5K0XA

Crystal structure of the catalytic domain of the proto-oncogene tyrosine-protein kinase mer in complex with inhibitor unc2541
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
288
structure length
258
Chain Sequence
KLEDVVIDRNLLILGKILGEGSVMEGNLKQEDGTSLKVAVKTMKLDNSSQIEEFLSEAACMKDFSHPNVIRLLGVCIEPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase Mer
publication title Discovery of Macrocyclic Pyrimidines as MerTK-Specific Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 74
structure length 258
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5k0xA02
5ICPA 4GVJA 3GCVA 1GJOA 2BKZA 5C27A 1KWPA 2WFYA 4IC8A 4P2KA 1OPJA 5IH5A 1XBBA 1MQBA 4X6QC 2ETMA 3SLSA 4ITHA 4D28A 2ZYBA 4I22A 3CQEA 4RSSA 1Q97A 4IZAA 4TYHA 3QRKA 2XIYA 3LFAA 1PMUA 1SVGA 4IAYA 3PRFA 3MFTA 4QYYA 4U3YA 4IVDA 1Y8YA 5IKWA 2DWBA 2W5BA 4G3DA 3OOMA 5AP0A 3W55A 3C51A 5E90A 4M69B 3RM6A 3IK3A 2QOOA 5EYCA 4ZLYA 3O17A 5M57A 1PYXA 3LZBA 4NEUA 3EB0A 3TXOA 1QL6A 2XK7A 4JBPA 1GIHA 4QQCA 4PP7A 2C6OA 4WUNA 5AP2A 5CENA 3UOLA 3PE1A 4A06A 4OT5A 2A27A 3UC3A 4QMMA 2O63A 1Q8YA 2W1ZA 4JX3A 1UWHA 5GHVA 4X2FA 4AX8A 2BTRA 4RZVA 5JQ5A 3LCDA 4XP0A 4UB7A 2YN8A 3CY3A 2JKMA 4RFMA 3SDJA 2UZTA 1KE8A 2YAKA 5AUVA 1ZZ2A 4X3FC 4PPCA 3ZCLA 2AUHA 1ZAOA 2R3OA 2VO0A 3WF7A 2FGIA 3SQQA 4ENYA 4BVUA 2VGPA 4MK0A 5CNOA 4XEYA 5FM3A 3HRFA 4BCQA 3PUPA 3MJ1A 4TL0A 4M13A 2OIBA 3H0ZA 3IPHA 1J91A 3GQIA 4BDDA 1FMKA 2HZ4A 4NK9A 3DB6A 4WA9A 4A9RA 3ANRA 4W4XA 4YSJA 4E6CA 2X0GA 3OP5A 5HD4A 4G6NA 1ZOEA 4R3PA 1WMKA 2PZYA 3FLQA 4W4WA 2XKCA 3UOHA 3A61A 3OW4A 3I5NA 1UU7A 4CFXA 1Q24A 2BRNA 2PVKA 2OH0E 3V6RA 4EBWA 1QPCA 4RT7A 4QP3A 3CJFA 3DJ5A 5KCVA 1PXMA 2GHGA 1YOJA 3AC3A 5J8IA 4AU8A 4C3FA 4EORA 3SXSA 3FDNA 4CXAA 4QMTA 2QC6A 2W1FA 5M53A 1DAWA 4E8AA 3FKOA 4QTAA 3IW7A 3PPKA 1CKIA 3VRZA 3DS6A 2F7EE 2R3RA 3DB8A 3EH9A 5AX3A 3MBLA 5C8KA 4BBFA 3JUHA 4ERKA 2PWLA 2E2BA 1KE6A 5EI2A 3QCYA 3WE4A 4AE6A 4C4JA 3LFSA 1H1RA 5CU2A 3BZ3A 3OFMA 2I6LA 2WEIA 1XH9A 3FKLA 3F88A 2E9PA 3MIAA 4KWPA 4D5KA 3V5PA 2V55A 3PA5A 4XX9A 2B4SB 2Y0AA 3M42A 5FRIA 1URWA 4AUAA 4GH2A 2CGUA 3UPZA 4NCTC 4YJVA 5IMXA 2OF2A 3A7JA 5H9BA 3HMPA 3PE2A 5CALA 5K4IA 5HNIX 2WAJA 4ANNA 4FVQA 3E7VA 1YOLA 4AWIA 4G6OA 3FLYA 5EW3A 4K8AA 2C5XA 3KY2A 4IANA 3DLZA 2GU8A 3IO7A 3NCZA 3MA3A 2XS0A 4E1ZA 5CANA 5CSXA 4QQJA 3LXNA 4MXYA 4O0WA 2BTSA 3U4UA 4BWPA 3V01A 3VS5A 1ZZLA 4FTLA 1U5RA 5HTCA 5L2TA 3DK3A 4DEEA 3D15A 2ITTA 3K5VA 4AT3A 4MAOA 2IVSA 3KVWA 3CPCA 2PVHA 2QD9A 4FKGA 2XBAA 5I3RA 4O21A 3F5PA 3WF6A 3ZO2A 4B8MA 3WILA 5HO6A 4DH5A 4I5MA 2XF0A 3WZKA 3VQHA 5CF4A 5KMNA 4FZAB 3DXNA 4J95A 3NYVA 3R9HA 3R04A 5JZNA 5IPJA 3R1QA 3A62A 3MH0A 4WO5A 5CSPA 3MFUA 3KC3A 3PG1A 2OU7A 2QNJA 4BTKA 2WTKC 2O65A 5JRQA 1H1QA 3BLHA 5HU3A 3H9OA 5AR2A 2J51A 1YVJA 3HL7A 3OY3A 1ATPE 4R5SA 1JSUA 2J9MA 2W0JA 2Y8OA 3DLSA 4RMZA 5CWZA 2I0YA 2VO3A 5AV2A 2ERZE 3P86A 4B99A 2JIVA 4QMPA 5CEOA 2W4JA 1QPJA 3KF4A 5DLSA 5J7HA 3QTZA 1VJYA 4CNHA 2O5KA 1AQ1A 3HRBA 4R6VA 3EKNA 3GU7A 3GFEA 4K2RA 2XB7A 5A4QA 1I09A 1R0EA 2OSCA 2HCKA 3FMKA 3NLBA 3TTJA 5JZJA 2IW8A 3VUTA 4MHAA 4F99A 5I9XA 4U6RA 4GUEA 4H3BA 4RBLA 3FV8A 3ORNA 2Z7RA 3EL7A 3NW7A 4KS8A 1VZOA 5IA5A 3ZLWA 4CKIA 2C3JA 5EYMA 3OWLA 1OKZA 2R7BA 5ETIA 2YABA 4ZZNA 3BE9A 4IFCA 2C1AA 5IA0A 3BE2A 3LVPA 3RK7A 3W2RA 4RIXB 4GG7A 5HE2A 5D1JA 3WZEA 4CSVA 3FLWA 2WOTA 4FGBA 4KRCA 1HCKA 2YCFA 3IOPA 4EH2A 4FF8A 4BDFA 4ITIA 2DS1A 4JBVA 5IZFA 2F7ZE 2JIIA 4ZTMA 3T9TA 4FSZA 4GEOA 1YXVA 2HZNA 2QU6A 2QR8A 3N51A 4QTBA 5AM6A 5E8XA 3TEIA 2P55A 4BCFA 4EJNA 2BDWA 4ANBA 4F9CA 5IH6A 1SM2A 3I5ZA 3EN4A 3FQEA 2X1NA 3QYWA 4FI1A 4IACA 2GNGA 2XNNA 1H00A 1BL6A 3Q9YA 5DHJA 3IG7A 4I0SA 3O8PA 3QD0A 3MH2A 4S2ZA 5JEBA 2DYLA 3Q96A 3MTFA 2Y6OA 4HJOA 3E93A 3NRMA 4IEBA 4CFWA 4ASXA 2ONLC 4IE9A 4HYUA 3NIEA 4IZ7A 1LEZA 2P33A 2JFLA 4RJ6A 4QP8A 5EI6A 4RIYA 4CLJA 1WBTA 4YUQA 5FXRA 3OUNB 1MRYA 1Y91A 2HK5A 2W9FB 5HHWA 4BDCA 4JVGA 4MWIA 5LQFA 2VTLA 5D12A 3OW3A 2XCHA 3BBWA 2X9EA 3WF5A 4NM3A 4TZRA 3OY1A 3P9JA 2AC3A 4YGAA 4YPDA 3RPYA 5KMOA 4RIWA 3CGFA 5A46A 4C4HA 3DY7A 3NW5A 3CKWA 3QX2A 3AXWA 3ZC6A 2R3MA 2R3GA 4GVAA 5C03A 3P78A 4TYIA 2J90A 1JAMA 3OTVA 3PG3A 2GFSA 4G9RA 3G90X 2VO7A 2W1IA 3HEGA 2XEYA 3OS3A 4IDTA 1TVOA 5BX0A 1JLUE 3KMMA 2P4IA 5IISA 4JAIA 3HGKA 4Y8DA 1RJBA 2GS2A 3DBQA 5EM6A 3PY0A 3AT2A 3OG7A 4J71A 2C6KA 5CXHA 4AW1A 4B9DA 5EM7A 3UNJA 3HUCA 4RX5A 5DOSA 2OO8X 2ZV9A 3PXZA 4WIHA 4A7CA 4AGUA 2UW9A 2CGVA 4YC6A 1E1VA 3A2CA 2QOIA 3ZBXA 2VO6A 5JFXA 2R3PA 2VTPA 3OOGA 5A4EA 2BDJA 3I60A 4HVIA 2WMWA 1STCE 1M17A 4UWBA 3OCBA 5BUJA 2XBJA 1UNHA 4UMUA 4FZ7A 3CTQA 3ZLSA 3M11A 4O1PA 2YA9A 3VF9A 5IUGA 4FSQA 4S33A 2VWYA 4BHNA 3UG2A 2QOCA 3SRVA 4UYAA 2JD5A 4YPSA 4RQKA 5HBJA 4Y95A 4U79A 3MTLA 4L52A 3EN7A 4AT4A 5CNNA 4GJ3A 3VUGA 5CZIA 3GCQA 5DEYA 3ZXZA 2VAGA 3TV4A 3GQLA 5M44A 4RRVA 2X2KA 3DBDA 2QU5A 1WBPA 4D4SA 3DKOA 3GP0A 3GI3A 5AUTA 5EYDA 5FTQA 1G5SA 4C59A 4C61A 4F9YA 3EQDA 3FE3A 2ZMCA 3UVRA 5AUXA 2WMAA 4JQ7A 4CTBA 4DFXE 2I0EA 3BRBA 5FEDA 3G51A 2C1BA 3W10A 3RPRA 4E7WA 1BL7A 3D94A 2FYSA 2PZRA 2WTKB 4JDKA 4CT1A 4USDA 4ZLOA 4I92A 5CSHA 4KBAA 4FYOA 4MXAA 5K4JA 1YDRE 2EB2A 4AN3A 2RL5A 3ORPA 4MBJA 4QNYA 5DBXA 5JT2A 3E8NA 2YISA 2ZV2A 4BBMA 4C36A 4FIFA 3I4BA 5CSWA 2UW8A 2C3KA 5CY3A 3UVQA 4MD8E 3QD4A 3SV0A 4Y72A 4RZWA 4BYJA 2J7TA 3WE8A 2QHNA 1YI3A 3EN6A 3LFQA 5G1XA 1OIRA 2G01A 1YXUA 2F57A 3BKBA 3L8VA 3OMVA 2B1PA 4D4VA 4FTCA 1TQPA 4A4OA 2RFDA 3C9WA 4IW0A 4CQEA 3EFWA 4QRCA 4KSQA 4U3ZA 5CASA 2UV2A 3VO3A 1FINA 2VX0A 3ZUVA 2ZV8A 2RF9A 4FV5A 3LM0A 3OVVA 5KNJA 5IF1A 4FTQA 2FB8A 4FL3A 2B9FA 4ZY4A 2FSLX 3FZPA 3FL4A 5HKMA 2XK3A 5J5SA 4XRLA 5HX8A 4PRJA 2IZSA 5M4UA 2I1MA 3JY0A 4JR3A 3LMGA 5K5XA 4P5ZA 1ZOGA 3R7EA 1H26A 2X81A 3EQIA 3FZOA 4ZSEA 3SXFA 2CDZA 4X6RA 4IAZA 2JITA 2QO9A 3DK7A 5EYKA 3COKA 4XYFA 5HORA 2ITXA 3DFAA 4ACHA 3NZ0A 3UMWA 5AWMA 3PVWA 4R1YA 4RWJA 1Y57A 3BPRA 3ZO3A 1CSNA 4HGSA 4YTCA 4IJ9A 2HZIA 4ONAA 4E6AA 4PL3A 4MVFA 5CVGA 4F65A 1ZXEA 3BU3A 4DYMA 4EZ3A 2Y4IB 3BV3A 4GMYA 3TV7A 3NUSA 3P5KA 3GU5A 4PQNA 3ALNA 2V7OA 4U97A 3TNQB 1PXIA 4YU2A 1Q8ZA 1Q3DA 1Q4LA 4CEGA 3VJNA 1OIYA 3FMHA 4BICA 4ZIMA 1SYKA 2X7FA 2XJ0A 4OTFA 2GCDA 3R1NA 2V7AA 4FNWA 5KX8A 3BX5A 4QYHA 4D2WA 2C6EA 1S9JA 2C6LA 3BYVA 4W4YA 5AIKA 3SHEA 4FNYA 4EOKA 1Y6AA 2GS7A 3R00A 4DEBA 3QXPA 5D7AA 4E3CA 3QHWA 3A7FA 3MGYA 2BRGA 4FTUA 2XNMA 2EWAA 5CAVA 4L46A 2VV9A 4AZFA 2XK8A 2X4ZA 4LRJA 4CKJA 3I7BA 2F4JA 4ZEGA 5I9WA 4EK3A 4XBUA 4DG0E 2WD1A 3NUXA 3UODA 4C0TA 3GFWA 3ORKA 4EH3A 2BHEA 4EHEA 2HOGA 2P2HA 4DGLC 4GV1A 2B54A 5D9HA 4Y5HA 3PXRA 3LFEA 3TZ7A 3E8EA 4IWDA 2CHLA 4M15A 3EN9A 4AG8A 5C1QB 5JQ8A 2QQ7A 2QOLA 2DQ7X 2A0CX 2UW3A 2PVYA 1W98A 2W1EA 4IHPA 3PSDA 5EHLA 4UALA 4QP6A 5JMSA 4I6FA 1APME 1A9UA 4FV3A 4UBAA 4IJPA 4X3FA 5CQUA 4ASEA 5L2SA 5IEVA 4ZZMA 5HE3A 4J98A 5AMNA 5DRBA 4KKEA 4AF3A 4DTKA 3B2WA 3IECA 4RJ5A 3HRCA 4FKQA 4XV2A 4ASDA 2CCHA 4XG2A 5TO8A 5EKNA 3OROA 4DGMA 1FGKA 3OXZA 4BF2A 4LOPA 2R5TA 3ZUUA 4FTTA 3RALA 2G2HA 4D2PA 3LJ2A 5HBEA 4F63A 4FSMA 4O6EA 3FPQA 3CPBA 5HIEA 3Q9WA 4AE9A 5LARA 3FI3A 2W7XA 3EWHA 2CPKE 2PVNA 4JDIA 4CZYB 2OZAB 3EFJA 3OXIA 4QP9A 5K9IA 3V8WA 3PTGA 3W32A 1H07A 2YDIA 2Z60A 4RJ4A 1ZYSA 4FKJA 4CD0A 1OL5A 4EYJA 5HBHA 3OEZA 3S2PA 4N70A 5LVPA 2R3NA 4XG3A 2UZNA 2G2FA 4FV7A 3OHTA 4WD5A 3K3IA 3KULB 4NFNA 5EG3A 3RCDA 4CZUA 4DH3A 4F64A 4OBQA 2V62A 4QYEA 3GNIB 4CRLA 5BNJA 4U81A 4AGWA 4UMRA 2I40A 5HO8A 4TW9A 1JVPP 5EHOA 2BPMA 3LJ1A 4GCJA 3TTIA 3PP1A 3D4QA 3PVBA 4MXZA 1UWJA 3T3VA 4CV8A 4IVCA 4K18A 5LMAA 4EH4A 2IZUA 3NNXA 1WBNA 1OUKA 2BILB 2BHHA 4KIKA 2W1CA 2WHBA 2CLQA 3D0EA 4TPTA 2EVAA 3MA6A 3POZA 4UYNA 4CFMA 5BVOA 1OPKA 2OJJA 3DV3A 3QGYA 4WG4A 4E4MA 5FXQA 3WARA 2YHVA 3PJ2A 4M3QA 4IH8A 1KOAA 1FVVA 2JC6A 4MX9A 1MQ4A 3R2YA 2IW6A 4OTRA 1K3AA 4DFZE 5DG5A 4BZOA 1DS5A 3BQRA 3IW6A 4C2VA 4R7IA 4E6DA 2JDRA 2OICA 2X6DA 2Y4PA 4E5AX 1FVTA 1GZNA 3ZSHA 4FSWA 1OKWA 4LL0A 4I5HA 4M0ZA 2PL0A 2CJMA 4I5PA 4XNEA 1J1CA 4NWMA 2YFXA 2X8DA 3S00A 3O0GA 3AG9A 5DT3A 3MFSA 5AV0A 4FKTA 4LG4A 4DFNA 4QPSA 1ZMWA 4HZSA 4L53A 4PMSA 1Q8UA 1Q8TA 1R1WA 3EIDA 3OT3A 4XG6A 4EI4A 3W2CA 5HGIA 4EL9A 4XMOA 5A14A 5FBOA 2H96A 3QRJA 1G3NA 2WMBA 3FZ1A 1YI6A 3RJCA 1UA2A 3BIZA 3W2PA 4TRLA 3CCNA 1SNXA 3R9DA 3DOGA 2A2AA 2PVLA 1LPUA 5FP5A 3UQCA 4U42A 4XV3A 2WTVA 3DTCA 4DEAA 5M4IA 5AAFA 2XZSA 3LFDA 2R3QA 4IX6A 4EZ5A 5CQWA 4YZBA 4FKRA 4FICA 3TNHA 3FI4A 3NWWA 4JDHA 4JL9A 5ANKA 2JAVA 2R64A 4GT4A 4HCTA 4G16A 5BYYA 2UW4A 4C2WA 3DDQA 3UP2A 4G3CA 5DR2A 1OKYA 2BCJA 4C4FA 4F0GA 4E6QA 4BL1A 2XA4A 4W9WA 4DN5A 4F9AA 5LWNA 4YBKA 5CSVA 3KQ7A 1DI8A 3RHXA 3KFAA 4F0FA 3G2FA 3F66A 4M14A 4JDJA 3PWDA 3KB7A 3FMDA 4TWCA 3L8XA 4R3RA 4USEA 4R1VA 4JBQA 4EEVA 4B4LA 2JDVA 2ZM4A 4V04A 3A99A 2J2IB 1YW2A 1YWNA 2PK9A 3BHYA 4CMTA 4YJUA 2FVDA 4RWIA 3CXWA 4TY1A 3I79A 1U54A 4I4FA 2ZVAA 5EKOA 4XHKB 4Z7HA 3KXGA 4NJ3A 3AT3A 2WTIA 2C3IB 4JOAA 4LGDA 4YNOA 3B8QA 3WOWA 4EH8A 4UMTA 2BRHA 5HIDA 3NAXA 3ERKA 3BGPA 3RAIA 2E9NA 4AOIA 3R7UA 3QLFA 1NXKA 3DAEA 4GSBA 1YQJA 1R0PA 4UV0A 4BKJA 4ACDA 3DDPA 3UIMA 3I0OA 4JAJA 3OXTA 3R63A 4K33A 2KTYA 4I5CA 1CTPE 4UX9A 1OECA 4WNOA 4BFMA 5FEQA 1E1XA 3PZEA 5ACBC 1SZMA 3PY1A 3ZU7A 2F9GA 2OIDA 4CKRA 5J1WA 2WTJA 4BRXA 2G15A 3JVRA 3FAAA 1CDKA 3QQFA 3P4KA 4HCUA 4RG0A 4IAFA 3U9CA 4QOXA 2WEVA 4BZNA 1H01A 3Q4TA 4IZ5A 1F0QA 4PNKA 5I5ZA 3HZTA 3QZGA 5GJFA 3SXRA 2BZIB 4IVBA 2OJIA 5TKDA 2J5FA 4TYGA 2VTOA 3VW8A 4MYGA 4TYJA 2R0IA 4UWCA 3VBYA 3FMJA 3QZFA 3GEQA 3AC8A 5CX9A 1Q8WA 2W06A 4MXXA 3UO6A 3O7LB 4PMPA 2IO6A 4RFYA 5IUHA 1IRKA 4CFFA 3CTJA 3E8CA 3PLSA 4EWQA 2XK6A 3D7TA 4Q2AA 4JX7A 4TWPA 4MD7E 3R1SA 2Z8CA 3AC2A 3RGFA 4DBNA 3DBCA 4NIFB 3ZEPA 5J9LA 4DFLA 2XYUA 3C4XA 4O1OA 3ZSGA 5I9ZA 4OTDA 2XMYA 3CS9A 3S4QA 2JBPA 3MIYA 3SOCA 4S30A 5BQ0A 4YJPA 3KXZA 4F9WA 5HVKA 4FOBA 3ZRKA 1M52A 2JKKA 3OT8A 2OXXA 1CM8A 5ANJA 4HW7A 3QKKA 5EDPA 5L2QA 3Q4CA 1T45A 4X2JA 5A4TA 4FSRA 4QMWA 5E8WA 4MQ1A 3V04A 3UBDA 4QPAA 4DEDA 1RDQE 3I6WA 5FXSA 4F6SA 2GDOA 4DG2E 5K5NA 1LR4A 2BDFA 3W16A 2R3LA 3QC9A 2XK9A 3C0GA 4QMOA 5AR3A 1TQIA 3CE3A 4ZJIA 5T3QA 2PMIA 5FQDC 1MUOA 3EQHA 1BMKA 3HMNA 4WSYA 3W2SA 4BI1A 4ARKA 4BDIA 3ODZX 4OTIA 4AA0A 1VYWA 2O3PA 3G6GA 2VN9A 1YRPA 1M2PA 3EQFA 3O71A 4EYMA 2XVDA 3MFRA 2XKDA 4V0GB 3QCXA 5CYIA 4YP8A 5DIAA 3TJCA 3QC4A 4DLIA 1MRVA 2FH9A 4FTOA 2Q0BA 1OZ1A 3Q5IA 4JG6A 2WTWA 5CEIA 3GENA 3DA6A 4WRGA 3OC1A 3A4PA 3G5DA 3NYNA 3VS3A 4X7QA 4DITA 3W8QA 4DGGA 1XH4A 4YZ9A 4BWKA 5HE0A 3V5TA 4BN1A 3LCSA 4X3JA 2JEDA 4XOZA 2IVTA 4EH6A 4EHVA 4BCOA 3U4WA 2YM8A 4XRJA 4RA5A 5IDPA 4YLJA 4BIEA 4LL5A 4RVKA 2X39A 4BI2A 4ZY5A 3LQ8A 5E8TA 1BKXA 2FUMA 2I0HA 5HOAA 1F3MC 4D4YA 3VS2A 3AQVA 4OGRA 4XLVA 4QQ5A 5I9VA 1ZMVA 2J0JA 2VTIA 3PY3A 2O64A 2PUUA 4U8ZA 1GOLA 2Y9QA 4FSTA 1YWVA 4ALWA 4EK4A 5LMKC 1A06A 1M2QA 4FT3A 2Z7LA 2GNLA 4I0RA 3FYJX 4YBJA 5IMEA 3LXLA 3MYGA 2AC5A 3IDBA 1JNKA 5L8KA 4FKOA 4C4EA 1B6CB 3AD4A 3WZJA 4DCEA 2CLXA 3D2IA 3QD2B 4G9CA 3Q6WA 1WFCA 3LM5A 4YMJA 4IC7A 5AP7A 3V5WA 1KSWA 2JDTA 3VAPA 3EQBA 2OGVA 3EL8A 3HV6A 4PDPA 5J1VA 4PDSA 5C8MA 4WG5A 4FL1A 5D41A 4HGTA 1ZRZA 5AM7A 3VHKA 2VX1A 1W0XC 3DT1A 4DEHA 3UOJA 5AIRA 1PXJA 1ZYLA 5DEWA 2V22A 2C5NA 2ZAZA 4J7BA 3UPXA 3HMIA 4YO6A 4MNEB 2BR1A 4Y83A 1NVRA 3FMEA 1XO2B 3MPAA 5FBNC 4YJNA 2BROA 4UXLA 3R6XA 5EDQA 4OLIA 3H3CA 3W1FA 2QR7A 2WKMA 3S0OA 2HELA 3BCEA 2VWXA 4LV8A 2IWIA 3FKNA 4MTAA 3VS7A 5IU2A 2BMCA 4FR4A 3KXHA 3KCKA 1BYGA 4YZDA 5C26A 3TI1A 5M4CA 3KK8A 2BFYA 1J3HA 2VRXA 2OG8A 3HDNA 3VS6A 4BCIA 3BEAA 2E9OA 2ITNA 1BI7A 3R8LA 2OW3A 2Z7SA 2BAQA 1RW8A 2H6DA 3EQCA 2XUUA 5DVRA 5IA3A 3Q4UA 1Q41A 4XJ0A 3LXPA 3FMNA 5FTOA 3V6SA 4J52A 3MY0A 4GFMA 5ANDA 3A8WA 5AP6A 3UZPA 5JFSA 4FV4A 2C5OA 4IX5A 1I44A 3V5QA 5E1EA 2ITYA 1ZWSA 5L3AA 4XS2A 3C0HA 3VUHA 4ERWA 2Y4IC 4M97A 3E87A 2Y7JA 4CCBA 3HP5A 2W4OA 4FZ6A 2ZDTA 3TKIA 3A8XA 1PXLA 2BZKB 3R8ZA 1PXPA 2VTNA 3CD8A 3QTQA 3F7WA 5JSMA 2OJFE 3RWPA 3EZVA 4M66A 3AC5A 4FIHA 3PJ1A 3ET7A 4IFGA 3WZUA 2R4BA 4A9UA 2EXMA 4FKPA 3C4FA 4FT9A 4RQVA 2YZAA 2PSQA 1IR3A 2UVZA 4J1RA 2LGCA 3REPA 1M2RA 3WF8A 1H4LA 2GS6A 3MPMA 3TL8A 3QTRA 4AGDA 1UKHA 4M7IA 4U7ZA 3G9LX 5EHYA 4BKYA 4EKKA 4F1OA 4GJ2A 5M51A 1XJDA 4PTGA 4CLIA 2GNIA 3WYYA 2NPQA 3P7BA 5CI7A 4YJTA 3TIZA 3PXKA 4M69A 4ACMA 2OXDA 4ZSAA 4YHJA 3F3WA 5CAOA 4NW5A 3ZXTA 4YNEA 1PXNA 2CMWA 4D1XA 2R9SA 4PPBA 3GB2A 1H1PA 2H34A 2WMSA 3OCGA 4WNPA 5A9UA 4LYNA 1H8FA 1H08A 4L43A 1Q62A 3C13A 3RZBA 2YIQA 2CN8A 2CSNA 5ANIA 1PMVA 5DWRA 4MWHA 3BWJA 3C4ZA 3R8VA 4YZMA 2OWBA 4HGLA 3PRIA 1LUFA 2W9ZB 3GXLA 5BVEA 5L6OA 2YIYA 4QMVA 5FGKA 4BTMA 3ZLXA 4LRMA 4RWLA 4J8NA 2HZ0A 2OZOA 3G0FA 1BLXA 2OF4A 3C4WA 3R83A 2HIWA 3QTXA 2C5VA 3R30A 5KMLA 3Q3BA 3Q6UA 2B7AA 2XNBA 5K0XA 3EHAA 4LUDA 3TIYA 4AACA 3O23A 1VR2A 4MBLA 1M14A 1U46A 3PPZA 4JG7A 3WYXA 3P0MA 2PVRA 2QLUA 2C6TA 1YI4A 5CEMA 3F3VA 2QI8A 3IKAA 3MY5A 4PNIA 3BU6A 2YM3A 4HYSA 3FWQA 1OB3A 1V0OA 4D9UA 3C50A 4CT2A 4YZNA 3TZMA 2XEZA 1UU8A 3IDCA 1AGWA 1R78A 2C4GA 2Q0NA 3MI9A 4C3RA 4V01A 4JQ8A 2Z7QA 3RAHA 2VTJA 4FVRA 5J79A 2C3LA 3DU8A 4IAIA 4IX4A 3LFNA 3DBEA 4QTDA 2R7IA 4KKGA 5TOZA 3HV7A 3SC1A 1P4OA 3TNPC 3ZTXA 3RPOA 3F5GA 2QOHA 4BDKA 3GUBA 4DFYA 3VBTA 3ZZEA 1PJKA 4F6UA 3H4JA 4YHFA 5AP1A 3THBA 3ORXA 5HG7A 3EQGA 4GFOA 3W18A 3M1SA 2NRYA 2HW6A 2X4FA 1J1BA 2PMOX 4AW2A 4BGHA 4L7SA 4N6YA 5DT4A 2OI4X 4QPMA 3FYKX 3CEKA 4G3EA 4E4NA 3R7GA 4PMTA 3WF9A 4AGCA 3VWAA 4O0VA 1Q99A 1JKLA 4FV8A 4CYIA 4RVTA 4UXQA 4FUYA 2XK4A 4GIIA 4ZP5A 3D5VA 4C7TA 3QQLA 4GYGA 5FDXA 5KZIA 4YTIA 3HA6A 3SVVA 3UGCA 2IVUA 4FVPA 1SNUA 4BDJA 3EJ1A 1OIUA 4V05A 4F09A 5CU0A 4YC8A 3OWPA 3EOCA 4G2FA 2PHKA 4MBIA 3VIDA 4R3CA 5E8YA 2UZWE 3GC7A 2B9HA 4QMYA 4WNMA 2PE1A 3BHTA 3LAUA 4UZHA 4R8QA 5H8GA 4YTFA 4JS8A 2WZJA 4FTNA 3PIXA 3QTSA 2R3FA 3P1AA 4FG9A 3BYSA 4KINA 4HNIA 4BZDA 4IBMA 4F7JA 3VS0A 1XHAA 3LFCA 4NKAA 2WMUA 2HWOA 3KVXA 4OT6A 4TNBA 4I6BA 5ACKA 3LCTA 1ZY4A 4FBXA 4II5A 3AC1A 3JPVA 4EH7A 3ACKA 3QWJA 5ANGA 4FKSA 1E9HA 3QZHA 3NX8A 4IWPA 2WIHA 1WCCA 4BDAA 2KULA 2UZVA 4TXCA 2R3HA 4RC3A 5EI8A 4S34A 4WBOA 4WSQA 4F0IA 1NA7A 1WBVA 4BC6A 3ZONA 4QMQA 1ZOHA 4QTEA 5AUUA 5GZAA 2C6IA 4ZY6A 4BYIA 1H27A 5EW9A 2FA2A 3KRWA 3SD0A 3ULZA 3ZFMA 2XM9A 3HVCA 1IASA 1LEWA 3IGGA 4D2RA 4IM0A 5KHXA 2ZB1A 4RIXA 4O96A 3LFBA 3I0QA 3UIBA 5I4NA 1L3RE 4APCA 3QLGA 4FIJA 4JRVA 4FODA 2VWUA 5I3OA 4DLJA 3CY2A 1KE5A 3QKMA 3QD3A 3R71A 1YKRA 4KIQA 1JKKA 2VZ6A 5ANOA 3CD3A 3ZS5A 4C58A 4FL2A 2QLQA 2P3GX 4RIOA 5D11A 5JGBA 3T9IA 4ANOA 4AN2A 4EOMA 1SVEA 2F7XE 3F3TA 3H9FA 3PJCA 1YOMA 4FSYA 4UWYA 3NYXA 4U9AA 3UMXA 3DQWA 2YACA 3FC2A 4TNDA 1PF8A 2B9IA 1QPEA 3I1AA 3MV5A 4GK3A 4XG8A 5DPVA 5G6VA 4DG3E 4F7SA 5KBRA 1XWSA 2GNJA 4O91A 5CI6A 1NVSA 4JLCA 3ZEWA 3F3ZA 4FV2A 4QP1A 2YLFA 1YHSA 3U51A 4B6LA 4FNZA 4U80A 3VS4A 3D14A 3UG1A 5LWMA 2OBJA 3G33A 4IDVA 3ZZWA 2YAAA 2XIZA 3L8PA 5HEZA 4FKIA 4MQ2A 4QMXA 5JFWA 3ZFXA 3B8RA 1H1WA 1MP8A 2GQGA 3O2MA 5HTIA 3Q9XA 2XNEA 4OBPA 1OL7A 4TYHB 4H36A 2GTMA 2P0CA 5AV1A 4EWHA 3F5UA 5AX9A 4A9TA 2YLEA 2WO6A 2GNFA 5L8LA 3EQRA 3PWYA 3IW5A 2QOKA 2UVYA 2UZOA 3POOA 4KBKA 5AR4A 4XBRA 2BUJA 5DGZA 4D2SA 4ZZOA 3IW4A 3GCPA 4LQMA 5C9CA 3SX9A 4USFA 3I6UA 4LM5A 4LUEA 3R7IA 4XV9A 5L8JA 5HVYA 3OEFX 1SVHA 4RLLA 4BGGA 5KMIA 3P7AA 5ITAA 3ORLA 4QP4A 2PVMA 4YTHA 5HLPA 2X8EA 3U9NA 3FLZA 5AA9A 3FZSA 3SW7A 3QCQA 4KAOA 4XG7A 4ZTRA 3WZDA 3RP9A 2VD5A 4DEIA 4I94A 5LMBA 3D2KA 4QQTA 4LV5A 4ANSA 3MWUA 4DGNA 5KHWA 3ULIA 2HXQA 3D7TB 3VULA 4L44A 4AQCA 4EKLA 3ZRLA 4F1TA 1PYEA 3QQHA 4PTEA 3UJGA 3V51A 4GT3A 4D5HA 1OI9A 5BVDA 2BVAA 3DKFA 3O7LD 1W82A 4X2GA 4D1ZA 2RG6A 1H0WA 5ETCA 4ANLA 2J0IA 3W8LA 2XIXA 4PDOA 1M7QA 3NEWA 3G0EA 3VRYA 2WPAA 4F6WA 5JGAA 2WELA 4UN0C 4PP9A 4FIGA 4I3ZA 5ANEA 3CLYA 2BIYA 3LJ0A 1OM1A 3FBVA 4FT7A 4WRSA 5LVNA 4ZJJA 3FXXA 3WBLA 3FC1X 4NCTA 4AA5A 4S32A 3AGMA 2QG5A 4RPVA 3GU8A 5CZHA 2ZM1A 4B0GA 3AMBA 2C0IA 2RFEA 4H1MA 5KKRC 1WBOA 1KV1A 3Q60A 4JXFA 3MPTA 4NM5A 2ERKA 3IDPA 4EK6A 4L7FA 4EOPA 3VQUA 3RPSA 3F6XA 1ZYJA 2PY3A 1GAGA 4Q5EA 5FP6A 1IG1A 3A7IA 2ITPA 1XH7A 2XKFA 3QU0A 4G17A 4J53A 4IM2A 4L3LA 5CU6A 3NNWA 3OF0A 4RJ3A 1OMWA 5AA8A 4LOQA 5DRDA 4TWOA 5AUYA 4OW8A 3LFFA 2HY81 4FUXA 4O22A 5HESA 1K2PA 3LIJA 4XP2A 1GIJA 4AOTA 3UO5A 4U43A 5LMKA 4RA4A 4TKSA 3KKVA 3UYSA 2J5EA 4O2ZA 2YM5A 1R3CA 3N9XA 3QRIA 3S1HA 2W5AA 4AZSA 1RE8A 3FXZA 4MEDA 5E7RA 2UZUE 2UUEA 2UZBA 3FSFA 4U5JA 4BDGA 3IS5A 4C3PA 3P79A 3Q4ZA 5EH0A 4TWNA 3W2OA 3HX4A 4AW5A 4JJRA 4ZSJA 3VBWA 4KA3A 3ZMMA 4NM0A 4RX8A 4WG3A 2X9FA 1H1SA 4L67A 4EQCA 3O8TA 3QUDA 5B2KA 4XG4A 3D5WA 2C69A 3RNIA 3COIA 1IA8A 2HWPA 1YHWA 2PTKA 2XCKA 4GRBA 1JSTA 2W5HA 2O0UA 3QA8A 4FMQA 4KSPA 5H3QA 5AEPA 4YO4A 2ZJWA 5GJGA 3RPVA 4A9YA 2XJ1A 4S31A 5AR7A 4CFUA 3VBQA 5EFQA 4HVSA 2PE0A 3RCJA 4D2VA 4HCVA 3QALE 1WBWA 4D4RA 3R21A 5IUIA 5DFPA 3PXYA 3MY1A 3P23A 1H28A 3UQGA 4RJ7A 1PY5A 2VX3A 1HCLA 2YIRA 4EUUA 4L9IA 4LMNA 2PZ5A 4PL5A 4LFIA 2GTNA 4OR5A 4Z9LA 3BI6A 2XNGA 5HI2A 1K9AA 5CEQA 3BHUA 2PVFA 3ELJA 3LOKA 4FG7A 5F94A 4DHFA 3TKHA 1OIQA 2VTSA 3SOAA 4HPUE 5D7VA 3QQGA 1O6LA 1UKIA 1XQZA 3V8TA 2WTDA 4FKVA 1FQ1B 4FZFB 5E8UA 3QAME 1U4DA 2YIWA 4GW8A 5HE1A 4QTCA 3KMUA 3D7ZA 3HP2A 2UZDA 3CTHA 3ORMA 4KIOA 2ONLA 5DN3A 5FM2A 2GHLA 3EZRA 4HGEA 2BZHB 4E4LA 2QO7A 3ZDIA 2ETKA 3ZBFA 3NDMA 3CQWA 2JKQA 4KS7A 4C8BA 3MVHA 3L9LA 2B9JA 5E1SA 3V3VA 3VNTA 4P90A 4RC4A 3SKCA 5EOLA 4BCJA 5E8VA 4BCHA 3C4CA 1UNGA 3P7CA 2UW7A 4NT4A 3S3IA 3RKBA 4EC8A 3W2QA 3FUPA 2W1HA 3GC0A 3B2TA 3QXOA 3ZLYA 1Z57A 4CVAA 4ZOGA 4ZAUA 3ENHA 2OFUA 3EQPA 4LGHA 3UTOA 5CEKA 2CGXA 3LHJA 4GUBA 5HLNA 4U40A 3UIUA 3F9NA 2NP8A 3FQSA 3QHRA 3UYTA 4OTPA 2YDKA 3CJGA 5AV4A 4JIKA 5LVMA 4FK6A 4RIYB 3TZ8A 3A4OX 5FD2A 5F20A 1FOTA 1FMOE 3ZC5A 4NJDA 4OAUC 4AW0A 4A07A 5CU4A 4W4VA 4IAKA 4APPA 2HW7A 4EOQA 4QMUA 4UMPA 5KO1A 3G6HA 2XNOA 3FLNC 4L6QA 4BCGA 4RIWB 3VVHA 3RAKA 2PZPA 4D58A 4MD9E 5JN2A 3A7GA 4FG8A 2V0DA 3QTWA 4PF4A 4W8EA 3PXFA 3KA0A 1FGIA 5CAPA 2ZV7A 1OKVA 3BV2A 3HDMA 3PVGA 4FTAA 2GPHA 3HNGA 4GL9A 5K0KA 5BVNA 1WZYA 3OBGA 3RI1A 4FIEA 3NSZA 2WQNA 4EOOA 4G31A 4ASZA 3KF7A 1ZYCA 4JIAA 4PY1A 5AR8A 4HNFA 1KE7A 3R1YA 3II5A 3KCFA 1GZ8A 1JWHA 4G3GA 4GT5A 3RBWA 5J5TA 3DJ6A 4K1BA 1Q61A 4NFMA 5KKRB 5LJJA 4FSNA 4I1ZA 4M0YA 4DH8A 5BUIA 2OZAA 4KIPA 2F2CB 5DT0A 3E3PA 3HV3A 5AP5A 3FHIA 5LVOA 3HYHA 3R7VA 4JG8A 1CMKE 4GK2A 3IGOA 4I23A 4QYGA 5BMMA 4WHZA 1JSVA 3ZM4A 1PXOA 1ZLTA 2HAKA 3E8DA 2GSFA 3PA4A 3QBNA 3RAWA 5CF5A 5B2LA 2IJMA 2DUVA 5IH4A 2O8YA 2YM6A 3KULA 4XLIA 5KMJA 1GIIA 3QZIA 3R7OA 4KD1A 4KNBA 3ZRMA 3FY2A 4BCKA 2QKWB 4CZTA 4L3JA 2XH5A 2WU6A 1F5QA 4DGOA 5CAQA 2RFSA 5DMZA 3QL8A 3MDYA 3SRVB 5IA1A 4IB3A 4D9TA 3VBXA 4GK4A 4IQ6A 2CKEA 2UZEA 5GZ9A 2VTTA 4QP2A 1EH4A 3QYZA 3E7OA 2RIOA 4MH7A 3ZSIA 3NNUA 4AZVA 4EHZA 2OJ9A 3DJ7A 4IB0A 2PMNX 4PMMA 4C02A 2GFCA 4LOOA 4AS0A 1SMHA 4GU9A 1GZOA 2H9VA 4FV1A 2IZTA 5J87A 4J8MA 3VUIA 4PPAA 2EU9A 3CR0A 4I93A 4O6LA 5LOHA 3EN5A 2JDSA 3JYAA 4TN6A 2XIKA 2I0VA 3OTUA 3ZYAA 4MKCA 4YC3A 3DGKA 5FG8A 3FPMA 2VNWA 3RTPA 3QX4A 5IA4A 3NS9A 2AYPA 4H3QA 4A4LA 1Y6BA 4J97A 4OTQA 5TE0A 4M67A 3K5UA 4QO9A 2GNHA 3A7HA 4NZWB 2Z2WA 4HYIA 1Q5KA 2ZM3A 4IAAA 5H8EA 4BDEA 3HLLA 1ERKA 4JT3A 2ITOA 3DAJA 3BHVA 3UZTA 1P5EA 4FK3A 4X2KA 5BYZA 3R8MA 2QOFA 4P7EA 1DI9A 4LI5A 4XCUA 3NYOA 1JPAA 3CGOA 5AP3A 4ZSGA 2FSOX 3AMAA 2FSTX 2WQMA 3GU4A 2VWZA 5A4CA 1V0BA 2C68A 3UNKA 3F82A 5TR6A 1HOWA 4EQUA 3RM7A 4B8LA 4BTFA 4HYHA 3RHKA 4Q9ZA 5M55A 3LCOA 4KKHA 4QMSA 3NIZA 3LLTA 3ORZA 3C4EA 3DFCB 5A4LA 5CXZA 3ZO4A 3MN3A 1PMNA 5DA3A 5J9ZA 3BEGA 2WNTA 4FC0A 4FNXA 4FT0A 4YJOA 4ALVA 4ZTQA 5HD7A 4L68A 1NVQA 3NGAA 2G9XA 5I9YA 5KMKA 5FWKK 1WVWA 3MJ2A 4ZS0A 4C62A 4N6ZA 2PZIA 4L42A 3K2LA 2VTMA 2JBOA 3OUKA 5HIBA 1YWRA 2W17A 3A60A 5HG9A 4QMLA 3UQFA 2FO0A 4C4IA 4W8DA 1H24A 3DZOA 5A54A 4R5YA 3VHEA 4G6LA 5E8SA 3E62A 2QCSA 4G34A 2OJGA 3OCTA 2ZB0A 3KGAA 4FKLA 1UU9A 4MCVA 3MH3A 4AA4A 1DAYA 3DNDA 5DNRA 4I41A 3GOKA 4QT1A 2WQEA 3U8WA 4L01A 1H25A 3HV5A 4EK8A 4RX9A 2WXVA 3TUBA 2XJ2A 3F69A 3BBTB 3BYOA 4ZTLA 4DH1A 2V5QA 2YM7A 3RK9A 3BU5A 4CTCA 3R2BA 4BCPA 3MS9A 1OITA 5E8ZA 5HLWA 5E91A 4C33A 5A6OA 2IZRA 5I0BA 1PMEA 4YJRA 3VN9A 2B55A 4U44A 4W9XA 3DBFA 4ZSLA 5F1ZA 2EUFB 2X7GA 2XNPA 1QMZA 2QKRA 2Y6MA 4NUSA 3VBVA 4CFVA 5JKGA 2ITWA 2WMQA 5M4FA 4ZLZA 3ALOA 3PSCA 4IB1A 3GC8A 1IEPA 4GIHA 5CF8A 3QTUA 2WMVA 3RMFA 3OD6X 1M7NA 3MB7A 5JRSA 5DR6A 3QCSA 2QURA 2B52A 4A4XA 2C30A 4O0YA 3VUKA 4C34A 5CLPA 4L8MA 3DNEA 4JNWA 3MH1A 4AFJA 3NUYA 3FI2A 4AZTA 1OUYA 3NUPA 3TKUA 3LPBA 1Q3WA 3KXXA 2IVVA 2QO2A 2GHMA 2WMTA 1CKJA 3O50A 3R01A 4N0SA 4O0UA 1LP4A 5F95A 3ZO1A 1R39A 1REJA 3LQ5A 4G3FA 1S9IA 3AC4A 1FVRA 1VEBA 5GJDA 3KN5A 5AP4A 3MVLA 5AAGA 4PL4A 5HICA 4AOJA 4GG5A 2JDOA 2VNYA 4GFGA 5C8NA 1JQHA 2XIRA 4FKUA 3QRTA 2CGWA 4IWQA 2VTHA 5AR5A 4ZXTA 4EOJA 4LGGA 3L8SA 3ORIA 1YDSE 4FV0A 3CIKA 3IOKA 5BVFA 2REIA 3FXWA 4BDHA 3EYHA 4UY9A 4QYFA 2H8HA 2BAJA 2A1AB 5HU9A 4AZEA 5IDNA 3NUNA 3QUEA 3SA0A 5IEXA 4WT6A 4FV6A 4X3FB 4XG9A 1P4FA 2C6MA 3Q32A 3IQ7A 3R22A 3RINA 4E26A 4OBOA 2NRUA 4F08A 3QFVA 3RNYA 1YXTA 4EZ7A 3GBZA 4FEQA 2J6MA 4NIFA 4CCUA 4F70A 5FDPA 3RK5A 3E63A 3F61A 2JGZA 2RGPA 1W7HA 2ETRA 4O0XA 1WVYA 2VTQA 2WQOA 5CVHA 2VGOA 1W84A 4E4XA 5D10A 5L6WL 2YCSA 2OIQA 2R2PA 3IW8A 3KRJA 4NH1A 4QMZA 4BCNA 4E20A 1DM2A 2R3IA 1TQMA 4H58A 4P4CA 1U59A 4XP3A 2X2LA 4YJQA 3PSBA 3KN6A 5CTPA 3ZUTA 4YR8A 5JH6A 5F4NA 4U0IA 2A4LA 5L4QA 3F3UA 3TCPA 3Q52A 3PFQA 2EXCX 4BI0A 1OGUA 5J7BA 3CKXA 3OCSA 1UVRA 1UNLA 4EBVA 4FTJA 5M56A 4FYNA 3MSSA 2WMRA 3PJ3A 4K0YA 1W8CA 3H0YA 4GYIA 4QD6A 3TT0A 3ZFYA 3JY9A 2XKEA 2J50A 4PTCA 3ZOSA 4EOLA 3R8UA 1JOWB 4AN9A 3O96A 4OTWA 2PVJA 4NU1A 2QODA 4V0GA 2GMXA 4HZRA 3V8SA 2OH4A 4EQMA 5K3YA 1YXSA 4HVDA 3DK6A 3FLSA 4I24A 4Q9SA 1U5QA 3ORTA 2RFNA 5HCZA 5HG5A 3BHHA 1BX6A 2YWPA 5I9UA 1WVXA 5CAUA 4OAVB 5CF6A 4U45A 3PIZA 5EDRA 4LRKA 4GS6A 4E93A 3KXNA 4KIKB 3MW1A 4N4SA 5AAEA 4CV9A 4CFNA 3CC6A 4FX3A 5KE0A 3K3JA 1KV2A 2F2UA 2VWIA 4JQEA 4GU6A 4K6ZA 3BLQA 4C35A 5LVLA 3PJ8A 3Q5ZA 4J96A 5ETAA 2J0LA 2J0MB 1PKDA 2SRCA 2WU7A 3NAYA 1QPDA 4YLKA 1P2AA 4O0SA 4EC9A 1XH6A 3BYMA 3NPCA 3KRXA 5B7VA 3PP0A 3F2AA 4F9BA 2YJRA 4DC2A 3GVUA 5EW8A 3OZ6A 5LXMA 3ENMA 3GU6A 2UW6A 3E88A 1T46A 2E9UA 5AV3A 5AJQA 4IB5A 4HOKA 1URCA 5KBQA 1YHVA 2VWBA 3C5UA 4IXPA 4CQGA 3GOPA 3OWKA 3TACA 1PW2A 4BB4A 3TNIA 3PXQA 2G2IA 2RG5A 3QGWA 4AAAA 3TUCA 5CT7A 1CKPA 1KOBA 2QOBA 3NR9A 4X21A 3BGZA 1Z5MA 3AD6A 3OWJA 3HMMA 3TG1A 1OVEA 4RVLA 4QP7A 3ZDUA 2YEXA 3FSKA 4NSTA 5L2IA 2XRUA 2YCQA 3QF9A 2BZJA 4F7NA 4JRNA 3RZFA 3C7QA 2UZLA 3O51A 4M68A 2VWWA 4FT5A 4Y5QA 4ITJA 3HV4A 4ALUA 1H0VA 3QQJA 4X0MA 3UIXA 3M2WA 2JAMA 2UW0A 4Z55A 4XH6A 5HCXA 4ANQA 4Z7GA 1JBPE 1JKSA 4PX6A 3G9NA 4U41A 3R0TA 2X7OA 2W4KA 4MNEA 2UW5A 5FLFA 4G5PA 2RSVA 5KUPA 3ITZA 3CP9A 4FTRA 3KRRA 4D0WA 5B0XA 1UU3A 5BMSA 4UEUA 1ZYDA 4RJ8A 2ZMDA 2BIKB 5L6PA 3QQKA 3ROYA 1GNGA 3L1SA 4FKWA 4MF0A 4EK5A 5CEPA 3QRUA 4L00A 4CYJA 3FQHA 4CRSA 4ID7A 4Q5HA 5B2MA 3AOXA 4G1WA 5GNKA 4HVHA 1GZKA 2A19B 4A9SA 5JFVA 4XOYA 2WOUA 4OTGA 4YHTA 1BI8A 4BCMA 4Y46A 1YDTE 4FOCA 4M84A 3F7ZA 3NNVA 3TV6A 4TYEA 3EMGA 4WUAA 3QA0A 3R73A 4C38A 4FSUA 4CMOA 2OK1A 5FEEA 3C1XA 4RWKA 5E92A 2QONA 3BLRA 3D83A 3RVGA 5H8BA 4ANMA 1U54B 5J9YA 3EKKA 4I6QA 4C57A 1REKA 3GT8A 2C0OA 5A3XA 3GCUA 3ROCA 5DI1A 4ACCA 4E5WA 5BVWA 4DH7A 3PVUA 4AP7A 4DINA 3I81A 4M12A 2PE2A 1B39A 3L9NA 2W99B 3MVJA 3FHRA 3TJDA 3DCVA 2CCIA 3RWQA 5HVJA 2ITVA 4YSMA 1FPUA 3VW6A 3DTWA 3E3BX 3K54A 1XKKA 2ITUA 4Y85A 4E73A 4RC2A 4F1MA 3D5UA 2XYNA 1Y8GA 1W83A 3FL5A 3H30A 3MB6A 4K77A 5HNGA 5IA2A 1OL6A 1ZARA 2IN6A 3NUUA 4B7TA 5TF9A 4O27B 3FMLA 3U6JA 4RX7A 2ESMA 3PZHA 3DQXA 3T3UA 3KK9A 3UC4A 5IEYA 4H3PA 3HKOA 4AZWA 2W1GA 3ZH8A 3MVMA 2OXYA 3LXKA 3HECA 3IONA 4FIIA 2WIPA 4OTHA 4MXCA 3UDBA 4CMUA 2WQBA 5KZ0A 4P5QA 3ZHPC 4C37A 3E5AA 4L3PA 2J4ZA 3BQCA 3KL8A 4EUTA 2RKUA 5DE2A 3SAYA 4IVAA 3ETAA 5HQ0A 4O0TA 2EB3A 1O9UA 3OBJA 4I4EA 2BAKA 1RQQA 5EOBA 3E92A 3UP7A 4ZTNA 4NKSA 3U6IA 2ITZA 3H10A 4D0XA 4FTKA 5HG8A 4I0TA 5HZNA 3VJOA 3O8UA 2ZOQA 5HCYA 4E5BA 4FTIA 1KE9A 1NY3A 3F2NA 2X8IA 4R7HA 4WNKA 2O2UA 4MF1A 5H2UA 3D9VA 4BKZA 3Q04A 2VTRA 2JFMA 4YURA 1UV5A 2YJSA 4RLKA 2R3KA 4YLLA 3BYUA 2C0TA 4EH9A 1WBSA 4IIRA 2VU3A 3COMA 4BIBA 4Z3VA 4HPTE 4BWXA 5J95A 2XRWA 4ENXA 5GZ8A 4L45A 4BBEA 3S95A 5KMMA 2W96B 5HTBA 1V1KA 4AXAA 4O0RA 2C5YA 2YM4A 3AT4A 4RFZA 3R9NA 2OKRA 4C4GA 4IADA 2VWVA 3UNZA 4MXOA 5DR9A 1PHKA 3QWKA 3R28A 1VYZA 2X2MA 3KEXA 3UOKA 3E64A 4UZDA 1V0PA 4JI9A 2R0UA 1ZY5A 3JXWA 3UO4A 1P14A 4O38A 2IW9A 4F4PA 3Q9ZA 5JGDA 2ZDUA 2YDJA 3GCSA 2HXLA 2JIUA 3Q53A 2R3JA 4WOVA 2BRMA 3BELA 2HYYA 3AMYA 3VUDA 5JK3A 2UVXA 4IWOA 4FV9A 5EM5A 4DAWA 4X2NA 2JLDA 4KBCA 2YIXA 2ACXA 4MNFA 1JKTA 2JKOA 2P2IA 1Z9XA 5HX6A 3R9OA 4YJSA 5BPYA 4QNAA 3TZ9A 3DAKA 3KXMA 2QOQA 1GY3A 3COHA 2XP2A 3DPKA 3VF8A 1O6YA 1XH5A 2X6EA 4IM3A 5DH3A 1OL2A 5HNBA 3BGQA 5ETFA 3PA3A 2VTAA 3NW6A 2WGJA 4NW6A 1OPLA 4FA2A 2J0KA 3ODYX 4BHZA 4NTTA 1OL1A 5T6KA 3V5LA 3EFKA 4TT7A 4ZTHA 2ITQA 3R7YA 4ZTSA 1XH8A 1QCFA 3TNWA 3VUMA 1BUHA 3PPJA 5F9EA 3AD5A 3P08A 3LCKA 4LMUA 2C6DA 1YXXA 4D55A 1PXKA 4PV0A 3EYGA 3W33A 3BWFA 4NTSA 1XBCA 4BTJA 4D1SA 4IZYA 5CS6A 2E9VA 2PMLX 5C01A 3FY0A 2FSMX 4IX3A 4Z16A 3V5JA 3H9RA 1XBAA 3HUBA 5CU3A 3F5XA 3FJQE 4KABA 3JS2A 2BFXA 4I21A 3UE4A 3QUPA 4EHGA 5BVKA 4JBOA 2OFVA 4K11A 4EONA 3KRLA 2XM8A 3L9PA 4IMYA 2B53A 2W1DA 4FZDB 4BIDA 2BALA 3DKCA 3HA8A 2W05A 3GC9A 2YCRA 1WAKA 5HO7A 4HVGA 3HMOA 5AUWA 3AGLA 4PUZA 4WBBB 1MRUA 4I20A 4PWNA 2QHMA 4WKQA 5EK7A 3QKLA 4H1JA 3TN8A 5LCJA 5BUEA 2NO3A 2QVSE 2YITA 3FZTA 3UVPA 4UMQA 3VS1A 3CBLA 5CT0A 3LW0A 3CQUA 2WTCA 2F49A 2C47A 4AT5A 2YERA 1TKIA 4BDBA 4AFEA 2BRBA 2CN5A 3C0IA 4H39A 4RVMA 4EH5A 5LCKA 4QMNA 3JVSA 2HY0A 3U87A 4JR7A 4DEGA 4BGQA 4D2TA 4G5JA 3VC4A 5A6NA 5IG1A 4O2PA 4TTHB 1PKGA 4Y73A 2LAVA 3PIYA 1X8BA 3KMWA 3FMMA 5T68A 3EFLA 2G1TA 5L2WA 3T8OA 5EM8A 3QQUA 5AUZA 3DKGA 3WI6A 4EOSA 4OUCA 3TWJA 4XUFA 4NM7A 4ZJVA 4YZCA 3Q2MA 4FTMA 2WMXA 3ACJA 3FZRA 3NCGA 4KRDA 4EOIA 1B38A 1AD5A 1ZMUA 4KB8A 5AADA 3U6HA 2WB8A 3I7CA 4J99A 2VUWA 4RGJA 4M8TA 4F7LA 2HENA 4XV1A 5CVFA 3WIGA 5TT7A 1XR1A 3L9MA 4ACGA 2EXEA 4I6HA 3QTIA 3DZQA 3R02A 3GGFA 3D5XA 3KU2A 3ANQA 3TUDA 4K9YA 3SW4A 1O6KA 3PYYA 4ZK5A 3LE6A 3WIKA 3R8PA
chains in the Genus database with same CATH superfamily
5ICPA 4GVJA 3GCVA 1GJOA 2BKZA 5C27A 1KWPA 2WFYA 4IC8A 4P2KA 1OPJA 5IH5A 1XBBA 1MQBA 4X6QC 2ETMA 3SLSA 4ITHA 4D28A 2ZYBA 4I22A 3CQEA 4RSSA 1Q97A 4IZAA 4TYHA 3QRKA 2XIYA 3LFAA 1PMUA 1SVGA 4IAYA 3PRFA 3MFTA 4QYYA 4U3YA 4IVDA 1Y8YA 5IKWA 2DWBA 2W5BA 4G3DA 3OOMA 5AP0A 3W55A 3C51A 5E90A 4M69B 3RM6A 3IK3A 2QOOA 5EYCA 4ZLYA 3O17A 5M57A 1PYXA 3LZBA 4NEUA 3EB0A 3TXOA 1QL6A 2XK7A 4JBPA 1GIHA 4QQCA 4PP7A 2C6OA 4WUNA 5AP2A 5CENA 3UOLA 3PE1A 4A06A 4OT5A 2A27A 3UC3A 4QMMA 2O63A 1Q8YA 2W1ZA 4JX3A 1UWHA 5GHVA 4X2FA 4AX8A 2BTRA 4RZVA 5JQ5A 3LCDA 4XP0A 4UB7A 2YN8A 3CY3A 2JKMA 4RFMA 3SDJA 2UZTA 1KE8A 2YAKA 5AUVA 1ZZ2A 4X3FC 4PPCA 3ZCLA 2AUHA 1ZAOA 2R3OA 2VO0A 3WF7A 2FGIA 3SQQA 4ENYA 4BVUA 2VGPA 4MK0A 5CNOA 4XEYA 5FM3A 3HRFA 4BCQA 3PUPA 3MJ1A 4TL0A 4M13A 2OIBA 3H0ZA 3IPHA 1J91A 3GQIA 4BDDA 1FMKA 2HZ4A 4NK9A 3DB6A 4WA9A 4A9RA 3ANRA 4W4XA 4YSJA 4E6CA 2X0GA 3OP5A 5HD4A 4G6NA 1ZOEA 4R3PA 1WMKA 2PZYA 3FLQA 4W4WA 2XKCA 3UOHA 3A61A 3OW4A 3I5NA 1UU7A 4CFXA 1Q24A 2BRNA 2PVKA 2OH0E 3V6RA 4EBWA 1QPCA 4RT7A 4QP3A 3CJFA 3DJ5A 5KCVA 1PXMA 2GHGA 1YOJA 3AC3A 5J8IA 4AU8A 4C3FA 4EORA 3SXSA 3FDNA 4CXAA 4QMTA 2QC6A 2W1FA 5M53A 1DAWA 4E8AA 3FKOA 4QTAA 3IW7A 3PPKA 1CKIA 3VRZA 3DS6A 2F7EE 2R3RA 3DB8A 3EH9A 5AX3A 3MBLA 5C8KA 4BBFA 3JUHA 4ERKA 2PWLA 2E2BA 1KE6A 5EI2A 3QCYA 3WE4A 4AE6A 4C4JA 3LFSA 1H1RA 5CU2A 3BZ3A 3OFMA 2I6LA 2WEIA 1XH9A 3FKLA 3F88A 2E9PA 3MIAA 4KWPA 4D5KA 3V5PA 2V55A 3PA5A 4XX9A 2B4SB 2Y0AA 3M42A 5FRIA 1URWA 4AUAA 4GH2A 2CGUA 3UPZA 4NCTC 4YJVA 5IMXA 2OF2A 3A7JA 5H9BA 3HMPA 3PE2A 5CALA 5K4IA 5HNIX 2WAJA 4ANNA 4FVQA 3E7VA 1YOLA 4AWIA 4G6OA 3FLYA 5EW3A 4K8AA 2C5XA 3KY2A 4IANA 3DLZA 2GU8A 3IO7A 3NCZA 3MA3A 2XS0A 4E1ZA 5CANA 5CSXA 4QQJA 3LXNA 4MXYA 4O0WA 2BTSA 3U4UA 4BWPA 3V01A 3VS5A 1ZZLA 4FTLA 1U5RA 5HTCA 5L2TA 3DK3A 4DEEA 3D15A 2ITTA 3K5VA 4AT3A 4MAOA 2IVSA 3KVWA 3CPCA 2PVHA 2QD9A 4FKGA 2XBAA 5I3RA 4O21A 3F5PA 3WF6A 3ZO2A 4B8MA 3WILA 5HO6A 4DH5A 4I5MA 2XF0A 3WZKA 3VQHA 5CF4A 5KMNA 4FZAB 3DXNA 4J95A 3NYVA 3R9HA 3R04A 5JZNA 5IPJA 3R1QA 3A62A 3MH0A 4WO5A 5CSPA 3MFUA 3KC3A 3PG1A 2OU7A 2QNJA 4BTKA 2WTKC 2O65A 5JRQA 1H1QA 3BLHA 5HU3A 3H9OA 5AR2A 2J51A 1YVJA 3HL7A 3OY3A 1W2DA 1ATPE 4R5SA 1JSUA 2J9MA 2W0JA 2Y8OA 3DLSA 4RMZA 5CWZA 2I0YA 2VO3A 5AV2A 2ERZE 3P86A 4B99A 2JIVA 4QMPA 5CEOA 2W4JA 1QPJA 3KF4A 5DLSA 5J7HA 3QTZA 1VJYA 4CNHA 2O5KA 1AQ1A 3HRBA 4R6VA 3EKNA 3GU7A 3GFEA 4K2RA 2XB7A 5A4QA 1I09A 1R0EA 2OSCA 2HCKA 3FMKA 3NLBA 3TTJA 5JZJA 2IW8A 3VUTA 4MHAA 4F99A 5I9XA 4U6RA 4GUEA 4H3BA 4RBLA 3FV8A 3ORNA 2Z7RA 3EL7A 3NW7A 4KS8A 1VZOA 5IA5A 3ZLWA 4CKIA 2C3JA 5EYMA 3OWLA 1OKZA 2R7BA 5ETIA 2YABA 4ZZNA 3BE9A 4IFCA 2C1AA 5IA0A 3BE2A 3LVPA 3RK7A 3W2RA 4RIXB 4GG7A 5HE2A 5D1JA 3WZEA 4CSVA 3FLWA 2WOTA 4FGBA 4KRCA 1HCKA 2YCFA 3IOPA 4EH2A 4FF8A 4BDFA 4ITIA 2DS1A 4JBVA 5IZFA 2F7ZE 2JIIA 4ZTMA 3T9TA 4FSZA 4GEOA 1YXVA 2HZNA 2QU6A 2QR8A 3N51A 4QTBA 5AM6A 5E8XA 3TEIA 2P55A 4BCFA 4EJNA 2BDWA 4ANBA 4F9CA 5IH6A 1SM2A 3I5ZA 3EN4A 3FQEA 2X1NA 3QYWA 4FI1A 4IACA 2GNGA 2XNNA 1H00A 1BL6A 3Q9YA 5DHJA 3IG7A 4I0SA 3O8PA 3QD0A 3MH2A 4S2ZA 5JEBA 2DYLA 3Q96A 3MTFA 2Y6OA 4HJOA 3E93A 3NRMA 4IEBA 4CFWA 4ASXA 2ONLC 4IE9A 4HYUA 3NIEA 4IZ7A 1LEZA 2P33A 2JFLA 4RJ6A 4QP8A 5EI6A 4RIYA 4CLJA 1WBTA 4YUQA 5FXRA 3OUNB 1MRYA 1Y91A 2HK5A 2W9FB 5HHWA 4BDCA 4JVGA 4MWIA 5LQFA 2VTLA 5D12A 3OW3A 2XCHA 3BBWA 2X9EA 3WF5A 4NM3A 4TZRA 3OY1A 3P9JA 2AC3A 4YGAA 4YPDA 3RPYA 5KMOA 4RIWA 3CGFA 5A46A 4C4HA 3DY7A 3NW5A 3CKWA 3QX2A 3AXWA 3ZC6A 2R3MA 2R3GA 4GVAA 5C03A 3P78A 4TYIA 2J90A 1JAMA 3OTVA 3PG3A 2GFSA 4G9RA 3G90X 2AQXA 2VO7A 2W1IA 3HEGA 2XEYA 3OS3A 1W2CA 4IDTA 1TVOA 5BX0A 1JLUE 3KMMA 2IF8A 2P4IA 5IISA 4JAIA 3HGKA 4Y8DA 1RJBA 2GS2A 3DBQA 5EM6A 3PY0A 3AT2A 3OG7A 4J71A 2C6KA 5CXHA 4AW1A 4B9DA 5EM7A 3UNJA 3HUCA 4RX5A 5DOSA 2OO8X 2ZV9A 3PXZA 4WIHA 4A7CA 4AGUA 2UW9A 2CGVA 4YC6A 1E1VA 3A2CA 2QOIA 3ZBXA 2VO6A 5JFXA 2R3PA 2VTPA 3OOGA 5A4EA 2BDJA 3I60A 4HVIA 2WMWA 1STCE 4O4CA 1M17A 4UWBA 3OCBA 5BUJA 2XBJA 1UNHA 4UMUA 4FZ7A 3CTQA 3ZLSA 3M11A 4O1PA 2YA9A 3VF9A 5IUGA 4FSQA 4S33A 2VWYA 4BHNA 3UG2A 2QOCA 3SRVA 4UYAA 2JD5A 4YPSA 4RQKA 5HBJA 4Y95A 4U79A 3MTLA 4L52A 3EN7A 4AT4A 5CNNA 4GJ3A 3VUGA 5CZIA 3GCQA 5DEYA 3ZXZA 2VAGA 3TV4A 3GQLA 5M44A 4RRVA 2X2KA 3DBDA 2QU5A 1WBPA 4D4SA 3DKOA 3GP0A 3GI3A 5AUTA 5EYDA 5FTQA 1G5SA 4C59A 4C61A 4F9YA 3EQDA 3FE3A 2ZMCA 3UVRA 5AUXA 2WMAA 4JQ7A 4CTBA 4DFXE 2I0EA 3BRBA 5FEDA 3G51A 2C1BA 3W10A 3RPRA 4E7WA 1BL7A 3D94A 2FYSA 2PZRA 2WTKB 4JDKA 4CT1A 4USDA 4ZLOA 4I92A 5CSHA 4KBAA 4FYOA 4MXAA 5K4JA 1YDRE 2EB2A 4AN3A 2RL5A 3ORPA 4MBJA 4QNYA 5DBXA 5JT2A 3E8NA 2YISA 2ZV2A 4BBMA 4C36A 4FIFA 3I4BA 5CSWA 2UW8A 2C3KA 5CY3A 3UVQA 4MD8E 3QD4A 3SV0A 4Y72A 4RZWA 4BYJA 2J7TA 3WE8A 2QHNA 1YI3A 3EN6A 3LFQA 5G1XA 1OIRA 2G01A 1YXUA 2F57A 3BKBA 3L8VA 3OMVA 2B1PA 4D4VA 4FTCA 1TQPA 4A4OA 2RFDA 3C9WA 4IW0A 4CQEA 3EFWA 4QRCA 4KSQA 4U3ZA 5CASA 2UV2A 3VO3A 1FINA 2VX0A 3ZUVA 2ZV8A 2RF9A 4FV5A 3LM0A 3OVVA 5KNJA 5IF1A 4FTQA 2FB8A 4FL3A 2B9FA 4ZY4A 2FSLX 3FZPA 3FL4A 5HKMA 2XK3A 5J5SA 4XRLA 5HX8A 4PRJA 2IZSA 5M4UA 2I1MA 3JY0A 4JR3A 3LMGA 5K5XA 4P5ZA 1ZOGA 3R7EA 1H26A 2X81A 3EQIA 3FZOA 4ZSEA 3SXFA 2CDZA 4X6RA 4IAZA 2JITA 2QO9A 3DK7A 5EYKA 3COKA 4XYFA 5HORA 2ITXA 3DFAA 4ACHA 3NZ0A 3UMWA 5AWMA 3PVWA 4R1YA 4RWJA 1Y57A 3BPRA 3ZO3A 1CSNA 4HGSA 4YTCA 4IJ9A 2HZIA 4ONAA 4E6AA 4PL3A 4MVFA 5CVGA 4F65A 1ZXEA 3BU3A 4DYMA 4EZ3A 2Y4IB 3BV3A 4GMYA 3TV7A 3NUSA 3P5KA 3GU5A 4PQNA 3ALNA 2V7OA 4U97A 3TNQB 1PXIA 4YU2A 1Q8ZA 1Q3DA 1Q4LA 4CEGA 3VJNA 1OIYA 3FMHA 4BICA 4ZIMA 1SYKA 2X7FA 2XJ0A 4OTFA 2GCDA 3R1NA 2V7AA 4FNWA 5KX8A 3BX5A 4QYHA 4D2WA 2C6EA 1S9JA 2C6LA 3BYVA 4W4YA 5AIKA 3SHEA 4FNYA 4EOKA 1Y6AA 2GS7A 3R00A 4DEBA 3QXPA 5D7AA 4E3CA 3QHWA 3A7FA 3MGYA 2BRGA 4FTUA 2XNMA 2EWAA 5CAVA 4L46A 2VV9A 4AZFA 2XK8A 2X4ZA 4LRJA 4CKJA 3I7BA 2F4JA 4ZEGA 5I9WA 4EK3A 4XBUA 4DG0E 2WD1A 3NUXA 3UODA 4C0TA 3GFWA 3ORKA 4EH3A 2BHEA 4EHEA 2HOGA 2P2HA 4DGLC 4GV1A 2B54A 5D9HA 4Y5HA 3PXRA 3LFEA 3TZ7A 3E8EA 4IWDA 2CHLA 4M15A 3EN9A 4AG8A 5C1QB 5JQ8A 2QQ7A 2QOLA 2DQ7X 2A0CX 2UW3A 2PVYA 1W98A 2W1EA 4IHPA 3PSDA 5EHLA 4UALA 4QP6A 5JMSA 4I6FA 1APME 1A9UA 4FV3A 4UBAA 4IJPA 4X3FA 5CQUA 4ASEA 5L2SA 5IEVA 4ZZMA 5HE3A 4J98A 5AMNA 5DRBA 4KKEA 4AF3A 4DTKA 3B2WA 3IECA 4RJ5A 3HRCA 4FKQA 4XV2A 4ASDA 2CCHA 4XG2A 5TO8A 5EKNA 3OROA 4DGMA 1FGKA 3OXZA 4BF2A 4LOPA 2R5TA 3ZUUA 4FTTA 3RALA 2G2HA 4D2PA 3LJ2A 5HBEA 4F63A 4FSMA 4O6EA 3FPQA 3CPBA 5HIEA 3Q9WA 4AE9A 5LARA 3FI3A 2W7XA 3EWHA 2CPKE 2PVNA 4JDIA 4CZYB 2OZAB 3EFJA 3OXIA 4QP9A 5K9IA 3V8WA 3PTGA 3W32A 1H07A 2YDIA 2Z60A 4RJ4A 1ZYSA 4FKJA 4CD0A 1OL5A 4EYJA 5HBHA 3OEZA 3S2PA 4N70A 5LVPA 2R3NA 4XG3A 2UZNA 2G2FA 4FV7A 3OHTA 4WD5A 3K3IA 3KULB 4NFNA 5EG3A 3RCDA 4CZUA 4DH3A 4F64A 4OBQA 2V62A 4QYEA 3GNIB 4CRLA 5BNJA 4U81A 4AGWA 4UMRA 2I40A 5HO8A 4TW9A 1JVPP 5EHOA 2BPMA 3LJ1A 4GCJA 3TTIA 3PP1A 3D4QA 3PVBA 4MXZA 1UWJA 3T3VA 4CV8A 4IVCA 4K18A 5LMAA 4EH4A 2IZUA 3NNXA 1WBNA 1OUKA 2BILB 2BHHA 4KIKA 2W1CA 2WHBA 2CLQA 3D0EA 4TPTA 2EVAA 3MA6A 3POZA 4UYNA 4CFMA 5BVOA 1OPKA 2OJJA 3DV3A 3QGYA 4WG4A 4E4MA 5FXQA 3WARA 2YHVA 3PJ2A 4M3QA 4IH8A 1KOAA 1FVVA 2JC6A 4MX9A 1MQ4A 3R2YA 2IW6A 4OTRA 1K3AA 4DFZE 5DG5A 4BZOA 1DS5A 3BQRA 3IW6A 4C2VA 4R7IA 4E6DA 2JDRA 2OICA 2X6DA 2Y4PA 4E5AX 1FVTA 1GZNA 3ZSHA 4FSWA 1OKWA 4LL0A 4I5HA 4M0ZA 2PL0A 2CJMA 4I5PA 4XNEA 1J1CA 4NWMA 2YFXA 2X8DA 3S00A 3O0GA 3AG9A 5DT3A 3MFSA 5AV0A 4FKTA 4LG4A 4DFNA 4QPSA 1ZMWA 4HZSA 4L53A 4PMSA 1Q8UA 1Q8TA 1R1WA 3EIDA 3OT3A 4XG6A 4EI4A 3W2CA 5HGIA 4EL9A 4XMOA 5A14A 5FBOA 2H96A 2X0PA 3QRJA 1G3NA 2WMBA 3FZ1A 1YI6A 3RJCA 1UA2A 3BIZA 3W2PA 4TRLA 3CCNA 1SNXA 3R9DA 3DOGA 2A2AA 2PVLA 1LPUA 5FP5A 3UQCA 4U42A 4XV3A 2WTVA 3DTCA 4DEAA 5M4IA 5AAFA 2XZSA 3LFDA 2R3QA 4IX6A 4EZ5A 5CQWA 4YZBA 4FKRA 4FICA 3TNHA 3FI4A 3NWWA 4JDHA 4JL9A 5ANKA 2JAVA 2R64A 4GT4A 4HCTA 4G16A 5BYYA 2UW4A 4C2WA 3DDQA 3UP2A 4G3CA 5DR2A 1OKYA 2BCJA 4C4FA 4F0GA 4E6QA 4BL1A 2XA4A 4W9WA 4DN5A 4F9AA 5LWNA 4YBKA 5CSVA 3KQ7A 1DI8A 3RHXA 3KFAA 4F0FA 3G2FA 3F66A 4M14A 4JDJA 3PWDA 3KB7A 3FMDA 4TWCA 3L8XA 4R3RA 4USEA 4R1VA 4JBQA 4EEVA 4B4LA 2JDVA 2ZM4A 4V04A 3A99A 2J2IB 1YW2A 1YWNA 2PK9A 3BHYA 4CMTA 4YJUA 2FVDA 4RWIA 3CXWA 4TY1A 3I79A 1U54A 4I4FA 2ZVAA 5EKOA 4XHKB 4Z7HA 3KXGA 4NJ3A 3AT3A 2WTIA 2C3IB 4JOAA 4LGDA 4YNOA 3B8QA 3WOWA 4EH8A 4UMTA 2BRHA 5HIDA 3NAXA 3ERKA 3BGPA 3RAIA 2E9NA 4AOIA 3R7UA 3QLFA 1NXKA 3DAEA 4GSBA 1YQJA 1R0PA 4UV0A 4BKJA 4ACDA 3DDPA 3UIMA 3I0OA 4JAJA 3OXTA 3R63A 4K33A 2KTYA 4I5CA 1CTPE 4UX9A 1OECA 4WNOA 4BFMA 5FEQA 1E1XA 3PZEA 5ACBC 1SZMA 3PY1A 3ZU7A 2F9GA 2OIDA 4CKRA 5J1WA 2WTJA 4BRXA 2G15A 3JVRA 3FAAA 1CDKA 3QQFA 3P4KA 4HCUA 4RG0A 4IAFA 3U9CA 4QOXA 2WEVA 4BZNA 1H01A 3Q4TA 4IZ5A 1F0QA 4PNKA 5I5ZA 3HZTA 3QZGA 5GJFA 3SXRA 2BZIB 4IVBA 2OJIA 5TKDA 2J5FA 4TYGA 2VTOA 3VW8A 4MYGA 4TYJA 2R0IA 4UWCA 3VBYA 3FMJA 3QZFA 3GEQA 3AC8A 5CX9A 1Q8WA 2W06A 4MXXA 3UO6A 3O7LB 4PMPA 2IO6A 4RFYA 5IUHA 1IRKA 4CFFA 3CTJA 3E8CA 3PLSA 4EWQA 2XK6A 3D7TA 4Q2AA 4JX7A 4TWPA 4MD7E 3R1SA 2Z8CA 3AC2A 3RGFA 4DBNA 3DBCA 4NIFB 3ZEPA 5J9LA 4DFLA 2XYUA 3C4XA 4O1OA 3ZSGA 5I9ZA 4OTDA 2XMYA 3CS9A 3S4QA 2JBPA 3MIYA 3SOCA 4S30A 5BQ0A 4YJPA 3KXZA 4F9WA 5HVKA 4FOBA 3ZRKA 1M52A 2JKKA 3OT8A 2OXXA 1CM8A 5ANJA 4HW7A 3QKKA 5EDPA 5L2QA 3Q4CA 1T45A 4X2JA 5A4TA 4FSRA 4QMWA 5E8WA 4MQ1A 3V04A 3UBDA 4QPAA 4DEDA 1RDQE 3I6WA 5FXSA 4F6SA 2GDOA 4DG2E 5K5NA 1LR4A 2BDFA 3W16A 2R3LA 3QC9A 2XK9A 3C0GA 4QMOA 5AR3A 1TQIA 3CE3A 4ZJIA 5T3QA 2PMIA 5FQDC 1MUOA 3EQHA 1BMKA 3HMNA 4WSYA 3W2SA 4BI1A 4ARKA 4BDIA 3ODZX 4OTIA 4AA0A 1VYWA 2O3PA 3G6GA 2VN9A 1YRPA 1M2PA 3EQFA 3O71A 4EYMA 2XVDA 3MFRA 2XKDA 4V0GB 3QCXA 5CYIA 4YP8A 5DIAA 3TJCA 3QC4A 4DLIA 1MRVA 2FH9A 4FTOA 2Q0BA 1OZ1A 3Q5IA 4JG6A 2WTWA 5CEIA 3GENA 3DA6A 4WRGA 3OC1A 3A4PA 3G5DA 3NYNA 3VS3A 4X7QA 4DITA 3W8QA 4DGGA 1XH4A 4YZ9A 4BWKA 5HE0A 3V5TA 4BN1A 3LCSA 4X3JA 2JEDA 4XOZA 2IVTA 4EH6A 4EHVA 4BCOA 3U4WA 2YM8A 4XRJA 4RA5A 5IDPA 4YLJA 4BIEA 4LL5A 4RVKA 2X39A 4BI2A 4ZY5A 3LQ8A 5E8TA 1BKXA 2FUMA 2I0HA 5HOAA 1F3MC 4D4YA 3VS2A 3AQVA 4OGRA 4XLVA 4QQ5A 5I9VA 1ZMVA 2J0JA 2VTIA 3PY3A 2O64A 2PUUA 4U8ZA 1GOLA 2Y9QA 4FSTA 1YWVA 4ALWA 4EK4A 5LMKC 1A06A 1M2QA 4FT3A 2Z7LA 2GNLA 4I0RA 3FYJX 4YBJA 5IMEA 3LXLA 3MYGA 2AC5A 3IDBA 1JNKA 5L8KA 4FKOA 4C4EA 1B6CB 3AD4A 3WZJA 4DCEA 2CLXA 3D2IA 3QD2B 4G9CA 3Q6WA 1WFCA 3LM5A 4YMJA 4IC7A 5AP7A 3V5WA 1KSWA 2JDTA 3VAPA 3EQBA 2OGVA 3EL8A 3HV6A 4PDPA 5J1VA 4PDSA 5C8MA 4WG5A 4FL1A 5D41A 4HGTA 1ZRZA 5AM7A 3VHKA 2VX1A 1W0XC 3DT1A 4DEHA 3UOJA 5AIRA 1PXJA 1ZYLA 5DEWA 2V22A 2C5NA 2ZAZA 4J7BA 3UPXA 3HMIA 4YO6A 4MNEB 2BR1A 4Y83A 1NVRA 3FMEA 1XO2B 3MPAA 5FBNC 4YJNA 2BROA 4UXLA 3R6XA 5EDQA 4OLIA 3H3CA 3W1FA 2QR7A 2WKMA 3S0OA 2HELA 3BCEA 2VWXA 4LV8A 2IWIA 3FKNA 4MTAA 3VS7A 5IU2A 2BMCA 4FR4A 3KXHA 3KCKA 1BYGA 4YZDA 5C26A 3TI1A 5M4CA 3KK8A 2BFYA 1J3HA 2VRXA 2OG8A 3HDNA 3VS6A 4BCIA 3BEAA 2E9OA 2ITNA 1BI7A 3R8LA 2OW3A 2Z7SA 2BAQA 1RW8A 2H6DA 3EQCA 2XUUA 5DVRA 5IA3A 3Q4UA 1Q41A 4XJ0A 3LXPA 3FMNA 5FTOA 3V6SA 4J52A 3MY0A 4GFMA 5ANDA 3A8WA 5AP6A 3UZPA 5JFSA 4FV4A 2C5OA 4IX5A 1I44A 3V5QA 5E1EA 2ITYA 1ZWSA 5L3AA 4XS2A 3C0HA 3VUHA 4ERWA 2Y4IC 4M97A 3E87A 2Y7JA 4CCBA 3HP5A 2W4OA 4FZ6A 2ZDTA 3TKIA 3A8XA 1PXLA 2BZKB 3R8ZA 1PXPA 2VTNA 3CD8A 3QTQA 3F7WA 5JSMA 2OJFE 3RWPA 3EZVA 4M66A 3AC5A 4FIHA 3PJ1A 3ET7A 4IFGA 3WZUA 2R4BA 4A9UA 2EXMA 2X0QA 4FKPA 3C4FA 4FT9A 4RQVA 2YZAA 2PSQA 1IR3A 2UVZA 4J1RA 2LGCA 3REPA 1M2RA 3WF8A 1H4LA 2GS6A 3MPMA 3TL8A 3QTRA 4AGDA 1UKHA 4M7IA 4U7ZA 3G9LX 5EHYA 4BKYA 4EKKA 4F1OA 4GJ2A 5M51A 1XJDA 4PTGA 4CLIA 2GNIA 3WYYA 2NPQA 3P7BA 5CI7A 4YJTA 3TIZA 3PXKA 4M69A 4ACMA 2OXDA 4ZSAA 4YHJA 3F3WA 5CAOA 4NW5A 3ZXTA 4YNEA 1PXNA 2CMWA 4D1XA 2R9SA 4PPBA 3GB2A 1H1PA 2H34A 2WMSA 3OCGA 4WNPA 5A9UA 4LYNA 1H8FA 1H08A 4L43A 1Q62A 3C13A 3RZBA 2YIQA 2CN8A 2CSNA 5ANIA 1PMVA 5DWRA 4MWHA 3BWJA 3C4ZA 3R8VA 4YZMA 2OWBA 4HGLA 3PRIA 1LUFA 2W9ZB 3GXLA 5BVEA 5L6OA 2YIYA 4QMVA 5FGKA 4BTMA 3ZLXA 4LRMA 4RWLA 4J8NA 2HZ0A 2OZOA 3G0FA 1BLXA 2OF4A 3C4WA 3R83A 2HIWA 3QTXA 2C5VA 3R30A 5KMLA 3Q3BA 3Q6UA 2B7AA 2XNBA 5K0XA 3EHAA 4LUDA 3TIYA 4AACA 3O23A 1VR2A 4MBLA 1M14A 1U46A 3PPZA 4JG7A 3WYXA 3P0MA 2PVRA 2QLUA 2C6TA 1YI4A 5CEMA 3F3VA 2QI8A 3IKAA 3MY5A 4PNIA 3BU6A 2YM3A 4HYSA 3FWQA 1OB3A 1V0OA 4D9UA 3C50A 4CT2A 4YZNA 3TZMA 2XEZA 1UU8A 3IDCA 1AGWA 1R78A 2C4GA 2Q0NA 3MI9A 4C3RA 4V01A 4JQ8A 2Z7QA 3RAHA 2VTJA 4FVRA 5J79A 2C3LA 3DU8A 4IAIA 4IX4A 3LFNA 3DBEA 4QTDA 2R7IA 4KKGA 5TOZA 3HV7A 3SC1A 1P4OA 3TNPC 3ZTXA 3RPOA 3F5GA 2QOHA 4BDKA 3GUBA 4DFYA 3VBTA 3ZZEA 1PJKA 4F6UA 3H4JA 4YHFA 5AP1A 3THBA 3ORXA 5HG7A 3EQGA 4GFOA 3W18A 3M1SA 2NRYA 2HW6A 2X4FA 1J1BA 2PMOX 4AW2A 4BGHA 4L7SA 4N6YA 5DT4A 2OI4X 4QPMA 1TZDA 3FYKX 3CEKA 4G3EA 4E4NA 3R7GA 4PMTA 3WF9A 4AGCA 3VWAA 4O0VA 1Q99A 1JKLA 4FV8A 4CYIA 4RVTA 4UXQA 4FUYA 2XK4A 4GIIA 4ZP5A 3D5VA 4C7TA 3QQLA 4GYGA 5FDXA 5KZIA 4YTIA 3HA6A 3SVVA 3UGCA 2IVUA 4FVPA 1SNUA 4BDJA 3EJ1A 1OIUA 4V05A 4F09A 5CU0A 4YC8A 3OWPA 3EOCA 4G2FA 2PHKA 4MBIA 3VIDA 4R3CA 5E8YA 2UZWE 3GC7A 2B9HA 4QMYA 4WNMA 2PE1A 3BHTA 3LAUA 4UZHA 4R8QA 5H8GA 4YTFA 4JS8A 2WZJA 4FTNA 3PIXA 3QTSA 2R3FA 3P1AA 4FG9A 3BYSA 4KINA 4HNIA 4BZDA 4IBMA 4F7JA 3VS0A 1XHAA 3LFCA 4NKAA 2WMUA 2HWOA 3KVXA 4OT6A 4TNBA 4I6BA 5ACKA 3LCTA 1ZY4A 4FBXA 2IEWA 4II5A 3AC1A 3JPVA 4EH7A 3ACKA 3QWJA 5ANGA 4FKSA 1E9HA 3QZHA 3NX8A 4IWPA 2WIHA 1WCCA 4BDAA 2KULA 2UZVA 4TXCA 2R3HA 4RC3A 5EI8A 4S34A 4WBOA 4WSQA 4F0IA 1NA7A 1WBVA 4BC6A 3ZONA 4QMQA 1ZOHA 4QTEA 5AUUA 5GZAA 2C6IA 4ZY6A 4BYIA 1H27A 5EW9A 2FA2A 3KRWA 3SD0A 3ULZA 3ZFMA 2XM9A 3HVCA 1IASA 1LEWA 3IGGA 4D2RA 4IM0A 5KHXA 2ZB1A 4RIXA 4O96A 3LFBA 3I0QA 3UIBA 5I4NA 1L3RE 4APCA 3QLGA 4FIJA 4JRVA 4FODA 2VWUA 5I3OA 4DLJA 3CY2A 1KE5A 3QKMA 3QD3A 3R71A 1YKRA 4KIQA 1JKKA 2VZ6A 5ANOA 3CD3A 3ZS5A 4C58A 4FL2A 2QLQA 2P3GX 4RIOA 5D11A 5JGBA 3T9IA 4ANOA 4AN2A 4EOMA 1SVEA 2F7XE 3F3TA 3H9FA 3PJCA 1YOMA 4FSYA 4UWYA 3NYXA 4U9AA 3UMXA 3DQWA 2YACA 3FC2A 4TNDA 1PF8A 2B9IA 1QPEA 3I1AA 3MV5A 1W2FA 4GK3A 4XG8A 5DPVA 5G6VA 4F7SA 5KBRA 1XWSA 2GNJA 4O91A 5CI6A 1NVSA 4JLCA 3ZEWA 3F3ZA 4FV2A 4QP1A 2YLFA 1YHSA 3U51A 4B6LA 4FNZA 4U80A 3VS4A 3D14A 3UG1A 5LWMA 2OBJA 3G33A 4IDVA 3ZZWA 2YAAA 2XIZA 3L8PA 5HEZA 4FKIA 4MQ2A 4QMXA 5JFWA 3ZFXA 3B8RA 1H1WA 1MP8A 2GQGA 3O2MA 5HTIA 3Q9XA 2XNEA 4OBPA 1OL7A 4TYHB 4H36A 2GTMA 2P0CA 5AV1A 4EWHA 3F5UA 5AX9A 4A9TA 2YLEA 2WO6A 2GNFA 5L8LA 3EQRA 3PWYA 3IW5A 2QOKA 2UVYA 2UZOA 3POOA 4KBKA 5AR4A 4XBRA 2BUJA 5DGZA 4D2SA 4ZZOA 3IW4A 3GCPA 4LQMA 5C9CA 3SX9A 4USFA 3I6UA 4LM5A 4LUEA 3R7IA 4XV9A 5L8JA 5HVYA 3OEFX 1SVHA 4RLLA 4BGGA 5KMIA 3P7AA 5ITAA 3ORLA 4QP4A 2PVMA 4YTHA 5HLPA 2X8EA 3U9NA 3FLZA 5AA9A 3FZSA 3SW7A 3QCQA 4KAOA 4XG7A 4ZTRA 3WZDA 3RP9A 2VD5A 4DEIA 4I94A 5LMBA 3D2KA 4QQTA 4LV5A 4ANSA 3MWUA 4DGNA 5KHWA 3ULIA 2HXQA 3D7TB 3VULA 4L44A 4AQCA 4EKLA 3ZRLA 4F1TA 1PYEA 3QQHA 4PTEA 3UJGA 3V51A 4GT3A 4D5HA 1OI9A 5BVDA 2BVAA 3DKFA 3O7LD 1W82A 4X2GA