4D5KA

Focal adhesion kinase catalytic domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
272
structure length
255
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Allosteric Regulation of Focal Adhesion Kinase by Pip2 and ATP.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE
total genus 86
structure length 255
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d5kA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d5kA01
1R0PA 4MKCA 4L01A 3F2NA 5BQ0A 2XNPA 5JRSA 2BFYA 1R78A 1NA7A 5AR8A 4BCFA 2B4SB 1YHSA 3COHA 4JDJA 4OTPA 4RC4A 2E9NA 3QD4A 4NT4A 4DCEA 3I60A 4C4JA 4EQCA 5HU9A 3FHRA 1OPLA 3KRRA 3BLQA 5HTIA 4B9DA 3BIZA 5C9CA 5IA5A 1YW2A 5HNGA 3FMEA 3FMNA 4IWPA 3Q6WA 2R3HA 4USDA 2QVSE 2JKKA 4BTMA 2C3KA 4R8QA 3RAIA 2CSNA 5DWRA 4F9CA 2OW3A 3VBYA 4MF0A 3AMAA 3WZEA 4QPMA 1JNKA 3M1SA 3QTZA 4IZ7A 4R3CA 2JFMA 4Y73A 3R7IA 2CMWA 4QQTA 5I9UA 2JD5A 2C5OA 4I5MA 5CVGA 5AV0A 4PRJA 2UW5A 2WHBA 4IB3A 4QMPA 5KZIA 4QMWA 5BYZA 3WILA 5J7BA 3VJNA 2VTOA 4OGRA 2OKRA 3PE1A 1Y8YA 4HGLA 2VWXA 4O0UA 4Y5HA 3NMUF 4BKYA 3JS2A 5L2WA 4BL1A 2YIRA 2OJIA 4JI9A 4UZDA 3F5PA 2BDFA 4AFEA 1LEWA 3R63A 1Y8GA 4YJRA 1GIIA 5EH0A 2HZIA 4EH9A 4HNIA 2YZLA 1JLUE 2GFSA 4XG9A 3MYGA 3ZLXA 2UVYA 4ACDA 2CGUA 5K3YA 3NGAA 3WBLA 5DA3A 4FV7A 2WTDA 4IAYA 4LM5A 4Y46A 4P90A 3HMNA 3C51A 3O71A 1REKA 4YPDA 3BHTA 2RF9A 3QCXA 3MA3A 4X3FB 5KMLA 5CZIA 1L8TA 5AUXA 1H1SA 4ASXA 1W7HA 4FTAA 2PU8A 1KSWA 3QGYA 3CPBA 4HCUA 3W2PA 3U6HA 4F0IA 2ZM3A 3A8WA 3CBLA 3GENA 5AR3A 3PFQA 2X4ZA 4CV8A 2R3KA 2IN6A 2QHNA 3Q2MA 3R28A 4G6NA 3QD0A 4BWXA 3JYAA 4K18A 2PVMA 4GIIA 4EWQA 5J5SA 4NW6A 1IASA 5DNRA 5C8MA 3RHXA 4BDBA 4DGGA 4NM7A 4O7VA 1OGUA 3KXGA 1LEZA 5L2TA 4BY9E 3JY0A 5E1SA 1E1VA 2W1CA 3GCQA 1R0EA 3P4KA 1S9JA 4CLIA 1A06A 2C30A 4GG7A 4JG8A 3VBXA 3RM7A 4DH5A 3F88A 1BI7A 1FMKA 2DUVA 4L42A 2J0JA 4B6LA 5A46A 3KRWA 2HY81 4L7FA 4XBRA 4DINA 3CE3A 2B55A 3R7OA 2ITZA 4IZYA 1PKGA 1JQHA 2HK5A 2W1FA 3PPKA 1SM2A 4GK2A 4Y85A 3VUTA 4DEAA 4AGWA 1UWHA 3HLLA 1ZY4A 1YWRA 3HEGA 1PHKA 4AG8A 3IW6A 4EOKA 3QWKA 4GU9A 5J9LA 4QMVA 4BDGA 4FTOA 4MD9E 4YLKA 3H9OA 4XX9A 4RC3A 3OG7A 3FLQA 2G2HA 3DFAA 4TWNA 1W82A 4EORA 4CRSA 3VBQA 3OS3A 2OFVA 4QMSA 4YURA 2WQNA 2XBAA 2YIWA 4ZIMA 4JXFA 1M52A 4X2GA 5CF5A 3I7CA 2WMRA 5HOAA 4APPA 2JKOA 3WI6A 4FK6A 4UMPA 5BYYA 5IEXA 3QZGA 5HVJA 3FXZA 3W2QA 2B9JA 2I1MA 3OOMA 4N6ZA 2G9XA 3FQSA 4BCPA 3DBDA 1KV1A 3PJCA 1GNGA 2A0CX 1FGIA 2OWBA 4HPTE 4F9AA 1FMOE 4KNBA 3ZHPC 4B8LA 3ET7A 5GINE 5D10A 3G0FA 1J1CA 3ZXTA 4DH3A 2BTRA 5JZNA 1GOLA 4IB5A 4YUQA 2YWVA 4L52A 3HECA 3IQ7A 3ZO4A 3S4QA 4DGMA 3LJ2A 3UQGA 4EUTA 5CU0A 4M66A 2VO0A 3EQPA 3HMMA 4IX3A 4MWHA 4Z3VA 3TNHA 3MV5A 3Q9YA 4LOQA 3NPCA 3ALOA 4JDHA 3QTXA 3NNUA 4M8TA 4WSQA 3ATSA 2YCQA 3O50A 1PXJA 3BBWA 3VF8A 5FGKA 1BL6A 4J8MA 4R7IA 5EFQA 4I24A 3I79A 4FTNA 4MHAA 4OBPA 2ITXA 4AU8A 3TT0A 4AZTA 4LG4A 2PE1A 2ERKA 5IUIA 3REPA 4FEWA 3AC1A 2IVSA 5DH3A 3BV2A 3NUSA 4J8NA 4Y8DA 4ITJA 1Q5KA 4RBLA 3MJ1A 3QYWA 5JQ8A 2UZNA 4JR7A 5K5XA 4FZAB 5J8IA 4G6LA 2VTMA 2NO3A 3HUBA 3LW0A 3BX5A 4YNOA 4YNEA 5HO6A 5DYJA 2XJ0A 2XP2A 4FVRA 1Z57A 3AC4A 4YHJA 2YM5A 1W84A 4PMSA 5EW9A 4JJRA 4UMTA 5HIEA 3IW8A 1KUTA 3VWAA 2PHKA 3BPRA 1YKRA 3EQBA 3NCGA 1U46A 3E87A 5HVYA 5J1VA 4XRLA 2XNNA 3OCSA 2R3JA 3JVRA 5CAQA 3HAVA 4UXLA 4DN5A 1PYEA 3PXRA 3TL8A 4TY1A 3F3TA 4L68A 4RPVA 3DFCB 2H96A 3TUBA 4R78A 3ZEWA 2X9FA 3MWUA 2X2KA 3HMPA 4ZY5A 1V1KA 2WMBA 2WMQA 3TN8A 2HZ4A 5HCZA 4GUEA 3R73A 2W96B 4UBAA 3EIDA 4J95A 4IBMA 5JFXA 2P0CA 3COIA 4CMTA 5AUUA 2J90A 3IK3A 4I4FA 5L6PA 3LMIA 5AV4A 4M69A 4QTDA 4JT3A 4GK3A 3EKNA 1YVJA 3TNPC 3FZRA 4ERWA 4PL4A 4C3FA 2YACA 4HYSA 2QOOA 4I1ZA 2VTPA 3RI1A 2XNMA 5JGDA 2YIYA 3DLSA 5AUWA 2VWWA 4YC8A 3UO4A 1UKIA 4OTQA 3ZSHA 3DQXA 2XNBA 3FZPA 1ND4A 4QP7A 3V8SA 3V5TA 4YO6A 4RJ6A 4FGRA 1Q97A 3QQLA 5EOLA 2BRHA 3PA5A 3G6GA 3F5XA 4MYGA 2OO8X 4FKWA 5TOZA 4O91A 4ZLZA 4F9WA 3GU4A 3EQCA 3VS6A 2WTJA 2E9PA 3KMMA 4GV1A 4G2FA 2CKPA 1E1XA 2VNWA 4EK5A 2XK7A 3LFQA 2GU8A 4MNEA 3DOGA 5CXHA 3WE4A 5IF1A 2UUEA 5KKRB 3TV4A 3QQGA 3R8ZA 2XK6A 4V04A 5I3OA 4DFBA 3UC4A 4GYIA 4L3PA 3UDBA 2C69A 3H10A 3R8UA 1OECA 3IOKA 5HG8A 3ZRLA 4KIPA 3WIGA 4IC8A 2R7BA 2YFXA 4AUAA 3TV6A 3EL7A 5CAVA 3ETAA 3D14A 1OKZA 2OXDA 4WNOA 3BWJA 4ANNA 1T46A 2FVDA 3G15A 4IX6A 4YSJA 2RFSA 5BVNA 3R7EA 5HTCA 3PJ8A 3R22A 2YEXA 4OTWA 2GPHA 4G17A 5L8KA 3PJ3A 2C6KA 2Z7QA 4AA5A 4BYIA 4RVLA 4CZUA 4IACA 4D4YA 5HX8A 5IZFA 2J0LA 4EWHA 5A4QA 3UIBA 4U45A 3A61A 3LZBA 3LFDA 2XJ2A 4AOJA 1PMVA 2BRBA 3UIXA 2V62A 3VIDA 3NZ0A 3AD4A 1DM2A 2RG6A 5CSHA 3NR9A 4KKGA 2XJ1A 4BIDA 5AAGA 1JSTA 3QCQA 3RCJA 1MUOA 2ZV9A 4C57A 3QZIA 3CQWA 2KTYA 3E3BX 4FSMA 3R9OA 4ZJIA 4KS7A 2GNHA 3CEKA 2C5NA 3PPJA 5AIRA 3VBVA 1OIRA 4AT3A 5HU3A 1G8SA 1BI8A 2YLFA 5KMKA 4KS8A 1MP8A 4BDEA 3QC9A 4HJOA 3MY0A 4EYJA 1UVRA 3QCSA 3OFMA 4ZY6A 3KXXA 4AAAA 3OVVA 4EC8A 3DZQA 2CCIA 2WQBA 4WHZA 4K6ZA 4FE2A 5TE0A 1DI8A 4CCBA 4EQUA 2QI8A 3LE6A 4FKOA 5FP6A 5T3QA 4EKKA 4QRCA 5CEPA 5IQEA 3ZSIA 3F2AA 5DRBA 2F49A 2ZM4A 2XEYA 3RK5A 4EHEA 4FT5A 4LUEA 3KA0A 4ONAA 5E90A 5KMOA 4I94A 1JVPP 3DB6A 2HZNA 3B8QA 1PXOA 1M7NA 3QHWA 5ANEA 3N4UA 4ZTHA 3NW6A 4AGCA 4EL9A 4DT9A 5DHJA 2W1HA 4F6SA 2BRMA 5FWKK 3PXQA 4FYNA 2P55A 4NW5A 4X21A 3R6XA 3CKXA 3ZH8A 4G3EA 3BU5A 1IRKA 2XEZA 3ZCLA 2EUFB 3ORLA 1MQBA 3FAAA 1PXLA 3Q4ZA 1UKHA 3QZFA 4YJVA 3UO6A 3QTWA 4FA2A 2W1DA 2R3NA 3VS5A 3COMA 1W98A 2XCHA 3BLHA 4O82A 4O1PA 2GSFA 3KL8A 3O23A 3MDYA 5EDQA 4O0XA 4R3RA 4QT1A 1LPUA 2BHHA 2Y6OA 5LVMA 3NWWA 3IONA 5CI7A 4YHFA 3SXSA 5CSPA 3DXPA 2ITYA 5LCJA 3EZRA 4F09A 3OD6X 1YOJA 4HPUE 4RT7A 3OCTA 4FZFB 3AGLA 2GMXA 5IMEA 3FEGA 2OGVA 2PVKA 2UW3A 4JRVA 5FEQA 3GCSA 3W32A 2GFCA 3CY2A 4EHGA 3DJ6A 4JQ8A 4TW9A 4BFMA 1Q99A 4CYIA 5C8KA 4I6HA 5CAPA 4DE4A 3NYVA 1Q61A 5I5ZA 4I3ZA 4FYOA 4J7BA 2UZTA 2V7OA 4HOKA 3DY7A 3RBWA 3RNIA 3BE2A 4Q2AA 4HVDA 3BE9A 3V8TA 4PTCA 5E92A 3VS0A 5GJFA 2R4BA 3R83A 3LFFA 2FSMX 4PDPA 2R3QA 2IW9A 2UW9A 5L8LA 3PXZA 1GZKA 2FA2A 3NRMA 3Q4CA 3WZKA 4AN3A 5L3AA 4YJTA 3PXFA 2W99B 1XH8A 3O8PA 5CU3A 3TCPA 2CPKE 4GCJA 4UALA 3FLYA 2VU3A 4N70A 3LFSA 4X2NA 2YLEA 5AX3A 4CFUA 1JKLA 4RIWA 3QKLA 5JK3A 5CWZA 3HYHA 2VTTA 4HGTA 4O0WA 4A4LA 4UX9A 4M68A 1Q3WA 2W1IA 1VYWA 2X8DA 3CQUA 3PXYA 4TWCA 3NYXA 2ITWA 1NVSA 4MF1A 4JX7A 4BTJA 4G9RA 4RQVA 4E1ZA 4DGLC 4PMTA 5AP3A 3QRTA 4F9BA 2XKFA 3QX2A 3DKGA 2I6LA 3FXWA 5CU6A 3LKMA 2OXYA 3IDCA 4CYJA 5HNBA 2QD9A 4YSMA 3O17A 5BVFA 1H4LA 2IW6A 1WAKA 5LQFA 2QQ7A 4II5A 4CT2A 4FT3A 3HVCA 4DLJA 5L2SA 4YLJA 4XP2A 3MH2A 2JBPA 2WOTA 2ITNA 3FMKA 4BTFA 4J71A 4A9UA 5I9WA 3IDBA 4DGNA 2BROA 3DGKA 3QKKA 2XIYA 4QMMA 1H27A 1CDKA 4XOZA 5BYLA 3CR0A 2BZKB 1XBAA 1E9HA 2Z7LA 4APCA 2CDZA 2WNTA 3O96A 3T8OA 5I9ZA 3F5UA 4IVBA 1KE9A 5EHYA 2BRNA 3U4WA 4B8MA 2IZUA 3HMOA 4CFVA 2IWIA 4KIKB 3GCVA 3OBJA 5AV2A 4FTMA 3CXWA 5GJDA 4ARKA 5FDPA 3A7GA 4B99A 3R30A 2P2HA 3QQKA 4X3FC 3MFUA 4FNXA 3DBFA 1M17A 2RSVA 4FUXA 4DTBA 1YDRE 5HI2A 4RRVA 3QF9A 4ZZNA 3ULZA 4ZLOA 5GZ9A 1GY3A 3AT3A 4XRJA 5AR4A 5KKRC 5LWNA 2BKZA 3KCKA 4RGJA 3OWPA 2E9UA 2EXEA 2X2MA 4ASDA 5I4NA 5KO1A 4ASZA 1B38A 3LFCA 4PDSA 3RK9A 4WNPA 4D0WA 5E9EA 1OI9A 2PK9A 3MH1A 2HCKA 3AOXA 2IZTA 3KMUA 3EN9A 4FKVA 2W7XA 1Z9XA 4R5SA 4RIOA 2R5TA 2E9VA 2ZB1A 2EU9A 4HZRA 2PZRA 3EQHA 2C0IA 1SNUA 3F3ZA 3NYOA 4FEQA 2QU6A 4FZDB 4TYGA 4XHKB 3BHUA 2J50A 2C6IA 3I0QA 4BDFA 4FT9A 4CKIA 2R0IA 4NKSA 3Q6UA 1JWHA 1U4DA 4FV4A 3SD0A 5GZ8A 1IAHA 2NNWB 1IAJA 1O6LA 3ZLWA 2XK4A 5J9ZA 2OK1A 3FY2A 1ZYSA 3AMBA 2UW0A 4NZWB 4U5JA 3QKMA 4AA0A 3UNKA 4ZMEA 4ID7A 3I81A 3POZA 2HW7A 5BUIA 3DLZA 3II5A 4KRDA 3DNEA 2PYWA 2QONA 2HAKA 3FE3A 4RWJA 4BGGA 2QOFA 5TF9A 5LVOA 3QTUA 2CN8A 4FV9A 4YGAA 3AMYA 3FI4A 2CKOA 3BLRA 4NL0A 3VUDA 4AN9A 1ZAOA 2WIPA 1H08A 4CMOA 1LR4A 5GZAA 4PWNA 4O7WA 4FSYA 5EDPA 4FG9A 4O2ZA 2XKCA 4RWKA 5DR2A 3S00A 5IQHA 2GTMA 1OKYA 2C1AA 3B2TA 4XLVA 1M14A 3W18A 4DEEA 4I5CA 4E3CA 4ZTMA 4JR3A 2BIKB 5EQEA 3D2KA 3OWLA 4U0IA 1J3HA 4AT4A 4JQEA 2GQGA 5L2IA 1F5QA 2VO3A 4W4VA 5EI8A 3K2LA 1AGWA 2QODA 3V5QA 5E8YA 3HAMA 2FSLX 3DTWA 1JPAA 2UZLA 2EXCX 4MBIA 2JDVA 4NCTC 1OBDA 2JEDA 4OR5A 4Y5QA 3VJOA 3QQHA 3R9DA 2J5EA 3PVBA 4CFFA 3UIUA 4F7NA 2JITA 5IEVA 4WBOA 2F2CB 4E8AA 4Y83A 1SMHA 1UV5A 1Q8TA 4NM5A 4S32A 4MK0A 4ZSLA 2VV9A 4TWOA 2ZOQA 4IM3A 3TJDA 2CHLA 3E63A 1ZYLA 3O7LB 4BIEA 2BIYA 4E20A 4YZBA 4Q9SA 3AQVA 2JDOA 1IEPA 3C0HA 3IGOA 3MSSA 3NS9A 3ORXA 4MAOA 4TZRA 4X6QC 1O9UA 3GCPA 3LIJA 1H00A 4WIHA 3FPMA 2B7AA 4LV8A 2RKUA 4JOAA 4H1JA 2UW4A 2C3JA 2VUWA 4S34A 3LQ8A 5HX6A 4M7IA 4YHTA 5I9YA 2JAVA 4D2TA 3UO5A 1J7IA 2YZAA 1OIQA 4V05A 4BDIA 4WG4A 2B9IA 3GU6A 2GNLA 5DOSA 4OLIA 5D7VA 5HG9A 4KA3A 4O7NA 4RLKA 4YZ9A 3S3IA 3A62A 3CPCA 3NUAA 2R3IA 3R01A 1I09A 2VTJA 3RZFA 4LRMA 3PP1A 4L67A 3VAPA 1YXVA 1PJKA 2HELA 5DBXA 3BCEA 2GS6A 5HLPA 2Q0NA 4TPTA 3RINA 4O0SA 3RVGA 3ZRMA 4FTRA 1YI4A 3KMWA 3ELJA 4FV1A 2BZJA 3OT3A 5A4EA 3I6WA 5HE0A 2RGPA 5C1QB 2CCHA 4ZP5A 4FTJA 2J4ZA 1BLXA 4W8EA 1PYXA 1KE5A 5HVKA 3L8SA 1B6CB 1SYKA 5HBEA 1PRYA 3LMGA 4CKRA 1GZNA 3ACKA 5M44A 2O64A 3P79A 4IVCA 5HD7A 4DLIA 5JSMA 4PMPA 3O0GA 4FIIA 3VS7A 2HXLA 4RX7A 1Y6AA 1PMUA 5LXMA 3A4OX 3UBDA 3KN5A 4W4XA 5E8WA 3LQ3A 4V0GB 4XNEA 1XKKA 5FBOA 2Z60A 2X4FA 2C4GA 5IQGA 5CASA 4NSTA 4IZ5A 3QRIA 4CSVA 1JSUA 4G3FA 2YM8A 5IA1A 3G9LX 3C5IA 3V51A 4HYUA 1M7QA 4XV3A 3MH0A 5AAFA 4EZ5A 4EUUA 2EWAA 2O8YA 2QU5A 3QWJA 4QO9A 3NW5A 2JAMA 3LLTA 4DFXE 2GCDA 5D12A 5KMIA 1A48A 4I6FA 5L2QA 2VGPA 4BDHA 4D1XA 1REJA 4O0VA 4PDOA 4HGSA 2YM6A 5CT0A 3HGKA 1DAWA 5EHLA 3ACJA 2VTIA 3FMMA 4ZTRA 3LXLA 4EK6A 4C2VA 5F9EA 4MXCA 4JLCA 4MXYA 2C3IB 3V8WA 2QNJA 3NCZA 2WTKC 3SHEA 3QQUA 1OUKA 4FIGA 4XV9A 4EQMA 4Z7GA 3MPMA 1J91A 1NY3A 3DTCA 4I6QA 5FQDC 4BBFA 3PY3A 3R7GA 4ZTNA 3WIKA 3A99A 4MEDA 3OXTA 4W9WA 3CC6A 1V0PA 3TTIA 1P2AA 3MGYA 2Q0BA 4PL3A 2E9OA 2QLUA 2YISA 2OI4X 1FPUA 3QTQA 4U42A 3SXRA 4BDKA 5CU4A 4DBXA 2HWPA 4I6BA 4RIYB 5IA4A 2X7OA 4U80A 5FTQA 3O51A 4ANQA 4GG5A 1XHAA 5AM6A 3T9TA 4O21A 5M57A 2XYUA 3FQEA 2ZMDA 3BKBA 3H30A 4TWPA 2QG5A 5LMAA 1Q3DA 2HIWA 1O6KA 3KVXA 5BNJA 5EW8A 2W1GA 4WRGA 1XH4A 5E91A 3ZUVA 1STCE 2R64A 4FKSA 5CXZA 3SRVB 3PG3A 3D7TB 4DFUA 4K2RA 2XA4A 2GNIA 4IX4A 3U55A 4DFZE 3QHRA 4LOPA 3RAKA 4DC2A 2PL0A 4G5JA 2VWZA 4RWIA 4EI4A 2YAKA 4LV5A 4QNYA 1R3CA 5LVLA 4D2WA 4UMUA 2BRGA 4IWQA 1WBPA 1JSVA 4USFA 4ZXTA 4ZEGA 5CT7A 3LJ1A 5B7VA 4IVAA 1Y57A 1PY5A 4QP1A 4G9CA 4M84A 4PDYA 4HYHA 2C47A 4G16A 5M53A 3OWJA 2QKRA 2F7EE 2X8EA 4RC2A 1HCLA 1ZWSA 3Q53A 5HZNA 5KNJA 3C4XA 4NWMA 4N57A 1BKXA 2XK8A 2O0UA 1UU9A 3LLAA 2IO6A 3R7YA 5ACKA 5EYMA 4CFNA 3ENHA 3NDMA 3VHEA 3HV3A 2R3RA 1WBVA 4IFCA 1PKDA 2OH4A 4QTEA 2VTQA 1QL6A 4ALUA 3CTJA 2WO6A 4P5ZA 4FTQA 4NYEA 4EZ3A 3DU8A 5C4KA 4FG8A 1UNGA 4J1RA 1FGKA 4O7ZA 4ENYA 2CLXA 1BX6A 2XRUA 3KRXA 2Y6MA 4RSSA 4QMTA 3DAEA 4HW7A 2JFLA 4FX3A 4NJDA 2BZHB 1QPDA 4MTAA 5E8UA 3TNQB 1A9UA 5JGAA 5HIDA 3CIKA 2QOKA 2XH5A 1IA8A 3R04A 3JR1A 4FZ7A 4JNWA 5C4LA 2YDKA 3MB7A 4KKEA 5GIPE 4P2KA 4BWKA 3DS6A 2EB3A 2Y8OA 3AT2A 4QMLA 2ESMA 3LXNA 5FP5A 4BGQA 3QZHA 4RX9A 4L8MA 1MRYA 2F7XE 1Q8UA 4O27B 5E4HA 3QL8A 3UOHA 5IH4A 3MTFA 4RFMA 5AP2A 4ORKA 4PPAA 3QX4A 5ANIA 5LARA 3FMDA 3DA6A 5M09A 2C6MA 4V0GA 3W55A 4A9RA 2WMXA 4O22A 5AR5A 4R1YA 4ACGA 4XMOA 3H0ZA 1OKVA 3ZC6A 2NRUA 2CJMA 4RVKA 3HDNA 1ZOHA 3ZUTA 4RQKA 2WB8A 1KWPA 3GI3A 3E8EA 1Q24A 3Q04A 5BVDA 5TO8A 3CSVA 2PVHA 4HZSA 4BCGA 2ZMCA 1PXKA 4O83A 2RL5A 4F70A 1BYGA 1WBWA 4UN0C 3D15A 3MS9A 5IQBA 4OT5A 3FXXA 3PLAE 3QLFA 4FR4A 3BU6A 1YHWA 4E6CA 4FKJA 2I0YA 3MIAA 3DKCA 3GOKA 5ETFA 4E4NA 2BDWA 5DI1A 5E8TA 4DTKA 2HXQA 2JGZA 4BZDA 1JKKA 4CEGA 4UWCA 3ZFMA 4OAVB 3ZBXA 2W4OA 5FEDA 1P5EA 3C0IA 1S9IA 1H01A 3RCDA 5JRQA 4QTAA 5HESA 5KUPA 5LMKC 4BCKA 3TDVA 4X2FA 4C4EA 4ZS4A 5DT0A 3ZO2A 2BAKA 2LGCA 3F6XA 4GJ3A 4I0TA 4N4SA 3ANQA 1RDQE 4D9UA 1OL1A 4RWLA 2QO7A 4K0YA 2C0OA 2ZV8A 3U4UA 2A2AA 4ANSA 1TQMA 3M11A 5EKOA 2HOGA 4ENXA 3VUMA 2V55A 3QD2B 2VWUA 3PRIA 3SC1A 5AP1A 5H8GA 4YTFA 3F3VA 4GT5A 5CY3A 3L8VA 1R1WA 3PA4A 2VGOA 4TN6A 4LGGA 5JGBA 3H4JA 5H8BA 1T45A 4RFYA 4F63A 1PXIA 2XKEA 4QYFA 2VWIA 2YDIA 3EH9A 3FKLA 4FVQA 4U81A 4D2PA 3ZDIA 4E5AX 4D58A 5M08A 3TJCA 4MD8E 3E3PA 4D9TA 3UMXA 4FTKA 3RAHA 3C4ZA 4G5PA 1GAGA 2PVJA 4RVMA 1WVXA 1F0QA 1YDTE 3D2IA 3EN5A 3MB6A 4FV6A 3L9LA 4R1VA 4AOTA 2WTVA 2DWBA 3GT8A 2PZPA 4JAIA 4Y95A 4A06A 4Q9ZA 3S0OA 3VUHA 3BBTB 4MXXA 3DJ7A 4QOXA 3OBGA 4EH6A 2F9GA 4LYNA 1ZYJA 3Q32A 3A8XA 2WZJA 3UQCA 3KXHA 4KD1A 3FZ1A 3RALA 3IS5A 2FYSA 1SZMA 2O63A 3VNTA 2XMYA 4O6EA 4UZHA 5H8EA 2Z7RA 2C5VA 3ORMA 4IAFA 5CX9A 5D41A 2VZ6A 5HHWA 1H0VA 4IAZA 3R9HA 4B4LA 5HD4A 1DI9A 3H3CA 5CAOA 1WBNA 2Y0AA 1ATPE 4M3QA 3H9RA 3GCUA 4L00A 4AWIA 2WXVA 1FVRA 4YJQA 5DMZA 2QG7A 2ZDUA 3FZSA 4AGDA 5M07A 4BCJA 5M56A 4RZWA 5DIAA 4DH7A 3SQQA 4BB4A 2OF2A 3ZDUA 3UJGA 2WQOA 4IZAA 4L45A 5HQ0A 2R3MA 4S31A 5DGZA 3SKCA 4MQ2A 4FTLA 4DFLA 5M55A 5C8NA 1DS5A 1KE8A 2YJRA 5DT3A 3VC4A 4O2PA 4EK4A 4GSBA 4U44A 3LJ0A 2B52A 4F08A 3NVKI 4FIFA 4MXZA 3K5VA 5HO7A 5CEKA 1ERKA 3GUBA 4EOJA 5FM2A 2IPXA 4DT8A 5ANKA 4Z9LA 3KK9A 4C02A 3RGFA 4FEUA 3LPBA 3TZ9A 3MBLA 3W2OA 2W4JA 4JAJA 5G1XA 4I20A 3ZLSA 1YDSE 4BKZA 2DYLA 4PQNA 4X0MA 5AUYA 3NAYA 2R3GA 4M14A 4R5YA 3TNWA 5JQ5A 3A4PA 2VTNA 3DV3A 2HW6A 3UTOA 2RFEA 5JFWA 4IW0A 3RZBA 2OIQA 3BYSA 2VX3A 3D0EA 4D4RA 3HL7A 3PDTA 4AW1A 2BVAA 3SLSA 2UZUE 2XYNA 2ZDTA 2O65A 5AP0A 4TYIA 4YBJA 5JN2A 4E4LA 1V0BA 3PSDA 2G15A 1VEBA 3F5GA 4NTTA 5F4NA 3BGPA 2PE2A 2W1ZA 2WAJA 3P5KA 4IANA 2X6EA 3VW6A 4ANMA 3Q60A 2ZV2A 3HRCA 4PP7A 5IKWA 3U9CA 3UOJA 1X8BA 3QFVA 5KX8A 3C0GA 4MCVA 4C3RA 1ZRZA 2ZVAA 4XYFA 2ZAZA 4S33A 3EWHA 2YWPA 2FH9A 4C34A 2GQRA 5EYDA 4BRXA 3Q2JA 4FKTA 3ULIA 3SVVA 2WU6A 1FQ1B 5M4CA 4U6RA 3K5UA 4G3DA 4KINA 4XH6A 3TIYA 3WZUA 4E6QA 3RPRA 5J1WA 4OTHA 3EN6A 3F2RA 4E4MA 3CQEA 3E8CA 3K3JA 5DPVA 4ZK5A 3RMFA 3U6IA 3D9VA 2WTIA 2Y7JA 3KULA 3NX8A 4S2ZA 4UWBA 2WIHA 3C4CA 4TNBA 2FGIA 1ZZLA 3CJGA 3ROYA 2HZ0A 2JIIA 3CLYA 5IMXA 3EJ1A 3KK8A 4N0SA 4DEBA 3SA0A 4EJNA 4FEXA 4EOSA 2R3OA 4YTIA 3F61A 3HA8A 5HTBA 3H0YA 3I4BA 4AZFA 3GXLA 1U5RA 3WZJA 2GHMA 3VS4A 3I1AA 4GKHA 4IHPA 4WO5A 3E92A 2ITPA 4JIKA 4OBQA 1OIUA 4BC6A 3QC4A 3OHTA 4QYEA 4YBKA 3WARA 4QTBA 1Q41A 3QALE 2PY3A 1YHVA 3HV4A 3MPAA 3UPXA 3GB2A 4HVIA 3NW7A 2VD5A 3G33A 1VYZA 2OZOA 4FT0A 4JS8A 4FEVA 4JG7A 3EN7A 3LFAA 4WD5A 5ANGA 3D7TA 3DK6A 4U3YA 3D5WA 4J98A 5CQUA 2GQSA 3VQHA 4QMXA 4Y72A 2BUJA 5F20A 4FV8A 3FLWA 1ZZ2A 1M2RA 3KKVA 3QA0A 3PPZA 2EB2A 4YJSA 5HBHA 5CENA 3UC3A 4F6WA 3DXQA 5GNKA 3WE8A 4CVAA 4LOOA 2VTSA 3VBWA 1R39A 4RG0A 4GRBA 3FI8A 4JBPA 3I5NA 2J0IA 4KB8A 4U43A 5CNOA 4O1OA 5M4FA 3PWYA 4WSYA 2ETKA 2G01A 5IUHA 1Q8ZA 1JBPE 4ZTLA 4ZSAA 1WCCA 4JDKA 2X9EA 3EKKA 2WTKB 4FL2A 4QQJA 3C13A 3G90X 4FTIA 5JT2A 2OXXA 2ZV7A 4F4PA 4K8AA 4I5HA 4NM0A 4FTCA 1FINA 1YRPA 1URWA 4FIHA 1P4FA 4YTCA 3D4QA 4XG4A 4USEA 3QUEA 4I92A 4O7YA 1TQIA 3DKOA 1NVQA 3FMHA 4X2JA 4FKLA 1OL6A 2H6DA 3HX4A 4LGDA 3OC1A 4TRLA 5EM5A 3VF9A 3WZDA 4ZSEA 3BZ3A 4W4WA 2V22A 1FVTA 3KCFA 3E93A 3HNGA 4QQCA 3VRZA 4BCQA 4EOIA 5HORA 1CTPE 4NFMA 5CI6A 1KOBA 2VRXA 2ITOA 3RWPA 4DEGA 4PP9A 4GU6A 1OM1A 3MY5A 3ZLYA 5IISA 5JEBA 4O7RA 2UZVA 3AC3A 3ZO3A 2YCSA 4C4IA 1QMZA 1AD5A 2RIOA 5L6OA 2BKKA 3GGFA 1NXKA 4DTAA 2FSTX 2BALA 3GU8A 3FJQE 5DR6A 4DG0E 3KB7A 3PYYA 5ETIA 4M97A 4WA9A 5EW3A 4IJ9A 4FI1A 2VNYA 3UPZA 5HE2A 4OAUC 3FV8A 5HBJA 1YOMA 1SNXA 1UNHA 2W5AA 2OLCA 4QP2A 3KXZA 3OOGA 3EL8A 3IPHA 3QUPA 2UZWE 4IB1A 2UZBA 3VS3A 3TI1A 4M0ZA 2GS7A 2W5HA 2H8HA 2YDJA 2RG5A 4X2KA 2QR8A 4YZDA 5CTPA 1PXMA 3UYSA 2JLDA 3UMWA 3V04A 4JQ7A 1M2QA 4GVAA 4UMRA 4M69B 4YZNA 2ZYBA 4RJ5A 3QGWA 2J0MB 3L8XA 4MBJA 4PF4A 4ZS0A 4FOBA 1CKJA 3Q9XA 4ZMFA 3PRFA 5AP5A 4FG7A 3RP9A 5AA8A 2YIQA 4F99A 3AC8A 2A19B 4QYGA 1Y6BA 4LI5A 3WYXA 3ZMMA 1U54A 2WMVA 5E8VA 4AN2A 2UW6A 4BBMA 4OT6A 4OUCA 3VUKA 4C61A 5EKNA 3PUPA 5KBRA 2WQEA 4H05A 4G3CA 5EDRA 1EH4A 3QU0A 2BHEA 1PW2A 2YITA 2NRYA 1G8AA 3V5JA 2WTWA 5A54A 4NUSA 3NAXA 3ERKA 3WOWA 1OBGA 5KHWA 2GNJA 4FSWA 2YERA 3PVWA 3FZTA 4NK9A 4GW8A 5C03A 5HNIX 4OTRA 4YO4A 4Q5HA 2J6MA 5JH6A 4FODA 1WVWA 5KMJA 3MVLA 4X3FA 1JOWB 2XB7A 3OROA 5C27A 3C4WA 4AZVA 4D2SA 4Z55A 4FZ6A 3MTLA 4ZJVA 3HV6A 3UP2A 3LCKA 3R9NA 3PWDA 2YCFA 4CQEA 5ANOA 4BCOA 3SRVA 3FKOA 4KSPA 1QCFA 4O7LA 4UWYA 3W2RA 4DYMA 2F57A 3V5PA 4JL9A 5AX9A 3EYHA 3KN6A 5EI6A 5AJQA 4BCHA 3P86A 1CKIA 3TIZA 3NUXA 4W9XA 5K0XA 2QOQA 5M4UA 5A6NA 3QA8A 4BCMA 2PUIA 3IGGA 2OBJA 4RFZA 3PJ1A 4CTBA 3WF6A 1M2PA 4FSTA 4GS6A 4TT7A 1L3RE 3R1QA 1BL7A 4DEDA 3KREA 3E62A 3QAME 2WOUA 2CKEA 2YM7A 4LQMA 3ITZA 5AP6A 3QRJA 1H24A 4KRCA 3UGCA 3V3VA 4IWOA 3A7JA 5HGIA 3TZMA 4U79A 3GC9A 3ZBFA 4C58A 2PVYA 3L9NA 4EJ7A 3QTSA 3UVQA 3RWQA 3EB0A 3AC2A 3C4EA 4HGEA 2YHVA 5HEZA 4FV3A 1YWNA 2CNUA 2WD1A 3R9RA 3B8RA 3IDPA 4JVGA 4O0TA 4U40A 3C1XA 2PVRA 4C38A 2YCRA 5DEYA 4EKLA 4F1TA 1LUFA 3F82A 4KUJA 4FVPA 4TTHB 4AE9A 3UQFA 4B0GA 4BIBA 2X0GA 2W0JA 4K77A 4BI0A 3EZVA 4C59A 5D9HA 5IH5A 3SXFA 4CLJA 3LM5A 3TM0A 3Q5IA 4F1MA 2ITUA 1ZLTA 5IQDA 4BN1A 3L9MA 2VWYA 3V01A 4ZY4A 3RTPA 4NTSA 4OTFA 3IO7A 4L44A 5AP4A 3TKUA 4IAKA 3BI6A 1WBOA 2C6LA 3KQ7A 4BDCA 3U9NA 2AUHA 3NYNA 4G31A 4OTIA 4XOYA 4KIOA 2IW8A 4PV0A 3DBCA 3EFJA 2VWVA 3ZO1A 4LUDA 2XRWA 3GNIB 4ZTSA 5J87A 4E93A 2XZSA 4OW8A 4ANOA 4U8ZA 3ZM9A 5KE0A 4I0RA 3UYTA 2EXMA 3N51A 5DVRA 1RJBA 4IXPA 4C37A 1MRVA 3OMVA 2WKMA 2R3LA 3ODYX 3BYVA 4JBOA 4MX9A 3GC7A 3MA6A 2PVFA 2PMOX 1FOTA 2BAQA 5H3QA 3UODA 1OL7A 1U59A 2X1NA 3NEWA 4ZLYA 2IG7A 4CD0A 4YLLA 3FC1X 5A4LA 3FLNC 3OTUA 4X7QA 5K4IA 3D83A 4IFGA 3KC3A 4IVDA 3RPYA 1OMWA 2UW7A 4NIFB 3OCBA 3EHAA 5I9VA 3TUCA 3QQJA 4L3JA 5HE3A 3ZTXA 1VJYA 3EQIA 3PIYA 2C5XA 3D94A 3DBEA 4XV1A 2B9FA 2JKQA 4R7HA 3FKNA 3OEFX 5DE2A 2XBJA 1HOWA 1H0WA 4QYYA 5IQIA 2JBOA 4DG2E 2UV2A 4BHZA 5KBQA 3OY1A 2A4LA 2CGWA 3D5VA 4ZAUA 3OT8A 3GU7A 4M67A 2J5FA 5DG5A 1U54B 3UG2A 3LCTA 2X39A 5FTOA 2ERZE 5I9XA 4UYAA 4WOVA 5CEMA 3SGCA 3E7OA 5AP7A 4FTTA 5CQWA 3FY0A 1G3NA 4MWIA 3ZYAA 5BUJA 2Z02A 4JG6A 4K33A 4IIRA 4CZTA 2PZYA 5IUGA 4I0SA 3E88A 4DGOA 4FC0A 2IVTA 2PZ5A 4E5WA 5IEYA 2CLQA 2LAVA 4Q5EA 3EQRA 3LM0A 3PG1A 3FQHA 5C01A 5AUZA 2W06A 3MIYA 3CKWA 3HA6A 4HCTA 3VQUA 5CSWA 2XF0A 5DRDA 2ZM1A 4UEUA 5CU2A 2PULA 5ANDA 1KE7A 4CXAA 4O7SA 3D5XA 4D5HA 3P0MA 3W10A 3MN3A 5DT4A 4YZMA 2ACXA 3SX9A 3Q96A 2PE0A 5CF6A 3NVMB 1AQ1A 2JDRA 1HCKA 3HRBA 3H9FA 3R8LA 3SDJA 4HYIA 5BMMA 3KFAA 3VO3A 3F69A 3LFEA 4AT5A 4UYNA 4TL0A 3ORTA 4O7TA 2GNFA 4EONA 3TDWA 3BHVA 4IADA 2G2FA 4XLIA 1J1BA 4TYEA 2PUUA 3E7VA 3RKBA 1K3AA 4M15A 1YI6A 4I41A 2OIDA 4FT7A 3OF0A 5FEEA 3SG8A 3GQLA 3GEQA 3PXKA 4I21A 3CY3A 4MD7E 2FB8A 3WYYA 2QOBA 4J52A 5KZ0A 3CJFA 4QP6A 2BTSA 4WNMA 4Z16A 4RMZA 3QBNA 4WG5A 4JX3A 5HG5A 2WTCA 5LMBA 1WMKA 2Z2WA 3F3UA 3PLSA 3G51A 2QCSA 4FIJA 4WRSA 3BHHA 2Y4IB 1GJOA 4H36A 3KF7A 4P4CA 4PL5A 1DAYA 2REIA 1ZYCA 5GHVA 4HVHA 5AADA 3KF4A 5EM8A 4I23A 4YP8A 4YU2A 3MI9A 5D7AA 3ZM4A 4KIKA 5IDPA 3DBQA 1YXUA 3VHKA 2W1EA 1WFCA 3ORNA 5DR9A 5IPJA 4MXAA 2GNGA 4JBQA 2XM8A 2CNQA 3CS9A 4FV5A 4A4XA 4GFMA 3DT1A 4NM3A 5CLPA 3RPSA 4AQCA 3AXWA 4AS0A 3NUNA 2X2LA 2BFXA 3ZUUA 3VS2A 4F9YA 4UV0A 4D0XA 4DBNA 2BAJA 2X7FA 5CNNA 3SV0A 4B7TA 1OITA 2F4JA 1KE6A 2ITTA 2C0TA 2UVXA 5DEWA 4CV9A 4PNIA 5IA2A 4D2RA 5AUTA 5FXQA 4EBVA 4XBUA 3ZRKA 4EEVA 2AC3A 4RX8A 1FVVA 3AGMA 5EOBA 4M0YA 3W8LA 3R8VA 4YR8A 4WBBB 3DDQA 4DH1A 4IH8A 1LP4A 3HZTA 4W8DA 4EC9A 2XIKA 2QKWB 5IA3A 4KSQA 4CFXA 3F9NA 3HV5A 3FHIA 3QXOA 3I6UA 4OTDA 4E6AA 5M06A 3ENMA 3KY2A 3L9PA 4CG8A 3A7FA 1YXXA 4I4EA 4RX5A 3KVWA 1APME 3MH3A 2BDJA 4XG6A 4D2VA 3G0EA 2XIRA 4IAAA 1UWJA 3UG1A 2OIBA 4GFOA 4ANBA 4U7ZA 1VZOA 3Q9ZA 4AX8A 4BBEA 1UNLA 4H3BA 3SOAA 4AZEA 4C2WA 2I7QA 5EQYA 3BEAA 4L3LA 3R1YA 3MW1A 3E5AA 5LCKA 1XH7A 4EBWA 3C50A 2IVVA 4YJUA 2V5QA 3DXNA 4RLLA 2JDSA 3VN9A 3VUGA 5EM7A 4V01A 4QP9A 4K9YA 5F95A 4H1MA 3E64A 1TVOA 2QO2A 3TTJA 3IW4A 4FUYA 2IZRA 3NNVA 3I5ZA 3UNZA 2WMSA 3ANRA 5ACBC 4EOLA 2W9FB 5J79A 3QTIA 4A9YA 1URCA 4AZWA 3AD5A 3Q5ZA 3K54A 3PZHA 4G6OA 1O6YA 4IX5A 4QP3A 1OZ1A 4L7SA 4RA5A 3UVRA 4EZ7A 5JKGA 4BI1A 3PE2A 4GL9A 4C33A 2GHLA 3HKOA 4BCNA 5L4QA 3FYJX 5TKDA 1YOLA 1WVYA 3OCGA 2B1PA 3EQGA 2PVNA 2RFNA 2AC5A 3BGZA 3Q9WA 5CEOA 4I22A 3C5UA 3UZPA 4E7WA 1NW1A 3LAUA 4EH8A 4EH5A 2XIXA 2PMLX 2WEIA 2CGVA 4RA4A 2IVUA 4A07A 3WF9A 4L43A 5EK7A 4FMQA 4QPAA 4FL3A 3BYMA 4GH2A 5ETAA 3R00A 4O0YA 4F0GA 3EOCA 4ITHA 3CD8A 4MH7A 4PMMA 5JZJA 4NCTA 2Z8CA 2R0UA 4RJ7A 1W0XC 3U51A 4CQGA 1H28A 2CNVA 4MBLA 4D1ZA 4KABA 3GFEA 4WT6A 1V0OA 2W4KA 2XS0A 4R77A 3FUPA 4FGBA 4BDJA 2QOIA 2IZSA 4PTEA 1U5QA 2QHMA 4BYJA 2YA9A 5EYCA 2UZEA 2PSQA 3ZC5A 3ZZEA 4AF3A 3N9XA 3G2FA 4IAIA 3T3UA 4IB0A 4IWDA 5LWMA 3BHYA 2PPQA 2E2BA 2QLQA 4ZSJA 4CNHA 5A3XA 2C6DA 2B54A 3HP5A 3PSBA 4DH8A 3PIZA 1CSNA 1WBTA 2C5YA 2EVAA 3EYGA 3KULB 4FV0A 4ANLA 4C8BA 5A4CA 2O2UA 3EFLA 2UW8A 3NSZA 3A60A 4AW5A 1QPCA 2XUUA 3E8DA 5FBNC 3TNIA 1UU8A 3KXMA 4K11A 4IM0A 2B53A 3DJ5A 3OY3A 5E8ZA 4PTGA 2JIUA 2WMAA 4C4FA 1Q8YA 3Q3BA 4AXAA 2O5KA 2W05A 4J53A 3AG9A 3MFSA 4QQ5A 4C35A 2GTNA 4EH2A 3PTGA 1J7UA 5HIBA 1XWSA 5CYIA 5EQPA 3COKA 3LFBA 4O0RA 4TYHB 2P3GX 4F0FA 4ACMA 3JVSA 2X6DA 4NFNA 4O38A 5F94A 5J5TA 2XKDA 5EM6A 2YM3A 5IG1A 3AD6A 2Z7SA 4D5KA 3CD3A 3QXPA 1XJDA 3NLBA 2BPMA 3PVGA 4FSQA 4L6QA 5AWMA 1YWVA 2BZIB 3QLGA 4MXOA 3MFTA 5ANJA 3JPVA 3R0TA 3BU3A 3NUPA 4O6LA 3RNYA 4PPCA 3S2PA 3ZSGA 3MESA 1H1RA 3LFNA 1KOAA 4XG2A 2YABA 3FPQA 3FMLA 5J9YA 3I0OA 3TKHA 2PUNA 4M12A 4J99A 2H9VA 3CTHA 4NKAA 1MRUA 4NU1A 4AOIA 4BCIA 2PVLA 4PUZA 5BVWA 3BYUA 5KMNA 1GZOA 5T68A 2WMTA 4AW0A 4KBAA 2XM9A 2B0QA 3FBVA 5B2LA 2RFDA 3FSKA 1YI3A 4IE9A 5E8SA 5B0XA 3R8MA 4FBXA 4HNFA 5J95A 4DEIA 3Q4TA 1H25A 1P4OA 2BMCA 3FYKX 1JAMA 2P33A 2Y4IC 4UY9A 4IC7A 3PZEA 2G1TA 3MFRA 4LMUA 3QCYA 3KRJA 2P4IA 5LJJA 4QTCA 2I0EA 3MY1A 3ORPA 1XH9A 3VW8A 3LMHA 1H07A 3PIXA 4EHVA 4EOPA 4ALVA 5L8JA 5BUEA 5FLFA 3JUHA 5TR6A 1XBBA 4C4HA 4D28A 5GJGA 3D7ZA 3RJCA 2J9MA 4RJ4A 5HKMA 4JRNA 4F64A 4IDVA 3ZZWA 3LCDA 3LVPA 1K2PA 5ETCA 2DQ7X 2X8IA 4XS2A 4MNEB 5M51A 2YAAA 3OXZA 3ORIA 4FKRA 5CVHA 4EH4A 5A9UA 4CT1A 2OG8A 3TUDA 4OTGA 4UMQA 5IQCA 3UZRA 5J7HA 4YZCA 3W8QA 5IA0A 1XH5A 2JC6A 2W17A 3K3IA 4A7CA 5M4IA 4QP8A 1OUYA 5BX0A 2ZB0A 3IKAA 3DAKA 3SG9A 1PXPA 3FL4A 2WPAA 1MQ4A 4N6YA 3SW7A 3A2CA 4E73A 3U54A 1KV2A 2OSCA 3HV7A 3BGQA 4GEOA 4MQ1A 5FRIA 4ASEA 4X3JA 1CKPA 1OB3A 4WG3A 4RZVA 4W4YA 5AR7A 4Z7HA 5ICPA 4XG8A 4BR3A 3C4FA 2VN9A 4BVUA 1ZY5A 4H3PA 3TWJA 4YJNA 3N4TA 4O96A 1K9AA 1GZ8A 3HDMA 4FIEA 4YJPA 4P7EA 4P5QA 5CF8A 3ORKA 1F3MC 3BRBA 3DPKA 3W33A 3FC2A 1H1PA 3C7QA 4CRLA 4ZZOA 1UU3A 1SVGA 5L6WL 5EHOA 2UZDA 5C26A 3P7BA 2FO0A 2DS1A 3OUKA 4D1SA 2C6OA 1PXNA 3RPVA 2OJJA 2PMIA 2VTHA 3OTVA 3PJ2A 3R71A 1H26A 3DK3A 3V6RA 3VBTA 4EH7A 5I0BA 5JMSA 3NNXA 4F6UA 2PMNX 3GU5A 5AV1A 4RVTA 4X6RA 5E7RA 1OPKA 3FZOA 3W16A 5CSVA 4FSZA 3O8TA 4U41A 2CGXA 4J97A 5I3RA 2P2IA 3UE4A 1P14A 4NH1A 4LFIA 1XH6A 3ALNA 3GFWA 4PPBA 3LXKA 2GHGA 4XG3A 3VRYA 4BZOA 5A6OA 4JIAA 3P23A 3UZTA 2W5BA 3U87A 3PA3A 4YC3A 4ACHA 3G6HA 2XNEA 3U8WA 2IJMA 2Y9QA 4BGHA 4G34A 2V7AA 4E6DA 3MVHA 2OZAA 4MNFA 3N4VA 4AP7A 4RIXB 4C62A 4E5BA 2CKQA 2X7GA 4CGAA 3TZ8A 4R3PA 3Q4UA 4H3QA 5FDXA 4QYHA 5FXSA 1GIHA 4YPSA 4FSRA 3VULA 4R7BA 3GQIA 3WF5A 4FSUA 3Q52A 2OH0E 3BQCA 5DLSA 3DDPA 4EOQA 1IA9A 4EOOA 1Q62A 5JFSA 4I5PA 4QMNA 4CKJA 1ZXEA 4PX6A 3NIZA 3QYZA 4TXCA 4CFWA 3AC5A 3KXNA 4FNYA 4KWPA 4BICA 4BWPA 3FI2A 3MVMA 3R2BA 4IDTA 3O8UA 4KKHA 3AT4A 3P78A 3BELA 5AR2A 2OICA 3CP9A 2G2IA 2PTKA 3M42A 2FSOX 2GDOA 4FTUA 4OBOA 3HUCA 4QMUA 5AA9A 4ZSGA 4AE6A 5A4TA 2YM4A 2HYYA 4J96A 5K0KA 5D1JA 2ONLA 3ORZA 5BVKA 3RPOA 4A4OA 2XVDA 2VX0A 3DAJA 2WU7A 2JKMA 4G1WA 4D55A 3QTRA 3THBA 4F7LA 4BHNA 3D5UA 2QOHA 4WKQA 4A9SA 1ZOEA 4LRJA 4CTCA 4DFYA 1UU7A 5KMMA 4ALWA 4DHFA 4FKIA 1WZYA 3F66A 3QQFA 3R1SA 4F7JA 4HVSA 3PVUA 4XV2A 4NIFA 4AGUA 2NPQA 4AZSA 3NIEA 1QPJA 1Q8WA 4FF8A 4WNKA 5CALA 5HLNA 5IDNA 2QR7A 4FKPA 3ZFYA 3DKFA 4QD6A 3IECA 4XJ0A 3TZ7A 4FKGA 4JDIA 4IJPA 2WFYA 3EQFA 4A9TA 4MVFA 4YJOA 3UOLA 5IQAA 4FV2A 1W8CA 5FD2A 3RHKA 4TKSA 4BZNA 4C0TA 5FTGA 5GIOE 3UIMA 4KBCA 3F7ZA 4QP4A 3ZOSA 4JBVA 4KAOA 1FBNA 1Y91A 2X81A 4BF2A 2WMUA 3BEGA 2VO6A 3TV7A 3GVUA 3P08A 4HVGA 2OZAB 3OWKA 3DCVA 4LRKA 4BI2A 4EYMA 1OL5A 1Q4LA 2YJSA 2YN8A 5AIKA 3GOPA 2WMWA 3TKIA 2OJGA 2R9SA 5CVFA 4DITA 2SRCA 3G5DA 3JY9A 3GC0A 4EK3A 5LVPA 3EMGA 4QMOA 4DCAA 4IEBA 1ZOGA 3E8NA 3VVHA 3ZFXA 2JIVA 3FSFA 4IM2A 5AFVA 4RJ8A 1ZMVA 3P7AA 3ATTA 4RIXA 1OVEA 1ZMUA 4FL1A 5BPYA 1YXTA 5CF4A 2J7TA 4QNAA 5EI2A 4DEHA 4O81A 5HG7A 4BKJA 2ONLC 4FKQA 4KBKA 4U3ZA 2OF4A 5BVEA 5K9IA 2I0HA 3SAYA 4EHZA 2R2PA 4GFGA 2Y4PA 1XQZA 1G5SA 3IW5A 2CN5A 3F3WA 2XK3A 4L53A 4ZJJA 5AV3A 1UA2A 2J2IB 2XK9A 1OL2A 2KULA 5HCYA 3GC8A 4QMZA 3ODZX 4I93A 3O7LD 4XCUA 4F7SA 1JKTA 4IQ6A 3FLSA 3ZXZA 4E26A 3B2WA 4AA4A 5IQFA 1TQPA 3MPTA 1QPEA 3PY0A 2HWOA 2WGJA 4DAWA 5HCXA 2GS2A 2ZJWA 5B2MA 4XP0A 2VTLA 4GT3A 4TYHA 4QMYA 2ETRA 3NUYA 3QRKA 5AMNA 5FUTA 4RIYA 2C3LA 2VTAA 3EFKA 4YTHA 5B2KA 4EK8A 5HLWA 1OKWA 4LGHA 4FK3A 4NJ3A 3TEIA 3IW7A 2C6TA 4ZTQA 1H1QA 4H39A 2R3PA 1ZYDA 4GYGA 3NUUA 2XNOA 3FWQA 1CMKE 2J0KA 4WUNA 5T6KA 3TG1A 4AW2A 3IOPA 1H8FA 5F1ZA 4WUAA 4LL5A 3ROCA 3DB8A 5K5NA 4ACCA 4S30A 1PF8A 5AEPA 4IMYA 4QMQA 2QURA 1SVHA 4F1OA 2AYPA 3JXWA 3KGAA 3DZOA 3T3VA 5DN3A 3U6JA 2QC6A 5A14A 4PY1A 3G9NA 3FI3A 5JFVA 3EQDA 3T9IA 4CG9A 5IH6A 5KCVA 1OPJA 2QOCA 1NVRA 3R7UA 4C7TA 3P1AA 3FLZA 3OP5A 3TXOA 4LL0A 3R8PA 4PNKA 2B9HA 4GKIA 1YQJA 4D4SA 1WBSA 4DA5A 3BWFA 1XO2B 3RK7A 4GK4A 3R02A 4FNWA 5FM3A 3KU2A 2OJ9A 3C9WA 1OIYA 3QRUA 4F65A 2F7ZE 2PWLA 4D4VA 5CEIA 3DNDA 3M2WA 3PSCA 5FXRA 2YIXA 5LMKA 5CS6A 4GUBA 5TT7A 2XIZA 3POOA 1VR2A 4L9IA 4TNDA 4UXQA 5BMSA 3LCSA 2PZIA 1ZMWA 3HP2A 2C6EA 2VO7A 4K1BA 5DFPA 4AFJA 3UOKA 1RE8A 4U9AA 2Q83A 3NNWA 1XR1A 2UZOA 3PP0A 4FOCA 5E1EA 2R7IA 2R3FA 5AM7A 3L1SA 3EFWA 2QOLA 5G6VA 1B39A 4M13A 4YMJA 3EN4A 4XUFA 2I40A 4O84A 2O3PA 4GJ2A 1ZARA 4ITIA 2XCKA 5CZHA 3WF8A 4EH3A 2UVZA 1I44A 3A7IA 3UVPA 5E8XA 3OZ6A 3O2MA 3CGOA 2BILB 3TACA 4XEYA 1YXSA 3MJ2A 3ZS5A 3A7HA 3MVJA 3CCNA 3FL5A 5CSXA 2I0VA 5HE1A 5CAUA 2VWBA 4ZZMA 2VX1A 3VS1A 2A27A 4FICA 3QUDA 3ZU7A 3ID6C 3BQRA 4ZOGA 3SOCA 5LVNA 3W2CA 3LOKA 4H58A 4ERKA 3S95A 3SW4A 2QO9A 3OEZA 3LXPA 4GMYA 1H1WA 1PMNA 2OFUA 1IG1A 3V6SA 4BDAA 4UB7A 3R2YA 3L8PA 2OU7A 2VTRA 2C1BA 4L46A 5HICA 3BV3A 4G3GA 3UP7A 4C4GA 4O86A 4QPSA 5EG3A 2WELA 5HO8A 1XBCA 3PY1A 1JKSA 4KIQA 4RIWB 2FUMA 2OJFE 5EYKA 3P9JA 4DF3A 1BUHA 1NT2A 4NEUA 1CM8A 1Z5MA 3VUIA 2BCJA 4DFNA 5CANA 2JDTA 2H34A 2HY0A 2XNGA 4GVJA 5CEQA 2ITQA 3BYOA 3S1HA 4CFMA 2VAGA 3HRFA 3KRLA 1RQQA 3OW4A 2C68A 3V5WA 3OXIA 4FNZA 5H9BA 5FG8A 4BDDA 4E4XA 4YC6A 1TKIA 2ETMA 1IR3A 3I7BA 3WF7A 1SVEA 3OUNB 3IG7A 4AACA 2ITVA 1RW8A 3OW3A 4GIHA 2BR1A 2F2UA 2V0DA 5LOHA 2PUPA 4CCUA 1W83A 3GP0A 3KEXA 3DQWA 4U97A 4BTKA 4XG7A 3W1FA 1J7LA 3W2SA 1BMKA 2J51A 2WEVA 2A1AB 3ZONA 4DG3E 4HCVA 5ITAA 3CTQA 2NP8A 3CGFA 4FKUA 3LHJA 5AAEA 2WQMA 3QD3A 1PMEA 5D11A 5H2UA 3ZEPA 2W9ZB 4R6VA 5IU2A 3GBZA 3R7VA 3V5LA 4C36A 3P7CA 4RJ3A 4C3PA 4CMUA 4CZYB 2HENA 3R1NA 4GT4A 5KHXA 3RAWA 5BVOA 3FDNA 4EOMA 3FMJA 4LMNA 3F7WA 3HMIA 5AUVA 3RM6A 1GIJA 4XP3A 4TYJA 5K4JA 3R21A 4FSNA 3LCOA 3DK7A 3UNJA 3LQ5A
chains in the Genus database with same CATH superfamily
1R0PA 4MKCA 4L01A 3F2NA 5BQ0A 2XNPA 5JRSA 2BFYA 1R78A 1NA7A 5AR8A 4BCFA 2B4SB 1YHSA 3COHA 4JDJA 4OTPA 4RC4A 2E9NA 3QD4A 4NT4A 4DCEA 3I60A 4C4JA 4EQCA 5HU9A 3FHRA 1OPLA 3KRRA 3BLQA 5HTIA 4B9DA 3BIZA 5C9CA 5IA5A 1YW2A 5HNGA 3FMEA 3FMNA 4IWPA 3Q6WA 2R3HA 4USDA 2QVSE 2JKKA 4BTMA 2C3KA 4R8QA 3RAIA 2CSNA 5DWRA 4F9CA 4BJJB 2OW3A 3VBYA 4MF0A 3AMAA 3WZEA 4QPMA 1JNKA 3M1SA 3QTZA 4IZ7A 4R3CA 2JFMA 4Y73A 3R7IA 2CMWA 4QQTA 5I9UA 2JD5A 2C5OA 4I5MA 5CVGA 5AV0A 4PRJA 2UW5A 2WHBA 4IB3A 4QMPA 5KZIA 4QMWA 5BYZA 3WILA 5J7BA 3VJNA 2VTOA 4OGRA 2OKRA 3PE1A 3O5AA 1Y8YA 4HGLA 2VWXA 4O0UA 4Y5HA 3NMUF 4BKYA 3JS2A 5L2WA 4BL1A 2YIRA 2OJIA 4JI9A 4UZDA 3F5PA 2BDFA 4AFEA 1LEWA 3R63A 1Y8GA 4YJRA 1GIIA 5EH0A 2HZIA 4EH9A 4HNIA 2YZLA 1JLUE 2GFSA 4FJVA 4XG9A 3MYGA 3ZLXA 2UVYA 4ACDA 2CGUA 5K3YA 3NGAA 3WBLA 5DA3A 4FV7A 2WTDA 4IAYA 4LM5A 4Y46A 4P90A 3HMNA 3C51A 3O71A 1REKA 4YPDA 3BHTA 2RF9A 3QCXA 3MA3A 4X3FB 5KMLA 5CZIA 1L8TA 5AUXA 4AAYA 1H1SA 4ASXA 1W7HA 4FTAA 2PU8A 1KSWA 3QGYA 3CPBA 4HCUA 3W2PA 3U6HA 4F0IA 2ZM3A 3A8WA 3CBLA 3GENA 5AR3A 3PFQA 2X4ZA 4CV8A 2R3KA 2IN6A 2QHNA 3Q2MA 3R28A 4G6NA 3QD0A 4BWXA 3JYAA 4K18A 2PVMA 4GIIA 4EWQA 5J5SA 4NW6A 1IASA 4O4BB 5DNRA 5C8MA 3RHXA 4BDBA 4DGGA 4NM7A 4O7VA 1OGUA 3KXGA 3W0OA 1LEZA 5L2TA 4BY9E 3JY0A 5E1SA 1E1VA 2W1CA 3GCQA 1R0EA 3P4KA 3P5JC 1S9JA 2A98A 1A06A 2C30A 4GG7A 4JG8A 3VBXA 4CLIA 3RM7A 4DH5A 3F88A 1BI7A 1FMKA 2DUVA 4L42A 2J0JA 4B6LA 5A46A 3KRWA 2HY81 4L7FA 4XBRA 4DINA 3CE3A 2B55A 3R7OA 2ITZA 4IZYA 1PKGA 1JQHA 2HK5A 2W1FA 3PPKA 1SM2A 4GK2A 4Y85A 3VUTA 4DEAA 4AGWA 1UWHA 3HLLA 1ZY4A 1YWRA 3HEGA 1PHKA 4AG8A 3IW6A 4EOKA 3QWKA 4GU9A 5J9LA 4QMVA 4BDGA 4FTOA 4MD9E 4YLKA 3H9OA 4XX9A 4RC3A 2XARA 3OG7A 3FLQA 2G2HA 3DFAA 4TWNA 1W82A 4EORA 4CRSA 3VBQA 3OS3A 1G8KA 2OFVA 4QMSA 4YURA 2WQNA 2XBAA 2YIWA 4ZIMA 4JXFA 1M52A 4X2GA 5CF5A 3I7CA 2WMRA 5HOAA 4APPA 2JKOA 3WI6A 4FK6A 4UMPA 5BYYA 5IEXA 3QZGA 5HVJA 3FXZA 3W2QA 2B9JA 2I1MA 3OOMA 4N6ZA 2G9XA 3FQSA 4BCPA 3DBDA 1KV1A 3PJCA 1GNGA 2A0CX 1FGIA 2OWBA 4HPTE 4F9AA 1FMOE 4KNBA 3W0PA 3ZHPC 4B8LA 3ET7A 5GINE 5D10A 3G0FA 1J1CA 3ZXTA 4DH3A 2BTRA 5JZNA 1GOLA 4IB5A 4YUQA 2YWVA 4L52A 3HECA 3IQ7A 3ZO4A 3S4QA 4DGMA 3LJ2A 3UQGA 4EUTA 5CU0A 4M66A 2VO0A 3EQPA 3HMMA 4IX3A 4MWHA 4Z3VA 3TNHA 3MV5A 3Q9YA 4LOQA 3NPCA 3ALOA 4JDHA 3QTXA 3NNUA 4M8TA 4WSQA 3ATSA 2YCQA 3O50A 1PXJA 3BBWA 3VF8A 5FGKA 1BL6A 4J8MA 4R7IA 5EFQA 4I24A 3I79A 4FTNA 4MHAA 4OBPA 2ITXA 4AU8A 3TT0A 4AZTA 4LG4A 2PE1A 2ERKA 5IUIA 3REPA 4FEWA 3AC1A 2IVSA 2X0PA 5DH3A 3BV2A 3NUSA 4J8NA 4Y8DA 4ITJA 1Q5KA 4RBLA 3MJ1A 3QYWA 5JQ8A 2UZNA 4JR7A 5K5XA 4FZAB 5J8IA 4G6LA 2VTMA 2NO3A 3HUBA 3LW0A 3BX5A 4YNOA 4YNEA 5HO6A 5DYJA 2XJ0A 2XP2A 4FVRA 1Z57A 3AC4A 4YHJA 2YM5A 1W84A 4PMSA 5EW9A 4JJRA 4UMTA 5HIEA 3IW8A 1KUTA 3VWAA 2PHKA 3BPRA 1YKRA 3EQBA 3NCGA 1U46A 3E87A 5HVYA 5J1VA 4XRLA 2XNNA 3OCSA 2R3JA 3JVRA 5CAQA 3HAVA 4UXLA 4DN5A 1PYEA 3PXRA 3TL8A 4TY1A 3F3TA 4L68A 4RPVA 3DFCB 2H96A 3TUBA 4R78A 3ZEWA 2X9FA 3MWUA 2X2KA 3HMPA 4ZY5A 1V1KA 2WMBA 2WMQA 3TN8A 2HZ4A 5HCZA 4GUEA 3R73A 2W96B 4UBAA 3EIDA 4J95A 4IBMA 5JFXA 2P0CA 3COIA 4CMTA 5AUUA 2J90A 3IK3A 4I4FA 5L6PA 3LMIA 5AV4A 4M69A 4QTDA 4JT3A 4GK3A 3EKNA 1YVJA 3TNPC 3FZRA 4ERWA 4PL4A 4C3FA 2YACA 4HYSA 2QOOA 4I1ZA 2ZFYA 2VTPA 3RI1A 2XNMA 5JGDA 2YIYA 3DLSA 5AUWA 2VWWA 4YC8A 3UO4A 1UKIA 4OTQA 3ZSHA 3DQXA 2XNBA 3FZPA 1ND4A 4QP7A 3V8SA 3V5TA 4YO6A 4RJ6A 4FGRA 1Q97A 3QQLA 5EOLA 2BRHA 3PA5A 3NFGB 3G6GA 3F5XA 4MYGA 2OO8X 4FKWA 5TOZA 4O91A 4ZLZA 4F9WA 3GU4A 3EQCA 3VS6A 2WTJA 2E9PA 3KMMA 4GV1A 4G2FA 2CKPA 1E1XA 2VNWA 4EK5A 2XK7A 3LFQA 2GU8A 4MNEA 3DOGA 5CXHA 3WE4A 5IF1A 2UUEA 5KKRB 3TV4A 3QQGA 3R8ZA 2XK6A 4V04A 5I3OA 4JMQA 4DFBA 3UC4A 4GYIA 4L3PA 3UDBA 2C69A 3H10A 3R8UA 1OECA 3IOKA 5HG8A 3ZRLA 4KIPA 3WIGA 4IC8A 2R7BA 2YFXA 4AUAA 3TV6A 3EL7A 5CAVA 3ETAA 3D14A 1OKZA 2OXDA 4WNOA 3BWJA 4ANNA 1T46A 2FVDA 3KIOC 3G15A 4IX6A 4YSJA 2RFSA 5BVNA 3R7EA 5HTCA 3PJ8A 3R22A 2YEXA 4OTWA 2GPHA 4G17A 5L8KA 3PJ3A 2C6KA 2Z7QA 4AA5A 4BYIA 4RVLA 4CZUA 4IACA 4D4YA 5HX8A 5IZFA 2J0LA 4EWHA 5A4QA 3UIBA 4U45A 3A61A 3LZBA 3LFDA 2XJ2A 4AOJA 1PMVA 2BRBA 3UIXA 2V62A 3VIDA 3NZ0A 3AD4A 1DM2A 2RG6A 5CSHA 3NR9A 4KKGA 2XJ1A 4BIDA 5AAGA 1JSTA 3QCQA 3RCJA 1MUOA 2ZV9A 4C57A 3QZIA 3CQWA 2KTYA 3E3BX 4FSMA 3R9OA 4ZJIA 4KS7A 4QEBA 2GNHA 3CEKA 2C5NA 3PPJA 5AIRA 3VBVA 1OIRA 4AT3A 5HU3A 1G8SA 1BI8A 2YLFA 3BL7A 5KMKA 4KS8A 1MP8A 4BDEA 3QC9A 4HJOA 3MY0A 4EYJA 1UVRA 3QCSA 3OFMA 4ZY6A 3KXXA 4AAAA 3OVVA 4EC8A 3DZQA 2CCIA 2WQBA 4WHZA 4K6ZA 4FE2A 5TE0A 1DI8A 4CCBA 4EQUA 2QI8A 3LE6A 4FKOA 5FP6A 5T3QA 4EKKA 4QRCA 5CEPA 5IQEA 3ZSIA 3F2AA 5DRBA 2F49A 2ZM4A 2XEYA 3RK5A 4EHEA 4FT5A 4LUEA 3KA0A 4ONAA 5E90A 5KMOA 4I94A 1JVPP 3DB6A 2HZNA 3B8QA 1PXOA 1M7NA 3QHWA 5ANEA 3N4UA 4ZTHA 3NW6A 4AGCA 4EL9A 4DT9A 5DHJA 2W1HA 4F6SA 2BRMA 5FWKK 3PXQA 4FYNA 2P55A 4NW5A 4X21A 3R6XA 3CKXA 3ZH8A 4G3EA 3BU5A 1IRKA 2XEZA 3ZCLA 2EUFB 3ORLA 1MQBA 3FAAA 1PXLA 3Q4ZA 1UKHA 3QZFA 4YJVA 3UO6A 3QTWA 4FA2A 2W1DA 2R3NA 3VS5A 3COMA 1W98A 2XCHA 4QDVA 3BLHA 4O82A 4O1PA 2GSFA 3KL8A 3O23A 3MDYA 5EDQA 4O0XA 4R3RA 4QT1A 1LPUA 2BHHA 2Y6OA 5LVMA 3NWWA 3IONA 5CI7A 4YHFA 3SXSA 5CSPA 3DXPA 2ITYA 5LCJA 3EZRA 4F09A 3OD6X 1YOJA 4HPUE 4RT7A 3OCTA 4FZFB 3AGLA 2GMXA 5IMEA 3FEGA 2OGVA 2PVKA 2UW3A 4JRVA 5FEQA 3GCSA 3W32A 2GFCA 3CY2A 4EHGA 3DJ6A 4JQ8A 4TW9A 4BFMA 1Q99A 4CYIA 5C8KA 4I6HA 5CAPA 4DE4A 3NYVA 1Q61A 5I5ZA 4I3ZA 4FYOA 4J7BA 2UZTA 3W0RA 2V7OA 4HOKA 3DY7A 3RBWA 3RNIA 3BE2A 4Q2AA 4HVDA 3BE9A 3V8TA 4PTCA 5E92A 3VS0A 5GJFA 2R4BA 3R83A 3LFFA 2FSMX 4PDPA 2R3QA 2IW9A 2UW9A 5L8LA 3PXZA 1GZKA 2FA2A 3NRMA 3Q4CA 3WZKA 4AN3A 5L3AA 4I6LA 4YJTA 3PXFA 2W99B 1XH8A 3O8PA 5CU3A 3TCPA 2CPKE 4GCJA 4UALA 3FLYA 2VU3A 4N70A 3LFSA 4X2NA 2YLEA 5AX3A 4CFUA 1JKLA 4RIWA 3QKLA 5JK3A 5CWZA 3HYHA 2VTTA 4HGTA 4O0WA 4A4LA 4UX9A 3PFYA 4M68A 1Q3WA 2W1IA 1VYWA 2X8DA 3CQUA 3PXYA 4TWCA 3NYXA 2ITWA 1NVSA 4MF1A 4JX7A 4BTJA 4G9RA 4RQVA 4E1ZA 4DGLC 4PMTA 5AP3A 3QRTA 4F9BA 2XKFA 3QX2A 3DKGA 2I6LA 3FXWA 5CU6A 3LKMA 2OXYA 3IDCA 4CYJA 5HNBA 2QD9A 4YSMA 3O17A 5BVFA 1H4LA 2IW6A 1WAKA 5LQFA 2QQ7A 4II5A 4CT2A 4FT3A 3HVCA 4DLJA 5L2SA 4YLJA 4XP2A 3MH2A 2JBPA 2WOTA 2ITNA 3FMKA 4BTFA 4J71A 4A9UA 1XMMA 5I9WA 3IDBA 4DGNA 2BROA 3DGKA 3QKKA 2XIYA 4QMMA 1H27A 1CDKA 4XOZA 5BYLA 3CR0A 2BZKB 1XBAA 1E9HA 2Z7LA 4APCA 2CDZA 2WNTA 3O96A 3T8OA 5I9ZA 3F5UA 4IVBA 1KE9A 5EHYA 2BRNA 3U4WA 4B8MA 2IZUA 3HMOA 4CFVA 2IWIA 4KIKB 3GCVA 3OBJA 5AV2A 4FTMA 3CXWA 5GJDA 4ARKA 1VLRA 5FDPA 3A7GA 4B99A 3R30A 2P2HA 3QQKA 4X3FC 3MFUA 4FNXA 3DBFA 1M17A 2RSVA 4FUXA 4DTBA 1YDRE 5HI2A 4RRVA 3QF9A 4ZZNA 3ULZA 4ZLOA 5GZ9A 1GY3A 3AT3A 4XRJA 5AR4A 5KKRC 5LWNA 2BKZA 3KCKA 4RGJA 3OWPA 2E9UA 2EXEA 2X2MA 4ASDA 5I4NA 5KO1A 4ASZA 1B38A 3LFCA 4PDSA 3RK9A 4O4FA 4WNPA 4D0WA 5E9EA 1OI9A 2PK9A 3MH1A 2HCKA 3AOXA 2IZTA 3KMUA 3EN9A 4FKVA 2W7XA 1Z9XA 4R5SA 4RIOA 4DHIB 2R5TA 2E9VA 2ZB1A 2EU9A 4HZRA 2PZRA 3EQHA 2C0IA 1SNUA 3F3ZA 3NYOA 4FEQA 2QU6A 4FZDB 4TYGA 4XHKB 3BHUA 2J50A 2C6IA 3I0QA 4BDFA 4FT9A 4CKIA 2R0IA 4NKSA 3Q6UA 1JWHA 1U4DA 4FV4A 3SD0A 5GZ8A 1IAHA 2NNWB 1IAJA 1O6LA 2XANA 3ZLWA 2X0OA 2XK4A 5J9ZA 2OK1A 3FY2A 1ZYSA 3AMBA 2UW0A 4NZWB 4U5JA 3QKMA 4AA0A 3UNKA 4ZMEA 4ID7A 3I81A 3POZA 2HW7A 5BUIA 3DLZA 3II5A 4KRDA 3DNEA 2PYWA 2QONA 2HAKA 3FE3A 4RWJA 4BGGA 2QOFA 5TF9A 5LVOA 3QTUA 2CN8A 4FV9A 4YGAA 3AMYA 3FI4A 2CKOA 3BLRA 4NL0A 3VUDA 4AN9A 1ZAOA 2WIPA 1H08A 4CMOA 1LR4A 5GZAA 4PWNA 4O7WA 4FSYA 5EDPA 4FG9A 4O2ZA 2XKCA 4RWKA 5DR2A 3S00A 5IQHA 2GTMA 1OKYA 2C1AA 3B2TA 4XLVA 1M14A 3W18A 4DEEA 4I5CA 4E3CA 4ZTMA 4JR3A 2BIKB 5EQEA 3D2KA 3OWLA 4U0IA 1J3HA 4AT4A 4JQEA 2GQGA 5L2IA 1F5QA 2VO3A 4W4VA 5EI8A 3K2LA 1AGWA 2QODA 3V5QA 5E8YA 3BLAA 2FSLX 3DTWA 3HAMA 1JPAA 2UZLA 2EXCX 4MBIA 2JDVA 4NCTC 1OBDA 2JEDA 4OR5A 4Y5QA 3VJOA 3QQHA 3R9DA 2J5EA 3PVBA 4CFFA 3UIUA 4F7NA 2IF8A 2JITA 5IEVA 4WBOA 2F2CB 4E8AA 4Y83A 1SMHA 1UV5A 1Q8TA 4NM5A 4S32A 4MK0A 4ZSLA 2VV9A 4TWOA 2ZOQA 4IM3A 3TJDA 2CHLA 3E63A 1ZYLA 3O7LB 4BIEA 2BIYA 4E20A 4YZBA 4Q9SA 3AQVA 2JDOA 1IEPA 3C0HA 3IGOA 3MSSA 3NS9A 3ORXA 4MAOA 4TZRA 4X6QC 1O9UA 3GCPA 3LIJA 1H00A 4WIHA 3FPMA 2B7AA 4LV8A 2RKUA 4JOAA 4H1JA 2UW4A 2C3JA 2VUWA 4S34A 3LQ8A 5HX6A 4M7IA 4YHTA 5I9YA 2JAVA 4D2TA 3UO5A 1J7IA 2YZAA 1OIQA 4V05A 4BDIA 4WG4A 2B9IA 3GU6A 2GNLA 5DOSA 4OLIA 5D7VA 5HG9A 4KA3A 4O7NA 4RLKA 4YZ9A 3S3IA 3A62A 3CPCA 3NUAA 2R3IA 3R01A 1I09A 2VTJA 3RZFA 4LRMA 3PP1A 4L67A 3VAPA 1YXVA 1PJKA 2HELA 5DBXA 3BCEA 2GS6A 5HLPA 2Q0NA 4TPTA 3RINA 4O0SA 3RVGA 3ZRMA 4FTRA 1YI4A 3KMWA 3ELJA 4FV1A 2BZJA 3OT3A 5A4EA 3I6WA 5HE0A 2RGPA 5C1QB 2CCHA 4ZP5A 4FTJA 2J4ZA 1BLXA 4W8EA 1PYXA 1KE5A 5HVKA 3L8SA 1B6CB 1SYKA 5HBEA 1PRYA 3LMGA 4CKRA 1GZNA 3ACKA 5M44A 2O64A 3P79A 4IVCA 5HD7A 4DLIA 5JSMA 4PMPA 3O0GA 4FIIA 3VS7A 2HXLA 4RX7A 1Y6AA 1PMUA 5LXMA 3A4OX 3UBDA 3KN5A 4W4XA 5E8WA 3LQ3A 4V0GB 4XNEA 1XKKA 5FBOA 2Z60A 2X4FA 2C4GA 5IQGA 5CASA 4NSTA 4IZ5A 3QRIA 4CSVA 1JSUA 4G3FA 2YM8A 5IA1A 3G9LX 3C5IA 3V51A 4HYUA 1M7QA 4XV3A 3MH0A 5AAFA 4EZ5A 4EUUA 2EWAA 2O8YA 3TMOA 2QU5A 3QWJA 4QO9A 3NW5A 2JAMA 3LLTA 4DFXE 2GCDA 5D12A 5KMIA 1A48A 4I6FA 5L2QA 2VGPA 4BDHA 4D1XA 1REJA 4O0VA 4PDOA 4HGSA 2YM6A 5CT0A 3HGKA 1DAWA 5EHLA 3ACJA 2VTIA 3FMMA 4ZTRA 3LXLA 4EK6A 4C2VA 5F9EA 4MXCA 4JLCA 4MXYA 2C3IB 3V8WA 2QNJA 3NCZA 2WTKC 3SHEA 3QQUA 1OUKA 4FIGA 4XV9A 4EQMA 4Z7GA 3MPMA 1J91A 1NY3A 3DTCA 4I6QA 5FQDC 4BBFA 3PY3A 4AXCA 3R7GA 4ZTNA 3WIKA 3A99A 4MEDA 3OXTA 4W9WA 3CC6A 1V0PA 3TTIA 1P2AA 3MGYA 2Q0BA 4PL3A 2E9OA 2QLUA 2YISA 2OI4X 1FPUA 3QTQA 4U42A 3SXRA 4BDKA 5CU4A 4DBXA 2HWPA 4I6BA 4RIYB 5IA4A 2X7OA 4U80A 5FTQA 3O51A 4ANQA 4GG5A 1XHAA 5AM6A 3T9TA 4O21A 5M57A 2XYUA 3FQEA 2ZMDA 3BKBA 3H30A 4TWPA 2QG5A 5LMAA 1Q3DA 2HIWA 1O6KA 3KVXA 5BNJA 5EW8A 2W1GA 4WRGA 1XH4A 5E91A 3ZUVA 1STCE 2R64A 4FKSA 5CXZA 3SRVB 3PG3A 3D7TB 4DFUA 4K2RA 2XA4A 2GNIA 4IX4A 3U55A 4DFZE 3QHRA 4LOPA 3RAKA 4DC2A 2PL0A 4G5JA 2VWZA 4RWIA 4EI4A 2YAKA 4LV5A 4QNYA 1R3CA 5LVLA 4D2WA 4UMUA 2BRGA 4IWQA 1WBPA 1JSVA 4USFA 4ZXTA 4ZEGA 5CT7A 3LJ1A 5B7VA 4IVAA 1Y57A 1PY5A 4QP1A 4G9CA 4M84A 4PDYA 4HYHA 2C47A 4G16A 5M53A 3OWJA 2QKRA 2F7EE 2X8EA 4RC2A 1HCLA 1ZWSA 3Q53A 5HZNA 5KNJA 3C4XA 4NWMA 4N57A 1BKXA 2XK8A 2O0UA 1UU9A 3LLAA 2IO6A 3R7YA 5ACKA 5EYMA 4CFNA 3ENHA 3NDMA 3VHEA 3HV3A 2R3RA 1WBVA 4IFCA 1PKDA 2OH4A 4QTEA 2VTQA 1QL6A 4ALUA 3CTJA 2WO6A 4P5ZA 4FTQA 4NYEA 4EZ3A 3DU8A 5C4KA 4FG8A 1UNGA 4J1RA 1FGKA 4O7ZA 4ENYA 2CLXA 1BX6A 2XRUA 3KRXA 2Y6MA 4RSSA 3BL9A 4QMTA 3DAEA 4HW7A 2JFLA 4FX3A 4NJDA 2BZHB 1QPDA 4MTAA 5E8UA 3TNQB 1A9UA 5JGAA 5HIDA 3CIKA 2QOKA 2XH5A 1IA8A 3R04A 3JR1A 4FZ7A 4JNWA 5C4LA 2YDKA 3MB7A 4KKEA 5GIPE 4P2KA 4BWKA 3DS6A 2EB3A 2Y8OA 3AT2A 4QMLA 2ESMA 3LXNA 5FP5A 4BGQA 3QZHA 4RX9A 4L8MA 1MRYA 2F7XE 1Q8UA 4O27B 4FRFA 5E4HA 3QL8A 3UOHA 5IH4A 3MTFA 4RFMA 5AP2A 4ORKA 4PPAA 3QX4A 5ANIA 5LARA 3FMDA 3DA6A 5M09A 2C6MA 4V0GA 3W55A 4A9RA 2WMXA 4O22A 5AR5A 4R1YA 4ACGA 4XMOA 3H0ZA 1OKVA 3ZC6A 2NRUA 2CJMA 4RVKA 3HDNA 1ZOHA 3ZUTA 4RQKA 2WB8A 1KWPA 3GI3A 3E8EA 1Q24A 3Q04A 5BVDA 5TO8A 3CSVA 2PVHA 4HZSA 4BCGA 2ZMCA 1PXKA 4O83A 2RL5A 4F70A 1BYGA 1WBWA 4UN0C 3D15A 3MS9A 5IQBA 4OT5A 3FXXA 3PLAE 3QLFA 4FR4A 3BU6A 4O4CA 1YHWA 4E6CA 4FKJA 2I0YA 3MIAA 3DKCA 3GOKA 5ETFA 4E4NA 2BDWA 5DI1A 5E8TA 4DTKA 2HXQA 2JGZA 4BZDA 1JKKA 4CEGA 4UWCA 3ZFMA 4OAVB 3ZBXA 2W4OA 5FEDA 1P5EA 3C0IA 1S9IA 1H01A 3RCDA 5JRQA 4QTAA 5HESA 5KUPA 5LMKC 4BCKA 3TDVA 4X2FA 4C4EA 4ZS4A 5DT0A 3ZO2A 2BAKA 2LGCA 3F6XA 4GJ3A 4I0TA 4N4SA 4LDTA 3ANQA 1RDQE 4D9UA 1OL1A 4O4DA 4RWLA 2QO7A 4K0YA 2C0OA 2ZV8A 3U4UA 2A2AA 4ANSA 1TQMA 3M11A 5EKOA 2HOGA 4ENXA 2IEWA 2V55A 3QD2B 3VUMA 2VWUA 3PRIA 3SC1A 1TFFA 5AP1A 5H8GA 4YTFA 3F3VA 4GT5A 5CY3A 3L8VA 1R1WA 3PA4A 2VGOA 4TN6A 4LGGA 5JGBA 3H4JA 5H8BA 1T45A 4RFYA 4F63A 1PXIA 2XKEA 4QYFA 2VWIA 2YDIA 3EH9A 3FKLA 4FVQA 4U81A 4D2PA 3ZDIA 4E5AX 4D58A 5M08A 3TJCA 4MD8E 3E3PA 4D9TA 3UMXA 4FTKA 3RAHA 3C4ZA 4G5PA 1GAGA 2PVJA 4RVMA 1WVXA 1F0QA 1YDTE 3D2IA 3EN5A 3MB6A 4FV6A 3L9LA 4R1VA 4AOTA 2WTVA 2DWBA 3GT8A 2PZPA 4JAIA 4Y95A 4A06A 4Q9ZA 3S0OA 3VUHA 3NFFB 3BBTB 4MXXA 3DJ7A 4QOXA 3OBGA 4EH6A 2F9GA 4LYNA 1ZYJA 3Q32A 3A8XA 2WZJA 3UQCA 3KXHA 4KD1A 3FZ1A 3RALA 3IS5A 2FYSA 1SZMA 2O63A 3VNTA 2XMYA 4O6EA 4UZHA 5H8EA 2Z7RA 2C5VA 3ORMA 4IAFA 5CX9A 5D41A 2VZ6A 5HHWA 1H0VA 3AKKA 4IAZA 3R9HA 4B4LA 5HD4A 1DI9A 3H3CA 5CAOA 1WBNA 2Y0AA 1ATPE 4M3QA 3H9RA 3GCUA 4L00A 4AWIA 2WXVA 1FVRA 4YJQA 5DMZA 2QG7A 2ZDUA 3FZSA 4AGDA 5M07A 4BCJA 5M56A 4RZWA 5DIAA 4DH7A 3SQQA 4BB4A 2OF2A 3ZDUA 3AKLA 3UJGA 2WQOA 4IZAA 4L45A 5HQ0A 2R3MA 4S31A 5DGZA 3SKCA 4MQ2A 4FTLA 4DFLA 5M55A 5C8NA 1DS5A 1KE8A 2YJRA 5DT3A 3VC4A 4O2PA 4EK4A 4GSBA 4U44A 3LJ0A 4AXFA 2B52A 4F08A 3NVKI 4FIFA 4MXZA 3K5VA 5HO7A 5CEKA 1ERKA 3GUBA 4EOJA 5FM2A 2IPXA 3UDTA 4DT8A 5ANKA 4Z9LA 3KK9A 4C02A 3RGFA 4FEUA 3LPBA 3TZ9A 3MBLA 3W2OA 2W4JA 4JAJA 5G1XA 4I20A 3ZLSA 1YDSE 4BKZA 2DYLA 4AQKA 4PQNA 4X0MA 5AUYA 3NAYA 2R3GA 4M14A 4R5YA 3TNWA 5JQ5A 3A4PA 4DDGA 2VTNA 3DV3A 2HW6A 3UTOA 2RFEA 5JFWA 4IW0A 3RZBA 2OIQA 3BYSA 2VX3A 3D0EA 4D4RA 3W0SA 1W2FA 3HL7A 3PDTA 4AW1A 2BVAA 3SLSA 4LV7A 2UZUE 2XYNA 2ZDTA 2O65A 5AP0A 4TYIA 4YBJA 5JN2A 4E4LA 1V0BA 3PSDA 2G15A 1VEBA 3F5GA 4NTTA 5F4NA 3BGPA 3TYKA 2PE2A 2W1ZA 2WAJA 3P5KA 4IANA 2X6EA 3VW6A 4ANMA 3Q60A 2ZV2A 3HRCA 4PP7A 5IKWA 3U9CA 3UOJA 1X8BA 3QFVA 5KX8A 3C0GA 4MCVA 4C3RA 1ZRZA 2ZVAA 4XYFA 2ZAZA 4S33A 3EWHA 2YWPA 2FH9A 4C34A 2GQRA 5EYDA 4BRXA 3Q2JA 4FKTA 3ULIA 3SVVA 2WU6A 1FQ1B 5M4CA 4U6RA 3K5UA 4G3DA 4KINA 4XH6A 3TIYA 3WZUA 4E6QA 3RPRA 5J1WA 4OTHA 3EN6A 3F2RA 4E4MA 3CQEA 3E8CA 3K3JA 5DPVA 4ZK5A 3RMFA 3U6IA 3D9VA 2WTIA 2Y7JA 3KULA 3NX8A 4S2ZA 4UWBA 2WIHA 3C4CA 4TNBA 2FGIA 1ZZLA 3CJGA 3ROYA 2HZ0A 2JIIA 3CLYA 5IMXA 3EJ1A 3KK8A 4N0SA 4DEBA 3SA0A 4EJNA 4FEXA 4EOSA 2R3OA 4YTIA 3F61A 3HA8A 5HTBA 3H0YA 3I4BA 4AZFA 3GXLA 1U5RA 3WZJA 2GHMA 5BV3A 3VS4A