4D5KA

Focal adhesion kinase catalytic domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
272
structure length
255
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords FOCAL ADHESION KINASE
publication title Allosteric Regulation of Focal Adhesion Kinase by Pip2 and ATP.
pubmed doi rcsb
source organism Gallus gallus
total genus 86
structure length 255
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d5kA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d5kA01
1ZOEA 2BKKA 1UNHA 4I24A 5C26A 5L2SA 3VJOA 4Z7GA 2VWXA 3G9NA 3RAIA 2PHKA 3BHYA 3RK5A 5F95A 3MY5A 2VTJA 4UXQA 3MFUA 1KV2A 4UB7A 1K2PA 2B52A 3AMYA 5KKRB 4BCOA 3QX4A 3AT4A 4J7BA 4ZY6A 4BGHA 4BCPA 4O83A 2JEDA 1M2QA 5TE0A 4U42A 2I1MA 3SRVA 1ZWSA 5HZNA 2NNWB 3UVRA 3PRIA 3POZA 4IAAA 1F0QA 3ZZEA 3N9XA 4YJNA 3OS3A 4YNOA 3I0QA 4YHFA 3R83A 4EHGA 5LMKC 3UZRA 4JNWA 2BAQA 3ZXZA 4CZTA 4UMRA 3EFWA 4GJ3A 4W4WA 3O71A 2VZ6A 3GC7A 2EWAA 2PUUA 3GNIB 3TNWA 3UYSA 4D4RA 1ND4A 3GP0A 3H3CA 4D1XA 5AR7A 3T3VA 3QD4A 3GENA 3NUUA 3QRUA 3TJDA 1AGWA 3AC1A 5JRSA 3B8RA 5LCJA 4FGRA 4Y5QA 5AFVA 4GIIA 4QNYA 4HNIA 3V5QA 3VN9A 1OB3A 4U9AA 4CLIA 3U9CA 1CDKA 2Y4IC 2O8YA 2C6MA 4ACCA 2A2AA 2OJGA 3BHHA 4FIEA 5BVFA 3I5ZA 4R7BA 3RNYA 1F3MC 1H25A 3HECA 1PRYA 1Q61A 4EBWA 3D7TB 4RJ7A 4HZRA 2QG7A 4AU8A 2XMYA 5HD4A 3A60A 1XHAA 5CT0A 4S34A 5B2MA 5KMOA 4QMMA 3MYGA 5KMNA 5HO6A 5DBXA 3Q2MA 2FSMX 4AGDA 3FXXA 3ZM9A 4O0SA 4FG8A 2QOBA 2O63A 3MTLA 3LPBA 3LKMA 2PPQA 1W7HA 5J95A 4EL9A 3C5UA 2IVSA 3F2NA 3R21A 4G9RA 4KRCA 4J95A 4LGHA 2AC3A 4B7TA 4DG2E 4C0TA 4DF3A 5IPJA 1M14A 5JH6A 3OD6X 3QTXA 4RFMA 2PVLA 3G0EA 2ZJWA 5CALA 4FNZA 2B55A 2GNLA 2ACXA 5D11A 5EQEA 2XIXA 3KA0A 4RZVA 3R04A 4IB5A 3WI6A 5KMKA 3FLSA 5AMNA 3D0EA 3AOXA 4WNOA 1R1WA 4KIQA 5LMAA 1H24A 2QHMA 4L3JA 4EKLA 1PY5A 4ONAA 4XG9A 1VZOA 2C5XA 3MVMA 3GUBA 1J1BA 4YC3A 2VX1A 3CGFA 5BMMA 3VS6A 4U0IA 3V8SA 3W10A 3W32A 1ZYCA 3VS2A 4LMNA 4EBVA 3DJ5A 5AR4A 4IFCA 4D28A 4QRCA 3VUGA 3DS6A 4G6NA 4QMWA 4DHFA 1VYZA 1Y8GA 4QMOA 1BX6A 3FMJA 4M13A 3QZGA 5KHWA 3MIAA 3QBNA 2A19B 2JAVA 5C01A 5CI7A 4NTSA 2VTAA 4LG4A 3RNIA 4AW0A 2IWIA 5GJFA 3G15A 4AGCA 1IA9A 3U4WA 3RK9A 3DK6A 4FK3A 5DH3A 1Q8UA 4C62A 2YCSA 4W4VA 3P7AA 5A54A 1YOJA 4L7SA 1YI6A 4EK8A 4FT5A 4E7WA 3FQEA 4F08A 5AP7A 5DR2A 4FSTA 4BKZA 3SQQA 5JRQA 2J0KA 1UNGA 2B9HA 3FI2A 3VWAA 2R3IA 4ZTMA 5CZIA 3CCNA 4TPTA 4MHAA 3DBEA 2PUNA 3ZLSA 1CM8A 2VWUA 4RA5A 1YXXA 2R7BA 2OH0E 4UMUA 2I7QA 3BLRA 4F70A 1Q5KA 5HNGA 5L6WL 2UZTA 3SW4A 4I23A 2O2UA 2J0MB 2UW8A 5AP4A 3F5XA 2PWLA 3LFDA 4QMYA 3DBCA 1BI8A 4CQGA 5AIKA 4HJOA 4UMTA 4NCTA 4AP7A 4KS7A 3TV6A 2RL5A 2BMCA 4D2SA 5JGBA 2CPKE 4ZAUA 2E2BA 5B0XA 4AOJA 1SVGA 2VRXA 4FL3A 5CU2A 4BDJA 3AD6A 2ZV7A 3PLSA 5E8YA 4H1MA 4D0XA 4NK9A 4G3DA 5H9BA 5I3OA 5BX0A 2C1AA 4C38A 4PL4A 5AA8A 4XRJA 2WTDA 3R9HA 2ETRA 3OW3A 3L9PA 4OT6A 3RPOA 4LUDA 1SM2A 5D9HA 4KS8A 4CYIA 4BY9E 1TKIA 2W5HA 2ZYBA 1OITA 3NUPA 4O2ZA 3KVWA 2UW4A 4IXPA 4J52A 3OF0A 4A7CA 4DINA 2X4ZA 4AN9A 5HTIA 3S0OA 3NW6A 3VHEA 3A2CA 2YLFA 2C0OA 2WQOA 3AMAA 3UOKA 4JOAA 3A7HA 4W4YA 3DB8A 3GEQA 4LV8A 3KXZA 3PP1A 2PMNX 5FBNC 4KKGA 1V0PA 4WRGA 3DXNA 4QP3A 1QPJA 1BL7A 3QTWA 3W33A 4CFFA 2W06A 3LFFA 4HGSA 3ZXTA 5KCVA 3QXOA 2BTRA 2QU5A 4C4IA 4EOIA 5CU0A 5J7BA 5E9EA 2FSOX 5HBHA 4QNAA 4ZP5A 3MIYA 3QRIA 1ERKA 2XIRA 3VF9A 4R5SA 4F0GA 1XKKA 3FI4A 5FTOA 2IPXA 3UQGA 5AADA 5AEPA 5E4HA 2XRUA 1M2RA 3HDNA 2PVYA 4A07A 1Q24A 3SVVA 5LQFA 2CGWA 2IZRA 3ACJA 3SLSA 3R28A 3KXGA 3M11A 4J1RA 5FXRA 4TYHB 3LFCA 5DRBA 3TZ7A 5D1JA 4Y85A 3FL5A 2YHVA 4L52A 4LM5A 3BQCA 4YUQA 2QNJA 2R3QA 5IEXA 1OBGA 5C4KA 1GZ8A 4U97A 4D2PA 4BL1A 5EYMA 2YISA 2HYYA 4FKJA 2X2LA 1QPDA 1Q41A 3GOKA 3MH0A 1M7QA 3FZSA 3LLTA 2XK6A 3BGZA 2XJ0A 5FBOA 2X4FA 4BIEA 3JS2A 4DGOA 5ICPA 5HLPA 4GK3A 4ZJVA 3DXQA 4BIBA 3BYOA 3FEGA 3NAXA 3ZSIA 2PE0A 4GG5A 4M97A 1OL5A 1ZMUA 3QAME 4R8QA 4O7LA 2VTTA 3D15A 4UBAA 5DEYA 2IW8A 2BHEA 3GQLA 3ZDIA 5KE0A 5JFSA 4ZK5A 2ITZA 4H36A 1TQMA 2XCHA 1P14A 3UYTA 3TZ8A 4JDJA 3ZC5A 3DTCA 2ITWA 3IPHA 3PIYA 3HUCA 3R71A 4XCUA 2XNEA 2ZVAA 4DH7A 3EKNA 3UIXA 4M66A 3KC3A 2WU6A 5HBJA 4WHZA 3O2MA 3RAWA 1LR4A 2OW3A 3KRWA 3PPJA 1QL6A 2VTOA 4YHJA 4DBNA 2C3LA 3EQCA 5DWRA 5FP5A 3VBYA 5EHLA 5EM8A 2YM5A 5B2KA 5IQAA 3BYVA 3EL7A 5CF8A 2ZMDA 4Y73A 5EM5A 2VWWA 5BVOA 2PY3A 2IJMA 3ELJA 4RVLA 2EB2A 2VV9A 4QPAA 5LVOA 4JX7A 4RVKA 4FSNA 3U51A 4IEBA 4CZUA 4R1VA 4X3FA 4EQMA 5GZAA 5AUYA 3C0IA 3EJ1A 2VWZA 4BC6A 3R22A 5L8KA 1J7LA 4M84A 2R3FA 2R3PA 3AGLA 1A9UA 2B9FA 3NUAA 4GCJA 5CU6A 4RVTA 1DM2A 5CF5A 3U87A 1GZOA 4LQMA 3ZUVA 4F1MA 2OU7A 4GKIA 3PA3A 5FEDA 2QD9A 5L3AA 5ANDA 1WVWA 2UZUE 2ZV9A 4DCEA 1JPAA 1LPUA 5HIDA 4EZ3A 3RM6A 4UN0C 4MAOA 1WVYA 4O0WA 1YHVA 3PYYA 3OP5A 4I5CA 3R00A 2YM4A 4B8MA 5IKWA 5L6OA 3N4VA 4JDIA 4I94A 4FIJA 4TN6A 5B2LA 4K11A 5EKNA 4MKCA 4C4GA 5L8LA 5L2TA 2P4IA 4XEYA 1GIIA 3K2LA 4Q2AA 5EI8A 2LAVA 4DFLA 3BKBA 4QOXA 4ZZNA 1L8TA 4QP6A 4E3CA 2GFSA 5AUVA 2HK5A 1NW1A 4MBLA 3R7YA 1PXIA 4IAIA 3RKBA 4G5PA 2XZSA 4I41A 3QHWA 1BMKA 3ODZX 3R01A 4IVDA 4M3QA 3VS0A 4ACDA 4EH8A 3I79A 2CKPA 3VO3A 5HVYA 4CG9A 5EYCA 4LGDA 2J6MA 3UJGA 5TOZA 2BZIB 2YFXA 5FP6A 3UNZA 2QU6A 3K3JA 2E9PA 4WD5A 4S30A 5CI6A 3CS9A 3RWQA 3PG1A 3P0MA 4OTPA 4TNBA 3RPYA 1H1QA 3KRRA 4YPSA 2VTPA 4PTEA 4J71A 4TWPA 4IADA 3VUHA 2BPMA 3THBA 5L2WA 3NWWA 3P5KA 2BR1A 3B8QA 4FV8A 3LMIA 2UZOA 3F3WA 4FICA 5HHWA 5BVEA 3G6GA 3PJ8A 3TKUA 3UG2A 2BAJA 2C30A 4C58A 5IH6A 4MXOA 3ALNA 4JAJA 4FKIA 4FTUA 4IWDA 3TUBA 4CQEA 3Q04A 3EQFA 3ITZA 3VVHA 3WF6A 5E8ZA 2OIDA 4O21A 3ZUUA 4L7FA 4D4YA 4EOOA 4MXXA 3JR1A 1LUFA 4ZTSA 5E91A 3KRLA 4D58A 4C3PA 2XH5A 4FTQA 5K4JA 4FZFB 3MV5A 1H28A 5A4EA 5IQIA 3R2BA 3ORTA 1URCA 3FLNC 2R3NA 2BZJA 3VW8A 4DC2A 1AQ1A 1Q4LA 3QKKA 2FYSA 4CCBA 3GOPA 3FL4A 5ETFA 2VU3A 2PVRA 3I6WA 4RIWB 1PXKA 3W2QA 2IZTA 4F99A 4MCVA 4W8EA 3O8UA 3QKLA 2C5NA 2YCFA 4FL2A 4HZSA 3R8PA 5CAVA 5J1WA 2IG7A 5CEQA 3U8WA 3IW7A 5FD2A 1H00A 5CQUA 1A06A 2X2KA 2A4LA 3GCSA 4MD9E 3IW5A 4TYHA 1GAGA 5K0XA 2YAAA 2XJ2A 3KEXA 5BMSA 5JN2A 1ZMWA 5AP5A 2UV2A 3ATSA 5CLPA 4RIXA 5I9UA 3FQSA 4EQUA 4KINA 3FYJX 4EH9A 5EHOA 3KXHA 5KMLA 1CKPA 3FLWA 2PZRA 3Q96A 4OTWA 3WF9A 4ANQA 1M2PA 5JT2A 1W84A 3EN5A 2ITNA 2BAKA 1KSWA 2NPQA 4NM0A 5IZFA 1KUTA 5IUIA 5EHYA 4DH1A 3ROYA 3NYXA 3SA0A 5DNRA 1OL1A 4GKHA 4E4MA 1GIJA 3SHEA 2GHMA 4II5A 4K9YA 3TIZA 3FHRA 4JX3A 4XOYA 5FQDC 5K3YA 2YZLA 4R78A 4EOMA 4IB3A 4YPDA 5IQGA 4DLJA 4U3ZA 3WF8A 5FTQA 4AQCA 3FAAA 4Y46A 5M55A 2XKDA 4BTFA 3OMVA 3F3ZA 4RRVA 3LJ2A 4PDPA 5GZ9A 4IM3A 4BDAA 3FKLA 4IZYA 3A7JA 4QMVA 4CFNA 4UXLA 4X2NA 3BPRA 2W4OA 4ALVA 4IW0A 3IK3A 2JDRA 3MVHA 4XP2A 4BKYA 1UU9A 2UVXA 1Y6BA 2YDJA 4C3RA 5BUJA 4ANLA 3QWJA 3BE2A 3PJ1A 5HO8A 4L3PA 3O17A 5DLSA 3TI1A 3TZ9A 2C6TA 4KIKB 3A4OX 4G6OA 5IQHA 2VWVA 5JGDA 4I6QA 3UP2A 2J0IA 5EW8A 3CJGA 3GBZA 4RGJA 2SRCA 2C3JA 1Q8TA 4NIFB 2C6EA 4D2VA 2HWPA 3JVRA 1ZYSA 2OKRA 5AV1A 2WTJA 2YIQA 3OC1A 5GINE 2DYLA 1PKGA 3LXKA 4E4NA 5FEQA 1O6YA 5CU4A 4Q5HA 1RE8A 5EDPA 1VR2A 1SZMA 2V0DA 2W7XA 4BDHA 4TL0A 2PVJA 5CNNA 4YTFA 4BHNA 1Y57A 3PA4A 4IJPA 3AD4A 3PXRA 2UZNA 2PVKA 4P2KA 4BHZA 5AV4A 3MWUA 5AR2A 3VRYA 4AE9A 5LVLA 5CENA 3BEGA 3EZVA 1H1PA 4OTGA 1KE8A 2WQMA 2WTCA 4C35A 4GFGA 5DMZA 4DEAA 4K18A 4E6CA 4PMMA 4P5ZA 2CDZA 2VUWA 4DBXA 5D10A 4ZTLA 3R1SA 3OT8A 4QT1A 5DN3A 2CJMA 4FK6A 4MBJA 4EK3A 2R3KA 3ZLWA 4CRLA 2HXQA 2B1PA 3CC6A 5HE3A 2P33A 1H27A 3ORPA 3MB6A 3R73A 4PRJA 1Q3DA 3JVSA 1DI8A 3CEKA 5HG5A 4TXCA 3O96A 4XG2A 4JDHA 2XK3A 2R3HA 3OZ6A 4H3PA 3QD3A 1OUKA 1Z57A 3CTJA 3OROA 4CFXA 3GCPA 3LMHA 2GTNA 5DGZA 4QMXA 4QTEA 3I81A 5M4IA 3KRXA 4D0WA 4HYUA 3MPAA 1OPKA 3UOLA 2CCHA 4AA5A 4AUAA 1APME 1KE9A 4D2WA 3QTQA 4EH5A 5E8XA 2Q0BA 4DFNA 4RC2A 2GQRA 4A9RA 4JT3A 1JOWB 4IB1A 1UNLA 1GZNA 5EFQA 1IAHA 1BLXA 3HZTA 4C02A 3CPCA 5LVNA 3NAYA 2X6EA 3D5VA 4XG3A 3AC3A 4YJQA 1VEBA 4YJVA 4D2RA 4U40A 5JQ5A 3R9DA 2WFYA 5J8IA 1MUOA 4Y95A 2BRMA 4ZSJA 4QP8A 5KX8A 4BCKA 3NUNA 4P4CA 4GS6A 5H8EA 3ZONA 4CT2A 2VTSA 1EH4A 3TUDA 4RIWA 2W96B 3I7BA 2G2IA 2OO8X 4MEDA 3FY0A 3EYHA 5HU9A 1J7UA 2X7OA 4BWKA 2WELA 3QLGA 3ZH8A 4BTJA 3TNHA 2R9SA 3MPMA 4FI1A 4MXYA 4F7LA 3O50A 4L53A 5DOSA 4BDFA 4PMTA 4FV1A 3TKHA 3UG1A 3GU8A 2YM7A 4D9UA 2WO6A 4E93A 4RWLA 3SW7A 2GFCA 1NVSA 2UW5A 4LL5A 1OIUA 3F5GA 3CTQA 4FTLA 4R3PA 3LFBA 3W18A 3ZUTA 3FZOA 4ZOGA 2YZAA 4DT8A 3F66A 4JRNA 4HVDA 2Y8OA 4FV2A 5DE2A 3AC5A 2ITUA 4L46A 3PWDA 3TNQB 2XNNA 4KKHA 4O7ZA 4FTKA 2Z7SA 3Q9ZA 2PZIA 3BGQA 3MGYA 2IVTA 3BHTA 2Q83A 4ITIA 3TT0A 4C8BA 4HPUE 1PF8A 2FH9A 5HG8A 4FEXA 3LFQA 5AV2A 4BCNA 4MQ2A 4FSYA 3RHXA 3U6JA 2C68A 4RSSA 3TNPC 1H0WA 1H1RA 2C0IA 4OTIA 5HD7A 3ALOA 3OHTA 1KOAA 2OSCA 3H0ZA 1HOWA 2QOOA 3HGKA 3KFAA 4EOSA 3AMBA 5KKRC 2R3OA 3D9VA 3BX5A 4CZYB 1XBAA 5FM2A 2ITYA 4EC8A 5IF1A 3E8NA 4YGAA 5E8UA 4ANSA 4BYJA 2C0TA 3NNXA 4AW5A 1BL6A 4IANA 4BZNA 1SNXA 3R9OA 5HE0A 3UIUA 5JFVA 3F82A 1OUYA 3PRFA 2BDWA 2YIWA 3DBQA 3H9FA 3I4BA 4M15A 2CHLA 2QO7A 3G33A 3AXWA 3ORIA 5D41A 1UV5A 4AGUA 4CYJA 5KMJA 3RZFA 2UW6A 5A6NA 2F9GA 3TCPA 5I5ZA 4GT5A 3GFEA 3HMPA 4RJ6A 1E9HA 4NSTA 2Z8CA 3R6XA 1GIHA 4YC6A 2X9FA 4FV6A 4NIFA 4JJRA 4C4EA 2OICA 2HIWA 2GNFA 4N0SA 4YJUA 3ZMMA 3UZPA 1YDSE 1OGUA 3HMNA 2OJFE 5LOHA 2ERZE 4YJSA 5EOLA 3K3IA 5LVPA 2V55A 3Q9XA 4M14A 3OCBA 4FEVA 1H1SA 3OWPA 5K4IA 3FC2A 2F49A 5AUZA 3FHIA 4YBJA 4IM0A 3DFCB 5AX9A 3LJ1A 4OTFA 5FRIA 5B7VA 5J7HA 2WQNA 4FIIA 3MFTA 4LRKA 4I22A 3HV6A 2Y7JA 1QMZA 3PVWA 4KBAA 3W2SA 3MJ2A 3NR9A 4L00A 5KZIA 3RPVA 3FYKX 5A4TA 5F4NA 2OLCA 5CTPA 2QHNA 3HNGA 5EW9A 5CZHA 5M44A 3ZOSA 2AUHA 4AAAA 1R78A 3ZS5A 4EOJA 3M1SA 4G9CA 1H08A 3L8XA 4DEIA 3LMGA 2HY81 3SC1A 5JFWA 5CSPA 4UZHA 2R0IA 4R6VA 2PUIA 4C3FA 2NRUA 2J90A 4CCUA 1BUHA 4EK6A 2WZJA 4BYIA 3DJ7A 4FKUA 4H39A 3VUDA 4USEA 5JMSA 3PJ2A 3ZO1A 3QHRA 3WARA 3R7GA 4RJ5A 2FO0A 3ZLXA 4ARKA 3C7QA 3LAUA 1NY3A 2WIHA 3JUHA 4G2FA 4UY9A 1AD5A 4XP0A 5CSWA 4QTDA 4YSMA 3FLQA 3POOA 1T46A 4EH4A 2R0UA 4GVJA 3SXFA 5CANA 3PZEA 3RM7A 3E8EA 1GNGA 3BIZA 5JFXA 5AAGA 4G16A 3VULA 3DNEA 3P79A 5D7AA 1OBDA 4JRVA 3DB6A 4M69A 4G5JA 5LMBA 4IX3A 1DI9A 2QC6A 3CQEA 4K1BA 3E3BX 3RJCA 3ZHPC 5HOAA 3BCEA 5EDRA 5BUIA 3HV3A 5G6VA 5AAFA 1TVOA 1ZYJA 2GS2A 4G6LA 3FZTA 4GUEA 3V5WA 3DLSA 4G3FA 4PUZA 2G01A 3A7GA 3H4JA 3MA3A 5DHJA 4LL0A 4QP4A 3EQIA 4B9DA 5HTBA 4W4XA 4FT0A 4YZ9A 3NMUF 2V62A 1V1KA 4I4FA 4RQKA 2WXVA 1JNKA 2J2IB 3HA8A 4DTBA 4ENXA 5BVDA 3R1QA 4OBQA 5DT0A 4DGLC 5GJGA 1HCLA 3EFKA 1U4DA 3UIMA 4FKWA 5A14A 4L43A 4X2GA 2GHLA 5ACBC 2BIYA 4ZIMA 2WOUA 3D14A 1LP4A 3NX8A 2WTKB 4FZ7A 3I5NA 3ORKA 3UQFA 2R2PA 2XUUA 5KMIA 3KRJA 5DFPA 5DVRA 2XP2A 1IASA 2G15A 4RJ3A 5EH0A 4GFOA 4E8AA 3KY2A 4EONA 2JGZA 3B2WA 2JDVA 5E8TA 4OTDA 2RSVA 4OTQA 2WMBA 4QP9A 4FTAA 1ZXEA 2P3GX 5IMEA 4CFMA 4XV9A 2UZDA 2BRHA 3W2RA 4WUAA 2O64A 3QD0A 4KSPA 4X3FB 4RFZA 3VHKA 1WVXA 2R4BA 4F7JA 3F2RA 3FXWA 2BUJA 3PXZA 4JBQA 2XNPA 1PMEA 3BU6A 3PA5A 2G9XA 4FOBA 4BICA 3UVQA 3BU5A 4DEGA 4APPA 3OG7A 5J5TA 2W17A 3R63A 4O91A 3ETAA 3QTIA 2WGJA 2X8DA 1PXLA 4B4LA 3P86A 3UQCA 4BI1A 3UPXA 3QA0A 5CSVA 3WYXA 5CAUA 5IA0A 4NFMA 5IH4A 1XH8A 3VS3A 2HXLA 1XH5A 4QQCA 3UP7A 4AZEA 3DBDA 3MPTA 1T45A 2W9FB 5EK7A 3U6HA 4M68A 3E62A 1XWSA 2JDOA 3CBLA 3SD0A 4BKJA 1FQ1B 5HE1A 3F5PA 3KK9A 4CFWA 2Z60A 4IX4A 3N4UA 4YZBA 5EKOA 4PX6A 4N70A 3CLYA 3V5PA 1WBWA 4WSQA 4J96A 5FUTA 3EQRA 4DE4A 3F88A 3WZKA 3KU2A 4XYFA 3NUSA 3V5JA 3VBTA 2VO0A 4I92A 5CEIA 4KBCA 2W05A 3UGCA 4NL0A 4I3ZA 4O2PA 1U46A 4PMSA 4I5HA 4YTHA 2QURA 3LIJA 2PSQA 2RG6A 4KWPA 2I0YA 5M4UA 2PMLX 3MH1A 2BRBA 4KUJA 2F4JA 3ZRKA 4FT7A 1HCKA 4XG6A 2C47A 4MD7E 1CMKE 4CG8A 3DLZA 3NNVA 5M06A 2ZM1A 3Q52A 4IC7A 2E9OA 4OTRA 4F0IA 4EORA 3ZRMA 4I21A 3QRTA 5CU3A 5K5XA 4DGMA 1R0PA 4F63A 5GHVA 4O38A 4QP2A 4FIFA 4KBKA 4JL9A 4WRSA 2XIYA 2JBOA 4HYIA 5HIBA 2P2IA 4YTIA 5ITAA 3Q32A 3P9JA 4KIPA 4TTHB 2I0VA 4ZZMA 2R3LA 4BRXA 3QQHA 4R3RA 3TXOA 5F94A 1OKWA 4DA5A 5C4LA 3ZCLA 5CF4A 3ROCA 5CVGA 1JKTA 4YZCA 4AZVA 1H8FA 2ZB0A 3C4FA 4O84A 3IO7A 4O7RA 4GT4A 2IZUA 3NLBA 4AS0A 4R1YA 5CS6A 3RK7A 4FSRA 3FKOA 1JVPP 2QO2A 4RIXB 3UDBA 3UO5A 3EN6A 4AZFA 1ZAOA 4ERWA 4N4SA 4N57A 5CSXA 5AIRA 3QZHA 4BCMA 3FI8A 1YI3A 4IZAA 4E4LA 4CGAA 2WTWA 3UOJA 4IJ9A 3MA6A 3D5UA 3IG7A 2JIUA 2JKQA 4GEOA 4BGGA 2PU8A 4WA9A 2BDJA 2JITA 5EQYA 4NJDA 3BRBA 3OWLA 2WOTA 3TG1A 5FM3A 3MVLA 4ASDA 1UU3A 2OXDA 4K8AA 4XLVA 2JKMA 3U55A 4OTHA 2NO3A 4CXAA 3E64A 4AT5A 4HOKA 1XH9A 1YXVA 4FIGA 4PF4A 2QR8A 4TRLA 3R02A 4DEEA 2HWOA 3ORXA 3QFVA 3PVUA 4Q9ZA 2QOLA 1Q62A 3JXWA 4AGWA 3TDVA 3BQRA 5ANOA 3UMXA 3FBVA 3NRMA 3ODYX 4IZ7A 3WZJA 3PJ3A 4XP3A 4C37A 3L9MA 3UVPA 3GC8A 3ORZA 1XH6A 2ITPA 4WIHA 2PYWA 3LFNA 2DS1A 4F6UA 4XNEA 4LOPA 4KKEA 4A9YA 3CD8A 1JLUE 1KE5A 4ZZOA 3H9RA 4PDSA 3WZDA 3EFJA 3QYZA 2O0UA 5IQDA 4HGTA 3DDPA 2XBAA 2V7AA 3O7LB 4AE6A 2R3JA 2XA4A 3ORMA 4DEBA 4YR8A 4BI2A 4J97A 5CWZA 2WKMA 5EYDA 4FSZA 2ZDTA 4L68A 5TF9A 1WBSA 4FKPA 2Y4PA 4IH8A 4Z7HA 1UKIA 4QTCA 4FC0A 3CR0A 1FBNA 4C4HA 2IW6A 4JQ8A 1A48A 5F1ZA 4AX8A 4RWJA 4HVGA 2YLEA 1XR1A 5BPYA 3G90X 3T8OA 2ZB1A 1FVVA 4R3CA 5AM7A 5ACKA 1NVQA 1W8CA 5I9WA 3WE4A 3A4PA 3QD2B 4D9TA 3LCTA 4BVUA 3OOGA 2DWBA 4GH2A 5IQEA 3LJ0A 2Q0NA 3QQJA 4A9SA 5AP6A 5GZ8A 5I0BA 1FPUA 3WF7A 4KSQA 1XBBA 5AX3A 2CN5A 4AN2A 5HNIX 1R39A 4QMSA 2V7OA 3UE4A 3VQHA 3F7WA 4FSWA 2J0LA 5HG9A 2BTSA 2GNIA 5H8GA 2ZOQA 3WF5A 3CKWA 2X7FA 4I6FA 4OLIA 1YI4A 3CY3A 3FLZA 4B6LA 4MX9A 4PP9A 3SV0A 5BNJA 3QZIA 3IW8A 3G51A 2CSNA 3VBVA 4NZWB 2OG8A 2UUEA 4JG8A 4GMYA 3UZTA 5TR6A 4FVPA 4UWBA 1O9UA 4XOZA 4V01A 3OW4A 4EJ7A 3PWYA 4EWHA 4IWQA 4FTCA 4RC3A 4YMJA 3DAKA 4RG0A 3F6XA 4V0GB 3R8MA 4DTKA 4BCQA 1OIYA 3KMMA 4PDYA 5IH5A 1LEWA 4MF0A 2YM8A 3T3UA 4FEUA 4BZDA 4BDDA 4JBPA 3UBDA 4RPVA 4KD1A 3FI3A 1K9AA 3FY2A 3LXPA 2W1IA 4TWCA 3FWQA 3GB2A 1URWA 5ETIA 3LCOA 1X8BA 3COHA 4L44A 3MFRA 3JY9A 3SXRA 2YN8A 3FMLA 5L4QA 4ZMEA 4YZMA 3GCVA 4TZRA 1FMOE 2ONLA 2XK9A 4L3LA 4X6QC 4XRLA 2QONA 4RVMA 4E6QA 2BFXA 1KWPA 1VYWA 1YXTA 1KV1A 3MSSA 2W99B 4RIYA 3HEGA 5D7VA 3ANQA 4FKLA 3REPA 2A0CX 4U3YA 4Q9SA 3A99A 4FKOA 1V0OA 2C6DA 3EHAA 4O0XA 3TTJA 5A4LA 3OWKA 4JQEA 4CLJA 5CY3A 4WG3A 2ZV2A 2UZEA 4L67A 4KNBA 3VAPA 3TZMA 4RJ4A 3BELA 4ZJJA 3F61A 2VTNA 2XYUA 2XCKA 4OBOA 3C0HA 4PNIA 4K33A 3PSCA 3PXQA 4O0VA 2BDFA 2WMVA 2YDIA 4BCGA 2F2CB 1PKDA 3NUYA 4H1JA 4IHPA 3R7UA 2YCRA 3HRFA 3RAHA 1FVTA 2ZV8A 5IUHA 3KK8A 4GUBA 2XNGA 3IOKA 1OPLA 5EOBA 4DH5A 2I40A 2YJRA 4CV9A 4BGQA 5I9YA 3C4WA 4J98A 2X81A 3FC1X 3QUPA 2WNTA 2IO6A 3LCSA 3L8SA 3DKCA 3UC4A 2OWBA 3H9OA 3WIKA 2E9VA 5JQ8A 4AACA 1YRPA 4LGGA 2LGCA 1OIQA 2JD5A 4HYHA 1O6KA 4XG4A 3W55A 5CXZA 3LM0A 2YITA 3N4TA 3OY3A 4O27B 3QQUA 5EI6A 4A9UA 4EH3A 1OECA 4UEUA 2CLXA 3RCDA 4UYNA 4MVFA 4C7TA 3MW1A 4E73A 3DY7A 3FMMA 3LXNA 2VO6A 3HV5A 4O96A 4AZWA 4D4VA 4IZ5A 1CKJA 2CGVA 5CAPA 5L6PA 4HGLA 5C8NA 2QLQA 4L42A 2IZSA 3IOPA 3RCJA 2PE1A 3ZC6A 3LVPA 2XKFA 2XYNA 3IGOA 4IWOA 3R1YA 4MNFA 3S95A 3MI9A 3ZO2A 3KXMA 1DS5A 5HCZA 1IAJA 2H34A 2QLUA 3Q5IA 2X39A 5KO1A 4ACHA 4Y83A 2VGOA 4FNYA 3QCYA 2ETKA 3VNTA 4BCJA 5H8BA 4DGGA 5A9UA 5FEEA 3KXXA 3VC4A 1PXJA 2XIKA 1ZOHA 3DDQA 2C6OA 2W1DA 2WEVA 4O6LA 5KBQA 2P55A 4ASEA 1PJKA 4D55A 3U6IA 1U54A 3QGWA 2YIXA 2E9NA 4IFGA 4M8TA 4TYJA 5CAOA 2QCSA 1XO2B 5A4QA 4FR4A 4NYEA 3NCGA 3DAEA 4FTTA 5M4CA 3CQWA 4FKTA 4D4SA 1KOBA 3L8PA 4MWIA 4I5PA 5M53A 2YIRA 4O22A 3WILA 3CKXA 3CJFA 3SXSA 4R77A 4IMYA 3EYGA 3OXTA 2I0EA 1H0VA 4YNEA 1H1WA 3G2FA 3E8CA 3QQGA 4IDTA 4FZDB 4WNPA 3WBLA 2QKRA 2WB8A 2EVAA 5K9IA 3D4QA 4HVIA 4XV2A 1Y6AA 4ACMA 4WNMA 4OW8A 3RPSA 2F2UA 4G31A 5DT4A 4CMOA 3Q2JA 4YO6A 2OJ9A 2ZMCA 4AT3A 4AW2A 1CKIA 1W82A 2FB8A 2YM6A 4E5WA 4EZ7A 1U5QA 2QI8A 4BR3A 2JFLA 4U5JA 1PXMA 5ANEA 4PY1A 3GQIA 3LQ5A 2C6IA 5IDPA 1WBPA 3VUKA 3VQUA 2XRWA 4ZSEA 2XIZA 3ZLYA 2HZIA 4DITA 4MK0A 4HW7A 4FT3A 4I4EA 2HY0A 4W9WA 5CEOA 2H9VA 5AA9A 1BKXA 1RQQA 3QC9A 4MTAA 4I6BA 4UWCA 4I0TA 5GIOE 4C33A 4EUUA 3ID6C 3LOKA 3CE3A 2YACA 2XBJA 3HDMA 1Q3WA 5ANKA 4F9YA 4ANMA 4F7SA 1OZ1A 3ERKA 4TKSA 4AOIA 5A6OA 4DH8A 3M42A 5HCXA 4LV5A 2F7XE 3VS5A 4WBBB 4WBOA 3VRZA 4J8NA 2HZ0A 3UOHA 3BBWA 4EH7A 3PJCA 5LCKA 3GCQA 1SYKA 4U79A 1JSTA 4V0GA 3W2CA 2GTMA 2H6DA 2HOGA 3LE6A 4QYYA 2UZLA 4MH7A 5E8SA 3DK7A 3PFQA 5JGAA 2XK8A 4BTMA 2X1NA 3E5AA 1E1VA 3MH2A 1NVRA 4ZJIA 5BVNA 3QCQA 1KE6A 2XM8A 3E3PA 4IC8A 4QPMA 3ULIA 4BDIA 1PXOA 2JIVA 3MB7A 2NP8A 3OBGA 4PQNA 3V5LA 3PG3A 4DEDA 5M4FA 3A7IA 2PE2A 4FKQA 4S32A 3GCUA 3AC4A 3MN3A 3ZRLA 4QMUA 2XEZA 4DYMA 3OEZA 3U9NA 5IA2A 3UNKA 2C5OA 2VX0A 4LRJA 4ERKA 1STCE 3KL8A 4JG6A 2GNHA 3ZEPA 4RX5A 4YZNA 3GI3A 1ZZLA 3JY0A 4GV1A 4IVAA 4QYGA 3MESA 5CEKA 3V3VA 4M69B 4IAFA 2QOCA 4FL1A 2XVDA 5BQ0A 3COMA 5CAQA 3NNWA 2JKOA 2XEYA 2OGVA 3FLYA 1ZYDA 3QKMA 4GJ2A 4X2JA 2WMSA 4DLIA 2RFNA 3PPKA 4X0MA 3ZSGA 2OF4A 5AR3A 4PDOA 3ZFYA 3LW0A 4L01A 2C3KA 2PL0A 3G5DA 4XMOA 3HUBA 3HX4A 2CCIA 4ITJA 5FDPA 3P7BA 3D94A 4R7HA 4RX9A 4RWIA 4CRSA 4FBXA 4DFUA 1H26A 1G5SA 1GJOA 3P23A 3QL8A 2BZHB 1MQBA 2EB3A 4C2WA 3NEWA 1YDRE 2WHBA 3A7FA 1Q97A 2PVFA 2VWYA 3BLHA 2XS0A 4MBIA 3BEAA 3HA6A 5IISA 4P7EA 2FSLX 3QUEA 2GU8A 2G1TA 2VWIA 2C4GA 3A62A 4JG7A 5AM6A 3TKIA 3LCKA 2YM3A 4XG8A 2BZKB 5E92A 2Y9QA 1FINA 3P08A 4NCTC 3RBWA 3ULZA 4NM7A 3EN4A 3CP9A 4KABA 3W2OA 3LFSA 4YURA 3A8WA 3UC3A 2CNVA 5C8KA 3U4UA 4YLKA 4DFYA 2QOQA 4USDA 4RX7A 3O51A 2CGXA 3P4KA 1M17A 3PTGA 2XNOA 4MNEA 5HBEA 4EKKA 3SAYA 3FSKA 4CKJA 3HYHA 4EYMA 3BHVA 4C59A 2OXXA 5ETCA 5E1SA 5IQCA 2XJ1A 3VUIA 3MJ1A 1SVEA 5M56A 4PMPA 5IG1A 3GU6A 4Q5EA 4C2VA 4F1OA 2C6LA 2IVUA 2FGIA 3VS7A 1GY3A 3C5IA 4M0YA 4CKRA 3Q4UA 5EG3A 5F20A 2V22A 3CIKA 4E6DA 4JIAA 4ZLYA 3QF9A 4EOLA 3LQ3A 5E8WA 3QLFA 5DT3A 4AF3A 5HNBA 2EXCX 3VW6A 2O65A 3AGMA 4FTNA 4ASZA 3QUDA 3VF8A 1YW2A 3Q9YA 4CT1A 3QQFA 1Q8YA 3DJ6A 5EQPA 4Y8DA 3AT3A 4X2KA 1U5RA 2UZBA 4EWQA 3OCGA 3LM5A 3Q6WA 4XG7A 1Q8ZA 1YVJA 2UW9A 2GDOA 2WMWA 3OUKA 5AUTA 5KHXA 2VWBA 5DPVA 5HORA 3PY1A 4FV4A 4GIHA 2Z2WA 2ESMA 4ZLZA 2YWPA 3P1AA 3UO4A 2GPHA 4GT3A 4E26A 3FZPA 2NRYA 5DR9A 3MTFA 5A3XA 3R8VA 3C1XA 1ATPE 2PZYA 2V5QA 2HW6A 2XNBA 3HLLA 4BTKA 4GG7A 4L9IA 3DQWA 3F2AA 3QA8A 3CXWA 3F5UA 3F7ZA 4OUCA 3D2IA 4G1WA 3LFEA 3LLAA 3DU8A 3NIZA 4GU9A 5E8VA 1GOLA 3O23A 1TQIA 3NCZA 4XBUA 3CSVA 3MVJA 2BCJA 5A46A 2BRGA 4XS2A 4PNKA 4S2ZA 1JSUA 1TQPA 3DA6A 4LI5A 2QVSE 3C13A 4QYHA 4XLIA 3R1NA 4ANNA 4F6SA 5I9VA 3R7IA 5I4NA 4R7IA 1YWRA 4IIRA 5CASA 1JBPE 1J3HA 1J7IA 2C6KA 4DH3A 3MBLA 3QALE 4AFJA 2PVNA 3FV8A 3DT1A 5DR6A 3ZO3A 4NWMA 2W4KA 3PXYA 1H07A 2BHHA 4UYAA 2OJJA 1I44A 1MRVA 1OVEA 3JYAA 4GK2A 3DXPA 4PPCA 3IDCA 2O5KA 3A8XA 1NXKA 4NW6A 3SOCA 5GNKA 1REJA 5LWMA 4WG4A 3KN6A 1P2AA 3GC9A 3HP2A 2O3PA 4ZSLA 3QTRA 3G0FA 3UNJA 3HV7A 3ORLA 5ANJA 3HAVA 2HELA 4CVAA 2OZAA 2JFMA 4USFA 1Z9XA 5HGIA 4EHVA 4F1TA 2FA2A 4L45A 4FNWA 4HVSA 4ANOA 5J9ZA 2XF0A 1ZY5A 4P5QA 5J1VA 1W83A 4CTCA 1UKHA 4PL5A 2GNGA 1IRKA 2BILB 5HCYA 3NYVA 2PZ5A 3II5A 1DAWA 5ETAA 5CT7A 2F7EE 2WTKC 1G8AA 5FTGA 3D2KA 5BYYA 2WMTA 4BCIA 2WMUA 1YKRA 2EXEA 3FMEA 4GYIA 1OL6A 2Y6MA 3FXZA 3ZYAA 3DPKA 5KBRA 2I0HA 2X7GA 4NH1A 3F3TA 3GT8A 3ZBXA 4QTAA 4GFMA 2QOHA 2XM9A 4NT4A 3TUCA 2WU7A 4IB0A 1FVRA 1LEZA 4OR5A 3I60A 1CSNA 2HCKA 3Q60A 4EHZA 4X3FC 5DA3A 3HAMA 1ZLTA 3KXNA 3LHJA 4JR3A 4AZSA 4IAZA 3TNIA 4ZY4A 3OCSA 4EOQA 1BYGA 2CKEA 2REIA 1ZRZA 2C69A 2AYPA 4CD0A 3O7LD 4LOOA 4FKSA 2RG5A 5IDNA 5CNOA 3C4XA 3OUNB 4TT7A 3MDYA 3QYWA 2HAKA 3FSFA 4A4XA 2PUPA 4FEWA 2OIQA 2A1AB 4P90A 3EZRA 1WBVA 4U45A 3SG9A 3KF7A 3L1SA 4F64A 3K5VA 4JXFA 3BYUA 2R5TA 2IN6A 5J87A 5GJDA 2QOFA 4CNHA 5AAEA 4G3GA 3RPRA 1GZKA 3H30A 5CSHA 4GW8A 3VJNA 4DTAA 4RQVA 2CNQA 5E7RA 2GQSA 4V04A 3WZUA 1YOLA 3GU5A 3EB0A 3QXPA 5ANIA 1FGKA 2W9ZB 3OTVA 4FSUA 4BB4A 1M52A 1KE7A 1IG1A 2Y4IB 3TV4A 2YIYA 4IVCA 4WOVA 4F09A 3D5WA 2HZNA 3K5UA 4RLKA 4QTBA 4RZWA 2XNMA 3TV7A 5CEMA 1BI7A 4YLLA 3WIGA 3EFLA 2B0QA 5EI2A 2W1HA 3MY1A 2G2FA 4ORKA 2UVZA 5EW3A 2ZM3A 5ANGA 5TT7A 1Q99A 1XH4A 5C03A 3S1HA 4RLLA 5IQBA 5CEPA 3QX2A 5FWKK 3Q6UA 4FV3A 3EKKA 4M67A 4DT9A 2BIKB 3E92A 4WO5A 5HESA 4QYEA 3EWHA 3PPZA 2C3IB 4K2RA 4E5AX 2J50A 1QPEA 3KN5A 5C27A 1H01A 3ZEWA 4BWPA 2ZM4A 4TWNA 3CTHA 1CTPE 2ONLC 4QQJA 5C9CA 2WEIA 3WOWA 3ZBFA 4HVHA 2W1ZA 4O1OA 1F5QA 3F3UA 3KQ7A 4XX9A 2E9UA 4ZSGA 4BDKA 2HENA 4BIDA 4MXCA 4NJ3A 4AN3A 3B2TA 4XHKB 3QRKA 5DEWA 3Q9WA 4IVBA 3IW4A 4YSJA 5CXHA 5J9YA 3BI6A 1R3CA 2JLDA 3ACKA 5CF6A 2B4SB 2C1BA 2YA9A 3HV4A 3PSDA 5AP0A 3RAKA 4Z16A 2ITVA 4GYGA 5J5SA 3UO6A 2QR7A 4UALA 5IEYA 4YP8A 5IA4A 2VO7A 4BFMA 4FTRA 4QMPA 2WMRA 2PVMA 1WMKA 4WG5A 4AOTA 4QPSA 3NDMA 5L2IA 1RW8A 4F9CA 4WT6A 3IONA 4PL3A 3PDTA 4NKAA 3V04A 3VUTA 4U6RA 3GVUA 3V6SA 1J1CA 3DK3A 4ACGA 5K5NA 4JI9A 3FMKA 2RFEA 2IW9A 1ZY4A 4CEGA 2EU9A 3BWJA 3FJQE 2YJSA 4JAIA 4KRDA 4FTJA 4N6YA 3RZBA 1OM1A 4FKRA 4BN1A 4CTBA 4F9AA 3N51A 3S3IA 2YABA 3GU7A 4A4OA 4OAUC 1JSVA 2W5AA 1OIRA 3PE2A 4HCUA 4APCA 1RJBA 4F4PA 3RWPA 3EL8A 4MF1A 3DKFA 2ITTA 2BKZA 4K0YA 5IA3A 3KCFA 3WE8A 3BE9A 4RIYB 4V05A 5KNJA 5LWNA 3PVBA 2WMXA 4D5HA 4NTTA 3RMFA 2W5BA 3EMGA 1G3NA 4FZAB 5IEVA 4WNKA 3QTZA 4UX9A 4O7TA 5JK3A 1JKSA 2VTRA 1Q8WA 3NVMB 3PE1A 1YHSA 3FZ1A 3PY3A 4IM2A 1WBNA 3QZFA 5KZ0A 2OFUA 4FE2A 5HIEA 5CVHA 3C4EA 3LQ8A 2QODA 3QTUA 2KTYA 4QP7A 1S9IA 2GQGA 3CPBA 4ENYA 1OPJA 1Y91A 2ITXA 4U81A 3NGAA 3C4ZA 4EH2A 4QP1A 3W16A 4DGNA 4WSYA 1MP8A 2XK7A 3VBXA 3K54A 4GK4A 4MD8E 4FT9A 2JDSA 2VX3A 3DOGA 4KIOA 3TTIA 4CFUA 2UW7A 1I09A 2EXMA 3EH9A 2R7IA 3PVGA 3GU4A 4L8MA 3V6RA 5AUUA 3O0GA 4K77A 2VTQA 3NSZA 5FXSA 4BZOA 4H05A 5T6KA 2WPAA 2UW0A 3W1FA 5BYZA 2F7ZE 4I20A 1UU8A 4BDEA 3D7TA 2A27A 5HX6A 4DG3E 5AJQA 4IE9A 4YLJA 5AV3A 4DFXE 3BV3A 4JR7A 5JZNA 3FE3A 4J53A 4D1SA 4FTIA 3UODA 3A61A 4H3BA 5G1XA 1YWNA 1WCCA 4ID7A 4M12A 4FG7A 2BALA 4U44A 4HPTE 3SGCA 3FZRA 3OVVA 2P2HA 1ZYLA 3H0YA 2GNJA 1K3AA 4A9TA 5LMKA 4FYNA 2CNUA 1JQHA 5AWMA 2UVYA 2W4JA 4ALUA 3BWFA 3NZ0A 4FOCA 4BBEA 4DG0E 1ZARA 2PMIA 4I6HA 1G8SA 4FTOA 2FUMA 4XV1A 2OH4A 4YJPA 4EOKA 1NA7A 2CLQA 4FA2A 4WUNA 2XB7A 5FG8A 4TY1A 3TL8A 3V8WA 5HICA 3OXZA 4O0YA 3R2YA 3RI1A 4J8MA 4ZTQA 3DKOA 4BCFA 2C5VA 2VD5A 3U54A 5L8JA 4O7VA 4IAYA 4ZY5A 1U54B 1YDTE 1QPCA 3F3VA 3NYNA 3ZFMA 1DAYA 2OK1A 4JQ7A 2YERA 4DCAA 2JKKA 3IDPA 5HI2A 2X8EA 3EIDA 3ZZWA 1WAKA 5KUPA 2JC6A 3S2PA 4CMUA 4FTMA 4YZDA 4DFZE 3QTSA 4EEVA 1MRUA 4QMTA 5M08A 2ITOA 4NM5A 3V01A 3CQUA 4KB8A 1RDQE 4FV0A 4QMZA 4U8ZA 3COIA 3L9NA 4JBVA 2X2MA 4C57A 3HMMA 1IA8A 4FNXA 4AWIA 2RFDA 4X7QA 3C0GA 4MQ1A 5IUGA 4O7YA 3DCVA 3E7VA 4ZTHA 3HRCA 5IQFA 2B9IA 4CMTA 3TM0A 4QYFA 5IA1A 4QQTA 5EDQA 4FUXA 3VUMA 3E8DA 3ORNA 3QCXA 5CVFA 2VAGA 2XK4A 1JWHA 3RTPA 4F9WA 4O82A 4JBOA 3I6UA 4H58A 4EK4A 4GRBA 5L2QA 3F9NA 3AT2A 1PHKA 4U41A 4OT5A 4XV3A 4FV9A 2J9MA 4FMQA 3RGFA 3QRJA 1S9JA 4O1PA 4X21A 4BDGA 4E4XA 3BYSA 3T9TA 3R0TA 2VN9A 4O6EA 4FKVA 4RIOA 4PPAA 2RIOA 3EQHA 1IR3A 4E20A 3OEFX 4OBPA 5E1EA 4IBMA 3Q4CA 4KA3A 4I1ZA 4RMZA 4BDBA 2GS7A 4RC4A 4F0FA 1JKLA 5TO8A 4G17A 2X8IA 3R9RA 4I93A 4A06A 2VTLA 2UW3A 2OXYA 2Y0AA 1O6LA 3KB7A 4HGEA 3VBWA 3PIZA 4EZ5A 2AC5A 3FQHA 3KVXA 4MYGA 4Z55A 4X2FA 2X0GA 1FMKA 4XJ0A 3PY0A 4MXZA 3R7OA 4ALWA 4F7NA 5JKGA 3GFWA 3LXLA 1PMUA 2JDTA 4JLCA 1JAMA 2I6LA 2R3MA 4PTCA 3OY1A 2UZVA 3Q4TA 2WMAA 4W8DA 5H3QA 2B7AA 4ANBA 3SOAA 3QQKA 2ZDUA 5CQWA 1H4LA 1OMWA 2OF2A 2W1FA 1R0EA 5LVMA 4YJOA 3OBJA 4ZSAA 3EOCA 5HTCA 4X3JA 3D5XA 3OXIA 4CKIA 4F65A 5J9LA 2HW7A 4JDKA 5C8MA 3AC2A 4NFNA 1XQZA 2F57A 4M7IA 3QQLA 4EHEA 3P7CA 1YHWA 3ZM4A 3RP9A 3R30A 5DRDA 2W0JA 4TNDA 3D83A 4ZMFA 3PLAE 2Z7QA 2IVVA 4FF8A 1QCFA 4LYNA 3FUPA 3HL7A 5HQ0A 5IU2A 2YDKA 3KMWA 3LFAA 3R8ZA 5I3RA 3KCKA 4IQ6A 3ZSHA 3ZU7A 4CSVA 4IX5A 2QOKA 3ANRA 3E93A 5AP3A 3IW6A 4NKSA 4O0UA 3KF4A 3TWJA 1MQ4A 4FKGA 3I0OA 2ETMA 4XH6A 5BVWA 5I9ZA 3G6HA 4RX8A 3CGOA 5M07A 2GSFA 3G9LX 2VTMA 2PTKA 1ZMVA 3FMNA 5HLWA 2YCQA 1PXNA 5HKMA 2QOIA 3ZDUA 4HNFA 1YWVA 5FGKA 5HEZA 3IQ7A 2JIIA 1M7NA 4FIHA 4EK5A 1OI9A 4BBFA 4AA4A 3I1AA 3FKNA 4MNEB 4AFEA 1WBTA 2J51A 2R64A 5M51A 4YHTA 5BVKA 3HP5A 3I7CA 4FVQA 3COKA 3E7OA 4G3CA 1OKVA 4RWKA 3OFMA 4UWYA 3PZHA 1UWHA 5T3QA 5DYJA 1Z5MA 4UMQA 5AP1A 3OCTA 3VS1A 4DAWA 5F9EA 4S31A 2P0CA 4NU1A 5DG5A 3KULB 4YC8A 4WKQA 3VBQA 2BROA 2JBPA 4R5YA 3FPQA 4IWPA 4C61A 1OKZA 2ZAZA 3BV2A 2H8HA 3BYMA 1VJYA 4FV5A 4FGBA 4EJNA 4C4FA 4L6QA 3E87A 3QGYA 1WFCA 4IACA 4BCHA 3HVCA 4GU6A 3E63A 4B0GA 3O8PA 3MY0A 2OFVA 4BI0A 4YO4A 4FG9A 3WYYA 5AR5A 2CGUA 2CMWA 3EN9A 4FYOA 4H3QA 3TACA 2Z02A 5K0KA 2C5YA 1YXSA 3AC8A 5JZJA 3Q53A 3NS9A 3CD3A 5FDXA 2GMXA 4ASXA 4HCTA 3WZEA 3R8UA 5HLNA 5KMMA 3BHUA 4LRMA 2VTIA 4IDVA 3FPMA 3C51A 3UMWA 4BBMA 5BYLA 4TYEA 2PK9A 2CKQA 3EQBA 2QKWB 1YQJA 2DQ7X 2YWVA 4UZDA 4O0TA 4TYGA 3JPVA 5J79A 1FOTA 5T68A 4FEQA 2VTHA 4O0RA 3OT3A 4F6WA 1NT2A 3DZQA 4UV0A 4O7SA 2Z7RA 3R9NA 5A4CA 3D7ZA 2VGPA 3NW7A 2J5FA 3KMUA 4CV8A 1IEPA 1REKA 1W0XC 3OOMA 4NM3A 4PV0A 2H96A 3ENMA 3HMOA 3IECA 1PXPA 2WMQA 4JVGA 3HRBA 3AQVA 5AUXA 1E1XA 3CY2A 3HKOA 2J7TA 4RT7A 3V51A 3KREA 4K6ZA 3C9WA 5HU3A 3BLQA 3DFAA 4U43A 3SKCA 2FSTX 4GSBA 5HX8A 3R7EA 1Y8YA 2GHGA 4GL9A 4E6AA 2BFYA 3DBFA 2GCDA 4PWNA 2RKUA 3FMHA 3BBTB 4NW5A 3UTOA 3FMDA 3TEIA 4C36A 1XH7A 5JEBA 3C50A 2RFSA 3QU0A 3S4QA 4EH6A 3NNUA 4MXAA 2X9EA 2PULA 2VNYA 4ZTRA 1WZYA 5HVKA 1YXUA 2CN8A 5HVJA 3T9IA 5DI1A 3ZFXA 4D2TA 2Z7LA 4RBLA 3L9LA 3AD5A 3RALA 2OBJA 4ZS0A 2OZAB 4PP7A 3SRVB 3ET7A 1OKYA 4RA4A 1J91A 4U7ZA 4B99A 3PXFA 4B8LA 4J99A 4TYIA 4YBKA 4NEUA 4U80A 3IKAA 3RVGA 4I0RA 1UU7A 3NW5A 3NUXA 3W8LA 1XBCA 2PZPA 3LZBA 1P4FA 3QC4A 5CX9A 1SMHA 4DN5A 3F69A 4FX3A 1MRYA 3KKVA 4OGRA 5EYKA 4E1ZA 3P78A 1V0BA 4ZLOA 2Y6OA 2XKEA 4EUTA 4ZS4A 3MS9A 3UIBA 2OI4X 1OL2A 2W1CA 4FSMA 4G34A 4EOPA 2DUVA 1UWJA 3EQPA 4FVRA 2ITQA 3OTUA 3PIXA 1PMVA 4S33A 5HO7A 4LFIA 3MH3A 3PXKA 3NYOA 3NVKI 4ZTNA 4HCVA 3S00A 1FGIA 3ENHA 2WTVA 3GXLA 4IX6A 3DGKA 2OJIA 2X6DA 4Z9LA 2W1EA 3M2WA 2BRNA 5BUEA 3SDJA 1UA2A 3DTWA 4YU2A 4I0SA 5LARA 4LOQA 4ITHA 2J4ZA 1PYEA 3HMIA 4YJRA 2XKCA 3O8TA 3MFSA 2PMOX 5E90A 4EI4A 3Q5ZA 5DIAA 4C34A 3SX9A 5M57A 4NUSA 4QMQA 4ZEGA 3TN8A 3QWKA 3DKGA 1U59A 3PUPA 4EYJA 4YTCA 5I9XA 5C1QB 3H10A 4QQ5A 5EM6A 4AW1A 2PVHA 5HE2A 4FODA 2FVDA 4UMPA 3VIDA 1B39A 4D5KA 4N6ZA 4QD6A 2J0JA 1OL7A 1SNUA 2ERKA 4LMUA 1YOMA 4YJTA 4ZXTA 1JKKA 4BF2A 5FXQA 3DAJA 3W2PA 3BGPA 5CYIA 5TKDA 2QG5A 2B9JA 3V8TA 4BDCA 2VO3A 4A4LA 2WD1A 4E5BA 4KAOA 4PTGA 3UPZA 2G2HA 3OWJA 3ZTXA 4TW9A 3IS5A 3DZOA 4Y5HA 3KULA 2KULA 2WTIA 4DEHA 3EN7A 3DV3A 4QO9A 1ZOGA 4AXAA 5AP2A 4Z3VA 3NIEA 2GS6A 4W9XA 4EC9A 2CKOA 5LXMA 4O86A 3BZ3A 3TJCA 1WBOA 2UZWE 4LUEA 2BVAA 2VNWA 2WAJA 3PP0A 1PMNA 2W1GA 3FDNA 2R3GA 3TIYA 4AG8A 4MWHA 4M0ZA 2YEXA 4TWOA 4G3EA 4AT4A 3Q3BA 4JS8A 3W8QA 3L8VA 4GVAA 4QMNA 4O7WA 4X6RA 4DFBA 2B54A 3IGGA 3V5TA 3VS4A 3TDWA 4OAVB 1PW2A 2B53A 3RINA 1B6CB 3LCDA 3Q4ZA 3ATTA 4BWXA 5M09A 3QCSA 1L3RE 4Y72A 3SG8A 3AG9A 1B38A 5JSMA 4AA0A 3RHKA 4O7NA 2RGPA 4RJ8A 4QMLA 2JAMA 5GIPE 4XUFA 4FSQA 4PPBA 4D1ZA 2RF9A 1W98A 5HG7A 2QO9A 3EQGA 1SVHA 3NPCA 4AZTA 4FV7A 4JIKA 4RFYA 1P4OA 2J5EA 4C4JA 2OIBA 5D12A 3DQXA 3ZO4A 4O81A 3GC0A 4IAKA 3PSBA 3R7VA 2EUFB 3R8LA 2WQBA 2WQEA 2R3RA 4FZ6A 5AV0A 5IMXA 3E88A 2OZOA 5LJJA 3BU3A 1PYXA 3DNDA 3EQDA 2YAKA 4I5MA 1P5EA 1ZZ2A 5FLFA 1XJDA 3KGAA 4FUYA 4EQCA 4KIKA 4F9BA 2HZ4A 5AR8A 5AUWA 1UVRA 4XBRA 4HYSA 5EM7A 5IA5A 4CFVA 3GGFA 2WIPA 3C4CA 3IDBA 2QQ7A 5H2UA
chains in the Genus database with same CATH superfamily
1ZOEA 2BKKA 1UNHA 4I24A 5C26A 5L2SA 3VJOA 4Z7GA 2VWXA 3G9NA 3RAIA 2PHKA 3BHYA 3RK5A 5F95A 3MY5A 2VTJA 4UXQA 3MFUA 1KV2A 4UB7A 1K2PA 2B52A 3AMYA 5KKRB 4BCOA 3QX4A 3AT4A 4J7BA 4ZY6A 4BGHA 4BCPA 4O83A 2JEDA 1M2QA 5TE0A 4U42A 2I1MA 3SRVA 1ZWSA 5HZNA 2NNWB 3UVRA 3PRIA 3POZA 4IAAA 1F0QA 3ZZEA 3N9XA 4YJNA 3OS3A 4YNOA 3I0QA 4YHFA 3R83A 4EHGA 5LMKC 3UZRA 4JNWA 2BAQA 3ZXZA 4CZTA 4UMRA 3EFWA 4GJ3A 4W4WA 3O71A 2VZ6A 3GC7A 2EWAA 2PUUA 3GNIB 3TNWA 3UYSA 4D4RA 1ND4A 3GP0A 3H3CA 4D1XA 5AR7A 3T3VA 3QD4A 3GENA 3NUUA 3QRUA 3TJDA 1AGWA 3AC1A 5JRSA 3B8RA 5LCJA 4FGRA 4Y5QA 5AFVA 4GIIA 4QNYA 4HNIA 3V5QA 3VN9A 1OB3A 4U9AA 4CLIA 3U9CA 1CDKA 2Y4IC 2O8YA 2C6MA 4ACCA 2A2AA 2OJGA 3BHHA 4FIEA 5BVFA 3I5ZA 1ST0A 4R7BA 3RNYA 1F3MC 1H25A 3HECA 3UDTA 1PRYA 1Q61A 4EBWA 3D7TB 4RJ7A 4HZRA 2QG7A 4AU8A 3BLAA 2XMYA 5HD4A 3A60A 1XHAA 5CT0A 4S34A 5B2MA 5KMOA 4QMMA 3MYGA 5KMNA 5HO6A 5DBXA 3Q2MA 2FSMX 4AGDA 3FXXA 3ZM9A 4O0SA 4FG8A 2QOBA 2O63A 3MTLA 3LPBA 3LKMA 2PPQA 1W7HA 5J95A 4EL9A 3C5UA 2IVSA 3F2NA 3R21A 4G9RA 4KRCA 4J95A 4LGHA 2AC3A 4B7TA 4DG2E 4C0TA 4DF3A 5IPJA 1M14A 5JH6A 3OD6X 3QTXA 4RFMA 2PVLA 3G0EA 2ZJWA 5CALA 3KIOC 4FNZA 2B55A 2GNLA 2ACXA 5D11A 5EQEA 2XIXA 3KA0A 4RZVA 3R04A 4IB5A 3WI6A 5KMKA 3FLSA 5AMNA 3D0EA 3AOXA 4WNOA 1R1WA 4KIQA 5LMAA 4LDTA 1H24A 2QHMA 4L3JA 4EKLA 1TZDA 1PY5A 3W0NA 4ONAA 4XG9A 1VZOA 2C5XA 3MVMA 3GUBA 1J1BA 4YC3A 2VX1A 3CGFA 5BMMA 3VS6A 4U0IA 3V8SA 3W10A 3W32A 1ZYCA 3VS2A 4LMNA 3BL9A 4EBVA 3DJ5A 5AR4A 4IFCA 4D28A 4QRCA 3VUGA 3DS6A 4G6NA 4QMWA 4DHFA 1VYZA 1Y8GA 4QMOA 1BX6A 3FMJA 4M13A 3QZGA 5KHWA 3MIAA 3QBNA 2A19B 2JAVA 5C01A 5CI7A 4NTSA 2VTAA 4LG4A 3RNIA 4AW0A 2IWIA 5GJFA 3G15A 4AGCA 1IA9A 3U4WA 3RK9A 3DK6A 4FK3A 5DH3A 1Q8UA 4C62A 2YCSA 4W4VA 3P7AA 5A54A 1YOJA 4L7SA 1YI6A 4EK8A 4FT5A 3BL7A 4E7WA 3FQEA 4F08A 5AP7A 5DR2A 4FSTA 4BKZA 3SQQA 5JRQA 2J0KA 1UNGA 2B9HA 2IF8A 3FI2A 3VWAA 2R3IA 4ZTMA 5CZIA 3CCNA 4TPTA 4MHAA 3DBEA 2PUNA 3ZLSA 1CM8A 2VWUA 4RA5A 1YXXA 2R7BA 2OH0E 4UMUA 2I7QA 3BLRA 4F70A 1Q5KA 5HNGA 5L6WL 2UZTA 3SW4A 4I23A 2O2UA 2J0MB 2UW8A 5AP4A 3F5XA 2PWLA 3LFDA 4QMYA 3DBCA 1BI8A 4CQGA 5AIKA 4HJOA 4UMTA 4NCTA 4AP7A 4KS7A 3TV6A 2RL5A 2BMCA 4D2SA 5JGBA 2CPKE 4ZAUA 2E2BA 5B0XA 4AOJA 1SVGA 2VRXA 4FL3A 5CU2A 4BDJA 3AD6A 2ZV7A 3PLSA 5E8YA 2NYAA 4H1MA 4D0XA 4NK9A 4G3DA 5H9BA 5I3OA 5BX0A 2C1AA 4C38A 4PL4A 5AA8A 4XRJA 2WTDA 3R9HA 2ETRA 3OW3A 3L9PA 4OT6A 3RPOA 4LUDA 1SM2A 5D9HA 4KS8A 4CYIA 4BY9E 1TKIA 2W5HA 2ZYBA 1OITA 3NUPA 4O2ZA 3KVWA 2UW4A 4IXPA 4J52A 3OF0A 4A7CA 4DINA 2X4ZA 4AN9A 5HTIA 3S0OA 3NW6A 3VHEA 3A2CA 2YLFA 2C0OA 2WQOA 3AMAA 3UOKA 2AQXA 4JOAA 3A7HA 4W4YA 3DB8A 3GEQA 4LV8A 3KXZA 3PP1A 2PMNX 5FBNC 4KKGA 1V0PA 4WRGA 3DXNA 4QP3A 1QPJA 1BL7A 3QTWA 3W33A 4CFFA 2W06A 3LFFA 4HGSA 3ZXTA 5KCVA 3QXOA 2BTRA 2QU5A 4C4IA 4EOIA 5CU0A 5J7BA 5E9EA 2FSOX 5HBHA 4QNAA 4ZP5A 3MIYA 4AQKA 3QRIA 1ERKA 2XIRA 3VF9A 4R5SA 4F0GA 1XKKA 3FI4A 5FTOA 2IPXA 3UQGA 5AADA 5AEPA 5E4HA 2XRUA 1M2RA 3HDNA 2PVYA 4A07A 1Q24A 3SVVA 5LQFA 2CGWA 2IZRA 3ACJA 3SLSA 3R28A 3KXGA 3M11A 4J1RA 5FXRA 4TYHB 3LFCA 5DRBA 3TZ7A 5D1JA 4Y85A 3FL5A 2YHVA 4L52A 4LM5A 3BQCA 4YUQA 2QNJA 2R3QA 5IEXA 1OBGA 5C4KA 1GZ8A 4U97A 4D2PA 4BL1A 5EYMA 2YISA 2HYYA 4FKJA 2X2LA 1QPDA 1Q41A 3GOKA 3MH0A 1M7QA 3FZSA 3LLTA 2XK6A 3BGZA 2XJ0A 5FBOA 2X4FA 4BIEA 3JS2A 4DGOA 5ICPA 5HLPA 4GK3A 4ZJVA 3DXQA 4BIBA 3BYOA 3FEGA 3NAXA 3ZSIA 2PE0A 4GG5A 4M97A 1OL5A 1ZMUA 3QAME 4R8QA 4O7LA 2VTTA 3D15A 4UBAA 5DEYA 2IW8A 2BHEA 3GQLA 3ZDIA 5KE0A 5JFSA 4ZK5A 2ITZA 4H36A 1TQMA 2XCHA 1P14A 3UYTA 3TZ8A 4JDJA 3ZC5A 3DTCA 2ITWA 3IPHA 3PIYA 3HUCA 3R71A 4XCUA 2XNEA 2ZVAA 4DH7A 3EKNA 3UIXA 4M66A 2XALA 3KC3A 2WU6A 4QEBA 5HBJA 4WHZA 3O2MA 3RAWA 4AXEA 1LR4A 2OW3A 3KRWA 3PPJA 1QL6A 2VTOA 4YHJA 4DBNA 2C3LA 3EQCA 5DWRA 5FP5A 3VBYA 5EHLA 5EM8A 2YM5A 5B2KA 5IQAA 3BYVA 3EL7A 5CF8A 2ZMDA 4Y73A 5EM5A 2VWWA 5BVOA 2PY3A 2IJMA 3ELJA 4RVLA 2EB2A 2VV9A 4QPAA 5LVOA 4JX7A 4RVKA 4FSNA 3U51A 4IEBA 4CZUA 4R1VA 4X3FA 4EQMA 5GZAA 5AUYA 3C0IA 3EJ1A 2VWZA 4BC6A 3R22A 5L8KA 1J7LA 4M84A 2R3FA 2R3PA 3AGLA 1A9UA 2B9FA 3NUAA 4GCJA 5CU6A 4RVTA 1DM2A 5CF5A 3U87A 1GZOA 4LQMA 3ZUVA 4F1MA 2OU7A 4GKIA 3PA3A 5FEDA 2QD9A 5L3AA 5ANDA 1WVWA 2IEWA 2ZV9A 2UZUE 1JPAA 1LPUA 5HIDA 4DCEA 4EZ3A 3RM6A 4UN0C 4MAOA 1WVYA 4O0WA 1YHVA 3PYYA 3OP5A 4I5CA 3R00A 2YM4A 4B8MA 5IKWA 5L6OA 3N4VA 4JDIA 4I94A 4FIJA 4TN6A 3AKLA 5B2LA 4K11A 5EKNA 4MKCA 4C4GA 5L8LA 5L2TA 2P4IA 4XEYA 1GIIA 3K2LA 4O4FA 4Q2AA 5EI8A 2LAVA 4DFLA 3BKBA 4QOXA 4ZZNA 1L8TA 4QP6A 4E3CA 2GFSA 5AUVA 2HK5A 1NW1A 4MBLA 3R7YA 1PXIA 4IAIA 3RKBA 4G5PA 2XZSA 4I41A 3QHWA 1BMKA 3ODZX 3R01A 4IVDA 4M3QA 3VS0A 4ACDA 4EH8A 3I79A 2CKPA 3VO3A 5HVYA 4CG9A 5EYCA 4LGDA 2J6MA 3UJGA 5TOZA 2BZIB 2YFXA 5FP6A 3UNZA 2QU6A 3K3JA 2E9PA 4WD5A 4S30A 5CI6A 3CS9A 3RWQA 3PG1A 3P0MA 4OTPA 4TNBA 3RPYA 1H1QA 3KRRA 4YPSA 2VTPA 4PTEA 4J71A 4TWPA 4IADA 3VUHA 2BPMA 3THBA 5L2WA 3NWWA 3P5KA 2BR1A 3B8QA 4FV8A 3LMIA 2UZOA 3F3WA 4FICA 5HHWA 5BVEA 3G6GA 3PJ8A 3TKUA 3UG2A 2BAJA 2C30A 4C58A 5IH6A 4MXOA 3ALNA 4JAJA 4FKIA 4FTUA 4IWDA 3TUBA 4DDIA 4CQEA 3Q04A 3EQFA 3ITZA 3VVHA 3WF6A 5E8ZA 2OIDA 4O21A 3ZUUA 4L7FA 4D4YA 4EOOA 4MXXA 3JR1A 1LUFA 4ZTSA 5E91A 3KRLA 4D58A 4C3PA 2XH5A 4FTQA 5K4JA 4FZFB 3MV5A 1H28A 5A4EA 5IQIA 3R2BA 3ORTA 1URCA 3FLNC 2R3NA 2BZJA 3VW8A 4DC2A 1AQ1A 1Q4LA 3QKKA 2FYSA 4CCBA 4DDGA 3GOPA 3FL4A 5ETFA 2VU3A 2PVRA 3I6WA 4RIWB 1PXKA 3W2QA 2IZTA 4F99A 4MCVA 4W8EA 3O8UA 3QKLA 2C5NA 2YCFA 4FL2A 4HZSA 3R8PA 5CAVA 5J1WA 2IG7A 5CEQA 3U8WA 3IW7A 5FD2A 1H00A 5CQUA 1A06A 2X2KA 2A4LA 3GCSA 4MD9E 3IW5A 4TYHA 1GAGA 3UDSA 5K0XA 2YAAA 2XJ2A 3KEXA 5BMSA 5JN2A 1ZMWA 5AP5A 2UV2A 3ATSA 5CLPA 4RIXA 5I9UA 3FQSA 4EQUA 4KINA 3FYJX 4EH9A 5EHOA 3KXHA 5KMLA 1CKPA 3FLWA 2PZRA 3Q96A 4OTWA 3WF9A 4ANQA 1M2PA 5JT2A 1W84A 3EN5A 2ITNA 2BAKA 1KSWA 2NPQA 4NM0A 5IZFA 1KUTA 5IUIA 5EHYA 4DH1A 3ROYA 3NYXA 3SA0A 5DNRA 1OL1A 4GKHA 4E4MA 1GIJA 3SHEA 2GHMA 4II5A 4K9YA 3TIZA 3FHRA 4JX3A 4XOYA 5FQDC 5K3YA 2YZLA 4R78A 4EOMA 4IB3A 4YPDA 5IQGA 4DLJA 4U3ZA 3WF8A 5FTQA 4AQCA 3FAAA 4Y46A 5M55A 2XKDA 4BTFA 3OMVA 3F3ZA 4RRVA 3LJ2A 4PDPA 5GZ9A 4IM3A 4BDAA 3FKLA 4IZYA 3A7JA 4QMVA 4CFNA 4UXLA 4X2NA 3VONA 3BPRA 2W4OA 4ALVA 4IW0A 3IK3A 2JDRA 3MVHA 4XP2A 4BKYA 1UU9A 2UVXA 1Y6BA 2YDJA 4C3RA 5BUJA 4ANLA 3QWJA 3TMOA 3BE2A 3PJ1A 5HO8A 4L3PA 3O17A 1W2DA 5DLSA 3TI1A 3TZ9A 2C6TA 4KIKB 3A4OX 4G6OA 5IQHA 2VWVA 5JGDA 4I6QA 3UP2A 2J0IA 5EW8A 3CJGA 3GBZA 4RGJA 2SRCA 2C3JA 1Q8TA 4NIFB 2C6EA 4D2VA 2HWPA 3JVRA 1ZYSA 2OKRA 5AV1A 2WTJA 2YIQA 3OC1A 5GINE 2DYLA 1PKGA 3LXKA 4E4NA 5FEQA 1O6YA 5CU4A 4Q5HA 1RE8A 5EDPA 1VR2A 1SZMA 2V0DA 2W7XA 4BDHA 4TL0A 2PVJA 5CNNA 4MUQA 4YTFA 4BHNA 1Y57A 3PA4A 4IJPA 3AD4A 3PXRA 2UZNA 2PVKA 4P2KA 4BHZA 5AV4A 3MWUA 5AR2A 3VRYA 4AE9A 5LVLA 5CENA 3BEGA 3EZVA 1H1PA 4OTGA 1KE8A 2WQMA 2WTCA 4C35A 4GFGA 5DMZA 4DEAA 4K18A 4E6CA 4PMMA 4P5ZA 2CDZA 2VUWA 4DBXA 5D10A 4ZTLA 3R1SA 3OT8A 4QT1A 3W0SA 5DN3A 2CJMA 4FK6A 4MBJA 4EK3A 2R3KA 3ZLWA 4CRLA 2HXQA 2B1PA 3CC6A 5HE3A 2P33A 1H27A 3ORPA 3MB6A 3R73A 4PRJA 1Q3DA 3JVSA 1DI8A 3CEKA 5HG5A 4TXCA 3O96A 4XG2A 4JDHA 2XK3A 2R3HA 3OZ6A 4H3PA 3QD3A 1OUKA 1Z57A 3CTJA 3OROA 4CFXA 3GCPA 3LMHA 4F78A 2GTNA 5DGZA 4QMXA 4QTEA 3I81A 5M4IA 3KRXA 4D0WA 4HYUA 3MPAA 1OPKA 3UOLA 2CCHA 4AA5A 4AUAA 1APME 1KE9A 4D2WA 3QTQA 4EH5A 5E8XA 2Q0BA 4DFNA 4RC2A 2GQRA 4A9RA 4JT3A 1JOWB 4IB1A 1UNLA 1GZNA 5EFQA 1IAHA 1BLXA 3HZTA 4C02A 3CPCA 5LVNA 3NAYA 2X6EA 3D5VA 4XG3A 3AC3A 4YJQA 1VEBA 4YJVA 4D2RA 4U40A 5JQ5A 3R9DA 2WFYA 5J8IA 1MUOA 4Y95A 2BRMA 4ZSJA 4QP8A 5KX8A 4BCKA 3NUNA 4P4CA 4GS6A 5H8EA 3ZONA 4CT2A 2VTSA 1EH4A 3TUDA 4RIWA 2W96B 3I7BA 2G2IA 2OO8X 4MEDA 3FY0A 3EYHA 5HU9A 1J7UA 2X7OA 4BWKA 2WELA 3QLGA 3ZH8A 4BTJA 3TNHA 2R9SA 3MPMA 4FI1A 4MXYA 4F7LA 3O50A 4L53A 5DOSA 4BDFA 4PMTA 4FV1A 3TKHA 3UG1A 3GU8A 2YM7A 4D9UA 2WO6A 4E93A 4RWLA 3SW7A 2GFCA 1NVSA 2UW5A 4LL5A 1OIUA 3F5GA 3CTQA 4FTLA 4R3PA 3LFBA 3W18A 3ZUTA 3FZOA 4ZOGA 2YZAA 4DT8A 3F66A 4JRNA 4HVDA 2Y8OA 4FV2A 5DE2A 3AC5A 2ITUA 4L46A 3PWDA 3TNQB 2XNNA 4KKHA 4O7ZA 4FTKA 2Z7SA 3NFGB 3Q9ZA 2PZIA 3BGQA 3MGYA 2IVTA 3BHTA 2Q83A 4ITIA 3TT0A 4C8BA 4HPUE 1PF8A 2FH9A 5HG8A 4FEXA 3LFQA 5AV2A 4BCNA 4MQ2A 4FSYA 3RHXA 3U6JA 2C68A 4RSSA 3TNPC 1H0WA 1H1RA 2C0IA 4OTIA 5HD7A 3ALOA 3OHTA 1KOAA 2OSCA 3H0ZA 1HOWA 2QOOA 3HGKA 3KFAA 4EOSA 3AMBA 5KKRC 2R3OA 3D9VA 3BX5A 4CZYB 1XBAA 5FM2A 2ITYA 4EC8A 5IF1A 3E8NA 4YGAA 5E8UA 4ANSA 4BYJA 2C0TA 3NNXA 4AW5A 1BL6A 4IANA 4BZNA 1SNXA 3R9OA 5HE0A 3UIUA 5JFVA 3F82A 1OUYA 3PRFA 2BDWA 2YIWA 3DBQA 3H9FA 3I4BA 4M15A 2CHLA 2QO7A 3G33A 3AXWA 3ORIA 5D41A 1UV5A 4AGUA 4CYJA 5KMJA 3RZFA 2UW6A 5A6NA 2F9GA 3TCPA 5I5ZA 4DHZA 4GT5A 3GFEA 3HMPA 4RJ6A 1E9HA 4NSTA 2Z8CA 3R6XA 1GIHA 4YC6A 4AXCA 2X9FA 4FV6A 4NIFA 4JJRA 4C4EA 2OICA 2HIWA 2GNFA 4N0SA 4YJUA 3ZMMA 3UZPA 1YDSE 1OGUA 3HMNA 2OJFE 5LOHA 2ERZE 4YJSA 5EOLA 3K3IA 5LVPA 2V55A 3Q9XA 4M14A 3OCBA 4FEVA 1H1SA 3OWPA 5K4IA 3FC2A 2F49A 5AUZA 3FHIA 4YBJA 4IM0A 3DFCB 5AX9A 3LJ1A 4OTFA 5FRIA 5B7VA 5J7HA 2WQNA 1XMMA 1VLRA 4FIIA 3MFTA 4LRKA 4I22A 3HV6A 2Y7JA 1QMZA 3PVWA 3PFYA 4KBAA 3W2SA 3MJ2A 3NR9A 4L00A 5KZIA 3W0MA 3RPVA 3FYKX 5A4TA 5F4NA 2OLCA 5CTPA 2QHNA 3HNGA 5EW9A 5CZHA 5M44A 3ZOSA 2AUHA 4AAAA 1R78A 3ZS5A 4EOJA 3M1SA 4G9CA 1H08A 3L8XA 4DEIA 3LMGA 2HY81 3SC1A 5JFWA 5CSPA 4UZHA 2R0IA 4R6VA 2PUIA 4FJVA 4C3FA 2NRUA 2J90A 4CCUA 1BUHA 4EK6A 2AEGA 2WZJA 4BYIA 3DJ7A 4FKUA 4H39A 3VUDA 4USEA 5JMSA 3PJ2A 3ZO1A 3QHRA 3WARA 3R7GA 4RJ5A 2FO0A 3ZLXA 4ARKA 3C7QA 3LAUA 1NY3A 2WIHA 3JUHA 4G2FA 4UY9A 1AD5A 4XP0A 5CSWA 4QTDA 4YSMA 3FLQA 3POOA 1T46A 4EH4A 2R0UA 4GVJA 3SXFA 5CANA 3PZEA 3RM7A 3E8EA 1GNGA 3BIZA 5JFXA 5AAGA 4G16A 3VULA 3DNEA 3P79A 5D7AA 1OBDA 4JRVA 3DB6A 4M69A 4G5JA 5LMBA 4IX3A 1DI9A 2QC6A 3CQEA 4K1BA 3E3BX 3RJCA 3ZHPC 5HOAA 3BCEA 5EDRA 5BUIA 3HV3A 5G6VA 5AAFA 1TVOA 1ZYJA 2GS2A 4G6LA 3FZTA 4GUEA 3V5WA 3DLSA 4G3FA 4PUZA 2G01A 3A7GA 3H4JA 3MA3A 5DHJA 4LL0A 4QP4A 3EQIA 4B9DA 5HTBA 4W4XA 4FT0A 4YZ9A 3NMUF 2V62A 1V1KA 4I4FA 4RQKA 2WXVA 1JNKA 2J2IB 3HA8A 4DTBA 4ENXA 5BVDA 3R1QA 4OBQA 5DT0A 4DGLC 5GJGA 1HCLA 3EFKA 1U4DA 3UIMA 4FKWA 1W2FA 5A14A 4L43A 4X2GA 2GHLA 5ACBC 2BIYA 4ZIMA 2WOUA 3D14A 1LP4A 3NX8A 2WTKB 4FZ7A 3I5NA 3ORKA 3UQFA 2R2PA 2XUUA 5KMIA 3KRJA 5DFPA 5DVRA 2XP2A 1IASA 2G15A 4RJ3A 5EH0A 4GFOA 4E8AA 3KY2A 4EONA 2JGZA 3B2WA 2JDVA 5E8TA 4OTDA 2RSVA 4OTQA 2WMBA 4QP9A 4FTAA 1ZXEA 2P3GX 5IMEA 4CFMA 4XV9A 2UZDA 2BRHA 3W2RA 4WUAA 2O64A 3QD0A 4KSPA 4X3FB 4RFZA 3VHKA 1WVXA 2R4BA 4F7JA 3F2RA 3FXWA 2BUJA 3PXZA 4JBQA 2XNPA 1PMEA 3BU6A 3PA5A 2G9XA 4FOBA 4BICA 3UVQA 3BU5A 4DEGA 4APPA 3OG7A 5J5TA 2W17A 3R63A 4O91A 3ETAA 3QTIA 2WGJA 2X8DA 1PXLA 4B4LA 3P86A 3UQCA 4BI1A 3UPXA 3QA0A 5CSVA 3WYXA 5CAUA 5IA0A 4NFMA 5IH4A 1XH8A 3VS3A 2HXLA 1XH5A 4QQCA 3UP7A 4AZEA 3DBDA 3MPTA 1T45A 2W9FB 5EK7A 3U6HA 4M68A 3E62A 1XWSA 2JDOA 3CBLA 3SD0A 4BKJA 1FQ1B 5HE1A 3F5PA 3KK9A 4CFWA 2Z60A 4IX4A 3N4UA 4YZBA 5EKOA 4PX6A 4N70A 3CLYA 3V5PA 1WBWA 4WSQA 4J96A 5FUTA 3EQRA 4DE4A 3F88A 3WZKA 3KU2A 4XYFA 3NUSA 3V5JA 3VBTA 2VO0A 4I92A 5CEIA 4KBCA 2W05A 3UGCA 4NL0A 4I3ZA 4O2PA 1U46A 4PMSA 4I5HA 4YTHA 2QURA 3LIJA 2PSQA 2RG6A 4KWPA 2I0YA 5M4UA 2PMLX 3MH1A 2BRBA 4KUJA 2F4JA 3ZRKA 4FT7A 1HCKA 4XG6A 2C47A 4MD7E 1CMKE 4CG8A 3DLZA 3NNVA 5M06A 2ZM1A 3Q52A 4IC7A 2E9OA 4OTRA 4F0IA 4EORA 3ZRMA 4I21A 3QRTA 5CU3A 5K5XA 4DGMA 1R0PA 4F63A 5GHVA 4O38A 4QP2A 4FIFA 4KBKA 4JL9A 4WRSA 2XIYA 2JBOA 4HYIA 5HIBA 2P2IA 4YTIA 5ITAA 3Q32A 3P9JA 4KIPA 4TTHB 2I0VA 4ZZMA 2R3LA 4BRXA 3QQHA 4R3RA 3TXOA 5F94A 1OKWA 4DA5A 5C4LA 3ZCLA 5CF4A 3ROCA 5CVGA 1JKTA 4YZCA 4AZVA 1H8FA 2ZB0A 3C4FA 4O84A 3IO7A 4O7RA 4GT4A 2IZUA 3NLBA 4AS0A 4R1YA 5CS6A 3RK7A 4FSRA 3FKOA 1JVPP 2QO2A 4RIXB 3UDBA 3UO5A 3EN6A 4AZFA 1ZAOA 4ERWA 4N4SA 4N57A 5CSXA 5AIRA 3QZHA 4BCMA 3FI8A 1YI3A 4IZAA 4E4LA 4CGAA 2WTWA 3UOJA 4IJ9A 3MA6A 3D5UA 3IG7A 2JIUA 2JKQA 4GEOA 4BGGA 2PU8A 4WA9A 2BDJA 2JITA 5EQYA 4NJDA 3BRBA 3OWLA 2WOTA 3TG1A 5FM3A 3MVLA 4ASDA 1UU3A 2OXDA 4K8AA 4XLVA 2JKMA 3U55A 4OTHA 2NO3A 4CXAA 3E64A 4AT5A 4HOKA 1XH9A 1YXVA 4AAYA 4FIGA 4PF4A 2QR8A 4TRLA 3R02A 4DEEA 2HWOA 3ORXA 3QFVA 3PVUA 4Q9ZA 2QOLA 1Q62A 3JXWA 4AGWA 3TDVA 3BQRA 5ANOA 3UMXA 3FBVA 3NRMA 3ODYX 4IZ7A 3WZJA 3PJ3A 4XP3A 4C37A 3L9MA 3UVPA 3GC8A 3ORZA 1XH6A 2ITPA 4WIHA 2PYWA 3LFNA 2DS1A 4F6UA 2ZFYA 4XNEA 4LOPA 4KKEA 4A9YA 3CD8A 1JLUE 1KE5A 4ZZOA 3H9RA 4PDSA 3WZDA 3EFJA 3QYZA 2O0UA 5IQDA 4HGTA 3DDPA 4QDEA 2XBAA 2V7AA 3O7LB 4AE6A 2R3JA 2XA4A 3ORMA 4DEBA 4YR8A 4BI2A 4J97A 5CWZA 2WKMA 5EYDA 4FSZA 2ZDTA 4L68A 5TF9A 1WBSA 4FKPA 2Y4PA 4IH8A 4Z7HA 1UKIA 4QTCA 4FC0A 3CR0A 1FBNA 4C4HA 2IW6A 4JQ8A 1A48A 5F1ZA 4AX8A 4RWJA 4HVGA 2YLEA 1XR1A 5BPYA 3G90X 3T8OA 2ZB1A 1FVVA 4R3CA 5AM7A 5ACKA 1NVQA 1W8CA 5I9WA 3WE4A 3A4PA 3QD2B 4D9TA 3LCTA 4BVUA 3OOGA 2DWBA 4GH2A 5IQEA 3LJ0A 2Q0NA 3QQJA 4A9SA 5AP6A 5GZ8A 5I0BA 1FPUA 3WF7A 4KSQA 1XBBA 5AX3A 2CN5A 4AN2A 5HNIX 1R39A 4QMSA 2V7OA 3UE4A 3VQHA 3F7WA 4FSWA 2J0LA 5HG9A 2BTSA 2GNIA 5H8GA 2ZOQA 3WF5A 3CKWA 2X7FA 1TFFA 4I6FA 4OLIA 1YI4A 3CY3A 3FLZA 4B6LA 4MX9A 4PP9A 3SV0A 5BNJA 3QZIA 3IW8A 3G51A 2CSNA 3VBVA 4NZWB 2OG8A 2UUEA 4JG8A 4GMYA 3UZTA 5TR6A 4FVPA 4UWBA 1O9UA 4XOZA 4V01A 3OW4A 4EJ7A 3PWYA 4EWHA 4IWQA 4FTCA 4RC3A 4YMJA 3DAKA 4RG0A 3F6XA 4V0GB 3R8MA 4DTKA 4BCQA 1OIYA 3KMMA 4PDYA 5IH5A 1LEWA 4MF0A 2YM8A 3T3UA 4FEUA 4BZDA 4BDDA 4JBPA 3UBDA 4RPVA 4KD1A 3FI3A 1K9AA 3FY2A 3LXPA 2W1IA 4TWCA 3FWQA 3GB2A 1URWA 5ETIA 3LCOA 1X8BA 3COHA 4L44A 3MFRA 3JY9A 3SXRA 2YN8A 3FMLA 5L4QA 4ZMEA 4YZMA 3GCVA 4TZRA 1FMOE 2ONLA 2XK9A 4L3LA 4X6QC 4XRLA 2QONA 4RVMA 4E6QA 2BFXA 1KWPA 1VYWA 1YXTA 1KV1A 3MSSA 2W99B 4RIYA 3HEGA 5D7VA 3ANQA 4FKLA 3REPA 2A0CX 4U3YA 4Q9SA 3A99A 4FKOA 1V0OA 2C6DA 3EHAA 4O0XA 3TTJA 5A4LA 3OWKA 4JQEA 4CLJA 3AKKA 5CY3A 4WG3A 2ZV2A 2UZEA 4L67A 4KNBA 3VAPA 3TZMA 4RJ4A 3BELA 4ZJJA 3F61A 2VTNA 2XYUA 2XCKA