICA 2VTTA 1MRYA 4ZTRA 2C5NA 4IC7A 4GIIA 1H1SA 5C03A 3FMEA 4GU9A 4L67A 1OKYA 3FMJA 3MWUA 2BIKB 5HVYA 4J8MA 4NW6A 5BUJA 4MBJA 5L6PA 4QP9A 5BUIA 2C3LA 2XS0A 4FSWA 4OTIA 3QLFA 4D2VA 3TWJA 3JVSA 4GUBA 3CXWA 3FY0A 2CGUA 4JXFA 2PTKA 3CD3A 4JDKA 3OTUA 4ZTHA 4HGLA 2PZ5A 3VWAA 5KHXA 3VUGA 3S0OA 2UZNA 5B7VA 4FV2A 4N6YA 3ZSIA 4XV1A 3COIA 2H6DA 2UZBA 3C4WA 4IFCA 4F6UA 1XWSA 1Q8YA 3DBDA 2XCHA 3LFEA 5HX8A 3DTWA 1BKXA 3MFUA 3HMMA 5HLPA 3CCNA 3EH9A 4JBVA 4FT0A 3MA3A 4QP7A 4A9YA 5CT0A 4TYHA 4TWNA 3LXPA 4L7SA 2OIQA 3TNIA 1JKTA 4TZRA 3E87A 3QTUA 4WKQA 5CASA 3GU6A 5KMJA 2YIXA 4BKZA 2GCDA 4F9WA 5LJJA 3MVLA 3KEXA 3ZCLA 1J1CA 4D28A 4FKTA 3E7OA 4J99A 4A4OA 1WVWA 3BWJA 4IX4A 3ULZA 2OKRA 3T8OA 2CN5A 3D0EA 4MYGA 4R3PA 2VWBA 3ENHA 4FUXA 4R3RA 3WE8A 4D1ZA 1PXIA 5L2QA 2PZIA 2ONLA 3QQLA 2VNYA 5EM5A 4WG3A 2XNPA 4HYSA 1H24A 3EL8A 1OKVA 4II5A 5KE0A 5JKGA 2YDIA 5EM6A 2R64A 4KKGA 3DXNA 2HZ0A 3H3CA 3H9FA 3PG3A 4IAAA 4YNEA 3DK3A 4YGAA 4IWPA 3VW6A 4ANNA 4DGLC 4YTCA 3SOAA 5IDPA 4RX7A 4UX9A 3WIGA 3ZRLA 3HMPA 5EH0A 3T3UA 4FTNA 2B1PA 3CEKA 3OS3A 3BLHA 4PP9A 4MD8E 2X39A 4P4CA 5J7HA 2XJ2A 2GFSA 3QWJA 1U54B 3PVBA 4I20A 3R7VA 3BU3A 2VV9A 4IACA 5DI1A 3P7CA 3QRTA 1ZAOA 3SAYA 4V05A 1RDQE 4F64A 3FY2A 5KMMA 3BHTA 4EOOA 4GJ2A 2XKEA 4JIAA 4RJ3A 4FR4A 3EN9A 3UPZA 2J2IB 3FC2A 3LHJA 1YOMA 4FBXA 1YWRA 3CY2A 4EJNA 5F95A 4WNKA 5E8TA 4WO5A 3OWJA 1DM2A 3CGFA 5AUUA 2PSQA 2UVZA 3TT0A 3LJ0A 1U5RA 5AUZA 2IW6A 3UOHA 5ETFA 3W10A 1OIQA 2BZJA 4IM3A 3ORTA 3QRJA 3HV6A 2UZLA 2W1EA 4JR3A 4LYNA 4ZSEA 5HIEA 3A7JA 3FI2A 2O63A 4X3FB 2YM6A 4FV6A 5JZNA 2XYNA 4XG7A 4KAOA 4IQ6A 4LMUA 3MB6A 4D5KA 5IA4A 1M7NA 1OL5A 2GNIA 1OIRA 2EU9A 4FICA 3VBYA 1YOLA 1BL6A 3I0OA 4H3QA 4R8QA 5ICPA 3PXYA 3A7FA 3VBTA 4KIPA 5FGKA 5HNIX 2EXCX 2C5YA 4FF8A 5DEWA 3HGKA 4G6NA 4LV8A 3QD2B 5KKRB 2NRYA 2OJIA 4OGRA 2G15A 2QU5A 5E8SA 3DJ5A 3IW7A 1YXTA 4FSZA 4GVJA 3S2PA 3F66A 4F6WA 3F69A 4DEHA 3KRJA 3L9PA 4ID7A 3BIZA 3PRIA 4IADA 2XIRA 3RWPA 3T9TA 4UN0C 2ESMA 4YSJA 3R7IA 4BDGA 1H0WA 4ZSAA 2PVLA 3V8SA 5IEYA 3PA4A 5FM2A 2EVAA 3OCGA 3RALA 3UZPA 3U51A 3UOLA 5DT0A 1XH9A 1TVOA 3ZLXA 4DGMA 1KE5A 3R9DA 3Q5IA 1HCLA 4RFMA 3ZHPC 4C37A 4G9CA 3DA6A 2FYSA 4LI5A 4U5JA 2W1GA 4YJNA 5JZJA 4R1VA 3KK9A 3ZLWA 4IDVA 3U4UA 3K3JA 3SVVA 4DEDA 2F7EE 3EN6A 2J0JA 2VWYA 3G6HA 4QP8A 3BHYA 4JG7A 3KL8A 4FV1A 4YZ9A 5L8KA 3SX9A 3RPOA 1FOTA 3ZC5A 4APCA 4AGCA 4YLKA 3TTJA 2JIUA 1ZZ2A 3A8WA 3L8PA 4IIRA 1LEZA 2PVNA 5DE2A 2PHKA 5IMEA 5K5XA 2YM3A 2GSFA 3Q6WA 3EZRA 2RFNA 3FHIA 4EHEA 3KXXA 3NSZA 4EKLA 4IVAA 2ACXA 4IHPA 4BCNA 4BCJA 4OBOA 2UZUE 4FSQA 5L8JA 3ZXZA 4X2GA 5CLPA 3DK7A 3N9XA 5BPYA 3BBWA 4FSUA 3C4ZA 4Q2AA 4AP7A 4FV0A 5CEOA 5HQ0A 5CZIA 3LVPA 4F7SA 3HP5A 3TKIA 3OC1A 4A9RA 1JKLA 1H26A 4E1ZA 4EKKA 1Z5MA 3FSFA 4FV5A 4LV5A 4ZLYA 5CEPA 4PRJA 3R28A 2ZDUA 4DCEA 5EM7A 4FOCA 2OJGA 3SD0A 3BEAA 3LCKA 5HVJA 1UKIA 1YHWA 3CKWA 3FXXA 4QMNA 3AGLA 1OGUA 3R6XA 3C5UA 1YWVA 4XS2A 4QP6A 5A4LA 4EZ3A 4RJ5A 4OTPA 3ZO3A 4YC6A 2E9VA 4DGNA 5CSVA 4UALA 1Q97A 4FIIA 2O64A 1UA2A 3TEIA 3PRFA 3R1NA 3Q3BA 2JITA 2XKFA 4O6LA 4B9DA 2VAGA 3GGFA 4Q5EA 4G17A 4WHZA 3HMOA 4CLIA 3COMA 3EFLA 2WGJA 1NA7A 3CQUA 5IH6A 4RVTA 4BCMA 2G9XA 2EB3A 4ENYA 5GJDA 3BPRA 5G6VA 4XP0A 1TKIA 1YI3A 5TT7A 3NNVA 3VF8A 1YW2A 2IZRA 3KCFA 4YZMA 2JDSA 5AADA 4JQ8A 2X2LA 3KVWA 2X6DA 4ZXTA 3EJ1A 2VZ6A 2FB8A 4OW8A 3QF9A 3A4OX 1FVVA 4QYFA 3NRMA 3MFTA 5CNOA 1BL7A 2J7TA 2OGVA 4EONA 2XJ1A 3DQWA 3KY2A 5LCKA 3R2YA 5C26A 3LAUA 1QCFA 4A9TA 4MD9E 4APPA 3MPMA 3PZEA 2QI8A 3KXZA 1ZYJA 5FRIA 5J8IA 3L8SA 4FKSA 4RJ6A 1OPJA 3RK9A 4I0RA 2HOGA 3OTVA 4QP4A 1WBNA 3MFRA 1OKWA 3OW4A 4BCPA 1ZOEA 2XEZA 4QP2A 1ZYCA 3DGKA 3NCGA 4QTEA 4RVMA 3SA0A 4WD5A 4AUAA 3UNKA 3V51A 4H3PA 1BMKA 4IB3A 3I60A 4FNYA 4DG3E 4RX5A 5TOZA 3OT8A 3ZMMA 2R9SA 4AWIA 1FVTA 4Y8DA 2PUUA 2GHGA 1XH6A 2WMQA 1YXUA 1R0PA 5E1EA 4YJVA 3DFCB 2W5HA 1OPLA 4CV9A 2C0TA 2X4FA 3QU0A 3TNHA 1IEPA 2BCJA 2W4JA 2VUWA 2HCKA 4CFNA 5AA8A 4ZJVA 1OL2A 2FGIA 3Q9ZA 5DBXA 2C6OA 4TYEA 2VD5A 3DDPA 2QD9A 4WT6A 4D0XA 5LMKC 3AG9A 2O2UA 3MIAA 1BI8A 4BZNA 3FDNA 4X3JA 2OJ9A 4C8BA 2Y4PA 3KA0A 2OF4A 4UMTA 3U6IA 3IECA 1DI8A 4JQEA 5M4IA 5K9IA 4L42A 2ETKA 4JG6A 5H8GA 5J79A 1IR3A 2VWWA 3GFEA 3U87A 3OCBA 5CTPA 4R7IA 2PE2A 3OWKA 3F3ZA 4HYHA 3MW1A 3MTLA 3CPCA 4YO4A 3QFVA 3TNWA 2RFDA 3KULB 3KRWA 1SYKA 1PXMA 4FKQA 5A4TA 1ZMUA 4QMTA 3CJFA 3PSCA 2WPAA 4XOZA 3SW4A 4PDOA 3MIYA 2EUFB 3BWFA 4L9IA 4U9AA 3MYGA 3CTHA 1ERKA 3P86A 1XH5A 4O6EA 3KGAA 4BRXA 1WBVA 3GP0A 4F9BA 2QOLA 4UEUA 3ITZA 5BVFA 4HYUA 4C2WA 3FPQA 2YAAA 3SQQA 2WQOA 4EWHA 4I24A 4BTJA 3A7GA 2C6DA 3QUDA 4OTWA 4IXPA 5AV4A 3R8MA 4MWHA 5EOLA 3R8LA 5JFWA 3EOCA 2OF2A 3NAYA 2YAKA 3OWLA 5LWMA 3QA0A 2B4SB 5CEQA 4PDPA 3QCSA 2ITOA 3QUEA 3TNPC 4KIQA 2C3KA 5HG7A 3IK3A 4WOVA 5K0XA 3GCSA 5IA1A 3C51A 3UC3A 4XV2A 4U81A 3HMIA 5M51A 3NUYA 4C3FA 4QQCA 3Q32A 4BGHA 4O1OA 2BAJA 4FODA 4AQCA 3NUSA 4NTSA 3Q60A 3LCSA 3E93A 5ITAA 1SVEA 2AC3A 4WBBB 5CWZA 3RKBA 4GVAA 4L3LA 4B0GA 3UO5A 3EKKA 4HZRA 4K11A 4IW0A 4TYJA 5FXSA 2P2HA 1CSNA 4NZWB 5BNJA 5CX9A 4FC0A 3QL8A 3EIDA 4FKRA 5C9CA 5A54A 4HOKA 3G2FA 4B8MA 5CANA 5K5NA 3AGMA 4MKCA 3VS3A 3RCJA 2PMNX 3LXLA 5ANGA 3VUDA 2IZUA 3F7ZA 1P5EA 3TXOA 4PPCA 4BDEA 3C7QA 4CV8A 3PG1A 1ZWSA 3T3VA 5I3RA 3ZLSA 3PY3A 4XHKB 1E1VA 3D5UA 2XB7A 5HE1A 2YIRA 1GIIA 5JRSA 4XOYA 3THBA 3O8TA 4AACA 2QODA 2E9PA 4S32A 3WZUA 1Q8ZA 5EM8A 4O0YA 2BILB 3NW7A 4FK6A 5FD2A 5EYKA 2F9GA 3B2TA 1OB3A 2DS1A 3IW6A 3NPCA 4H3BA 3TNQB 3BEGA 2YERA 3ERKA 3W2QA 5CF5A 2REIA 2UZDA 2XK9A 3BU5A 4NH1A 5JFSA 4P90A 4QNAA 4RT7A 3RINA 5IEXA 1L3RE 1WVYA 4XG6A 3NYNA 2IZSA 2B55A 3QCYA 4BBEA 2C6MA 3FMDA 5A6OA 3NIEA 3U9CA 3C0GA 3RBWA 2PVYA 3E7VA 2ZV9A 4BI1A 3C4XA 3EN7A 3PY0A 1ZMWA 2ITPA 3CJGA 3R8UA 3MI9A 3VW8A 2LGCA 3DTCA 4FA2A 3FI3A 4BB4A 4B8LA 3ORMA 4RIWA 4D4SA 2OFUA 2VTLA 2YIYA 5FBOA 4KS8A 4ARKA 1Y8GA 2BZIB 3FZTA 3LFNA 2QC6A 4K2RA 2C69A 3KRRA 4FSYA 3ORZA 4RLLA 3VBXA 4DEEA 5C8NA 5IH4A 3V04A 2OZAB 4GG5A 4XG4A 4HCUA 4RRVA 4BDJA 3BGQA 4FIFA 5LQFA 1Q8UA 5KMIA 4QP3A 5HG9A 5BQ0A 1LPUA 4FL3A 4BWKA 3Q9XA 4FKPA 3QLGA 3PA5A 3WI6A 2QHMA 4FKOA 4F1OA 3DDQA 5JGBA 2ITQA 3NYVA 3L8XA 4E4MA 2W5AA 3PJ3A 4C4FA 3TACA 4UXQA 3F3TA 5GNKA 5CEMA 1T46A 3RGFA 2I1MA 3S1HA 4C2VA 3RAWA 3LZBA 3L8VA 5AV0A 4O0UA 5I9YA 3E8DA 2HXQA 2X9FA 2YJRA 3VS1A 2DQ7X 1Q5KA 4FIHA 4NWMA 5AUWA 2QONA 4ANQA 4HPUE 3PA3A 4XBUA 3NUUA 2VTAA 3SXRA 4FNXA 4ITJA 5M4CA 4RSSA 2XIZA 3BE2A 4JG8A 3OW3A 3ZYAA 3W32A 3VRYA 5CI6A 3KB7A 3QWKA 4ALWA 3FLZA 3JPVA 3MY0A 2WNTA 3OXZA 1TQIA 3OOGA 5AEPA 2XNOA 3V5JA 2P4IA 2VTSA 3KC3A 4FTTA 4P5QA 4FG8A 4FVRA 4MQ2A 2RFEA 3UG2A 3QTWA 5CVFA 4WUAA 1JKSA 3FXWA 1OMWA 3NS9A 5KHWA 2OH0E 5DR9A 3PP0A 3CE3A 1PXOA 2WTIA 3NZ0A 3O50A 4FIJA 4H58A 4QMYA 3U4WA 4EOPA 4USFA 3MS9A 1OM1A 4CCBA 4LUDA 3LIJA 5BVDA 3OEFX 2Z8CA 5AUXA 2R3FA 4LGDA 2ZM1A 3W16A 4YPSA 4XUFA 4BCKA 2GTMA 2WFYA 2PY3A 4X2KA 4TNBA 5DPVA 5EI2A 4PNIA 3DZOA 5ANEA 4FYNA 5D12A 4QQ5A 4LOPA 3POOA 2ZJWA 4U40A 1GNGA 2YN8A 4NM3A 5FEDA 3RWQA 4ANBA 2ZM4A 3LFAA 2CCIA 3ZRKA 3D94A 4IE9A 4AN9A 3ZSHA 3ANRA 4C3RA 2WIPA 4QTBA 3ROCA 4ERWA 4MXYA 4M67A 5HBJA 3ZO4A 3UIUA 4FTIA 5EOBA 3AOXA 3HA8A 4CTCA 2RGPA 5AIRA 3H0YA 1XH8A 3RCDA 4NK9A 4I5HA 5HD7A 3DCVA 3P78A 4X2FA 4EH4A 3R7GA 4NJ3A 3SKCA 4YJTA 5F9EA 5IEVA 3RAHA 4C57A 4DFLA 4G6OA 3WF9A 2CGWA 4BCHA 3HP2A 4EOLA 2WU7A 2VTJA 3QQKA 4ANLA 4KBKA 2FA2A 3D7ZA 4JT3A 4XV9A 5T68A 4GRBA 3SOCA 5B2LA 2JKQA 2JDVA 2WTKB 3VS2A 4XG2A 2X2MA 2QOCA 4PPAA 4GEOA 4QP1A 3KXNA 3H10A 3MFSA 5FBNC 4C4HA 4E8AA 4AW0A 4EK4A 4QYEA 1W98A 2SRCA 5ANKA 4IZAA 3QRKA 3LCOA 3E88A 4WIHA 4GU6A 3FZSA 4LOOA 3R8VA 3ZBXA 5IA5A 3TL8A 2WU6A 3AC8A 1M17A 3UO6A 5CSPA 5GZAA 2YM5A 1FGIA 3P1AA 4LM5A 3KN5A 4FSRA 2XBJA 5EW3A 3RJCA 3ODYX 3R73A 1EH4A 4JBPA 1BYGA 3RI1A 3F5PA 1JKKA 3EQGA 3GUBA 5B0XA 3NW5A 2OZOA 5CSHA 1F5QA 2C0IA 2WEIA 2WMWA 5FG8A 5KZIA 3W55A 4G5PA 3RNYA 4C4JA 1PYEA 3CKXA 3EQDA 4D55A 5DFPA 2Q0NA 5IMXA 1KWPA 3PFQA 1K9AA 2H34A 3HV4A 4IVBA 3VULA 3L9LA 4JS8A 3HKOA 2JDOA 5KMNA 3TG1A 3D7TB 4UBAA 1QPEA 3A60A 3GEQA 2ONLC 2JLDA 4YUQA 3FQEA 3CGOA 4RGJA 4CFWA 3QQJA 1KV1A 4OTRA 4NW5A 3OHTA 3ETAA 3I5ZA 4KIOA 3KMWA 3KF7A 4AOIA 4BTFA 5LCJA 2A2AA 4B99A 2HW6A 4XRJA 4L45A 1URCA 4FZFB 3QYWA 1YQJA 2BRHA 4F7JA 2VO7A 4JIKA 4X2NA 4PTGA 3HMNA 4AT3A 3OZ6A 4HYIA 3TN8A 5H3QA 3FLYA 4EC9A 3BYVA 4YZCA 3VQUA 4RQKA 1F3MC 3Q4TA 1MQ4A 4MHAA 4IB0A 4WNMA 3P08A 3GOKA 1I44A 2VTMA 5ETAA 3R7YA 4EOKA 4BDDA 4E4NA 4EYMA 4XP3A 5EHLA 3VHKA 1UVRA 5FXQA 4QPAA 5HOAA 3MH3A 5BVWA 2Y4IB 3L9MA 2X8IA 5DR6A 4HW7A 4CQEA 3F2AA 4GH2A 1T45A 2F7XE 3DBQA 3KF4A 3F3WA 4M7IA 4EH2A 3UJGA 3OT3A 1YDSE 3EN5A 1MRUA 4DG0E 4ENXA 4IAKA 5BMMA 1CTPE 1CMKE 2OJFE 3F6XA 3GU4A 2WTJA 2OJJA 2EWAA 4U7ZA 4W4VA 5HCYA 3GXLA 3BZ3A 4L53A 4XG9A 1LR4A 5DT3A 3WF6A 4YNOA 2JKKA 1PXJA 2XIXA 3S3IA 2QOQA 4L00A 4YTHA 5D11A 4GCJA 2IVVA 3ZOSA 5FTOA 4RA4A 5J5SA 1ZZLA 1GZOA 2IN6A 4BN1A 3IOPA 3R01A 3QXOA 4EH7A 1UU8A 1MUOA 2XNBA 5JSMA 3R7UA 5L4QA 4F7NA 3P7AA 3WF8A 2VTHA 2X7FA 3KMMA 3KVXA 2V7OA 2Z2WA 3G0FA 4I92A 3CIKA 4FTUA 4W8EA 4F70A 3B8RA 5IUGA 3IO7A 2UZOA 1WBWA 2UW8A 4X21A 1LUFA 1OPKA 4YJQA 5E92A 3BKBA 3ZONA 2DWBA 4E7WA 2ZV8A 4IFGA 2CKEA 3EWHA 4MBIA 4MXAA 3QX2A 5AUTA 1OI9A 4FG7A 4C34A 3EYHA 3F9NA 5CAQA 3LCTA 2GNLA 2ITUA 4H39A 4UXLA 4R6VA 4FTRA 1UV5A 3LXKA 4AN2A 1V0PA 3MTFA 3AD5A 4KKEA 4OAUC 4FKJA 4U79A 3DQXA 4EQUA 1HCKA 3A62A 4J7BA 5BMSA 4K6ZA 3TI1A 1SZMA 3CTQA 3OXTA 2QO7A 3LJ2A 3GC8A 5FWKK 3NNUA 4USDA 2YA9A 1B6CB 3QHWA 4M66A 2W99B 4MH7A 2R7IA 3ZSGA 3EN4A 3QZFA 3AMAA 4F1MA 4EHZA 5LVLA 3BHVA 1PXKA 2YHVA 3BHUA 3NYXA 4U41A 2PVJA 3HVCA 3RPSA 2J90A 1HOWA 4FX3A 3D9VA 2BRNA 3QRIA 3DKFA 4ZP5A 4PTEA 3V6SA 4C33A 2IWIA 3II5A 3TKUA 4C62A 3RPVA 5DVRA 3RZFA 4H1MA 1PKGA 5LOHA 4DH5A 3IGGA 3IG7A 3CS9A 3QQFA 4NTTA 4AT4A 4IJ9A 1GJOA 1XJDA 4WNOA 5CU4A 4YTIA 5ANIA 2W1CA 3PZHA 2WXVA 2VRXA 4MF1A 3W2PA 1P4FA 1GOLA 3VF9A 4JQ7A 2X2KA 3BX5A 3Q9YA 5EDPA 4NKAA 5L6OA 1WVXA 3QD0A 4UMQA 2BTSA 1JAMA 4IMYA 2PWLA 3MPAA 2BPMA 2CHLA 3F3VA 3UQGA 1WCCA 3FMHA 5C1QB 4GFOA 3MVHA 4ZJJA 1KE8A 4ZTMA 5C27A
chains in the Genus database with same CATH superfamily
1IG1A 5F1ZA 4DEAA 5K4JA 3NW6A 2W5BA 3AMBA 2VU3A 3OOMA 1YI4A 3R21A 4JRVA 4W9XA 1UKHA 3PIXA 2WQMA 4X6QC 5DOSA 3QTIA 4CMUA 3VN9A 5IPJA 5JFVA 3G5DA 2OH4A 2W1ZA 3WYYA 4V04A 4RA5A 1PXNA 2J51A 3HDNA 4WRSA 4ASXA 5BVEA 4G9RA 2UZEA 3KU2A 5AR7A 3FKLA 4L68A 3WF7A 4QMQA 2OXXA 3D14A 3JUHA 4NUSA 5E8YA 1H4LA 4U45A 3A7HA 4O0XA 4PY1A 4TWPA 2F7ZE 4NSTA 4ZZNA 4YURA 3PPJA 4D5HA 4YO6A 4DYMA 3BU6A 3ORXA 4JBQA 3LFQA 3IW5A 4O21A 2QQ7A 5HE0A 1P14A 4YSMA 4KRCA 5KX8A 4IM0A 3S95A 3EHAA 4E6QA 4FVPA 1BX6A 1AGWA 3QGWA 3GOPA 2C6TA 5D1JA 4D58A 4BZOA 3WZEA 4OTQA 4YC8A 2J9MA 4DH3A 4TY1A 3D4QA 4BDIA 1W7HA 3IONA 3P7BA 4FI1A 5AWMA 5I9VA 4P2KA 4HGEA 4XBRA 5EK7A 2BUJA 4A7CA 3PPZA 5CY3A 3JY0A 4ACMA 3RP9A 4YLJA 4QMLA 5L2WA 3LCDA 4FKVA 4FTOA 4PDSA 3RM6A 2R3IA 1M52A 2XZSA 2BRMA 4XV3A 2WQEA 4XJ0A 5D7AA 1BLXA 2Z60A 4C36A 3Q4UA 1REKA 2IZTA 3KMUA 5CU2A 4JDHA 2JDRA 4JX7A 4QMSA 3VNTA 1YOJA 2E9NA 4O0RA 4HZSA 2ZMCA 3POZA 3U9NA 3WARA 4C4GA 3LFDA 3FQSA 4WNPA 3TUCA 5HIBA 1Q3DA 2QKRA 2X7OA 2UW0A 3NX8A 1STCE 3AD4A 4RIXB 3ZRMA 3DAEA 4LFIA 2FVDA 3BV3A 4RWIA 5HEZA 1MQBA 1QPDA 3HDMA 4OBPA 2VX1A 2JEDA 5LVPA 3IGOA 3FV8A 1R0EA 4RVLA 1JNKA 5IUIA 1QL6A 4FG9A 4YJRA 4UZHA 4YJOA 4CRSA 1GY3A 3I4BA 4O1PA 4U3ZA 4I94A 3E8EA 3FYJX 1IRKA 3C9WA 3PE1A 3PXKA 1PMUA 4MEDA 1B39A 1SNUA 3UOKA 5HG5A 4Z16A 2HENA 1R39A 2C0OA 2ITXA 4GYGA 2F2UA 4ZTNA 3OP5A 5HO8A 4FEQA 3W1FA 1VR2A 2R3QA 4HNFA 5TF9A 2ZB1A 4WG4A 2G2IA 3H30A 5L6WL 4M8TA 3UVPA 3GQIA 1DS5A 3VHEA 3VUHA 4ZY4A 4AGDA 4C0TA 1LP4A 2J0LA 1P4OA 5AIKA 4M84A 4QPSA 3JVRA 2WTKC 1H1QA 4KBAA 1V0OA 4AA5A 1M7QA 1WBTA 4O27B 2PK9A 5HBHA 1F0QA 1ZYLA 2VTOA 2IW8A 5EKNA 2QVSE 4FV9A 3C4CA 4GK3A 4GK4A 3ZUUA 1Q61A 2QR8A 5AX9A 4IJPA 2XJ0A 4HVSA 4JVGA 5HE3A 1XH7A 3AC3A 1SMHA 2OI4X 3QKKA 3TKHA 2CJMA 5D7VA 1SVHA 4HCVA 3FMKA 3LM5A 4Y5QA 3R8ZA 5AAGA 3PYYA 5HVKA 5JT2A 1FMKA 2W4KA 5FEQA 2R4BA 4BZDA 2W0JA 1PYXA 5GZ9A 5DHJA 1UWJA 4QYHA 4QTCA 4TL0A 2YM4A 4EH6A 1V0BA 4B6LA 2UW4A 2VO3A 4Z3VA 4M69B 4F0GA 1BUHA 3Q4CA 2C6IA 2JAMA 1S9IA 4G3EA 2CN8A 1NVQA 3COHA 4J52A 3WOWA 4AZSA 4LGHA 4C35A 2X8EA 4BI0A 3QTZA 2XBAA 3ODZX 2QR7A 4GW8A 5HIDA 3MV5A 1W82A 4DLIA 4BDFA 4ZZOA 3TV7A 1W84A 2QU6A 4A07A 4F65A 4MVFA 5AP4A 2R3PA 3FPMA 3VS0A 3OWPA 2VWZA 1PMEA 2OFVA 2WO6A 2VTNA 3BCEA 2W06A 2X9EA 5IDNA 4I3ZA 4F9CA 5JH6A 4E3CA 2BAKA 3KXHA 3IS5A 3P0MA 2XIKA 2WTDA 2BDJA 4TYIA 3MH1A 2WTCA 1OVEA 2OWBA 4FKUA 5IF1A 5C8MA 3UP7A 1O6KA 3FL4A 4O0TA 2UZWE 2YJSA 3Q6UA 4LGGA 4NKSA 4ALUA 5IG1A 2UUEA 4ITHA 4P5ZA 3UYSA 4KABA 2R3LA 5E8ZA 1FGKA 4YR8A 4UB7A 3E5AA 3TTIA 5A9UA 3T9IA 1WMKA 4HJOA 1KE9A 2PZRA 1J1BA 3GCUA 2R3OA 3G6GA 3BYOA 5AP2A 4CT1A 2W1HA 3FMLA 5DMZA 5E90A 4WBOA 3I7BA 4GT3A 1SVGA 4MD7E 3UC4A 4A4LA 3MJ2A 2ZYBA 4BCQA 2XMYA 1V1KA 3I79A 3RHKA 4CZYB 4E4XA 1SNXA 3MA6A 4E6CA 1H0VA 3C0IA 4MAOA 4YC3A 2X4ZA 4CLJA 1ZOGA 3UYTA 1R1WA 4E20A 2GDOA 1XBBA 5H8EA 3O17A 4HVDA 2WKMA 3IOKA 5HI2A 1MP8A 5CS6A 1SM2A 3PE2A 3QQUA 4BBFA 4YBKA 4UMPA 4PMPA 1YKRA 3D83A 5BVKA 4EQCA 3PY1A 3MH2A 5CQWA 4OR5A 5DA3A 3ZU7A 4EBWA 3WYXA 3ZLYA 5JQ8A 5LVNA 1JQHA 3QBNA 4D4RA 3P23A 4FTMA 2BHEA 4IVDA 4AGWA 4MBLA 4PQNA 2A27A 5EFQA 5E7RA 4E5WA 1KOBA 3VBVA 3HRBA 4U43A 3EKNA 5KMLA 3FXZA 2RSVA 1UNGA 3BI6A 2VNWA 5AP5A 4N6ZA 3VS4A 5CU0A 3NDMA 3QXPA 5T6KA 3VUTA 4CT2A 1XR1A 3KCKA 4ZTLA 4H36A 2BMCA 5DN3A 2XCKA 4J96A 4QPMA 4WG5A 3OD6X 3KQ7A 2Y7JA 4YZBA 1J91A 5GJFA 4AN3A 3NUXA 3ALNA 2VN9A 2R7BA 3D5WA 3SV0A 4D1SA 5A14A 5LMBA 1Q99A 2YABA 3L9NA 4G3CA 4I5CA 4BL1A 2C47A 4D9TA 1W2CA 3GENA 3QTRA 3SC1A 4EK5A 1Q24A 2CDZA 3QTSA 2C30A 4EQMA 3HLLA 3CQEA 4RQVA 3QCXA 2GNHA 4C02A 4IAYA 4Y73A 4HVHA 4GYIA 2OBJA 3ET7A 2OW3A 5IUHA 5D9HA 3PJ8A 5EW9A 2WMUA 5CF6A 2YWPA 4CFVA 4U80A 2JBPA 4W4WA 3KN6A 4QMOA 3V01A 4I6QA 5CYIA 4OBQA 3FE3A 2W17A 1H27A 5EI8A 5DNRA 4S30A 4DEIA 5HTBA 4TNDA 3MJ1A 4ZSLA 2RF9A 5AUYA 4D0WA 3D7TA 2HZ4A 3ZEWA 3FHRA 2YCQA 3NYOA 2WMSA 4A06A 4ZLOA 3UNZA 3R9OA 4I21A 4FUYA 4DH1A 4KB8A 4AZWA 4FIGA 3A2CA 4BYIA 1M2RA 2CLXA 3WZDA 5AV1A 4FMQA 4RBLA 5AAFA 2VO6A 4U6RA 3WIKA 5M4FA 3GT8A 4AW2A 4RIYB 2BVAA 1VYZA 2UVYA 3QC9A 2B54A 2C5VA 2R3NA 3A8XA 3FAAA 4JDIA 1Q4LA 4YZNA 3DNEA 3DLZA 3NCZA 4FV3A 5HX6A 3FLSA 3PWDA 2BFYA 4X6RA 4U97A 5L2TA 4QMVA 5CEKA 4JNWA 3QZIA 4X0MA 4C3PA 4D1XA 2WHBA 2GNFA 2QO2A 2WD1A 3R9HA 4S34A 4UMUA 3PJCA 2XM9A 3ZFYA 4DINA 2W1DA 2OXDA 3DJ7A 3FZ1A 4I41A 4MNEB 3BHHA 3LFSA 4EH9A 4RIOA 4BF2A 2IVUA 4FZDB 4E5BA 1JSVA 2W9ZB 5KMOA 3OUKA 4IAFA 3ZM4A 4XX9A 2HXLA 1K3AA 3LW0A 4ZSGA 2ZV7A 4CCUA 2X81A 2XEYA 3R02A 5EW8A 5EDQA 3VO3A 4R3CA 4Y95A 1U5QA 3DB6A 2WB8A 2J50A 2WMAA 3ZZEA 1GZNA 4M69A 3TUBA 4V0GA 2B9FA 5FDPA 4XRLA 2BZHB 3F5GA 5AP1A 4GIHA 5AP7A 3TUDA 1GAGA 4EOJA 4IB5A 4FV8A 4FZ6A 2B9IA 2J5EA 5HU3A 1B38A 3LXNA 4P7EA 3NR9A 4L8MA 1URWA 4RFZA 4RX9A 5T3QA 3UP2A 3VAPA 5KO1A 4ZY6A 2G1TA 5J95A 4BTMA 4TKSA 4V01A 3W2OA 3ZEPA 2Y6MA 3DAKA 2WQBA 2UW3A 4K18A 2W7XA 2AC5A 2JGZA 2ZM3A 3DKCA 3VS6A 4QMZA 4C4IA 1YXXA 4O22A 2ZMDA 4RC2A 5CF8A 1OL6A 2QOOA 3OCTA 2VGPA 4JLCA 2A1AB 2R3JA 4GMYA 4GFMA 1NVRA 4UWCA 3UG1A 2ITZA 2J6MA 5C01A 4QT1A 1YXSA 4O2PA 3IW4A 3FMMA 4PL3A 2WMTA 4K77A 1FMOE 3QCQA 4EHGA 5A3XA 5AR5A 4D4VA 2YZAA 4EOQA 3I7CA 2V62A 3SRVA 2C6EA 3E8CA 3O0GA 4J71A 2YLEA 3O23A 4G6LA 4YJSA 1CKPA 1U59A 3K3IA 4KA3A 3RZBA 3E8NA 3GCPA 1OUKA 4NCTA 3PLSA 4L52A 4BCGA 5D41A 4BDBA 2V0DA 3PTGA 4BWXA 4EUUA 2JD5A 3GFWA 3D15A 4F0IA 5IISA 3RK5A 3IKAA 4QQJA 1W83A 3NEWA 3QC4A 4I23A 2X7GA 3DK6A 3RAKA 5F4NA 3EMGA 1RQQA 3DBEA 4PMMA 4BYJA 4XLIA 4N0SA 4F99A 4G3FA 3NIZA 2JC6A 5FP5A 3SXFA 4K9YA 2YACA 2O0UA 2AUHA 4U8ZA 4I93A 4RC4A 3FKNA 5I0BA 1FVRA 3V5PA 4BCFA 5I9UA 3LFFA 5EHYA 4QMPA 5AM6A 5A46A 4ZS0A 5BYYA 2WMRA 3UMWA 2IF8A 4C61A 2VWUA 4ANSA 4CD0A 5G1XA 3JXWA 4WUNA 3RTPA 1JSTA 4EK3A 4BIEA 4TWCA 1OECA 3ALOA 4XNEA 5ANDA 4D9UA 3UZTA 5HTIA 1O6YA 4DFYA 1U54A 4M15A 3D2IA 2ERZE 4FT9A 2W05A 4AE9A 2NP8A 2X1NA 2JFMA 5I3OA 2GU8A 5BVNA 4JBOA 4ANMA 2EXMA 3QKLA 3R63A 4ACCA 2C6KA 2X0OA 4RZVA 3JS2A 5B2MA 4Y83A 4E26A 4K8AA 2H9VA 3F61A 3V6RA 2RKUA 2ITWA 3KRXA 3BRBA 3ORNA 3PJ1A 4HVIA 4AE6A 4CRLA 3A7IA 4O4CA 1Q8TA 3H4JA 2PE0A 4J8NA 1JPAA 1Q8WA 5AR3A 5F20A 5J87A 4UYNA 5A4CA 3AC5A 3BYUA 2Z7RA 3MVMA 4DH7A 1KOAA 1ZARA 4FSMA 4M0ZA 4BCIA 4I6BA 2QG5A 3AT2A 3QYZA 4ZOGA 3FBVA 3NNXA 4D2WA 1YDRE 5L2SA 1XBAA 3GBZA 4GFGA 4MXXA 3WZKA 1A06A 3OBGA 3I6WA 1ZMVA 1JOWB 2XK6A 3AT3A 4W9WA 2P33A 3H0ZA 2WELA 3MVJA 1ZYDA 2XA4A 4IBMA 3FKOA 4F08A 5L3AA 3A4PA 4LRKA 2VTRA 2HYYA 4YHFA 3ORKA 3PVGA 5DRBA 3MDYA 1XKKA 3EQRA 1OITA 2IEWA 4DG2E 3AXWA 4DTKA 2BDFA 4PNKA 2UVXA 4IWOA 4E93A 5D10A 2JIVA 2Z7QA 2JIIA 4BVUA 3QRUA 2CGXA 4BIDA 4MNEA 2F57A 3CP9A 2R2PA 2YLFA 2HZIA 3K2LA 3MBLA 4IWQA 3QD3A 3O7LD 4PL4A 4PTCA 3HV3A 4ZTQA 5IA2A 4WSQA 3MGYA 4JJRA 4XG3A 4I0TA 2BROA 3ULIA 5JEBA 4EL9A 1XH4A 2OZAA 2PVHA 4AFEA 4RIYA 4BKJA 4CYIA 2J0KA 4BTKA 5JQ5A 1OZ1A 2QOKA 4OT6A 5J9LA 5I5ZA 3QD4A 5IZFA 3ZO1A 4FZAB 2BRGA 4RWJA 5DWRA 4FVQA 5K4IA 4LL5A 1QMZA 5M56A 3FLWA 5E8XA 1W2FA 5HESA 3DT1A 1H28A 1CM8A 2GS2A 3PIZA 3QA8A 3RHXA 4L3PA 2YCSA 2PVMA 3H9OA 3VUMA 2JAVA 4MWIA 4DEGA 3JYAA 4YZDA 3FSKA 2V7AA 3V5WA 5CENA 5HLWA 2VWVA 2YM7A 5AUVA 2ETRA 3PXQA 3D5XA 3HA6A 3KK8A 3TZMA 4FRFA 3FQHA 3ZBFA 4CVAA 3BE9A 2W9FB 3MY1A 3VBWA 2A0CX 3GU7A 2YCRA 4TRLA 4BGGA 4FKWA 2ITNA 3TJCA 3ZS5A 2IW9A 4CFXA 4EYJA 3FYKX 4L44A 5J9YA 4FV4A 4C7TA 4L01A 4PMSA 4TPTA 4CSVA 3F7WA 4YMJA 4RJ8A 2JKMA 3C4FA 2BAQA 3R30A 5EYDA 3I1AA 4F1TA 3M1SA 4XH6A 1G3NA 5IH5A 4FTAA 1GIJA 3NAXA 4L7FA 5HKMA 2FSLX 4IWDA 1W0XC 3BGPA 4MXCA 2HZNA 4YTFA 4ACHA 2F49A 1H8FA 3KULA 1PKDA 3O51A 4QMMA 3ELJA 4RWKA 1UNLA 1XHAA 5CNNA 5HO7A 4DHFA 2ZAZA 4RJ7A 4AX8A 3G9NA 5BX0A 2ZV2A 2QCSA 3FI4A 3GQLA 3H9RA 4IDTA 2PMLX 4C58A 2BHHA 3W2CA 2R3RA 4PL5A 1O6LA 4D2TA 4LRMA 2XRUA 4EH3A 2BFXA 4AG8A 1XQZA 4GL9A 5I4NA 4O91A 2WOTA 1IASA 1Y6BA 5KUPA 4BHZA 1R78A 3CBLA 4MXZA 5FLFA 1OKZA 3HECA 4ALVA 3Q5ZA 4OTGA 3F5UA 3UE4A 4DC2A 1M14A 2E2BA 4EOIA 2UW6A 4AZTA 3HV7A 4NM0A 3FZRA 2IJMA 3QTQA 2XNMA 4IZ5A 2OU7A 5E91A 5JK3A 5BUEA 3S4QA 4F9AA 1YHVA 1YVJA 3NNWA 2UZVA 4FTKA 3RPRA 5AJQA 1IA8A 2VTIA 3CPBA 2P3GX 1CDKA 3OCSA 4AOJA 4DFZE 3C4EA 5HTCA 2V5QA 4Y46A 3UODA 3D2KA 4GUEA 2IVTA 1CKIA 4O4EA 3EFJA 4J53A 2R3MA 3UGCA 2XF0A 2VWIA 3DKOA 3R00A 5DRDA 5A4EA 4OT5A 5FTQA 3VRZA 3ZUTA 2H96A 4FT3A 1BI7A 1DAWA 5CU6A 3K54A 3NLBA 2PVRA 2I0HA 2WTWA 4R5SA 5J5TA 4NFMA 3A61A 5FEEA 1PJKA 3FWQA 2WTVA 2YCFA 4KKHA 4TYGA 5AAEA 4CKJA 2ERKA 2V22A 3PSBA 3CTJA 2Y9QA 2CMWA 4OTFA 1GIHA 3O8PA 5CF4A 5EG3A 4PP7A 5CEIA 4FT5A 5H8BA 2F4JA 3VJOA 1Q62A 2WMBA 1QPJA 3Q04A 5CAUA 1UNHA 2I0YA 3O71A 2O3PA 1H25A 2HIWA 4UV0A 4O2ZA 3VS7A 1YDTE 2W96B 5TE0A 3O96A 4XYFA 5DEYA 1MRVA 5A4QA 5EHOA 1PHKA 2IVSA 1PF8A 1W8CA 4DN5A 4AT5A 4YJPA 3BYSA 4RFYA 3ZDIA 4GV1A 5J9ZA 2RG6A 4J97A 2P0CA 3TV6A 4KIKA 4U42A 2JDTA 4LRJA 4BCOA 3QZHA 3VVHA 5LMAA 4QQTA 2PE1A 3RVGA 4IEBA 3B8QA 3NUPA 4FYOA 2B9JA 4MTAA 4EHVA 4EZ5A 5I9XA 2X0GA 2QO9A 1H07A 4FGBA 4EEVA 3WBLA 4CTBA 5GJGA 3NUNA 1UU3A 3K5VA 3CQWA 4QYYA 4YPDA 3QTXA 5HNBA 3E62A 3C50A 5DG5A 4YJUA 2AYPA 3DZQA 2I40A 1Y8YA 2W1FA 2WZJA 3K5UA 1H01A 1DI9A 2C5OA 4G16A 4AS0A 4U44A 1GZ8A 3EYGA 4PMTA 4QTAA 4CKIA 2JBOA 3PSDA 1FPUA 2YIWA 5EDRA 3EFWA 2J0MB 4ZEGA 1FQ1B 5ANOA 4IANA 4IC8A 4MXOA 4OAVB 5IA3A 1ZY5A 2VTPA 3PP1A 4M13A 4D4YA 3UOJA 3MY5A 4ZK5A 3EB0A 3OFMA 3CC6A 3F88A 3UIMA 4RZWA 2Q0BA 4K0YA 4K1BA 5HLNA 4BDHA 5TR6A 5IKWA 4IX6A 1U4DA 2CGVA 3M42A 3PVUA 3TIZA 2VWXA 2O65A 4JL9A 4LMNA 4E4LA 2RL5A 2Z7SA 1K2PA 2YDKA 3N51A 2GHLA 2W1IA 2PZYA 3ZUVA 4AA4A 4H1JA 1AQ1A 2QHNA 3ZO2A 4DLJA 3HYHA 3HZTA 4GSBA 4MX9A 4WA9A 5IU2A 5JGAA 4KRDA 3LQ8A 2WAJA 4KD1A 3F3UA 4OLIA 3W2RA 2OIBA 3HEGA 3R1QA 5HICA 3DY7A 4FV7A 4XLVA 2XK4A 3Q53A 2WQNA 3E64A 5CQUA 4L3JA 4KSPA 3LMGA 5EI6A 4TW9A 3WE4A 3ZFMA 3UVQA 5CSXA 1M2PA 3CY3A 4M97A 2NPQA 4CFMA 4EK6A 1KV2A 5M57A 2R0IA 3UBDA 4EOMA 4MNFA 4FTLA 4WSYA 4WRGA 3RAIA 3P5KA 3V3VA 3EFKA 2GS7A 2ITTA 3M2WA 4QD6A 3RMFA 1E1XA 1RE8A 3VS5A 4EBVA 4ZY5A 4I5MA 1PY5A 3GC7A 4U0IA 3R04A 3BV2A 2GPHA 2F2CB 4U3YA 5H2UA 4Z55A 1YWNA 1RJBA 4HVGA 4IB1A 1ZRZA 4FKLA 4QRCA 5HZNA 4G2FA 3AMYA 5ANJA 3UPXA 3UQFA 3KXGA 2XK3A 3PVWA 4I0SA 2QURA 5LWNA 2Z7LA 5TO8A 5FP6A 2VX0A 3R22A 4Y85A 5AX3A 3UIBA 2E9UA 4R5YA 2FSTX 3DJ6A 5ACBC 3TZ7A 3MN3A 3W8LA 3ANQA 3F82A 5A6NA 5HCZA 1Y57A 2XK8A 5CAPA 2GTNA 3ZTXA 4QMUA 5L8LA 1NY3A 4USEA 1XBCA 4BWPA 5CXZA 1WFCA 3MSSA 2FO0A 3W8QA 4O0VA 3E63A 5KBRA 5KKRC 5I9ZA 4LL0A 4O4BB 2FH9A 2UV2A 5CVGA 4CKRA 4J95A 4TYHB 3G33A 5FQDC 1OIUA 2XIYA 2I6LA 3R7OA 4GS6A 3OG7A 2HW7A 3VIDA 1S9JA 3R1SA 5H9BA 3RPYA 3DNDA 4BC6A 4CNHA 3R9NA 3I5NA 4RIWB 3G51A 3QQGA 4PWNA 3EQIA 3LFBA 4W4YA 4B4LA 3KRLA 1Y91A 4YU2A 5JMSA 2OIDA 4K33A 2I0VA 4G3GA 4GT5A 4RJ4A 5HE2A 4DAWA 1ZXEA 5GHVA 1WAKA 5DLSA 3ACJA 3M11A 4KIKB 3VUKA 5EYCA 3BBTB 4YLLA 4G31A 4CZTA 5M4UA 5HGIA 2PZPA 2QOFA 4E5AX 2XNNA 3KXMA 4YHTA 4OTHA 2BZKB 4FTCA 2XNGA 3C13A 3HNGA 4YP8A 4Y5HA 2VX3A 2BIYA 5HU9A 1NXKA 4G1WA 3S00A 2ZVAA 4AXAA 4F0FA 4EH5A 2DUVA 2XP2A 3D5VA 5M44A 3QQHA 4NFNA 5JFXA 3LM0A 1WBOA 1PXPA 3B2WA 3Q2MA 3R83A 4BBMA 5M53A 4LUEA 3PWYA 2X6EA 5J1VA 3ZXTA 2OG8A 4CEGA 2RFSA 3VBQA 4QTDA 5CSWA 4AW5A 1GZKA 2ETMA 2BTRA 3WILA 5KNJA 4PF4A 2G01A 1H08A 4FL1A 4I1ZA 1KE6A 3OUNB 1JWHA 5KCVA 3PXRA 3HL7A 5AR8A 4TT7A 5LARA 2VO0A 4CZUA 3UNJA 3SW7A 4HGSA 4ITIA 1NVSA 4BKYA 3LPBA 4IX3A 2NO3A 3GVUA 4JRNA 1W2DA 4BHNA 4C4EA 4ONAA 3FC1X 3BLQA 5B2KA 4QOXA 3R0TA 1FINA 1PXLA 3AC1A 4CXAA 2BR1A 3WZJA 1PW2A 1O9UA 2GQGA 4NM7A 3ENMA 4FTJA 4DGGA 3R2BA 5HNGA 5FXRA 3VC4A 3BLRA 2P55A 4RLKA 4O96A 2YIQA 4I22A 2A19B 4KSQA 3GB2A 1YHSA 4D2RA 4I6FA 3Q4ZA 4NCTC 3PJ2A 5FDXA 4GG7A 4D2PA 1R3CA 4AZEA 1CKJA 3BELA 4FTQA 4PV0A 3UIXA 2XYUA 4M3QA 2ZDTA 4ZAUA 4EUTA 2E9OA 4ZZMA 3RM7A 4CFFA 3AD6A 2FSOX 3DB8A 4N70A 4EORA 2C4GA 2UZTA 4TN6A 4E6DA 3OXIA 4M12A 3QGYA 2HY81 3I6UA 4RVKA 4AZVA 5BVOA 4J98A 2C1BA 2C1AA 4I4FA 2UW9A 3BQRA 3V5LA 2Y4IC 3CLYA 4FIEA 3FUPA 4QMWA 4KS7A 3REPA 2C3IB 4XP2A 2ITVA 3VQHA 4DH8A 2CSNA 3EL7A 5AMNA 1KSWA 2PL0A 3QX4A 1QPCA 4NM5A 4M68A 5JGDA 3MB7A 5HHWA 4IAZA 4L46A 4EI4A 2GMXA 3QUPA 4E6AA 3UTOA 4GK2A 4AOTA 5HD4A 3ZH8A 4R1YA 1ATPE 2B52A 5GZ8A 4UMRA 3C0HA 5CAVA 2C3JA 1Z9XA 3Q96A 3LE6A 2Y6OA 5AR2A 5AR4A 4Z7HA 3GCVA 3OEZA 4V0GB 3DFAA 2O8YA 5K3YA 4LG4A 4EZ7A 2UW5A 3Q9WA 4AGUA 3FLQA 4QYGA 5J1WA 3NWWA 5BYZA 4AW1A 3QHRA 2BKZA 2BRBA 3U6JA 2VTQA 4JAJA 3R8PA 4FK3A 5JN2A 4A4XA 2XK7A 4O0SA 2W4OA 4ZSJA 3BYMA 4ASEA 3AC4A 3W33A 4CMOA 3DU8A 2CPKE 3TZ8A 4Q9ZA 2GNJA 3EQFA 3L1SA 5HG8A 3GNIB 1UWHA 2YISA 3EQHA 3P9JA 4JR7A 4JX3A 4FNZA 4HCTA 4EWQA 1XO2B 4MF0A 3VJNA 3EQCA 4S31A 3U8WA 4ASDA 3CR0A 2XNEA 3ZFXA 4QMXA 3ORLA 2EXEA 3DLSA 3SHEA 2FUMA 3W18A 2PVKA 5KZ0A 3LQ5A 1WZYA 2YFXA 4MQ1A 2ITYA 3DKGA 3DBCA 1E9HA 2A4LA 3W2SA 2GS6A 4DFXE 2J0IA 3IW8A 4CMTA 3GU8A 5C8KA 2HK5A 4TXCA 2XM8A 5EYMA 1TQMA 3OY1A 1ZLTA 4IVCA 5AP0A 2BDWA 2PMOX 4BDKA 4LQMA 3ZDUA 4DITA 2YDJA 4I5PA 2OSCA 3KKVA 1J3HA 4UWBA 3SRVB 3ORPA 5CAOA 5DIAA 3MH0A 3GC0A 4A9UA 3PIYA 2Y8OA 3P79A 4XCUA 3UO4A 5E1SA 4FKGA 4KWPA 3G0EA 3HUBA 5KMKA 3I0QA 3FZPA 1Q3WA 1UU9A 2J4ZA 4IZ7A 4ZIMA 1Z57A 4AU8A 4ZLZA 3GI3A 3ROYA 4J1RA 5HBEA 5AP6A 4AF3A 4D2SA 5DR2A 5EKOA 3A99A 4KINA 3ZZWA 4AAAA 3F5XA 2CLQA 2XRWA 3R1YA 4QNYA 3TJDA 3AC2A 3OMVA 4UWYA 3RNIA 4RPVA 5ETCA 4F9YA 4OTDA 3GU5A 4M14A 3EQPA 3FLNC 3TCPA 5E8VA 2X0QA 4NEUA 4B7TA 4PUZA 2WMVA 3OBJA 3BGZA 4Y72A 5HORA 4Z9LA 2FSMX 3O7LB 4F4PA 3PPKA 4N4SA 4JOAA 5J7BA 1VZOA 4S33A 5F94A 3QALE 3UQCA 4CQGA 2YITA 1KE7A 1Y6AA 3FZOA 3C1XA 2XKDA 2DYLA 4ANOA 2ZB0A 3LOKA 2HY0A 3PXFA 4OUCA 4IH8A 3UMXA 2BALA 4DGOA 4YHJA 2H8HA 2JFLA 3JY9A 4QO9A 1OL1A 2B53A 3EQBA 2R5TA 4W4XA 1YXVA 1VEBA 1UU7A 1DAYA 4I4EA 4IZYA 4X3FC 5DGZA 3V8TA 2RG5A 3LFCA 4MK0A 5HO6A 5LXMA 1H1PA 3PXZA 4HNIA 5AV3A 4DFNA 3OY3A 1PMNA 5ACKA 3TIYA 4ACDA 5L2IA 1P2AA 2CCHA 3DV3A 1U46A 3DPKA 2C6LA 2OICA 2LAVA 4O0WA 3COKA 1M2QA 4NIFB 1LEWA 4X7QA 2XVDA 1I09A 2G2FA 3G9LX 1YI6A 3MPTA 2GHMA 2WOUA 5E8WA 2B9HA 3LLTA 2JKOA 4L6QA 3NGAA 2C5XA 5K0KA 3OF0A 4Q5HA 4JDJA 4S2ZA 4GJ3A 4IM2A 3ACKA 5JRQA 4IX5A 4EH8A 1G5SA 4FL2A 3V5QA 2UW7A 4XMOA 4W8DA 5CZHA 5ETIA 3SXSA 4FSNA 4BDAA 4EC8A 3ZC6A 3O8UA 4FKIA 3ORIA 4F09A 2Y0AA 1ZY4A 4TTHB 4CFUA 3IDBA 4O38A 3U6HA 3E92A 4GT4A 4NIFA 4ZTSA 3WF5A 4KBCA 1PMVA 2KULA 3HRFA 3FL5A 3O2MA 5CVHA 2R0UA 1APME 3SDJA 1X8BA 5IA0A 2X8DA 3DS6A 4ERKA 3DBFA 5CXHA 3V8WA 4BIBA 2WIHA 3DAJA 4ASZA 2WMXA 3GC9A 4RG0A 4F63A 2RIOA 3IDCA 1WBPA 3IQ7A 2OK1A 3CD8A 3HX4A 5FM3A 4G5JA 3I81A 4KNBA 4RWLA 3DOGA 2IO6A 2YEXA 4C59A 2V55A 2QOHA 3QZGA 4DEBA 3QAME 4ZJIA 2QLQA 4UYAA 3HV5A 4EOSA 4F6SA 4Z7GA 3SLSA 3GCQA 3VUIA 4RX8A 4NJDA 1AD5A 2GNGA 2VGOA 4UY9A 3UVRA 3HUCA 4TWOA 1JLUE 5DT4A 5KBQA 5AM7A 2R3GA 2HAKA 2PMIA 3BQCA 3HRCA 1VJYA 3OROA 2X0PA 2QKWB 5E8UA 4NU1A 5AP3A 5HCXA 4BFMA 4I6HA 3UDBA 1ZOHA 3E3PA 5DH3A 3EZVA 1ZYSA 4EK8A 2YM8A 3RK7A 4A9SA 1OIYA 3AQVA 5M55A 4MCVA 1JSUA 2ZOQA 2WEVA 2HWOA 5LVOA 2B7AA 5AA9A 4BDCA 1TQPA 2NRUA 3AT4A 4YBJA 4JAIA 4XG8A 3TV4A 4X3FA 2J5FA 4F7LA 4FNWA 5CT7A 3TZ9A 4PX6A 2OO8X