5K0XA

Crystal structure of the catalytic domain of the proto-oncogene tyrosine-protein kinase mer in complex with inhibitor unc2541
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
288
structure length
258
Chain Sequence
KLEDVVIDRNLLILGKILGEGSVMEGNLKQEDGTSLKVAVKTMKLDNSSQIEEFLSEAACMKDFSHPNVIRLLGVCIEPKPMVILPFMKYGDLHTYLLYSRLETGPKHIPLQTLLKFMVDIALGMEYLSNRNFLHRDLAARNCMLRDDMTVCVADFGPVKWIAIESLADRVYTSKSDVWAFGVTMWEIATRGMTPYPGVQNHEMYDYLLHGHRLKQPEDCLDELYEIMYSCWRTDPLDRPTFSVLRLQLEKLLESLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase Mer
publication title Discovery of Macrocyclic Pyrimidines as MerTK-Specific Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 74
structure length 258
sequence length 288
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2016-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5k0xA02
2XEYA 3Q5ZA 5AR3A 5K3YA 2VGOA 5EM8A 3V01A 5FWKK 4D4RA 2HWOA 3G0FA 5CWZA 4MF1A 2BZIB 5EI2A 5AV1A 4BTKA 4OW8A 2PVNA 4L46A 1OIYA 2H6DA 3ULZA 4II5A 5LQFA 3FV8A 3CQEA 3H3CA 4NM0A 3WZUA 3BE2A 4HGSA 3EL8A 3DKCA 1OB3A 3E8DA 4RX7A 3U9CA 4YTFA 2VWXA 2R3NA 3DS6A 5AADA 2YAAA 2C4GA 2EU9A 5L8KA 4EKLA 4F7LA 3OUNB 4IVAA 4O38A 3KMUA 1MRYA 5CEQA 3DTCA 5HORA 4CFXA 4FA2A 5AAFA 2FSTX 2X9EA 4ENXA 4FG8A 4IADA 5I9WA 2VTPA 3LFFA 4C4HA 4BDKA 4K9YA 4JBQA 4QP6A 4QQ5A 4NKSA 3WZDA 4J97A 2WU6A 5IH5A 2OFUA 3PRFA 4CFWA 4RZVA 4F9AA 4XG7A 4F6SA 2B1PA 5CU2A 5ETFA 3R8UA 5IKWA 5DEYA 3FY2A 4BCQA 3D2KA 5KMJA 3SAYA 4FSTA 4KKHA 4C58A 3SDJA 3PE2A 2WPAA 3C0IA 5DR6A 5TF9A 2HZ4A 5EYKA 5KO1A 2GFSA 4OUCA 3W10A 2BMCA 3NYVA 3RP9A 3CJFA 2WTJA 3ZZWA 4CQGA 4S30A 3BYOA 4HYSA 2OXXA 4FV7A 2FVDA 3GXLA 4AA5A 2R3PA 3NR9A 3SKCA 2BRGA 4CMOA 4BWKA 3POZA 4E73A 5IA2A 2QOBA 3KRJA 3HEGA 5AIRA 5AM6A 5I9UA 2W9FB 3H9RA 2OBJA 1SVEA 3K5UA 4V0GB 3RZFA 4TWCA 1AQ1A 3S95A 4FIHA 4HVIA 4UXLA 2Z8CA 3R71A 3W8LA 2HW6A 4R3PA 5GJFA 2HK5A 1PYXA 2VD5A 5EK7A 4EI4A 1Z5MA 4F9BA 2HAKA 3SW7A 1YXSA 3QQFA 5F20A 2X6EA 2C5OA 3DY7A 3DDPA 5ACKA 3ODYX 3WF7A 4FTJA 4KABA 3ZYAA 2IJMA 2I0YA 5HCXA 2ITPA 3HMIA 3KULB 4HZSA 3KVXA 4C2WA 2XK6A 3EN5A 4GJ3A 4WO5A 3UIMA 2BTSA 4FSUA 4WNMA 3LXPA 4D28A 4KBAA 3CPCA 1JPAA 1ZOEA 4YO4A 3D14A 3ELJA 5KHWA 1PF8A 4DINA 1OL2A 5IEYA 4E4NA 3KC3A 2BALA 4ANSA 4IIRA 2J5FA 2BAJA 5CVFA 1W7HA 3O50A 3PXQA 2GPHA 4ASXA 4B99A 4WG4A 5C1QB 3MB7A 3VRZA 4BGHA 4LUDA 2BIKB 3D5VA 3P7CA 4IZ5A 4WUAA 4ASEA 4CD0A 4GU6A 1PXIA 3AT3A 4Y95A 4D2SA 2C6TA 3QD3A 4LRMA 2VO7A 3F5GA 3SX9A 3QKKA 3PXRA 4N0SA 5E90A 4O1PA 4RIWB 3ZFMA 3DAJA 4CXAA 2OIDA 4OTFA 5EW3A 3ZFYA 4A07A 2JITA 1W8CA 2CPKE 2YLEA 3D7TA 3I6UA 4BN1A 3H10A 3UBDA 4PMMA 2HWPA 4PF4A 3LVPA 4K18A 2PZ5A 1ATPE 1H27A 3F3VA 3W2PA 4DFNA 2JDRA 2XH5A 4EYMA 3UO5A 3MH0A 4TZRA 4HGLA 3W32A 1FPUA 3ZXZA 4Z7GA 4Y5HA 5LCJA 5E8WA 4FYNA 1PMVA 3MFTA 4BCPA 1WBOA 4IZAA 1X8BA 2FSMX 3NIEA 2ERKA 4EK5A 2O3PA 2HENA 3Q4TA 5CU6A 5DH3A 4HVDA 4CV8A 3FDNA 3UOKA 2Y9QA 4QPSA 2O64A 4AE9A 5BMSA 4O6LA 4YC3A 2G2FA 4C62A 3OT3A 1QPCA 3A61A 3HV7A 3NEWA 3QZFA 3R63A 4GIHA 4OAUC 3VBTA 2ZJWA 4EH7A 1ZMUA 3FHRA 4XEYA 4BB4A 3ENMA 3D5UA 1XHAA 4RIYB 4BCJA 3VUDA 2YISA 4RJ7A 1XR1A 3DBEA 4GYIA 3ZHPC 5GZ8A 4FTIA 5BUJA 1PXLA 4IAAA 4AFEA 4MXAA 1UU8A 1SNUA 4LFIA 3WOWA 3AGLA 3E64A 1J3HA 4DBNA 2VZ6A 4WBOA 1V0BA 4ZSEA 2VX1A 4L3LA 1SVGA 3OXZA 4NM3A 3SW4A 4FIIA 4FVPA 4S31A 2XNOA 5LCKA 3OBGA 5BYZA 3ORKA 3ZDIA 4UX9A 4PX6A 4ENYA 2G2HA 4M69A 4RJ8A 4UMTA 3BZ3A 3DB6A 5E92A 4DH3A 4FKOA 5HG7A 4PTEA 1VJYA 3R83A 2E2BA 3VUMA 1LR4A 2ITTA 4WG3A 4IC8A 4YPSA 3VJOA 4C4JA 4B4LA 3R0TA 2HZ0A 2EVAA 4QMWA 3NX8A 4ZAUA 5CF5A 4FG7A 2IN6A 3V3VA 4YSMA 4FKGA 4EOJA 2V5QA 4AW2A 5CF8A 3DXNA 3R9OA 2GNIA 3GU8A 2QR7A 3KRWA 4UYAA 1H4LA 4DH1A 3FMEA 2Y8OA 4GL9A 3QA8A 4K6ZA 2BAQA 3F3ZA 4IB5A 4TY1A 1YDRE 3R1QA 5AP3A 5EYCA 3ZRLA 4DG0E 4UWBA 5TO8A 4I21A 5IPJA 4FKQA 5ANKA 2YM5A 4FT9A 3HV3A 3EQDA 1YQJA 3DV3A 3ORIA 4GT3A 4YJUA 3CCNA 2WELA 2UW5A 3A99A 5BX0A 1PXNA 3BV2A 2OW3A 3D2IA 4MWIA 3NPCA 4RLKA 2WMAA 4PMSA 4GMYA 4TYIA 3HDMA 4JDKA 4OBOA 5AWMA 3LPBA 4L7FA 4QYEA 2XK3A 4ACGA 4MX9A 3PG1A 3HGKA 2WIPA 3P1AA 5AV0A 3I7BA 4GG7A 3AD5A 5HNIX 2EB2A 2BDFA 5TT7A 1UU3A 5L6OA 3M42A 3PSDA 4FTKA 4P90A 2OIBA 3AC1A 2R5TA 2J0JA 3EHAA 1WBVA 1ZRZA 4S32A 2OIQA 4GK3A 3QLGA 4XOZA 5KMIA 3CY3A 1VEBA 3FY0A 2VNYA 3VS5A 2X39A 2FA2A 2O8YA 2XNEA 1ZYJA 4GK2A 4FBXA 2Y6MA 4D4YA 3KXZA 3DFCB 2X8IA 4TNBA 3Q2MA 4QP8A 3UO6A 3BU3A 4IM2A 2YM7A 3QRJA 4O0VA 3RWQA 5FBNC 1B39A 1H25A 5EM7A 2A4LA 3WARA 4F70A 4HNIA 2C5NA 2W5AA 3F6XA 5D1JA 3REPA 4U44A 4TRLA 1Q97A 3TTIA 1UKIA 2ZOQA 4S34A 4C34A 2CLXA 3DLZA 3V5QA 4YHJA 2Q0NA 5AAEA 2G1TA 2HOGA 3HP5A 3O8TA 4NM5A 1UWJA 2A2AA 1LUFA 2R4BA 3FLYA 1L3RE 4RVLA 2YJSA 3GOPA 4E5BA 5T68A 4DEDA 4EOSA 4J7BA 4CEGA 2X7GA 5CSHA 4A06A 5EHOA 4G2FA 1JQHA 1TQPA 4G1WA 4GCJA 1XBCA 4LQMA 3IK3A 3BYVA 4FEQA 4GSBA 3OOMA 3EH9A 5LVLA 2ITOA 3UOJA 1IRKA 4EH9A 5HIEA 3RJCA 3U4UA 3D7TB 3M1SA 5LVPA 2A27A 2G01A 3R28A 4OTHA 1PXPA 5CAQA 3HKOA 3MIAA 3IECA 2XK8A 4CSVA 2VRXA 4KRDA 5HNGA 5BVEA 3KK8A 4EONA 4JVGA 4V04A 4YJVA 4ZZNA 1Q24A 2P55A 1I44A 4IW0A 4EOLA 4BHNA 2C3IB 3F82A 2IZUA 4L43A 3OP5A 4FIGA 3DKGA 3LIJA 4JOAA 5CXHA 3DK7A 3AC2A 3QTXA 4X6RA 5BYYA 3P0MA 4KSPA 4RG0A 3EZVA 5AIKA 1E1XA 5M56A 3NUPA 2X1NA 4IDVA 5BUEA 5IUHA 4N6YA 1U54A 1UWHA 2C69A 3E92A 4H1JA 3AT4A 1ZLTA 3R9NA 4FTQA 3GUBA 3BGZA 3JUHA 4BCGA 4EEVA 3OCSA 1JOWB 1QMZA 3UVRA 4CZYB 1QPDA 3ORTA 5AMNA 2ITXA 1Q3DA 2WMQA 5EHLA 4AUAA 5HLWA 1T45A 2OU7A 2ZYBA 1PMEA 2BR1A 3KU2A 5E1SA 1Y57A 4FSNA 4RVTA 4TYGA 1BX6A 2JAMA 4WUNA 4AS0A 3SD0A 4AE6A 3OW4A 5CXZA 2ACXA 3QX4A 4FVQA 3UO4A 2ITQA 5KMOA 2QHNA 4QTEA 1OIUA 5I4NA 4O6EA 2E9OA 4RFMA 2J50A 3BCEA 1JSUA 3G6GA 2ESMA 3FKNA 2G2IA 5C01A 4IZYA 2B4SB 2ITWA 4PP9A 3A8XA 3W16A 4WRGA 4D2RA 4QMTA 3QA0A 4M69B 4IBMA 2OXYA 4I6BA 3Q4UA 4EOKA 1M52A 4WNOA 3TJDA 4FKPA 1QPEA 5H9BA 2W1GA 4FTOA 4EZ3A 5DN3A 3KXXA 4PL3A 5JGBA 3MSSA 2C3JA 2CGUA 3P78A 4ITJA 5EH0A 4BDJA 3E8CA 4XLIA 4FUXA 5EG3A 2ZMDA 3EN7A 4G9RA 2IWIA 1VYZA 3NCZA 3Q4CA 2XNMA 5TE0A 4EH4A 4AGDA 5L2QA 4U79A 2ZM1A 4IHPA 2X7OA 2IO6A 4PPBA 4PPCA 5AR2A 5CANA 1JKTA 4FOBA 3BYMA 3VJNA 1ZXEA 2VO6A 3GCUA 5JGAA 4AG8A 5FRIA 5AUUA 1H1RA 3WZEA 2J4ZA 3TEIA 5L6PA 1WZYA 3EIDA 2RIOA 3WYXA 3QD0A 5HX6A 5IA1A 2XB7A 4AW1A 2WGJA 4FTLA 4A9YA 4LOPA 3NUUA 2C6LA 5CENA 2OF4A 1RE8A 1OM1A 3ALNA 3GFEA 4MBJA 3WE8A 2QO9A 2WQBA 4RJ6A 3UC3A 4DLIA 2Y7JA 5J79A 2R9SA 3DBDA 1QL6A 3HA8A 1J1CA 4O2PA 4IX5A 5HD7A 3OS3A 3OTVA 5E8VA 3QXOA 4MVFA 4TTHB 3CP9A 3W55A 5CEIA 3GT8A 3R1NA 4GW8A 3DNEA 1U4DA 3EQBA 4FSRA 4BIEA 4USEA 4D2VA 3GVUA 3VS7A 3E3BX 3RGFA 4DITA 5CSXA 4FL2A 4GYGA 2O63A 1K9AA 1Q99A 3A4PA 4A9UA 4J8NA 2UZWE 3QUPA 4B9DA 4JBPA 2J0LA 5CEOA 3SOAA 3H0YA 5AR4A 2R64A 4AZWA 3DNDA 2UUEA 1WAKA 1G5SA 1W98A 3UMWA 2UW6A 1F0QA 3GP0A 3GNIB 2Y4IB 1PMNA 4JR7A 4LM5A 3R1SA 4JQEA 4NFMA 4O96A 3E87A 3CS9A 5JEBA 3GEQA 3VUKA 4NSTA 3HP2A 5DT0A 5EYDA 4BKZA 1YXTA 2Z7LA 4HJOA 3WIGA 4ZTRA 2R0IA 3MPAA 5DNRA 5HQ0A 3ZUVA 4PY1A 2J0IA 4Q2AA 5ETAA 5CU0A 3BEGA 4DEIA 3FSFA 4FL1A 3Q9XA 4UB7A 4XP3A 1YW2A 2UW0A 3IO7A 3JVSA 3U51A 3D5WA 4M7IA 4G5PA 2WO6A 1O6YA 3DFAA 4QYFA 3BX5A 3D94A 4X3FC 5EOLA 3CR0A 2WMSA 4R3RA 2WKMA 3C4WA 3PY3A 2BPMA 4H1MA 3R7OA 3ZTXA 5DMZA 4G34A 4X6QC 3G33A 3OZ6A 3AC3A 4F7JA 5KMMA 3OUKA 3P7BA 2XK9A 2UZUE 3IDBA 4RWLA 4WHZA 5LMBA 1G3NA 3FPMA 4F63A 3JVRA 4FF8A 3NNVA 5JRSA 1A9UA 1V0PA 4IWPA 4OTPA 1Q41A 3QTIA 4AFJA 3SLSA 1U46A 3ZH8A 5AX9A 2RF9A 4NJ3A 4U6RA 5CASA 4DEGA 3V8SA 3PA3A 4EQMA 1PXMA 2IVSA 2XKEA 4ZIMA 4BCNA 2PY3A 3CEKA 2A19B 4EYJA 1PKGA 4WG5A 4YC6A 4ZTQA 2C0TA 3W8QA 4ALUA 2B54A 3MY5A 3A4OX 2PL0A 1JSTA 3Q6WA 1WBPA 3OBJA 1YVJA 2RFEA 3EQFA 3VQHA 2ITNA 3TJCA 3MFSA 3C4EA 3DOGA 4FV6A 4C02A 3D5XA 3I81A 5K5NA 1ZY5A 3FI3A 3QWJA 1U54B 4RWKA 3GENA 4PWNA 4FTUA 2ZV7A 5CEMA 3NSZA 4LOOA 5ETIA 3SXSA 5I9YA 5KZIA 1AGWA 1OMWA 1OKYA 3W33A 4E5WA 1YHSA 4FV0A 4F9YA 5CVHA 4L42A 4S2ZA 2XUUA 3MTFA 3LCSA 5M4FA 1YRPA 3QQJA 4U40A 4ACMA 4IJ9A 2ONLC 1YHWA 1TVOA 3O96A 1PXJA 3I79A 1M2RA 3PXZA 1YI4A 1F5QA 4FSQA 4J1RA 3ZO3A 3M2WA 3PJ3A 4QNYA 2X2MA 4C33A 2C6EA 3MH2A 3TV4A 4UWCA 4E3CA 4UMPA 2VWYA 5M57A 3QRUA 3BWJA 3V5TA 5HTBA 2OICA 4C8BA 4PDPA 4C7TA 4JQ8A 4YZMA 4KSQA 5I9XA 3OY3A 3V6RA 4H39A 3ZC6A 5DEWA 2QODA 3ZSHA 4BRXA 5DLSA 5LMAA 4R7IA 5IEVA 4QMXA 3GFWA 4GIIA 1FOTA 3BELA 3PUPA 4FV3A 4O22A 2PVKA 3WZKA 4LMNA 5I5ZA 2B9HA 3HRBA 3GU6A 2YCSA 4AQCA 4BIDA 4EH3A 3V8WA 5JQ8A 1BLXA 4MEDA 3AMYA 3IOPA 3PPKA 3VHKA 3WF5A 4UYNA 5IUGA 4GEOA 3MVHA 4RIXA 2W5HA 3QCXA 2QR8A 2BRBA 1IEPA 4OLIA 3U9NA 2B7AA 3IW5A 1JSVA 3R8VA 3FC1X 5BVKA 5IF1A 5DE2A 4WNPA 4YHFA 2YIQA 1R3CA 4G3EA 3DJ7A 3I0QA 4EUUA 1JBPE 3TI1A 5JFSA 5EI8A 4GT5A 4QP3A 3F5PA 3L8SA 4NW6A 1OGUA 3EWHA 3PA5A 2OJ9A 5E8XA 3D4QA 2V7AA 3NLBA 4HVSA 3BE9A 4O2ZA 4JLCA 4PV0A 2WXVA 1GIIA 3ORPA 4ZP5A 1BUHA 4D2PA 4F6UA 3QLFA 3UNJA 2VWIA 5D12A 4BFMA 2V62A 3PJ1A 1LEZA 4JBVA 4PTGA 2G15A 5JK3A 2J6MA 1OUKA 5F1ZA 3ULIA 4C59A 2VTHA 4RT7A 3QFVA 1J91A 5H8EA 3TL8A 4ZSAA 3ZLYA 2Z7RA 4I0RA 4IM3A 4NZWB 4U9AA 2ZV9A 4E4XA 5IA5A 4B8MA 2HY81 4RJ3A 3W2QA 3HRFA 3EYHA 5HBEA 2QOLA 4YC8A 3LFAA 1REJA 2XCKA 3VS4A 2UZBA 3LHJA 4HNFA 2YIWA 3JYAA 2B55A 4RX5A 1K2PA 4AOJA 4EZ7A 2UZLA 4M12A 1OKZA 2R3MA 3KF7A 3R8LA 4P4CA 4I93A 4ZEGA 4C3RA 2BAKA 5BVNA 3KFAA 3VWAA 2X2KA 1GY3A 2OH4A 5A46A 5J87A 3QWKA 5IU2A 4MTAA 3F66A 3K54A 2VTQA 3QTUA 5EM6A 4KIKA 1M14A 3QD4A 2V7OA 3LM5A 3WF8A 3IW8A 3KCKA 3R7VA 1BL7A 3PVWA 4QMLA 5GJDA 4UWYA 5CZIA 4J98A 3RHKA 3TTJA 1UV5A 4EBVA 4OTWA 4RWIA 2PMOX 3AGMA 4FIFA 3EL7A 4NIFA 1OI9A 2WQMA 5HG9A 3HYHA 2QD9A 3NW5A 2CSNA 3KXHA 2LGCA 3Q52A 4AGWA 1YDTE 2ZV2A 4Y83A 1ZYCA 3MB6A 3AQVA 3UZTA 3I1AA 3QKMA 4AU8A 3BHUA 2ZMCA 4N70A 3PXFA 2VNWA 2JIIA 3ZUTA 3MDYA 3O0GA 2GU8A 2JKKA 2JFMA 3EZRA 4FR4A 3A7HA 3RK9A 2VTJA 3IKAA 2W5BA 3SXFA 3WYYA 4QP7A 3MS9A 5C8MA 2P33A 3UC4A 2X8EA 3BV3A 2R3KA 2DUVA 2JIVA 4QMYA 1STCE 4NK9A 1H1SA 4ANBA 3FYKX 1GZNA 2W1EA 3H9FA 3NWWA 3EQHA 4QP2A 4WSQA 3ACJA 2WZJA 1R78A 2JAVA 3FYJX 4ZTNA 4BCHA 3RNYA 2WEVA 5FM2A 1UKHA 3UODA 1WCCA 5E8SA 3BRBA 5AP2A 1Q4LA 4XBUA 1YXVA 4MD7E 5D7VA 4MH7A 2RFSA 4Q9ZA 5M4IA 2F2UA 4BHZA 2XP2A 3E8EA 4K11A 4NUSA 3U6HA 3HLLA 2GQGA 3QZGA 5J5SA 3DCVA 5DHJA 3C4XA 4QTBA 3VUHA 4KD1A 1OPJA 5L8JA 5FXRA 3B8QA 2B52A 4ZY6A 5CAUA 4FG9A 2B53A 4BCMA 5JFWA 4HW7A 3GC9A 5LXMA 4JG8A 1ZMVA 2OWBA 3FC2A 1H00A 3NYXA 5AP1A 4DFZE 2NRUA 4MXXA 3JY0A 2YCRA 1PHKA 3UIUA 4FV5A 2XM9A 1T46A 3F69A 4XLVA 5IMEA 5JKGA 3RAKA 3RM6A 4EC8A 3I60A 4BVUA 3VBVA 3FPQA 3F3WA 3UJGA 1W84A 4CKJA 4IWOA 2VTSA 2R3HA 4I4EA 2HXLA 2PZIA 5K9IA 3G51A 3PWYA 4ZSJA 3TZ7A 4BI0A 4BBFA 4GFMA 4I23A 3AC4A 2QOHA 3MA3A 3C4FA 2R7BA 4OTQA 2YABA 5CALA 3QX2A 3D83A 2YM3A 2UVXA 3R73A 4I24A 1CMKE 3W2SA 5C26A 3MVJA 3MPMA 2QKWB 3LMGA 3GOKA 4BWPA 4IX3A 2JIUA 4I41A 4OT5A 5GNKA 3F9NA 3LQ8A 4YPDA 5GJGA 5ANOA 3CE3A 4UMRA 4PDOA 2ZB0A 3ZDUA 4RRVA 4RIXB 4ACCA 4MF0A 1JLUE 1BL6A 5KUPA 5HG8A 1OPLA 2O65A 2PVFA 4XG3A 5FBOA 2YJRA 2UW4A 4WD5A 3MFUA 3CKWA 1WVXA 4RC2A 4YP8A 4F7NA 2UW3A 1KSWA 5CSPA 2CMWA 3PY1A 4OT6A 4WNKA 3FMDA 4DN5A 3FI2A 1V0OA 2JLDA 5FTQA 3AXWA 1KOBA 2V55A 2WU7A 3SQQA 3V5LA 5L3AA 5F95A 4DC2A 3PYYA 1GZOA 1MQBA 3DK3A 4M66A 1NXKA 4XCUA 4CT1A 2PUUA 4XOYA 2GHMA 4G17A 3UE4A 4U7ZA 4EK6A 3DBQA 4NCTA 4DEEA 3E88A 3FMJA 4ERWA 2H8HA 2I0HA 5HE2A 3GU5A 2FO0A 4XP0A 2WHBA 2W05A 2JBOA 2XYNA 2BFXA 3CXWA 4IWDA 4XV3A 3AMBA 3HNGA 3C50A 4GRBA 4X2GA 1YXUA 4U45A 4RPVA 3UGCA 4ZZMA 4AOIA 5JH6A 3FLWA 4L9IA 3HV4A 3UYTA 4KINA 4MNEA 2R3IA 3QYWA 3NAXA 3O8PA 3IOKA 4U5JA 2GS6A 3AD6A 4BCOA 4AXAA 5JSMA 3C5UA 2C6MA 4YU2A 3DK6A 4AOTA 2XYUA 5A54A 1WVWA 4ZOGA 4KB8A 5HLPA 2X4ZA 4RQKA 4AGUA 1ZARA 3O17A 5CNOA 4ANNA 5JQ5A 3W18A 3BHVA 1XH8A 3UIXA 4EOQA 2WAJA 4RC4A 2OFVA 4L67A 4GU9A 5CT0A 4H36A 4K77A 4X2KA 4X2NA 2W1FA 3NNUA 2GSFA 4I0TA 2W7XA 3QUDA 2JKOA 4H58A 4KA3A 1KOAA 4PRJA 1CSNA 4PMTA 4C4FA 4HGEA 4XBRA 3DT1A 4KIKB 3F88A 3JY9A 3MJ1A 5HO8A 3O51A 3ZEPA 2O0UA 3ZLXA 5JZJA 4PTCA 3EN6A 3QTRA 4JNWA 4LV8A 3ZOSA 4IQ6A 4AW0A 3B8RA 4HGTA 3AT2A 4M15A 5CVGA 3ANRA 2AYPA 4FODA 4I5HA 4PPAA 4O0RA 3ZXTA 5DA3A 5ANEA 3MH3A 2GFCA 3PRIA 4B6LA 3VW8A 1H1PA 3G2FA 4AWIA 5IMXA 1V1KA 5BVDA 3FLSA 2WEIA 4QMVA 2YM4A 2IW9A 5AP0A 2B9FA 3ENHA 3F3TA 1ZZLA 2PMIA 3MI9A 4QTCA 2VWBA 4S33A 4J8MA 4TPTA 3DBCA 4JS8A 3L9MA 4QO9A 5CI6A 3EFWA 3MV5A 3QTSA 3RNIA 3QF9A 4K1BA 1SMHA 2BDWA 3KXGA 1REKA 1XH7A 2YIXA 1ZY4A 3Q9WA 3G6HA 1WMKA 2Q0BA 3ETAA 2W99B 3Q9YA 4QP4A 1Q3WA 2Y4PA 4WBBB 3UOLA 4MD8E 4EH6A 5LVNA 3OT8A 2WNTA 1YI3A 3MIYA 4YTIA 3LJ0A 5LMKC 5BVFA 4LGGA 1OPKA 1P14A 2UZTA 5A6OA 3E5AA 1B6CB 2UVYA 3DBFA 3CPBA 4LRJA 2BRHA 3NAYA 3RVGA 3MPTA 3QCYA 1MQ4A 1WFCA 2OO8X 3P7AA 5ANDA 2XIKA 2QLQA 1XWSA 2QOIA 2QNJA 3U6IA 4G3DA 5HOAA 3ODZX 1WBTA 2WQOA 4IB3A 4ANLA 1BKXA 4EC9A 4F1OA 2GMXA 3FMNA 3A60A 1CM8A 4IM0A 3PZHA 4RIOA 4QQTA 1PJKA 2PVMA 1GAGA 1NA7A 2NPQA 3FL5A 3IDCA 3NNWA 4GVJA 4KNBA 4WSYA 4C3PA 4YZCA 2HYYA 4IMYA 3TUDA 3K3JA 2OZOA 5T3QA 3RZBA 4XV2A 1YI6A 3F7ZA 3R2BA 1WBSA 4FYOA 4I5PA 4ZY5A 4FICA 4I0SA 2FUMA 2C5YA 3V5WA 4Z55A 1MRUA 3UVQA 3VO3A 4BGQA 3II5A 1IR3A 4YJNA 5KBRA 3GQIA 3QYZA 4MXYA 1O6KA 2H34A 3TKIA 5HEZA 1JKLA 5AUZA 2XIXA 3N51A 4RLLA 5BVWA 4E8AA 4O0SA 2Z7QA 5EW9A 5AR8A 3I0OA 3OY1A 5CF6A 4O27B 1H0WA 4UXQA 3ZS5A 5HTCA 5IG1A 2ETRA 5AM7A 3EQRA 5FQDC 4ZJIA 5CAPA 4W9WA 3NCGA 3G0EA 3OXIA 3SOCA 2R3GA 4F99A 4IAZA 3GB2A 4WT6A 4J96A 3E62A 4EUTA 3LXNA 3E7OA 1M7QA 4J95A 3ZRMA 2IVUA 5AA8A 4GFGA 5LOHA 3O8UA 3V8TA 5ACBC 3WILA 4D1XA 2WMUA 3CTHA 3QGWA 3QZIA 1NVSA 5DR2A 3SRVA 4EHVA 2SRCA 3TG1A 4EHZA 2PE2A 2ITYA 1JVPP 5CX9A 3WBLA 4EK4A 3LFSA 4CCUA 4YTHA 2XZSA 2WIHA 5HLNA 2VO3A 3PIXA 1NVQA 4FIJA 1JNKA 4EK3A 5CQUA 3C9WA 3QBNA 4RBLA 2VGPA 5DGZA 4HPUE 4WKQA 3EYGA 2XIYA 3R6XA 3Q32A 3P08A 1YOLA 3DTWA 4IB1A 4JX7A 5AV2A 3RINA 5CAVA 5DWRA 2PMNX 5F4NA 2HZNA 5CSVA 2IZSA 2VWVA 4C38A 4Y46A 4FT3A 3LXLA 4L8MA 3IONA 4JRNA 3THBA 3HV5A 5CNNA 1NVRA 3FMKA 1GIHA 4PL4A 1ZZ2A 5FDPA 2C3KA 2W1DA 3OMVA 4YO6A 3ZUUA 3FJQE 3FXZA 4XH6A 2GNFA 4MKCA 2EUFB 4ANQA 2CDZA 2I0VA 2F7ZE 4FKTA 3RAIA 4X3FA 4MNEB 5AUTA 5I9ZA 5LVMA 1BI7A 4YJOA 4FTTA 5GZAA 4EOPA 4FZFB 2Z7SA 5CLPA 1YOMA 2WMTA 4BC6A 3R00A 4GUEA 1S9JA 2YM6A 1FVTA 4IH8A 4TWOA 4QMMA 2NRYA 4FT7A 4AT4A 2AC3A 4E7WA 3D0EA 3GBZA 3KMMA 4YJSA 2Z2WA 4QMSA 4X0MA 4FTAA 5CY3A 1XH6A 1Q62A 4E93A 4CNHA 1Q8WA 2J51A 4CKRA 3BYUA 3FKLA 3I4BA 2VV9A 2CLQA 5AR5A 2W0JA 4TN6A 4L44A 2P2IA 3OTUA 2WB8A 3HUCA 3FE3A 1H1WA 4KIQA 4L68A 4TXCA 5HU9A 4EQCA 2VUWA 2YDKA 3NUXA 4YLJA 5CF4A 3P4KA 5IISA 2ZDTA 4P7EA 2QLUA 4ZLOA 3R1YA 3ZO4A 3M11A 3K5VA 4FV4A 4DCEA 4YR8A 2XKDA 2NP8A 3LFNA 4QPAA 4DG2E 4FX3A 1S9IA 2F2CB 2IVTA 3RK5A 3ORZA 3NZ0A 4J53A 4U8ZA 1AD5A 1ZMWA 3COIA 2C3LA 2VTOA 2QO2A 3GGFA 5E8TA 3UQFA 4PUZA 3LXKA 4AN2A 4BIBA 5DVRA 4QQCA 3R8ZA 5BNJA 5LVOA 3ACKA 3EFKA 4UBAA 3LOKA 2F4JA 5ANGA 3EQCA 3DQXA 5HKMA 3EOCA 2NO3A 3R02A 2VO0A 2ONLA 4RJ5A 4E20A 4FKJA 3ZMMA 5KBQA 2UZDA 4JXFA 3WZJA 1YHVA 2QU5A 1OKVA 4H3BA 4APPA 3TIZA 3LZBA 4QYYA 2Y4IC 5HBJA 4TYJA 1PYEA 4O0TA 4L01A 4M3QA 3FKOA 3UNZA 1O9UA 4I3ZA 3JPVA 2ZB1A 4DFXE 4IX6A 3I6WA 4ALWA 5JT2A 5FDXA 4E6DA 2WQNA 1SNXA 3BWFA 2UVZA 3Q3BA 4BDEA 3DZOA 5FP5A 3MWUA 3A7IA 2YITA 4IVBA 4JIKA 3KXMA 1VZOA 2H9VA 5CS6A 4E4LA 2W96B 3T3UA 5K5XA 4TWPA 2X6DA 4D4VA 3IW6A 4O0UA 4F4PA 4TYEA 4BDHA 2J5EA 2QG5A 2I0EA 2YIYA 4TNDA 3UIBA 3GC7A 4BDIA 4U41A 3QXPA 3Q96A 4X21A 2PK9A 1KE9A 3C4ZA 5TOZA 4BL1A 2REIA 1Q8ZA 2F57A 5KZ0A 3FI4A 3SV0A 1E9HA 5CI7A 2HCKA 4RC3A 2YZAA 5FEDA 4BKJA 2OF2A 3VS2A 3PJ8A 2FB8A 5HNBA 2QHMA 3BQCA 3ZBFA 3P79A 1ZOHA 3PWDA 3S1HA 3W2OA 3K2LA 5AEPA 1Z57A 3VBXA 3Q5IA 3TNPC 4I1ZA 1KE8A 5D7AA 3VBWA 4O1OA 5D10A 2EB3A 4IZ7A 4KKGA 2WTKC 1R0PA 2GNHA 2V0DA 3BLHA 3OWJA 4UZHA 4BICA 4DYMA 4J71A 4BF2A 1H1QA 1B38A 2O2UA 3TWJA 4FSMA 2CCIA 4M0YA 3LLTA 3NRMA 3FZRA 2JDOA 5HD4A 3TZ8A 4ASZA 3UYSA 1OITA 2W1ZA 1J1BA 5E91A 5IEXA 4CMTA 1FVVA 4EH8A 5J9ZA 2PZYA 5AV3A 3R01A 3BYSA 3KF4A 3RHXA 3G90X 3U4WA 2IW8A 4ZSLA 3KEXA 3SRVB 3D7ZA 4FKWA 4M97A 3CIKA 3EJ1A 3LCKA 5DRBA 5KMLA 3PVGA 5L6WL 5M55A 2FGIA 4ZTSA 3TNWA 4F7SA 2RG5A 3GQLA 5TKDA 3LAUA 3OC1A 2PVYA 3MTLA 4R5SA 5HIDA 2JFLA 4BTJA 3FUPA 4FNZA 4M13A 3QALE 3T3VA 2WMVA 5G6VA 4ID7A 4RSSA 4Y85A 3TUCA 3FAAA 5FGKA 3O2MA 4Q5HA 2VWZA 2V22A 3GCSA 5KMKA 3UPZA 3PZEA 1R0EA 2J0MB 5KE0A 1GZ8A 1OVEA 2O5KA 2PSQA 3SC1A 3QU0A 4HCUA 5CEKA 5EOBA 3MH1A 3QC4A 3UG2A 4CRSA 4BKYA 2QOKA 4RVMA 4AA4A 3CGOA 1UU9A 3SXRA 3FZSA 5J7HA 3ZO2A 3LQ5A 4QP9A 4QD6A 4OBPA 3BHYA 3CGFA 2CN5A 2W1HA 3A7GA 4X3FB 3JXWA 4A9SA 5K0XA 4JG6A 4ZY4A 4RX9A 2JDVA 3F7WA 4QMOA 3VW6A 4DGNA 4FT0A 2BZKB 1JWHA 4FC0A 3ITZA 4AACA 2RGPA 4CV9A 1YWVA 3B2TA 4GG5A 3RAWA 3DAKA 5B2LA 4MXOA 3K3IA 3BLRA 3W2CA 1FGKA 4CYJA 3U8WA 4F08A 2CN8A 3KGAA 3LJ1A 3MW1A 4HYIA 1U5QA 2C0IA 4LI5A 3R7EA 5KKRB 4YNOA 1GJOA 5D9HA 4JQ7A 1ZYDA 2BHHA 3PSBA 5IDPA 5I3RA 4U42A 2XRWA 2W1IA 4I5MA 4AZFA 3PA4A 5FD2A 4EL9A 4LGDA 4NFNA 3RM7A 4NTSA 3NNXA 4DTKA 4L3PA 2W4OA 2VTIA 1H8FA 4YBJA 1BI8A 4RGJA 3KRLA 1PXKA 4IJPA 1KV1A 4W4VA 3IGGA 5AJQA 4CZUA 4U97A 3VS3A 2UW7A 2W17A 4BBMA 2P4IA 1A06A 5AA9A 2XNBA 5ANJA 4EOIA 3V6SA 3JS2A 3EFJA 1SM2A 4TYHA 3ZM4A 4F0IA 3QKLA 3ZSIA 4JDIA 2CGXA 4C4IA 5JFXA 3Q53A 4QT1A 3PJCA 3ZU7A 4A9TA 3OG7A 4FTNA 3TIYA 2PHKA 3MN3A 4LYNA 4E26A 4YZDA 1P5EA 4NKAA 4P2KA 1TQMA 2VWUA 2E9PA 5BQ0A 2CJMA 3G5DA 3C7QA 2P0CA 4PNIA 5IA0A 2WOTA 4YBKA 4J52A 4IWQA 3OW3A 3OCGA 2WTCA 3MA6A 4GUBA 3QHRA 4AZTA 2XIRA 3FZPA 4NT4A 5EDPA 4ARKA 4CT2A 4O0WA 2FYSA 4KBKA 1R1WA 4B0GA 2XNGA 4FSZA 3LFBA 3D15A 4FV2A 1IASA 1R39A 2C1AA 4CLIA 3IQ7A 4JDJA 3FXWA 1JKSA 3NIZA 3VF9A 2C30A 4UALA 5EYMA 5HVYA 3OFMA 4Z7HA 3UQGA 3GCQA 3KB7A 3DKFA 1FVRA 3QRTA 2ITUA 4MD9E 2J2IB 3MJ2A 3PY0A 1OZ1A 2FH9A 3C0HA 3CKXA 4FTRA 4G6LA 4B7TA 4GS6A 4JG7A 3DU8A 4NEUA 3TACA 3NW6A 2OK1A 4H3PA 2VU3A 4M67A 4GVAA 3ERKA 4OR5A 4DGOA 5AR7A 4EH2A 2YN8A 5E8UA 2RG6A 1LEWA 5LWMA 3Q04A 4NM7A 2UZEA 5ETCA 2XEZA 3RPSA 3UTOA 3SVVA 1PMUA 4EH5A 2R3OA 3UP2A 4EQUA 3LJ2A 5J95A 1IG1A 3CBLA 5HHWA 1XH4A 2HIWA 4YUQA 3EQIA 3LM0A 4W8DA 3VF8A 4C61A 2XM8A 4O0YA 4UV0A 4USFA 3SHEA 2BDJA 3RALA 3S4QA 3OF0A 4G5JA 5FXQA 1LPUA 3CTJA 4A4OA 4C4GA 5M44A 4CRLA 4D2WA 2OI4X 1ZOGA 3PIZA 5HZNA 5M51A 1H24A 5KCVA 5I0BA 4O91A 2DS1A 2ZM3A 5DRDA 5F9EA 2EXEA 3S3IA 2XK4A 4RMZA 1H01A 2HZIA 1UVRA 4Q9SA 3DA6A 3ZC5A 1KE6A 4ITHA 4R7HA 4QYHA 4RWJA 3KCFA 2WTIA 2EXMA 3P23A 4C35A 4XRLA 3FLNC 4ZTLA 1FMKA 3NYNA 3VUIA 3HMNA 4FVRA 2E9NA 1XBBA 4LUEA 5HIBA 4F09A 3E63A 3QRIA 1FGIA 2UZOA 3HDNA 4JRVA 3T8OA 4HYHA 4BZDA 4YTCA 4D0XA 1Q8YA 3SA0A 5B7VA 3L9NA 4FKLA 3R04A 4DH5A 3L8PA 1URCA 5C9CA 4ZJJA 3G9LX 4EZ5A 3KMWA 4IEBA 5IDNA 3C51A 4FKVA 4U80A 3KRRA 4DH8A 1P2AA 3UOHA 1U59A 4MAOA 4GH2A 3MY0A 4XP2A 3PVBA 4E6CA 3KL8A 4F1TA 4YJPA 1WBNA 4QTDA 2GTMA 3PIYA 2LAVA 3PVUA 2J9MA 1EH4A 3F61A 3IPHA 4TWNA 3WE4A 2F49A 2GHLA 4YZNA 2XJ0A 2C0OA 3TV6A 3BBWA 4D2TA 5L2SA 4TT7A 1SZMA 3EMGA 3GCPA 3CTQA 4QMUA 4K2RA 2JKMA 2VTMA 5AP6A 3ZZEA 3V5PA 4EKKA 4G3FA 3F5XA 5H2UA 2ITZA 1OL7A 4BDFA 2H96A 2XNPA 1H0VA 4IAIA 3UVPA 4HOKA 1RJBA 1CKJA 3B2WA 2YWPA 1DAYA 2CGWA 1ZYSA 2ERZE 5DPVA 5FLFA 4L00A 4L53A 1OL1A 5FEEA 2JEDA 3AOXA 1M2QA 2QOQA 4MK0A 3BHHA 3S2PA 4Y5QA 2CCHA 4L45A 4JT3A 4L6QA 3T9TA 2A1AB 3FBVA 1YDSE 1CKIA 5T6KA 4A4XA 4G6NA 4A9RA 5AUVA 4BBEA 5EM5A 1ZYLA 4TKSA 2XBAA 4TL0A 3RMFA 3VN9A 4F0GA 1DI9A 5L2IA 2C1BA 2PZRA 2Z60A 5K4IA 1ZAOA 3I5NA 4AX8A 5M4UA 3AC5A 3LFEA 1URWA 5DOSA 3UNKA 5AUYA 4W4XA 1XBAA 3TCPA 4WRSA 2ZVAA 4AZEA 5IH6A 5LMKA 4JX3A 3KK9A 4Q5EA 5FM3A 4ALVA 2RFNA 3UPXA 1GZKA 4XG8A 3FLZA 3LFQA 5L2WA 5E8ZA 3O71A 2ZM4A 3OWPA 2P3GX 4QYGA 5J1VA 3C4CA 2JD5A 4IFCA 5CSWA 3HRCA 3VIDA 3FQEA 3H4JA 4U3ZA 3Q9ZA 4XRJA 5EW8A 4CFFA 4AW5A 4K33A 4TYHB 4CTCA 3QCQA 4EBWA 4KS8A 2E9UA 3PPJA 4WA9A 2B9JA 4YLKA 5D41A 4LL0A 4OAVB 4DLJA 1OIRA 4PP7A 3CY2A 3W1FA 1ZWSA 2YA9A 4USDA 4X3JA 3PPZA 4HVHA 2GTNA 2ITVA 2WMWA 3ALOA 2JGZA 2C6OA 2VTNA 3ORNA 5K0KA 4C36A 4E6AA 2BRNA 3ROCA 2X4FA 5KX8A 3OCBA 3VRYA 3BPRA 3QL8A 4RA5A 4D0WA 4D4SA 1WVYA 1YWRA 2W4KA 4FSYA 5E8YA 4AAAA 4BZNA 4HVGA 3KVWA 5A4TA 4AT3A 2W1CA 2WMBA 3FQSA 4FOCA 3VUGA 1OUYA 2BRMA 3FQHA 5CU4A 3TNHA 4UY9A 3ZCLA 2VX0A 3RAHA 2ZV8A 3R9DA 5J5TA 4KRCA 1VR2A 3R9HA 4HCTA 4AT5A 3VHEA 4FTCA 4JJRA 3UG1A 4P5ZA 4U3YA 4BTFA 4CFUA 3N9XA 5HU3A 5IUIA 2XS0A 1M2PA 1APME 2KTYA 4KIOA 3RBWA 1H07A 1Y91A 4MNFA 5H8BA 2PVHA 2YAKA 4XS2A 5DBXA 1H28A 3BHTA 1KWPA 4XX9A 4FSWA 4XV9A 5HVJA 5HO7A 3GI3A 4BDGA 4NWMA 4OTRA 3MVLA 4X2FA 2IW6A 3F2AA 4DGMA 3HECA 3ANQA 4BTMA 5M53A 1Y6AA 3H9OA 3UQCA 3VVHA 3RCJA 5DR9A 4U81A 2VTLA 3E8NA 1UU7A 4E6QA 3BEAA 4MBLA 2IZTA 1YWNA 4ASDA 1Z9XA 5AP4A 1Q61A 4RVKA 2WOUA 3GCVA 5FTOA 4DH7A 1XH9A 5G1XA 2ZAZA 4MCVA 4NIFB 4PL5A 2BUJA 3P86A 3ZLWA 2W9ZB 3DAEA 3MYGA 2YHVA 4HYUA 2YFXA 4OGRA 3HL7A 5HCYA 1YOJA 3E3PA 4RX8A 5FP6A 3G9NA 2XK7A 4R8QA 3VNTA 4DEBA 3VUTA 4GFOA 3DPKA 2PTKA 2P2HA 4EOMA 3A8WA 5HE0A 4KWPA 4DFLA 3L1SA 3OWKA 2WD1A 1XJDA 5E1EA 5TR6A 5A4CA 4XG6A 3RTPA 4D5KA 3BGQA 2OJFE 1DM2A 5EDQA 4RFZA 2QI8A 3C1XA 3FL4A 3HA6A 4I94A 5LARA 3TZMA 4QMPA 3QTQA 1XKKA 3EQGA 5JRQA 5I3OA 3MY1A 5A4QA 4BYIA 2QQ7A 4BDDA 4E1ZA 4GJ2A 4YURA 2R3RA 3A7FA 3UDBA 5DI1A 4UMQA 3FZOA 4IACA 4XJ0A 4R6VA 2A0CX 4G3GA 4IAYA 4FV9A 4QOXA 5AV4A 4FZ6A 4F1MA 4KBCA 4C0TA 4XMOA 1HOWA 4PNKA 2DYLA 4UMUA 3TV7A 4CMUA 4ERKA 2VX3A 4BCKA 3V51A 4RA4A 3LCDA 3MFRA 4YNEA 2WMRA 2YERA 2QO7A 1M7NA 4WOVA 3TXOA 2YIRA 3V04A 3LCTA 2C68A 4O0XA 2VTTA 4LOQA 1I09A 4JIAA 4MQ1A 4CYIA 3A7JA 4FUYA 1Q8UA 2X8DA 4XG9A 5C8NA 5L8LA 3DJ5A 5B2MA 3FLQA 4QTAA 4CTBA 4QQJA 4FMQA 3EKNA 3OCTA 1QCFA 3OD6X 4EHEA 1OIQA 3NS9A 4CVAA 5JN2A 1UA2A 3KN6A 2ETMA 2YEXA 4YZBA 4RZWA 1W82A 3UMXA 2XNNA 3R2YA 4EHGA 5A9UA 4YHTA 4U0IA 2DQ7X 3L9LA 4ITIA 4WIHA 3QTZA 4JDHA 3COHA 3TNIA 4ZJVA 2PMLX 1GNGA 3PP0A 2OJIA 4IVDA 3KRXA 3VS0A 3TUBA 5AP5A 3QHWA 4I5CA 2PVJA 3DDQA 3DGKA 4CZTA 5ICPA 2PVLA 1XQZA 1Y8GA 4M0ZA 3VQUA 4DAWA 5E7RA 1E1VA 2G9XA 3FMHA 2XKCA 4NCTC 4AZSA 1DS5A 4D5HA 2BCJA 4MQ2A 4M68A 5AP7A 2XKFA 3HMOA 4I6HA 3ET7A 3FSKA 1OL6A 3TN8A 3QAME 4M84A 3HVCA 3NUNA 1HCLA 4FNYA 4JBOA 4Z9LA 2CHLA 4ZLZA 2XBJA 4R5YA 4IANA 4KAOA 3ROYA 4IC7A 5IZFA 4JL9A 4D55A 2UW8A 2FSLX 2OZAA 2DWBA 2YDJA 3ZO1A 4BI2A 3H30A 5CT7A 5KNJA 3RPRA 3DB8A 3QQUA 1GIJA 2OG8A 2QVSE 3PP1A 4YMJA 3HMPA 5BPYA 4NJDA 3Q4ZA 1P4OA 3NDMA 2R3LA 4FKUA 5CEPA 2Y6OA 4LGHA 3H0ZA 4B8LA 3FWQA 5HICA 5AUXA 2BTRA 3ORMA 4CKIA 3F2NA 3OHTA 3L8XA 5IA4A 4X2JA 1MP8A 2QKRA 1P4FA 4C4EA 2VN9A 1Q8TA 3HZTA 3PG3A 4BZOA 4ZLYA 2QURA 5A14A 4CFVA 2R2PA 3QQLA 3R30A 2JC6A 4JAJA 3O23A 3QC9A 4K8AA 3UZPA 4BGGA 1KV2A 4W4YA 2RL5A 4IAKA 3PXYA 4FGBA 2I40A 1UNLA 4XHKB 3AMAA 4ANMA 4EK8A 4YSJA 4L3JA 4EJNA 5EI6A 4C3FA 4G16A 5DFPA 3TZ9A 5AUWA 4AN3A 5EKNA 2CGVA 4P5QA 2XCHA 3COMA 2AC5A 3NUSA 4TW9A 3NYOA 4EORA 4XG2A 4XUFA 3D9VA 1LP4A 3LFDA 4UZDA 4KIPA 3DQWA 3P9JA 5IH4A 1M17A 4LL5A 2BZJA 5EHYA 4Z3VA 1KE5A 2R3QA 5ANIA 5HBHA 2BKZA 4J99A 2OSCA 3AG9A 4IB0A 3MBLA 3CQWA 3KXNA 2IZRA 4X7QA 2C6IA 5IA3A 3FXXA 3O7LB 4ACDA 5HO6A 2PE0A 4NH1A 2FSOX 4EWQA 5C27A 1TQIA 3QUEA 4IVCA 4R1YA 3QRKA 3RCDA 5HI2A 3PE1A 4DEAA 4FNXA 3TKHA 2OJGA 4M8TA 3BU5A 2C5VA 3RPYA 4FKSA 4ZZOA 3QTWA 1CTPE 2QOCA 4MHAA 3OOGA 5J7BA 4A4LA 3RI1A 3QCSA 1QPJA 4W4WA 2C47A 5H8GA 4APCA 2R7IA 3NGAA 4D9UA 2JDTA 4YJTA 5FG8A 5GHVA 4ZSGA 4BDCA 2YLFA 5DG5A 4K0YA 4QNAA 3U87A 2I6LA 3WF9A 4AA0A 3EFLA 2RKUA 3E7VA 4KS7A 1GOLA 2QU6A 2X9FA 4QMQA 4FZDB 4R1VA 5I9VA 5AX3A 2BIYA 3KY2A 2XVDA 2JKQA 5GZ9A 2R3JA 4CCBA 1TKIA 2QC6A 3FMLA 3Q6UA 4ZS0A 3GU7A 2UV2A 1UNGA 4CFNA 2ETKA 3CD3A 1O6LA 4YGAA 3L9PA 3KN5A 1OKWA 3ZSGA 4MYGA 4HPTE 3VC4A 3IGOA 3ZFXA 5HVKA 4CLJA 4OTGA 3BLQA 3QD2B 2PVRA 5BVOA 1PY5A 4MXZA 2KULA 3BU6A 4KKEA 4AZVA 4DG3E 4V01A 4PDSA 4IX4A 1KE7A 3WF6A 4CQEA 4D1ZA 4IXPA 3R7GA 4E4MA 2HXQA 1FINA 1JAMA 2YCQA 4LRKA 4LV5A 5A3XA 4R3CA 3VS1A 2YCFA 3F5UA 1SYKA 1OL5A 4JI9A 2J90A 1DI8A 2VAGA 2WTDA 2XJ1A 2IVVA 2GDOA 5JGDA 3U6JA 3IG7A 4NTTA 2YM8A 1YKRA 5C03A 3KKVA 4YJRA 2XJ2A 4QP1A 5JMSA 3EB0A 2OJJA 4FI1A 2OH0E 2W4JA 2C6KA 3HV6A 5A6NA 5EKOA 4OTIA 3BGPA 3OEZA 2QOFA 4RFYA 5CYIA 2I1MA 1PW2A 4W9XA 4FKRA 4C57A 1CKPA 2VTAA 2XA4A 2VTRA 4Y72A 4AN9A 2GNGA 3VULA 4IFGA 3DLSA 5HESA 3R7UA 4I4FA 5B2KA 2QOOA 4I20A 5J8IA 4YJQA 4FK3A 4FTMA 5A4EA 4HCVA 2EXCX 1BYGA 4ZTHA 5HG5A 3LE6A 4H3QA 3QGYA 2C6DA 4DFYA 4MXCA 5J9LA 3P5KA 3FZ1A 3BIZA 4D9TA 5A4LA 4FNWA 2Y0AA 2J7TA 3EQPA 5KHXA 2R3FA 4F6WA 1PKDA 3PLSA 5HGIA 3VBQA 1U5RA 1FMOE 3V5JA 4F0FA 4FIEA 4W8EA 1FQ1B 3C13A 1XH5A 2QCSA 3CJGA 4FZAB 5KMNA 4FKIA 4G3CA 4NW5A 4I22A 2HY0A 2XRUA 3KA0A 2OGVA 2PWLA 3A2CA 5CTPA 4ZK5A 3O7LD 1K3AA 4LG4A 4BDAA 3QQGA 4QMNA 2ZDUA 3EKKA 1HCKA 2QONA 3GU4A 3Q60A 3QQHA 3PFQA 4EWHA 4IE9A 3RK7A 1F3MC 3WI6A 3W2RA 4ONAA 3OVVA 2OZAB 3DJ6A 4L52A 3T9IA 4DGLC 2X7FA 3ZONA 5HCZA 2CKEA 2GS2A 2JBPA 2UW9A 4FL3A 4I92A 4BWXA 4PMPA 3S00A 4YLLA 4ANOA 4FK6A 4Y8DA 2GS7A 3HUBA 2X0GA 4N6ZA 5JZNA 1RQQA 1XO2B 1RW8A 1CDKA 2JDSA 2XIZA 4V05A 2R0UA 1MRVA 5EDRA 4BCIA 4BI1A 4FV8A 3LFCA 1Y8YA 2PE1A 2E9VA 5KKRC 2YDIA 2WFYA 1OECA 4FZ7A 4DGGA 4JR3A 5CQWA 2J0KA 2AUHA 1VYWA 1NY3A 3PXKA 4Y73A 1RDQE 2BILB 3BKBA 3CLYA 2WTKB 5D11A 4UEUA 2UZVA 3KQ7A 3MVMA 3DZQA 2GCDA 4OBQA 5LJJA 3HMMA 4QPMA 4BDBA 3CD8A 4V0GA 5CAOA 3S0OA 5CU3A 4U43A 5AAGA 3R8MA 3I5ZA 1JKKA 3GC8A 3OXTA 4LMUA 4QRCA 5B0XA 3R7IA 5M4CA 3VAPA 3TKUA 4FV1A 2WMXA 3COKA 3LCOA 3RPVA 2C5XA 4AGCA 3OWLA 4O21A 4E5AX 2HW7A 3AD4A 3R21A 3IW7A 4RJ4A 4BYJA 4G6OA 3KULA 2XMYA 2GHGA 4QMZA 5J1WA 1H08A 4ACHA 4GT4A 4F64A 3QQKA 4MBIA 4OTDA 3ZRKA 3IW4A 4AF3A 3A62A 3EN4A 5CZHA 5ITAA 3ORLA 2BROA 2X2LA 4G31A 4XG4A 3AC8A 5J9YA 4C2VA 1PXOA 2RFDA 2WQEA 3E93A 5BMMA 5K4JA 3PTGA 5C8KA 3ZEWA 2BZHB 5F94A 3EN9A 3RWPA 1UNHA 1Y6BA 2X81A 5DT3A 2RSVA 2W06A 3GC0A 4Z16A 2HELA 3CQUA 1MUOA 3HX4A 3BQRA 4IDTA 4HZRA 5EFQA 3LW0A 4N4SA 2GNLA 4RIWA 3WIKA 2WTVA 4I6QA 2WTWA 4IAFA 4D1SA 2OXDA 1ERKA 4MWHA 3MGYA 3DKOA 3IS5A 4M14A 3PSCA 4D58A 4GV1A 3POOA 4L7SA 5DT4A 4AP7A 4UN0C 2F7XE 2XF0A 1BMKA 3VS6A 2UZNA 3PJ2A 5HE1A 3ZBXA 3C0GA 2F9GA 1W83A 4PQNA 4GK4A 2OKRA 3IDPA 4NU1A 5JFVA 3CC6A 2BHEA 4YZ9A 5HTIA 4RQVA 4XNEA 3NUYA 3RKBA 3BBTB 3OEFX 1YXXA 4I6FA 3RPOA 3R22A 1Q5KA 2BVAA 5BUIA 3BI6A 3QZHA 3F3UA 5FEQA 4ZXTA 4G9CA 4F65A 4C37A 5HX8A 1IA8A 4ZTMA 4A7CA 5L2TA 1DAWA 3L8VA 5HE3A 2F7EE 4CFMA 4EOOA 1SVHA 3I7CA 3FZTA 1H26A 3TNQB 3ZLSA 5H3QA 3UP7A 3VBYA 3FHIA 2YACA 5DIAA 5L4QA 3FMMA 3TT0A 5LWNA 3R7YA 3NW7A 4F9CA 2BFYA 3R8PA 4JAIA 2VWWA 4RIYA 4XYFA 2PZPA 4DHFA 2EWAA 2GNJA 4BCFA 4XV1A 4DEHA 3ORXA 3OROA 5FXSA 4F9WA 2B9IA 4FT5A 1WBWA 1W0XC
chains in the Genus database with same CATH superfamily
2XEYA 3Q5ZA 5AR3A 5K3YA 2VGOA 5EM8A 3V01A 5FWKK 4D4RA 2HWOA 3G0FA 5CWZA 4MF1A 2BZIB 5EI2A 5AV1A 4BTKA 4OW8A 2PVNA 4L46A 1OIYA 2H6DA 3ULZA 4II5A 5LQFA 3FV8A 3CQEA 3H3CA 4NM0A 3WZUA 3BE2A 4HGSA 3EL8A 3DKCA 1OB3A 3E8DA 4RX7A 3U9CA 4YTFA 2VWXA 2R3NA 3DS6A 5AADA 2YAAA 2C4GA 2EU9A 5L8KA 4EKLA 4F7LA 3OUNB 4IVAA 4O38A 3KMUA 1MRYA 5CEQA 3DTCA 5HORA 4CFXA 4FA2A 5AAFA 2FSTX 2X9EA 4ENXA 4FG8A 4IADA 5I9WA 2VTPA 3LFFA 4C4HA 4BDKA 4K9YA 4JBQA 4QP6A 4QQ5A 4NKSA 3WZDA 4J97A 2WU6A 5IH5A 2OFUA 3PRFA 4CFWA 4RZVA 4F9AA 4XG7A 4F6SA 2B1PA 5CU2A 5ETFA 3R8UA 5IKWA 5DEYA 3FY2A 4BCQA 3D2KA 5KMJA 3SAYA 4FSTA 4KKHA 4C58A 3SDJA 3PE2A 2WPAA 3C0IA 5DR6A 5TF9A 2HZ4A 5EYKA 5KO1A 2GFSA 4OUCA 3W10A 2BMCA 3NYVA 3RP9A 3CJFA 2WTJA 3ZZWA 4CQGA 4S30A 3BYOA 4HYSA 2OXXA 4FV7A 2FVDA 3GXLA 4AA5A 2R3PA 3NR9A 3SKCA 2BRGA 4CMOA 4BWKA 3POZA 4E73A 5IA2A 2QOBA 3KRJA 3HEGA 5AIRA 5AM6A 5I9UA 2W9FB 3H9RA 2OBJA 1SVEA 3K5UA 4V0GB 3RZFA 4TWCA 1AQ1A 3S95A 4FIHA 4HVIA 4UXLA 2Z8CA 3R71A 3W8LA 2HW6A 4R3PA 5GJFA 2HK5A 1PYXA 2VD5A 5EK7A 4EI4A 1Z5MA 4F9BA 2HAKA 3SW7A 1YXSA 3QQFA 5F20A 2X6EA 2C5OA 3DY7A 3DDPA 5ACKA 3ODYX 3WF7A 4FTJA 4KABA 3ZYAA 2IJMA 2I0YA 5HCXA 2ITPA 3HMIA 3KULB 4HZSA 3KVXA 4C2WA 2XK6A 3EN5A 4GJ3A 4WO5A 3UIMA 2BTSA 4FSUA 4WNMA 3LXPA 4D28A 4KBAA 3CPCA 1JPAA 1ZOEA 4YO4A 3D14A 3ELJA 5KHWA 1PF8A 4DINA 1OL2A 5IEYA 4E4NA 3KC3A 2BALA 4ANSA 4IIRA 2J5FA 2BAJA 5CVFA 1W7HA 3O50A 3PXQA 2GPHA 4ASXA 4B99A 4WG4A 5C1QB 3MB7A 3VRZA 4BGHA 4LUDA 2BIKB 3D5VA 3P7CA 4IZ5A 4WUAA 4ASEA 4CD0A 4GU6A 1PXIA 3AT3A 4Y95A 4D2SA 2C6TA 3QD3A 4LRMA 2VO7A 3F5GA 3SX9A 3QKKA 3PXRA 4N0SA 5E90A 4O1PA 4RIWB 3ZFMA 3DAJA 4CXAA 2OIDA 4OTFA 5EW3A 3ZFYA 4A07A 2JITA 1W8CA 2CPKE 2YLEA 3D7TA 3I6UA 4BN1A 3H10A 3UBDA 4PMMA 2HWPA 4PF4A 3LVPA 4K18A 2PZ5A 1ATPE 1H27A 3F3VA 3W2PA 4DFNA 2JDRA 2XH5A 4EYMA 3UO5A 3MH0A 4TZRA 4HGLA 3W32A 1FPUA 3ZXZA 4Z7GA 4Y5HA 5LCJA 5E8WA 4FYNA 1PMVA 3MFTA 4BCPA 1WBOA 4IZAA 1X8BA 2FSMX 3NIEA 2ERKA 4EK5A 2O3PA 2HENA 3Q4TA 5CU6A 5DH3A 4HVDA 4CV8A 3FDNA 3UOKA 2Y9QA 4QPSA 2O64A 4AE9A 5BMSA 4O6LA 4YC3A 2G2FA 4C62A 3OT3A 1QPCA 3A61A 3HV7A 3NEWA 3QZFA 3R63A 4GIHA 4OAUC 3VBTA 2ZJWA 4EH7A 1ZMUA 3FHRA 4XEYA 4BB4A 3ENMA 3D5UA 1XHAA 4RIYB 4BCJA 3VUDA 2YISA 4RJ7A 1XR1A 3DBEA 4GYIA 3ZHPC 5GZ8A 4FTIA 5BUJA 1PXLA 4IAAA 4AFEA 4MXAA 1UU8A 1SNUA 4LFIA 3WOWA 3AGLA 3E64A 1J3HA 4DBNA 2VZ6A 4WBOA 2IF8A 1V0BA 4ZSEA 2VX1A 4L3LA 1SVGA 3OXZA 4NM3A 3SW4A 4FIIA 4FVPA 4S31A 2XNOA 5LCKA 3OBGA 5BYZA 3ORKA 3ZDIA 4UX9A 4PX6A 4ENYA 2G2HA 4M69A 4RJ8A 4UMTA 3BZ3A 3DB6A 5E92A 4DH3A 4FKOA 5HG7A 4PTEA 1VJYA 3R83A 2E2BA 3VUMA 1LR4A 2ITTA 4WG3A 4IC8A 4YPSA 3VJOA 4C4JA 4B4LA 4O4DA 3R0TA 2HZ0A 2EVAA 4QMWA 3NX8A 4ZAUA 5CF5A 4FG7A 2IN6A 3V3VA 4YSMA 4FKGA 4EOJA 2V5QA 4AW2A 5CF8A 3DXNA 3R9OA 2GNIA 3GU8A 2QR7A 3KRWA 4UYAA 1H4LA 4DH1A 3FMEA 2Y8OA 4GL9A 3QA8A 4K6ZA 2BAQA 3F3ZA 4IB5A 4TY1A 1YDRE 3R1QA 5AP3A 5EYCA 3ZRLA 4DG0E 4UWBA 5TO8A 4I21A 5IPJA 4FKQA 5ANKA 2YM5A 4FT9A 3HV3A 3EQDA 1YQJA 3DV3A 3ORIA 4GT3A 4YJUA 3CCNA 2WELA 2UW5A 3A99A 5BX0A 1PXNA 3BV2A 2OW3A 3D2IA 4MWIA 3NPCA 4RLKA 2WMAA 4PMSA 4GMYA 4TYIA 3HDMA 4JDKA 4OBOA 5AWMA 3LPBA 4L7FA 4QYEA 2XK3A 4ACGA 4MX9A 3PG1A 3HGKA 2WIPA 3P1AA 5AV0A 3I7BA 4GG7A 3AD5A 5HNIX 2EB2A 2BDFA 5TT7A 1UU3A 5L6OA 3M42A 3PSDA 4FTKA 4P90A 2OIBA 3AC1A 2R5TA 2J0JA 3EHAA 1WBVA 1ZRZA 4S32A 2OIQA 4GK3A 3QLGA 4XOZA 5KMIA 3CY3A 1VEBA 3FY0A 2VNYA 3VS5A 2X39A 2FA2A 2O8YA 2XNEA 1ZYJA 4GK2A 4FBXA 2Y6MA 4D4YA 3KXZA 3DFCB 2X8IA 4TNBA 3Q2MA 4QP8A 3UO6A 3BU3A 4IM2A 2YM7A 3QRJA 4O0VA 3RWQA 5FBNC 1B39A 1H25A 5EM7A 2A4LA 3WARA 4F70A 4HNIA 2C5NA 2W5AA 3F6XA 5D1JA 3REPA 4U44A 4TRLA 1Q97A 3TTIA 1UKIA 2ZOQA 4S34A 4C34A 2CLXA 3DLZA 3V5QA 4YHJA 2Q0NA 5AAEA 2G1TA 2HOGA 3HP5A 3O8TA 4NM5A 1UWJA 2A2AA 1LUFA 2R4BA 3FLYA 1L3RE 4RVLA 2YJSA 3GOPA 4E5BA 5T68A 4DEDA 4EOSA 4J7BA 4CEGA 2X7GA 5CSHA 4A06A 5EHOA 4G2FA 1JQHA 1TQPA 4G1WA 4GCJA 1XBCA 4LQMA 3IK3A 3BYVA 4FEQA 4GSBA 3OOMA 3EH9A 5LVLA 2ITOA 3UOJA 1IRKA 4EH9A 5HIEA 3RJCA 3U4UA 3D7TB 3M1SA 5LVPA 2A27A 2G01A 3R28A 4OTHA 1PXPA 5CAQA 3HKOA 3MIAA 3IECA 2XK8A 4CSVA 2VRXA 4KRDA 5HNGA 5BVEA 3KK8A 4EONA 4JVGA 4V04A 4YJVA 4ZZNA 1Q24A 2P55A 1I44A 4IW0A 4EOLA 4BHNA 2C3IB 3F82A 2IZUA 4L43A 3OP5A 4FIGA 3DKGA 3LIJA 4JOAA 5CXHA 3DK7A 3AC2A 3QTXA 4X6RA 5BYYA 3P0MA 4KSPA 4RG0A 3EZVA 5AIKA 1E1XA 5M56A 3NUPA 2X1NA 4IDVA 5BUEA 5IUHA 4N6YA 1U54A 1UWHA 2C69A 1W2DA 3E92A 4H1JA 3AT4A 1ZLTA 3R9NA 4FTQA 3GUBA 3BGZA 3JUHA 4BCGA 4EEVA 3OCSA 1JOWB 1QMZA 3UVRA 4CZYB 1QPDA 3ORTA 5AMNA 2ITXA 1Q3DA 2WMQA 5EHLA 4AUAA 5HLWA 1T45A 2OU7A 2ZYBA 1PMEA 2BR1A 3KU2A 5E1SA 1Y57A 4FSNA 4RVTA 4TYGA 1BX6A 2JAMA 4WUNA 4AS0A 3SD0A 4AE6A 3OW4A 5CXZA 2ACXA 3QX4A 4FVQA 3UO4A 2ITQA 5KMOA 2QHNA 4QTEA 1OIUA 5I4NA 4O6EA 2E9OA 4RFMA 2J50A 3BCEA 1JSUA 3G6GA 2ESMA 3FKNA 2G2IA 5C01A 4IZYA 2B4SB 2ITWA 4PP9A 3A8XA 3W16A 4WRGA 4D2RA 4QMTA 3QA0A 4M69B 4IBMA 2OXYA 4I6BA 3Q4UA 4EOKA 1M52A 4WNOA 3TJDA 4FKPA 1QPEA 5H9BA 2W1GA 4FTOA 4EZ3A 5DN3A 3KXXA 4PL3A 5JGBA 3MSSA 2C3JA 2CGUA 3P78A 4ITJA 5EH0A 4BDJA 3E8CA 4XLIA 4FUXA 5EG3A 2ZMDA 3EN7A 4G9RA 2IWIA 1VYZA 3NCZA 3Q4CA 2XNMA 5TE0A 4EH4A 4AGDA 5L2QA 4U79A 2ZM1A 4IHPA 2X7OA 2IO6A 4PPBA 4PPCA 5AR2A 5CANA 1JKTA 4FOBA 3BYMA 3VJNA 1ZXEA 2VO6A 3GCUA 5JGAA 4AG8A 5FRIA 5AUUA 1H1RA 3WZEA 2J4ZA 3TEIA 5L6PA 1WZYA 3EIDA 2RIOA 3WYXA 3QD0A 5HX6A 5IA1A 2XB7A 4AW1A 2WGJA 4FTLA 4A9YA 4LOPA 3NUUA 2C6LA 5CENA 2OF4A 1RE8A 1OM1A 3ALNA 3GFEA 4MBJA 3WE8A 2QO9A 2WQBA 4RJ6A 3UC3A 4DLIA 2Y7JA 5J79A 2R9SA 3DBDA 1QL6A 3HA8A 1J1CA 4O2PA 4IX5A 5HD7A 3OS3A 3OTVA 5E8VA 3QXOA 4MVFA 4TTHB 3CP9A 3W55A 5CEIA 3GT8A 3R1NA 4GW8A 3DNEA 1U4DA 3EQBA 4FSRA 4BIEA 4USEA 4D2VA 3GVUA 3VS7A 3E3BX 3RGFA 4DITA 5CSXA 4FL2A 4GYGA 2O63A 1K9AA 1Q99A 3A4PA 4A9UA 4J8NA 2UZWE 3QUPA 4B9DA 4JBPA 2J0LA 5CEOA 3SOAA 3H0YA 5AR4A 2R64A 4AZWA 3DNDA 2UUEA 1WAKA 1G5SA 1W98A 3UMWA 2UW6A 1F0QA 3GP0A 3GNIB 2Y4IB 1PMNA 4JR7A 4LM5A 3R1SA 4JQEA 4NFMA 2X0QA 3E87A 3CS9A 4O96A 5JEBA 3GEQA 3VUKA 4NSTA 3HP2A 5DT0A 5EYDA 4BKZA 1YXTA 2Z7LA 4HJOA 3WIGA 4ZTRA 2R0IA 3MPAA 5DNRA 5HQ0A 3ZUVA 4PY1A 2J0IA 4Q2AA 5ETAA 5CU0A 3BEGA 4DEIA 3FSFA 4FL1A 3Q9XA 4UB7A 4XP3A 1YW2A 2UW0A 3IO7A 3JVSA 3U51A 3D5WA 4M7IA 4G5PA 2WO6A 1O6YA 3DFAA 4QYFA 3BX5A 3D94A 4X3FC 5EOLA 3CR0A 2WMSA 4R3RA 2WKMA 3C4WA 3PY3A 2BPMA 4H1MA 3R7OA 3ZTXA 5DMZA 4G34A 4X6QC 3G33A 3OZ6A 3AC3A 4F7JA 5KMMA 3OUKA 3P7BA 2XK9A 2UZUE 3IDBA 4RWLA 4WHZA 5LMBA 1G3NA 3FPMA 4F63A 3JVRA 4FF8A 3NNVA 5JRSA 1A9UA 1V0PA 4IWPA 4OTPA 1Q41A 3QTIA 4AFJA 3SLSA 1U46A 3ZH8A 5AX9A 2RF9A 4NJ3A 4U6RA 5CASA 4DEGA 3V8SA 3PA3A 4EQMA 1PXMA 2IVSA 2XKEA 4ZIMA 4BCNA 2PY3A 3CEKA 2A19B 4EYJA 1PKGA 4WG5A 4YC6A 4ZTQA 2C0TA 3W8QA 4ALUA 2B54A 3MY5A 3A4OX 2PL0A 1JSTA 3Q6WA 1WBPA 3OBJA 1YVJA 2RFEA 3EQFA 3VQHA 2ITNA 3TJCA 3MFSA 3C4EA 3DOGA 4FV6A 4C02A 3D5XA 3I81A 5K5NA 1ZY5A 3FI3A 3QWJA 1U54B 4RWKA 3GENA 4PWNA 4FTUA 2ZV7A 5CEMA 3NSZA 4LOOA 5ETIA 3SXSA 5I9YA 5KZIA 1AGWA 1OMWA 1OKYA 3W33A 4E5WA 1YHSA 4FV0A 4F9YA 5CVHA 4L42A 4S2ZA 2XUUA 3MTFA 3LCSA 5M4FA 1YRPA 3QQJA 4U40A 2A98A 4ACMA 4IJ9A 2ONLC 1YHWA 1TVOA 3O96A 1PXJA 3I79A 1M2RA 3PXZA 1YI4A 1F5QA 4FSQA 4J1RA 3ZO3A 3M2WA 3PJ3A 4QNYA 2X2MA 2X0OA 4C33A 2C6EA 3MH2A 3TV4A 4UWCA 4E3CA 4UMPA 2VWYA 5M57A 3QRUA 3BWJA 3V5TA 5HTBA 2OICA 4C8BA 4PDPA 4C7TA 4JQ8A 4YZMA 4KSQA 5I9XA 3OY3A 3V6RA 4H39A 3ZC6A 5DEWA 2QODA 3ZSHA 4BRXA 5DLSA 5LMAA 4R7IA 5IEVA 4QMXA 3GFWA 4GIIA 1FOTA 3BELA 3PUPA 4FV3A 4O22A 2PVKA 3WZKA 4LMNA 5I5ZA 2B9HA 3HRBA 3GU6A 2YCSA 4AQCA 4BIDA 4EH3A 3V8WA 5JQ8A 1BLXA 4MEDA 3AMYA 3IOPA 3PPKA 3VHKA 3WF5A 4UYNA 5IUGA 4GEOA 3MVHA 4RIXA 2W5HA 3QCXA 2QR8A 2BRBA 1IEPA 4OLIA 3U9NA 2B7AA 3IW5A 1JSVA 3R8VA 3FC1X 5BVKA 5IF1A 5DE2A 4WNPA 4YHFA 2YIQA 1R3CA 4G3EA 3DJ7A 3I0QA 4EUUA 1JBPE 3TI1A 5JFSA 5EI8A 4GT5A 4QP3A 3F5PA 3L8SA 4NW6A 1OGUA 3EWHA 3PA5A 2OJ9A 5E8XA 3D4QA 2V7AA 3NLBA 4HVSA 3BE9A 4O2ZA 4JLCA 4PV0A 2WXVA 1GIIA 3ORPA 4ZP5A 1BUHA 4D2PA 4F6UA 3QLFA 3UNJA 2VWIA 5D12A 4BFMA 2V62A 3PJ1A 1LEZA 4JBVA 4PTGA 2G15A 5JK3A 2J6MA 1OUKA 5F1ZA 3ULIA 4C59A 2VTHA 4RT7A 3QFVA 1J91A 5H8EA 3TL8A 4ZSAA 3ZLYA 2Z7RA 4I0RA 4IM3A 4NZWB 4U9AA 2ZV9A 4E4XA 5IA5A 4B8MA 2HY81 4RJ3A 3W2QA 3HRFA 3EYHA 5HBEA 2QOLA 4YC8A 3LFAA 1REJA 2XCKA 3VS4A 2UZBA 3LHJA 4HNFA 2YIWA 3JYAA 2B55A 4RX5A 1K2PA 4AOJA 4EZ7A 2UZLA 4M12A 1OKZA 2R3MA 3KF7A 3R8LA 4P4CA 4I93A 4ZEGA 4C3RA 2BAKA 5BVNA 3KFAA 3VWAA 2X2KA 1GY3A 2OH4A 5A46A 5J87A 3QWKA 5IU2A 4MTAA 3F66A 3K54A 2VTQA 3QTUA 5EM6A 4KIKA 1M14A 3QD4A 2V7OA 3LM5A 3WF8A 3IW8A 3KCKA 3R7VA 1BL7A 3PVWA 4QMLA 5GJDA 4UWYA 5CZIA 4J98A 3RHKA 3TTJA 1UV5A 4EBVA 4OTWA 4RWIA 2PMOX 3AGMA 4FIFA 3EL7A 4NIFA 1OI9A 2WQMA 5HG9A 3HYHA 2QD9A 3NW5A 2CSNA 3KXHA 2LGCA 3Q52A 4AGWA 1YDTE 2ZV2A 4Y83A 1ZYCA 3MB6A 3AQVA 3UZTA 3I1AA 3QKMA 4AU8A 3BHUA 2ZMCA 4N70A 3PXFA 2VNWA 2JIIA 3ZUTA 3MDYA 3O0GA 2GU8A 2JKKA 2JFMA 3EZRA 4FR4A 3A7HA 3RK9A 2VTJA 3IKAA 2W5BA 3SXFA 3WYYA 4QP7A 3MS9A 5C8MA 2P33A 3UC4A 2X8EA 3BV3A 2R3KA 2DUVA 2JIVA 4QMYA 1STCE 4NK9A 1H1SA 4ANBA 3FYKX 1GZNA 2W1EA 3H9FA 3NWWA 3EQHA 4QP2A 4WSQA 3ACJA 2WZJA 1R78A 2JAVA 3FYJX 4ZTNA 4BCHA 3RNYA 2WEVA 5FM2A 1UKHA 3UODA 1WCCA 5E8SA 3BRBA 5AP2A 1Q4LA 4XBUA 1YXVA 4MD7E 5D7VA 4MH7A 2RFSA 4Q9ZA 5M4IA 2F2UA 4BHZA 2XP2A 3E8EA 4K11A 4NUSA 3U6HA 3HLLA 2GQGA 3QZGA 5J5SA 3DCVA 5DHJA 3C4XA 4QTBA 3VUHA 4KD1A 1OPJA 5L8JA 5FXRA 3B8QA 2B52A 4ZY6A 5CAUA 4FG9A 2B53A 4BCMA 5JFWA 4HW7A 3GC9A 5LXMA 4JG8A 1ZMVA 2OWBA 3FC2A 1H00A 3NYXA 5AP1A 4DFZE 2NRUA 4MXXA 3JY0A 2YCRA 1PHKA 3UIUA 4FV5A 2XM9A 1T46A 3F69A 4XLVA 5IMEA 5JKGA 3RAKA 3RM6A 4EC8A 3I60A 4BVUA 3VBVA 3FPQA 3F3WA 3UJGA 1W84A 4CKJA 4IWOA 2VTSA 2R3HA 4I4EA 2HXLA 2PZIA 5K9IA 3G51A 3PWYA 4ZSJA 3TZ7A 4BI0A 4BBFA 4GFMA 4I23A 3AC4A 2QOHA 3MA3A 3C4FA 2R7BA 4OTQA 2YABA 5CALA 3QX2A 3D83A 2YM3A 2UVXA 3R73A 4I24A 1CMKE 3W2SA 5C26A 3MVJA 3MPMA 2QKWB 3LMGA 3GOKA 4BWPA 4IX3A 2JIUA 4I41A 4OT5A 5GNKA 3F9NA 3LQ8A 4YPDA 5GJGA 5ANOA 3CE3A 4UMRA 4PDOA 2ZB0A 3ZDUA 4RRVA 4RIXB 4ACCA 4MF0A 1JLUE 1BL6A 5KUPA 5HG8A 1OPLA 2O65A 2PVFA 4XG3A 5FBOA 2YJRA 2UW4A 4WD5A 3MFUA 3CKWA 1WVXA 4RC2A 4YP8A 4F7NA 2UW3A 1KSWA 5CSPA 2CMWA 3PY1A 4OT6A 4WNKA 3FMDA 4DN5A 3FI2A 1V0OA 2JLDA 5FTQA 3AXWA 1KOBA 2V55A 2WU7A 3SQQA 3V5LA 5L3AA 5F95A 4DC2A 3PYYA 1GZOA 1MQBA 3DK3A 4M66A 1NXKA 4XCUA 4CT1A 2PUUA 4XOYA 2GHMA 4G17A 3UE4A 4U7ZA 4EK6A 3DBQA 4NCTA 4DEEA 3E88A 3FMJA 4ERWA 2H8HA 2I0HA 5HE2A 3GU5A 2FO0A 4XP0A 2WHBA 2W05A 2JBOA 2XYNA 2BFXA 3CXWA 4IWDA 4XV3A 3AMBA 3HNGA 3C50A 4GRBA 4X2GA 1YXUA 4U45A 4RPVA 3UGCA 4ZZMA 4AOIA 5JH6A 3FLWA 4L9IA 3HV4A 3UYTA 4KINA 4MNEA 4O4FA 2R3IA 3QYWA 3NAXA 3O8PA 3IOKA 4U5JA 2GS6A 3AD6A 4BCOA 4AXAA 5JSMA 3C5UA 2C6MA 4YU2A 3DK6A 4AOTA 2XYUA 5A54A 1WVWA 4ZOGA 4KB8A 5HLPA 2X4ZA 4RQKA 4AGUA 1ZARA 3O17A 5CNOA 4ANNA 5JQ5A 3W18A 3BHVA 1XH8A 3UIXA 4EOQA 2WAJA 4RC4A 2OFVA 4L67A 4GU9A 5CT0A 4H36A 4K77A 4X2KA 4X2NA 2W1FA 3NNUA 2GSFA 4I0TA 2W7XA 3QUDA 2JKOA 4H58A 4KA3A 1KOAA 4PRJA 1CSNA 4PMTA 4C4FA 4HGEA 4XBRA 3DT1A 4KIKB 3F88A 3JY9A 3MJ1A 4O4CA 3O51A 5HO8A 3ZEPA 2O0UA 3ZLXA 5JZJA 4PTCA 3EN6A 3QTRA 4JNWA 4LV8A 3ZOSA 4IQ6A 4AW0A 3B8RA 4HGTA 3AT2A 4M15A 5CVGA 3ANRA 2AYPA 4FODA 4I5HA 4PPAA 4O0RA 3ZXTA 5DA3A 5ANEA 3MH3A 2GFCA 3PRIA 4B6LA 3VW8A 1H1PA 3G2FA 4AWIA 5IMXA 1V1KA 5BVDA 3FLSA 2WEIA 4QMVA 2YM4A 2IW9A 5AP0A 2B9FA 3ENHA 3F3TA 1ZZLA 2PMIA 3MI9A 4QTCA 2VWBA 4S33A 4J8MA 4TPTA 3DBCA 4JS8A 3L9MA 4QO9A 5CI6A 3EFWA 3MV5A 3QTSA 3RNIA 3QF9A 4K1BA 1SMHA 2BDWA 3KXGA 1REKA 1XH7A 2YIXA 1ZY4A 3Q9WA 3G6HA 1WMKA 2Q0BA 3ETAA 2W99B 3Q9YA 4QP4A 1Q3WA 2Y4PA 4WBBB 3UOLA 4MD8E 4EH6A 5LVNA 3OT8A 2WNTA 1YI3A 3MIYA 4YTIA 3LJ0A 5LMKC 5BVFA 4LGGA 1OPKA 1P14A 2UZTA 5A6OA 3E5AA 1B6CB 2UVYA 3DBFA 3CPBA 4LRJA 2BRHA 3NAYA 3RVGA 3MPTA 3QCYA 1MQ4A 1WFCA 2OO8X 3P7AA 5ANDA 2XIKA 2QLQA 1XWSA 2QOIA 2QNJA 3U6IA 4G3DA 5HOAA 3ODZX 1WBTA 2WQOA 4IB3A 4ANLA 1BKXA 4EC9A 4F1OA 2GMXA 3FMNA 3A60A 1CM8A 4IM0A 3PZHA 4RIOA 4QQTA 1PJKA 2PVMA 1GAGA 1NA7A 2NPQA 3FL5A 3IDCA 3NNWA 4GVJA 4KNBA 4WSYA 4C3PA 4YZCA 2HYYA 4IMYA 3TUDA 3K3JA 2OZOA 5T3QA 3RZBA 4XV2A 1YI6A 3F7ZA 3R2BA 1WBSA 4FYOA 4I5PA 4ZY5A 4FICA 4I0SA 2FUMA 2C5YA 3V5WA 4Z55A 1MRUA 3UVQA 3VO3A 4BGQA 3II5A 1IR3A 4YJNA 5KBRA 3GQIA 3QYZA 4MXYA 1O6KA 2H34A 3TKIA 5HEZA 1JKLA 5AUZA 2XIXA 3N51A 4RLLA 5BVWA 4E8AA 4O0SA 2Z7QA 5EW9A 5AR8A 3I0OA 3OY1A 5CF6A 4O27B 1H0WA 4UXQA 3ZS5A 5HTCA 5IG1A 2ETRA 5AM7A 3EQRA 5FQDC 4ZJIA 5CAPA 4W9WA 3NCGA 3G0EA 3OXIA 3SOCA 2R3GA 4F99A 4IAZA 3GB2A 4O4EA 4WT6A 4J96A 3E62A 4EUTA 3LXNA 3E7OA 1M7QA 4J95A 3ZRMA 2IVUA 5AA8A 4GFGA 5LOHA 3O8UA 3V8TA 5ACBC 3WILA 4D1XA 2WMUA 3CTHA 3QGWA 3QZIA 1NVSA 5DR2A 3SRVA 4EHVA 2SRCA 3TG1A 4EHZA 2PE2A 2ITYA 1JVPP 5CX9A 3WBLA 4EK4A 3LFSA 4CCUA 4YTHA 2XZSA 2WIHA 5HLNA 2VO3A 3PIXA 1NVQA 4FIJA 1JNKA 4EK3A 5CQUA 3C9WA 3QBNA 4RBLA 2VGPA 5DGZA 4HPUE 4WKQA 3EYGA 2XIYA 3R6XA 3Q32A 3P08A 1YOLA 3DTWA 4IB1A 4JX7A 5AV2A 3RINA 5CAVA 5DWRA 2PMNX 5F4NA 2HZNA 5CSVA 2IZSA 2VWVA 4C38A 4Y46A 4FT3A 3LXLA 4L8MA 3IONA 4JRNA 3THBA 3HV5A 5CNNA 1NVRA 3FMKA 1GIHA 4PL4A 1ZZ2A 5FDPA 2C3KA 2W1DA 3OMVA 4YO6A 3ZUUA 3FJQE 3FXZA 4XH6A 2GNFA 4MKCA 2EUFB 4ANQA 2CDZA 2I0VA 2F7ZE 4FKTA 3RAIA 4X3FA 4MNEB 5AUTA 5I9ZA 5LVMA 1BI7A 4YJOA 4FTTA 5GZAA 4EOPA 4FZFB 2Z7SA 5CLPA 1YOMA 2WMTA 4BC6A 3R00A 4GUEA 1S9JA 2YM6A 1FVTA 4IH8A 4TWOA 4QMMA 2NRYA 4FT7A 4AT4A 2AC3A 4E7WA 3D0EA 3GBZA 3KMMA 4YJSA 2Z2WA 4QMSA 4X0MA 4FTAA 5CY3A 1XH6A 1Q62A 4E93A 4CNHA 1Q8WA 2J51A 4CKRA 3BYUA 3FKLA 3I4BA 2VV9A 2CLQA 5AR5A 2W0JA 4TN6A 4L44A 2P2IA 3OTUA 2WB8A 3HUCA 3FE3A 1H1WA 4KIQA 4L68A 4TXCA 5HU9A 4EQCA 2VUWA 2YDKA 3NUXA 4YLJA 5CF4A 3P4KA 5IISA 2ZDTA 4P7EA 2QLUA 4ZLOA 3R1YA 3ZO4A 3M11A 3K5VA 4FV4A 4DCEA 4YR8A 2XKDA 2NP8A 3LFNA 4QPAA 4DG2E 4FX3A 1S9IA 2F2CB 2IVTA 3RK5A 3ORZA 3NZ0A 4J53A 4U8ZA 1AD5A 1ZMWA 3COIA 2C3LA 2VTOA 2QO2A 3GGFA 5E8TA 3UQFA 4PUZA 3LXKA 4AN2A 4BIBA 5DVRA 4QQCA 3R8ZA 5BNJA 5LVOA 3ACKA 3EFKA 4UBAA 3LOKA 2F4JA 5ANGA 3EQCA 3DQXA 5HKMA 3EOCA 2NO3A 3R02A 2VO0A 2ONLA 4RJ5A 4E20A 4FKJA 3ZMMA 5KBQA 2UZDA 4JXFA 3WZJA 1YHVA 2QU5A 1OKVA 4H3BA 4APPA 3TIZA 3LZBA 4QYYA 2Y4IC 5HBJA 4TYJA 1PYEA 4O0TA 4L01A 4M3QA 3FKOA 3UNZA 1O9UA 4I3ZA 3JPVA 2ZB1A 4DFXE 4IX6A 3I6WA 4ALWA 5JT2A 5FDXA 4E6DA 2WQNA 1SNXA 3BWFA 2UVZA 3Q3BA 4BDEA 3DZOA 5FP5A 3MWUA 3A7IA 2YITA 4IVBA 4JIKA 3KXMA 1VZOA 2H9VA 5CS6A 4E4LA 2W96B 3T3UA 5K5XA 4TWPA 2X6DA 4D4VA 3IW6A 4O0UA 4F4PA 4TYEA 4BDHA 2J5EA 2QG5A 2I0EA 2YIYA 4TNDA 3UIBA 3GC7A 4BDIA 4U41A 3QXPA 3Q96A 2IEWA 4X21A 2PK9A 1KE9A 3C4ZA 5TOZA 4BL1A 2REIA 1Q8ZA 2F57A 5KZ0A 3FI4A 3SV0A 1E9HA 5CI7A 2HCKA 4RC3A 2YZAA 5FEDA 4BKJA 2OF2A 3VS2A 3PJ8A 2FB8A 5HNBA 2QHMA 3BQCA 3ZBFA 3P79A 1ZOHA 3PWDA 3S1HA 3W2OA 3K2LA 5AEPA 1Z57A 3VBXA 3Q5IA 3TNPC 4I1ZA 1KE8A 5D7AA 3VBWA 4O1OA 5D10A 2EB3A 4IZ7A 4KKGA 2WTKC 1R0PA 2GNHA 2V0DA 3BLHA 3OWJA 4UZHA 4BICA 4DYMA 4FRFA 4J71A 4BF2A 1H1QA 1B38A 2O2UA 3TWJA 4FSMA 2CCIA 4M0YA 3LLTA 3NRMA 3FZRA 2JDOA 5HD4A 3TZ8A 4ASZA