4D5KA

Focal adhesion kinase catalytic domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
272
structure length
255
Chain Sequence
YEIQRERIELGRCIGEGQFGDVHQGIYMSPENPAMAVAIKTCKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKFSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSATDCVKLGDFKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FOCAL ADHESION KINASE
publication title Allosteric Regulation of Focal Adhesion Kinase by Pip2 and ATP.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase
total genus 86
structure length 255
sequence length 272
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2014-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4d5kA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4d5kA01
2EVAA 4IMYA 4C3FA 4H05A 4XOYA 4UXQA 3FLYA 4LOOA 2R7BA 4EQMA 4TT7A 2QOQA 2W1IA 4K9YA 2QO7A 4G31A 4DTAA 4XG7A 1YXXA 2C5OA 5ACBC 4Z7GA 3BYUA 5DIAA 2PMIA 4JNWA 4QYYA 1OPJA 4BC6A 5CALA 2HWOA 4JOAA 2VX3A 4I0SA 2QI8A 2WO6A 3R7VA 4EWHA 2OF2A 2W7XA 4YHTA 3W32A 3AT2A 4WNPA 5M09A 5E8SA 4WOVA 4NK9A 4RVLA 3ZU7A 3N4VA 4EEVA 4LV8A 4YTCA 5E8ZA 3VBTA 4QQTA 3QD0A 2JEDA 5A6NA 2C3IB 3OXZA 2NP8A 1YWVA 3ZC5A 2XNNA 1Q8YA 1DS5A 3QC9A 4K18A 4JI9A 5BUEA 3QTIA 2R2PA 2WU7A 4NIFA 4RZWA 3GU8A 2XBJA 2QQ7A 2PHKA 4FV8A 2R3MA 3P4KA 5I9WA 3R2BA 1PY5A 4JIAA 2JAVA 5EK7A 1STCE 5HE3A 5KUPA 2CKPA 3NUXA 3R9RA 3VBWA 2Q0BA 4BDFA 2XNOA 2LAVA 3G90X 4J7BA 3R7EA 3UIBA 2IN6A 3JUHA 4NWMA 3GBZA 2RIOA 3ORTA 2ZJWA 3OWKA 3PZEA 4KWPA 1KE5A 4BY9E 4FTIA 4JBVA 4RC2A 4U45A 4XOZA 4KIOA 4OUCA 4BF2A 4MNEB 3CIKA 4F99A 3AC1A 4CFWA 4QP8A 1JBPE 4W9WA 5FWKK 4GIIA 2YCQA 4DT9A 2LGCA 4N0SA 2XK8A 5L2IA 3ETAA 4YLJA 4BYIA 2YA9A 2OXYA 2YM3A 1LP4A 3PIXA 4HVGA 2W99B 4IWOA 4RVTA 4O86A 1KUTA 3EQPA 1RW8A 2ITWA 4IVDA 4WRSA 5L2SA 4G9CA 3AC4A 4QRCA 1LR4A 2OO8X 3UIMA 1YOJA 4BWKA 2RGPA 4WSQA 3O0GA 1UNLA 3LCTA 2EXMA 5CENA 4RA4A 5C4LA 4FSMA 3GNIB 4AX8A 4BDEA 4O7ZA 4DGMA 3H9RA 4L44A 4N6YA 3QWJA 4GFOA 4TWPA 4TYGA 4I24A 3W2QA 3Q9ZA 4DHFA 3FMJA 3GOKA 2XB7A 5AR8A 3TWJA 2Z2WA 4CV9A 3IG7A 3QZGA 3D2KA 4XG2A 4R7HA 1KWPA 2RFEA 3HVCA 4JDKA 3MS9A 5T68A 5B2MA 4L53A 1GZKA 1H25A 3ZZWA 4OGRA 1SVEA 2C30A 2CPKE 4PDSA 4AG8A 2RG5A 3OUKA 3KRLA 4MXXA 5JGDA 3T3VA 4O1OA 1YWRA 4JAIA 4EH8A 3Q5ZA 1L8TA 2VGPA 3WIGA 4O84A 4CSVA 2WTJA 4LM5A 4XRLA 4Y5QA 5CWZA 4DG3E 5CY3A 2AC3A 4E6QA 2ZB1A 5M08A 4YTIA 2CGXA 4AE9A 5HE0A 1ZZ2A 3SC1A 5I9XA 4BCKA 3LQ8A 4Z9LA 1KV2A 3E7VA 4XV3A 3W2SA 3MB7A 1Q61A 3PXYA 4IM2A 2PYWA 5DR2A 1UA2A 5A4EA 4L68A 2UVYA 1GZOA 4BDJA 5IQGA 3IKAA 4TXCA 2VTRA 3I0OA 5C1QB 5AAGA 4L67A 4Y72A 1M52A 5H8GA 2GPHA 3I1AA 5HBHA 2GFCA 2O0UA 5DA3A 4G9RA 4KS8A 4LG4A 4LMNA 3BYSA 1OIYA 4U9AA 4QPMA 2YIWA 3G9NA 4W8EA 2R64A 1ZMUA 3FZTA 4IIRA 4FZFB 1ZWSA 4XEYA 3EQHA 4M84A 2BRHA 3VBQA 3CJFA 5M56A 2HOGA 3O23A 4EOLA 3R9DA 3BYOA 1MQBA 5CI7A 1W83A 3QQKA 2GHMA 2QOBA 4B99A 5IA5A 3QFVA 4IH8A 3EQBA 4R7IA 1WBTA 2E9VA 2QOCA 2UZWE 3NPCA 4MD7E 3W2CA 4A9SA 2GS2A 4ACGA 4F7SA 1ERKA 4YJUA 1MQ4A 2QLUA 4DH8A 1V0PA 4USEA 5T6KA 4E4NA 4LFIA 4C4JA 4EHVA 3NUSA 3BLRA 3FEGA 2QURA 3LJ1A 5B2KA 2XF0A 2JDVA 3LMHA 1YWNA 5AIKA 3R1YA 3DFAA 3PY3A 3BU6A 3R1NA 5AA8A 3DA6A 3D9VA 3TDVA 5A9UA 3P23A 4D9UA 3FL5A 1PMUA 3Q4TA 4QP2A 4YPSA 5HU3A 3NX8A 5JEBA 4O0TA 3OCBA 5AR5A 3QRKA 5F94A 2CJMA 4LRJA 3S95A 3O17A 5HVKA 4FX3A 1PYEA 4L3LA 3WZJA 3LFNA 2CSNA 3KRJA 4JAJA 5J7HA 5AR4A 5B0XA 4HCTA 4BIBA 2B0QA 1OGUA 3C5IA 3HMMA 2XKCA 3BHYA 3IW8A 4ACDA 4NH1A 4QPSA 3FMNA 5IQEA 2BTRA 3TTIA 4AW2A 3UP2A 2X8DA 4IZ7A 2W96B 4YZMA 1H4LA 2GS6A 4RC4A 4U5JA 3RI1A 3FZOA 4JG8A 3EL7A 3TJDA 4FI1A 3MTFA 5IA0A 3HA6A 4QMUA 5HHWA 4F9YA 4OAVB 2OK1A 2VWIA 2BAKA 3CSVA 4ZTNA 1B39A 5HE2A 3UOHA 4KAOA 3ZRKA 4E1ZA 2RF9A 3EQDA 5AAEA 3BYVA 2XIRA 4LMUA 3HP2A 4PQNA 3OD6X 4DH3A 5JQ8A 4F9AA 2VO6A 4H1MA 4AA4A 2C3JA 4JR3A 4UWCA 5IH4A 2A19B 5LCJA 2OBJA 2GTNA 3ANRA 5LMAA 4NTTA 3ZFYA 4BCHA 3PJ8A 2ZVAA 3PRFA 2IO6A 2UW7A 1NT2A 4ERKA 2CN8A 4BCGA 5CF6A 5FLFA 4U42A 1U54A 2WNTA 3AXWA 3II5A 1Q5KA 5KMOA 5DWRA 5GNKA 2E9PA 2G9XA 3GXLA 3S2PA 3VBVA 5AX9A 4GCJA 4C35A 5DR6A 2CCHA 4FV5A 1JPAA 4MD8E 4MTAA 2VTNA 4U44A 2ZMDA 3N4UA 2VTQA 1W98A 3FLWA 4PP7A 2WMXA 5HNIX 4D2PA 3ORPA 3DY7A 2BIYA 2ZYBA 1H1QA 4N57A 1KE7A 4IZYA 4II5A 3HV6A 4FV7A 4F0IA 2PPQA 3HRFA 3SA0A 4KKEA 3TI1A 2C6LA 1J91A 1Z9XA 4X6QC 4UALA 1Q8UA 2E9NA 3MPTA 4ASZA 2BILB 2X6EA 4G34A 3RZFA 5KMMA 2FYSA 1R0PA 5BVKA 4XNEA 2ITVA 5EI2A 5E8UA 4AXAA 4C61A 1V1KA 2Y0AA 3OMVA 3O96A 5A4CA 4FG8A 2XCHA 2WPAA 3DAEA 5CT7A 3FMMA 2WMUA 3G6GA 1JSVA 3QRIA 4X2FA 3FHIA 3S0OA 4ANSA 4D4RA 4L42A 5CXZA 4N6ZA 4FZ6A 4DEAA 5JGAA 2OLCA 1JOWB 2VTTA 2HZIA 2YM8A 4FSWA 5BMMA 1R0EA 5H2UA 5IMXA 3F5GA 3VW6A 1W82A 4O83A 4Y8DA 5AV1A 4LV5A 1WFCA 3D5WA 4WSYA 3Q3BA 5DOSA 4FVQA 4UMRA 4YU2A 4U81A 1HCLA 3HLLA 4EOJA 4KIQA 3ZUVA 2H96A 4HNFA 4CKIA 4KRCA 3RPVA 3A2CA 3N9XA 4F09A 3JVSA 4W9XA 1SZMA 5AP7A 4E93A 3KCKA 2UZLA 1MP8A 4R5SA 2FSOX 1YI4A 5CAPA 3EYHA 4WNMA 3R28A 3LQ5A 4GJ2A 4O2ZA 3GT8A 3BKBA 4CCBA 2G2FA 4GG5A 5BVEA 4EOQA 4NL0A 1P14A 4FV2A 4BWXA 4HGTA 4U41A 1ZYDA 4ASDA 4AP7A 2WMVA 2OGVA 3WIKA 4QD6A 3HAMA 4BTKA 2XS0A 3U54A 3BYMA 3OBGA 4F70A 3MVLA 5IEVA 5E8TA 5TF9A 3CQWA 3VS3A 2WU6A 5BVOA 3HX4A 1NVQA 3Q2MA 1PMEA 1ZMWA 2Y4PA 3CR0A 4B8MA 2WQEA 1P4OA 1CDKA 3RALA 3MJ1A 1F5QA 2R3IA 3HDMA 3K3IA 3P79A 3VS4A 3FI2A 4P4CA 4RJ6A 1J7LA 2WEIA 3TNPC 3FZ1A 4CGAA 2C0TA 2QLQA 3ATTA 3QXPA 4IM3A 2PUIA 2JKQA 3QX2A 3BLHA 3QC4A 4FL1A 2YIYA 3R8LA 4B7TA 5C4KA 3GCPA 3ORMA 4J52A 3QL8A 4ZLZA 4E20A 3MPMA 4S33A 2F9GA 2WD1A 4X3FC 4FKWA 3MH2A 3C1XA 2CHLA 2VN9A 3MSSA 1OL5A 2UW3A 3MDYA 3F3UA 1H1SA 4RJ7A 4IQ6A 3Q9XA 2R3NA 3UOKA 2IW8A 4J53A 4Q2AA 3VBXA 2YM4A 3VJOA 3POOA 3KREA 2UVZA 1LEWA 2HXLA 3HYHA 4L52A 5DT0A 5K4IA 2GNFA 4EKLA 4AOIA 4RA5A 5FEQA 1UKIA 1H28A 1BL7A 4DBXA 1JKSA 5L3AA 1Z5MA 4AOTA 5A46A 3MY0A 1KE9A 1BMKA 3R1QA 2GMXA 2OF4A 5C26A 3UQCA 3DLZA 3OW3A 1WCCA 2J4ZA 5EHYA 4AE6A 3CPBA 4JDIA 4IW0A 4IX6A 3FXXA 5M4FA 3AGMA 1UWJA 2QNJA 3FSFA 3FZRA 3UG2A 5J8IA 3E93A 5FXSA 5KCVA 2OH0E 4M69B 4FNYA 4GYGA 5EW8A 3TZ9A 3OEFX 3I6UA 4L01A 4D4VA 2RFDA 3KXNA 4F1MA 1UKHA 3HP5A 3PG3A 4O7RA 2V62A 3O51A 4CFUA 3UVPA 2ZV7A 3ENMA 3F3VA 4DFBA 2OIBA 3R8VA 3H0ZA 3CE3A 5AUVA 3WZKA 4J95A 2W1ZA 5CEPA 2ITXA 3ZLSA 2WMWA 4GEOA 4UMTA 4O81A 3G0FA 4YJTA 2XUUA 2XK9A 4EYJA 5J9ZA 1CMKE 4RWIA 1YRPA 3S3IA 4C33A 2XKFA 3QAME 4G3EA 4YZCA 5IPJA 3UZTA 4FEXA 2VTSA 5D1JA 2G2IA 5CU2A 5KMIA 4CTBA 3QZIA 1ZXEA 1A06A 3DQWA 3VS0A 3BE9A 3N4TA 3KMMA 3OHTA 2UZOA 4O1PA 3A99A 3SX9A 4NM3A 4TZRA 3BZ3A 2EWAA 2YABA 1ZMVA 4ASXA 3ORNA 2F49A 5AP5A 3SRVB 4TYEA 1YDTE 2XEYA 5J87A 3V8SA 3L9NA 4ZOGA 3L8SA 4FICA 4FKLA 1X8BA 3L9LA 4X3JA 4H3PA 5G6VA 1W7HA 4FTLA 1H0VA 4S32A 3MPAA 5EDQA 5ACKA 3FC2A 2W0JA 3KFAA 4XX9A 3D5UA 4XV1A 3KN5A 4Z3VA 3H0YA 4P7EA 5D9HA 4DC2A 4MD9E 5KMKA 2GSFA 3V5PA 3P08A 4BCMA 3SG9A 3RNYA 5AWMA 1UVRA 4PPBA 1YW2A 3VHKA 1BKXA 4FT0A 2P33A 2WMQA 2X39A 4WKQA 4FR4A 5D10A 2HYYA 1OECA 3QUEA 1Y57A 3CTJA 3VF9A 3BRBA 3ZDIA 1WZYA 4QQJA 4UYAA 4FKPA 3BV3A 4JX3A 4E4LA 5HLPA 3U4WA 2IW6A 4XG4A 1Q4LA 3KRRA 4R8QA 5EDRA 4ZSLA 4IAIA 4F7NA 3P7BA 4ANQA 4D4YA 1XBCA 1DAYA 3EOCA 2YERA 3OT3A 4FTRA 5FP6A 2OZOA 3OWJA 4EZ3A 4G5PA 3TM0A 3U51A 4QP7A 4B9DA 1J7UA 1MRYA 5EYCA 3EL8A 4RX8A 4J8MA 4YJPA 3OXTA 5EM7A 3PVUA 4QPAA 3RM6A 3MTLA 1ZOEA 1RE8A 1M17A 5D7AA 3OTVA 2YCFA 1YOMA 4FEUA 1Q3WA 4FMQA 1LEZA 4IVAA 4I22A 4C34A 3MY5A 2JITA 2WTVA 3QA8A 4FZAB 4TWOA 3EWHA 3IO7A 3V5LA 3ZSHA 4CV8A 2JDTA 2C4GA 5DI1A 4UWYA 5K9IA 3DCVA 4I6QA 2ONLA 4XMOA 4QQCA 3VS7A 2XNPA 3NUPA 2FO0A 3ZDUA 2B1PA 4C0TA 3D83A 2OZAA 2W4OA 3LFCA 2R3HA 5IEXA 1FGKA 3D7TB 5CNNA 5AP0A 4D2SA 4PMPA 5HTBA 3ULIA 4W4YA 2VO0A 4DEGA 4CKRA 3RGFA 3TN8A 3C4XA 5HG8A 2UZVA 2XM9A 3VAPA 4KBKA 4EOMA 3C51A 3V04A 2VTMA 3UIXA 4FZDB 2J0KA 3QLFA 3BU5A 3Q5IA 4NSTA 3RAKA 4DEBA 5IZFA 4XBUA 2V55A 2X7GA 5IKWA 4BDAA 1SYKA 2J9MA 2WKMA 3EIDA 3NUYA 4PMTA 4QMNA 3IGOA 3QD2B 4FSNA 4BN1A 2VTPA 2I0YA 4HJOA 2B7AA 2PULA 1YI3A 2UZNA 1OMWA 3P7AA 3W2RA 4DFNA 4QTEA 3GU6A 2NRYA 3NZ0A 3IQ7A 3MA6A 3CD8A 4FTCA 3RTPA 2UW4A 3BE2A 2Y9QA 4HNIA 3AD5A 3CKWA 3DAJA 4ANOA 4DINA 3IECA 4O0YA 3THBA 3OXIA 4U3YA 4I94A 5J1VA 1QPJA 4EONA 3PUPA 4FIGA 3LW0A 4I1ZA 5FD2A 1W0XC 4XG6A 5GJGA 1JKKA 2OSCA 4KA3A 5KNJA 2DUVA 2IVVA 5H3QA 3FQHA 5HD7A 4AN3A 2R5TA 3QXOA 4O0XA 5LVMA 2C3KA 2YWVA 2CCIA 3RK9A 4GK2A 4KIKA 4FKIA 2JFMA 3VUIA 2UZUE 4I5HA 3G5DA 4M0ZA 2BRBA 5I0BA 4FUXA 4A9UA 2OZAB 5A54A 2PZRA 3Q52A 4BCQA 1JAMA 2W5BA 4ITIA 3O50A 2H8HA 3QUPA 4OTPA 3WE8A 1Q97A 2RFNA 3COKA 5HE1A 5KZIA 3ZXZA 3AMAA 4ZJIA 4MWIA 4A9TA 4FEWA 5FXRA 4GK4A 3ZO3A 2PVYA 4TL0A 3R8ZA 2WTIA 4NW5A 4C59A 3GC0A 3G15A 1OL7A 4WBBB 3R0TA 4EORA 2VNWA 2O63A 5IISA 4GVAA 3ZRMA 5L6PA 2CNVA 5IA1A 4C57A 5L6OA 4JRVA 4F65A 4OTWA 3F88A 2B54A 5C8NA 3LXLA 1ZOHA 3FQEA 3DKCA 4J97A 4IDVA 1SVHA 5AV0A 1NVRA 1U59A 2BAQA 1VEBA 1IASA 4BFMA 3MH0A 4QYGA 1VZOA 1OZ1A 1PXMA 5EQPA 2JIUA 4BKZA 4IZAA 1I44A 5EM8A 5EQYA 4RIOA 3SXRA 2FB8A 1R39A 4IX4A 3E7OA 1Y6AA 3DBQA 4A7CA 5CEMA 3UBDA 4KUJA 5IQBA 5CSWA 3UG1A 2XBAA 2P4IA 3E3BX 2CKEA 1Q62A 2Z7LA 3VJNA 4PWNA 3ZYAA 4IACA 2A2AA 3FAAA 4GUEA 1J3HA 1CKPA 5L8KA 3ZSIA 4MNFA 3A8XA 5FP5A 5J1WA 4ZSEA 4QT1A 4U97A 3BGZA 3KY2A 5IQFA 4GFGA 3ZLXA 2XIZA 3HMIA 2O64A 2ZM3A 4HYIA 3RNIA 1JNKA 3G9LX 4R1YA 4ASEA 2HELA 5HBEA 5KBQA 4RJ4A 3FXZA 3MI9A 3O8TA 3LZBA 3QKLA 4XUFA 4FEQA 4BCNA 4BGHA 3TJCA 4WNOA 2VTAA 3COIA 3JY9A 4H39A 2ZDUA 1DAWA 3FZPA 4I0TA 1H07A 4DTKA 5E8VA 3UMWA 4FT3A 2ITQA 5IF1A 3CD3A 5LVOA 5TKDA 2AUHA 2YWPA 3SG8A 2W1EA 3NR9A 3C50A 4ZTSA 3NGAA 4FKQA 3OCSA 4E4XA 3C4ZA 4HZRA 2FH9A 4O7WA 3DXPA 2C1BA 3C5UA 3F82A 4O7NA 3AT4A 3UVRA 3PA3A 4H3BA 4GL9A 2PUNA 3DK3A 4PPAA 3HRCA 4D5KA 5JK3A 3PY0A 3HV7A 3SXSA 4UXLA 2Z7RA 2XK3A 1KOBA 3IDPA 4K33A 4FC0A 4TYHA 3IK3A 2FSLX 4TWNA 3JVRA 4RT7A 5KZ0A 5HO8A 2XJ0A 3PY1A 2WMRA 4FSRA 5ANJA 5A4QA 2OW3A 2QU5A 3F2AA 4FV0A 4NU1A 3DBEA 3UE4A 4BCFA 5KHWA 3ERKA 2ITZA 3I6WA 3MVHA 4O7LA 3RMFA 4RGJA 4MKCA 3ZFMA 5BPYA 1IAHA 3WOWA 5E9EA 4WBOA 1LUFA 4YTHA 4YP8A 4F6WA 5CF4A 2CDZA 1KE8A 4IAYA 4FNXA 4V0GB 1H08A 4I5CA 4MXCA 5JSMA 4OW8A 4S2ZA 4PMMA 1FQ1B 2RSVA 3RWQA 4MXZA 4RMZA 4KABA 1GZ8A 2YZLA 5KE0A 4RX5A 2BPMA 1PXNA 3E8DA 1JSTA 2Y6MA 2PVNA 3GC7A 3R63A 4BDIA 1YHVA 3ID6C 4YPDA 5ANDA 2BZJA 4L9IA 1Q3DA 2F57A 2VNYA 4KBAA 4E5AX 1OL2A 3A4OX 3RWPA 5BYYA 4DAWA 1UNGA 5LARA 2JKOA 3QTXA 3ZSGA 4IVBA 4KINA 1B6CB 2XKDA 1L3RE 3HA8A 4FSZA 2ITYA 4HPTE 4YGAA 5DRBA 4CFMA 1XR1A 4F6UA 4YTFA 3H9OA 4FKVA 1XH4A 2XJ2A 3OWPA 3W33A 1NA7A 2HWPA 1PMVA 3VHEA 5J5SA 5LQFA 3BI6A 3RPSA 5DEYA 4FODA 3QQUA 1WMKA 3K5UA 2VZ6A 5AUWA 4CZTA 5BX0A 4OT5A 5CU4A 4LI5A 4CEGA 3R04A 5GZ9A 5AR7A 4I4EA 2PUUA 3EFWA 3GU5A 1GY3A 4MXOA 4I4FA 2ESMA 3JR1A 4FGBA 3CS9A 4A07A 3E5AA 4YUQA 1REKA 4RIXA 3TL8A 4O21A 3D94A 1OKYA 2Y7JA 3ACKA 4E73A 2C6MA 4C4IA 3QTRA 1OM1A 4AZWA 4PDYA 3MJ2A 4B0GA 5CSHA 5HD4A 5J9LA 3ITZA 4LQMA 2NNWB 4EHGA 2JIVA 2VWYA 3TNQB 5L8LA 3NW7A 4XHKB 4P5QA 4LGDA 2JFLA 3RPYA 2C6IA 4NIFB 3ORIA 5HO6A 4BR3A 5AR2A 4DBNA 4GRBA 4E6AA 4YO6A 4DG0E 2RKUA 3PA5A 4H3QA 1PYXA 5JKGA 3W8LA 2BDJA 3ZO1A 2C3LA 4DF3A 5FTOA 2VX1A 3AQVA 4YJQA 5JRSA 2Q83A 4DFUA 2W05A 3CQUA 4YJNA 4WUNA 4ACHA 4ZTRA 3GENA 3T9TA 5HTCA 2UZDA 2ZDTA 2WAJA 1WBNA 3KQ7A 4QTBA 2GNJA 5JMSA 2VWBA 4UN0C 4PP9A 3W10A 3BELA 1SMHA 4NZWB 5CNOA 4BICA 4ITJA 4EH5A 2IWIA 4BCPA 5HEZA 3E3PA 4BKJA 3S1HA 5LWMA 4O38A 4CMOA 4UY9A 2VO7A 4D55A 4UX9A 2X8IA 4G3CA 4I20A 3POZA 4IB0A 4AT3A 3KVWA 4UB7A 2ITPA 4C4EA 2XRUA 2C1AA 3QTQA 3U8WA 1Z57A 3E92A 3QGWA 2X2LA 1OIRA 3FYJX 3OCGA 3QYWA 5FTQA 3BBTB 2CGVA 3C0HA 4UYNA 3REPA 1Q99A 3VUTA 2DS1A 4BGGA 4O0VA 3DK6A 4FTMA 4BYJA 5KMJA 1PRYA 4YJOA 3B2TA 3BGPA 3A4PA 4O22A 3QHRA 3P86A 4F7LA 3SVVA 3DQXA 3NNXA 4RBLA 4GMYA 1XJDA 3TT0A 3W2PA 4ZZOA 2UZEA 3FZSA 1NVSA 2W1DA 5CASA 3UJGA 2R7IA 2VTJA 1ZARA 2VWVA 3PXRA 3EN4A 3BHHA 3QBNA 2QKWB 3VF8A 3EFJA 3VS6A 5L4QA 3HAVA 2C6EA 4ZTHA 1H1PA 2F7EE 4DYMA 4A9RA 4Y85A 5IA4A 3NVMB 4GU6A 3OG7A 3EHAA 2ZM1A 4LOQA 4YSMA 1MRUA 5BUIA 2XA4A 4DITA 1K9AA 3LFDA 4GT5A 3WF8A 4EOKA 2P55A 4ZIMA 3ORXA 3E8NA 5ETFA 4AZSA 3LMIA 4QMLA 4BIEA 3ET7A 4MBIA 5HNGA 3ZEPA 4HYSA 3TIYA 2C5VA 2E2BA 4HVSA 3R71A 4LUEA 2HIWA 2V7OA 5IDPA 4KS7A 5C9CA 3HV5A 2PVFA 2HXQA 4DGGA 3LJ2A 3P78A 2XYUA 3KU2A 3OROA 4YC3A 5IUHA 2XYNA 3KA0A 3UC4A 5F4NA 3NEWA 5FEEA 5HGIA 3KMUA 3F9NA 3DOGA 3EB0A 3KC3A 2C6KA 4QP3A 5HORA 4OR5A 4HYHA 4OBQA 2Y4IB 5L2WA 2XJ1A 4PNIA 3NMUF 3K2LA 1YXVA 3U9NA 2UUEA 4G3FA 3EN5A 3ZXTA 4NM7A 3EFLA 4AOJA 3DK7A 4ZTLA 4KSQA 5ANIA 4YBKA 3QZHA 1PXLA 5HI2A 2BKKA 2BZIB 3QYZA 4WHZA 1PXPA 5CXHA 1M7NA 2QODA 3VUHA 4B8LA 2BFXA 2WOUA 3IOPA 4L00A 5CVFA 3PG1A 4FOCA 4IWQA 1OBGA 5CS6A 2ACXA 4HCUA 4I0RA 1YXUA 3W55A 3HNGA 3O7LB 4XCUA 2BZKB 3TNHA 2VTOA 4WG5A 2WTKC 4UZHA 3WE4A 3UZPA 3M11A 5JZNA 4F08A 2NO3A 3LIJA 3KGAA 1GJOA 1HCKA 3LCOA 4JDHA 2H6DA 5CX9A 5G1XA 5K0KA 2ITUA 4I6BA 2ERZE 2I1MA 4TTHB 5E92A 4DFLA 1AGWA 5KKRC 4RG0A 4CLJA 1U5RA 1I09A 2CGWA 3O8PA 4D0XA 2XNMA 3GP0A 4FL3A 2XCKA 4FTKA 4M12A 3TUCA 3LFSA 5T3QA 4MEDA 4AWIA 1UNHA 2PMLX 1QL6A 4YLKA 3O7LD 1APME 3OF0A 4ALUA 4IAAA 4YZ9A 4D2TA 2OXXA 5GZAA 3KRWA 4EHEA 3UO4A 3V8TA 3OVVA 4GK3A 3VS1A 5IQCA 4DEHA 2V7AA 5FRIA 3AOXA 4HVHA 4GT3A 2J6MA 4DE4A 2YITA 2KTYA 3PA4A 4EK8A 1XBBA 3L8XA 3WYXA 2R3LA 1ND4A 3DBCA 1OUYA 3GQLA 4KSPA 3OC1A 4DTBA 3DKFA 4NJ3A 3EMGA 4CG9A 4FV3A 1QPDA 5C8MA 2A27A 3OS3A 1KV1A 5AP3A 4O91A 2BMCA 4HCVA 4O0UA 4TN6A 3OOGA 4RRVA 4MK0A 4DH1A 2WQMA 3OFMA 5HIBA 3VW8A 1PW2A 5EI6A 3QLGA 4MXYA 3BHVA 3E62A 3LE6A 4TYJA 3FE3A 4RJ3A 3HMPA 3QX4A 5HCXA 3TUDA 2X0GA 3ZUUA 3H4JA 2X6DA 3DJ6A 4R3CA 3UO5A 4FKJA 3BU3A 3HECA 4IWDA 4XLVA 5BNJA 3PJ2A 1WBSA 3UPXA 2HENA 3LHJA 2XNGA 2XMYA 1TQIA 2B9HA 2R4BA 3LFQA 5AP6A 1Q8WA 1GIIA 2OG8A 2WTWA 4CRSA 1BUHA 4F1OA 3NS9A 2J0MB 4EUUA 1IR3A 3UNKA 2QCSA 3R9HA 4ZSAA 4JVGA 4WD5A 3DB8A 5AEPA 3FI8A 4X2KA 4BTJA 4F0GA 4YJRA 2YAKA 4ITHA 5EHOA 2O8YA 3FPQA 2XP2A 3ZBFA 4HW7A 3U55A 1U54B 4NUSA 3FMEA 4XG3A 1O6KA 2C6OA 3KF7A 3RM7A 3EQCA 3BBWA 4AN2A 1JSUA 3FMHA 4IFCA 4MCVA 2XM8A 3O8UA 4A4LA 2QR8A 4PY1A 4DH7A 4XV2A 3GI3A 5KMNA 2OKRA 3DNDA 5L8JA 3UZRA 3PE1A 1FOTA 2F7XE 4HVDA 4C3RA 3UQGA 4Q9SA 1W8CA 4DA5A 3DJ7A 4BBFA 4GIHA 4M67A 3DTWA 4CLIA 4JXFA 4UMQA 3U4UA 2PZ5A 3VN9A 2C68A 3G51A 2I6LA 3R22A 3GCSA 4C4GA 5HZNA 2NRUA 2B52A 3PRIA 3FKNA 2GNIA 2X9FA 4YZNA 2CNQA 1H0WA 2YJRA 2BVAA 3WZUA 3ZH8A 4AZEA 5GZ8A 4FNZA 4UWBA 4IDTA 1Y8YA 5HESA 3C13A 3P9JA 3KK8A 3UC3A 1OKVA 3F3ZA 3UYTA 4ALWA 3G2FA 2JDOA 4Q5EA 2V5QA 3F5XA 3SLSA 4CQGA 4IX3A 4MF1A 3ZHPC 4JQEA 4O0SA 1WBVA 4MBJA 4M8TA 3OT8A 2BHEA 4AGUA 4QMTA 4AFEA 1DI9A 4AUAA 4QTDA 5M55A 5M51A 1PXJA 1U46A 3FDNA 5BVDA 3VUDA 1UU7A 4HGLA 4AW1A 4AZFA 4BGQA 3MBLA 3TXOA 4OTQA 4E26A 2W1HA 3TG1A 2VWZA 2R3PA 5J7BA 2XK7A 4TW9A 4G16A 4L7SA 4MH7A 1JVPP 1UU3A 1ZYSA 2SRCA 2XK4A 3NIZA 1S9IA 4PF4A 2ZV2A 3TNWA 3KXHA 5HLNA 2PK9A 2PTKA 3BEGA 4JX7A 4MF0A 3F69A 4EKKA 1YVJA 4WT6A 5GJDA 5IEYA 2J0LA 5HQ0A 1P2AA 4RVKA 3RAWA 4AU8A 3HV4A 3U6HA 2BAJA 4PTCA 3LXPA 4CQEA 3Q4UA 5BUJA 4RZVA 5DBXA 4CFNA 4ENXA 3Q6WA 5LVPA 1KE6A 5AJQA 3R7GA 3B8RA 4K77A 4FKGA 2YCSA 4X3FA 2C69A 2PE0A 4C37A 3F5PA 3QALE 4WG4A 2BALA 1BI8A 4J1RA 3W18A 5HBJA 3DTCA 2JBPA 3ZZEA 4O6EA 2XIXA 2WMBA 3PPJA 3LM0A 4KD1A 5EOLA 4M15A 3RJCA 1CM8A 2PE1A 3G6HA 4JQ7A 5HOAA 1UU9A 3JY0A 3DZQA 3GCUA 3KEXA 4ID7A 3HEGA 2GS7A 2QHNA 3K54A 4Z16A 5EOBA 3FKLA 3IW6A 3SD0A 2YDIA 3AC5A 3PFQA 3V8WA 3E8CA 2QOHA 3FLNC 4JQ8A 3V6SA 4EK5A 4IJ9A 2PVMA 3D4QA 3GOPA 1ZYCA 3QTZA 4H1JA 4F9CA 4CFFA 4GUBA 2PU8A 4QMXA 4EUTA 2PVRA 3QU0A 4MVFA 4LRMA 4JR7A 1A9UA 1TQMA 4ZXTA 5L2TA 4U3ZA 3NUAA 3PXZA 2GQSA 5A4LA 2WFYA 4APCA 2PVJA 4G1WA 4ANNA 4DCEA 2BKZA 3FSKA 3I79A 4Y95A 2V22A 5EYKA 1Q8TA 4IB1A 4C38A 2YIXA 4U40A 4YBJA 5AP2A 2OJJA 2UW6A 3HMNA 4RFYA 5HKMA 3PVWA 3FY2A 1JQHA 2VO3A 2YFXA 2ERKA 2QO9A 4RIWA 3PE2A 4RFMA 4JDJA 4A4OA 4IZ5A 5HVYA 2F7ZE 4FG9A 5JZJA 3KF4A 4PL5A 4C2WA 2I0HA 3BHTA 3ENHA 4TKSA 5CT0A 5AR3A 4EJNA 3EQRA 2FGIA 3R02A 2O2UA 1OIQA 3OCTA 3EYGA 1CKJA 4I92A 1OI9A 3BWFA 5GHVA 1V0BA 4IWPA 4QMSA 3A7JA 5JRQA 4HPUE 3DB6A 3U6IA 2VTIA 3KULA 3R2YA 2GHGA 3DDQA 5FUTA 4QNAA 2OJGA 3SQQA 4FKOA 4CT1A 2YHVA 5B2LA 5K0XA 5H8BA 3VIDA 3G33A 3MY1A 3R7OA 3LFBA 1REJA 4AQCA 4DGLC 4PTGA 4J96A 3HUCA 2BZHB 3VQHA 2PUPA 4YZDA 5AMNA 3HRBA 2YDKA 3IW4A 3E87A 4DG2E 4DLJA 3PWDA 1CKIA 4LRKA 4MWHA 3OP5A 2OH4A 2WELA 3E88A 4FK3A 5GINE 4EHZA 4FZ7A 2G15A 3QCQA 3GU4A 4CRLA 4NFMA 3DU8A 3R83A 5JFVA 2WQOA 3TIZA 2QOIA 2PY3A 5ETIA 5CEIA 4C3PA 4ZY6A 3H10A 4QMZA 3ZMMA 2C47A 1PKGA 5CF8A 4FTQA 2PWLA 1YXTA 3FPMA 1G3NA 1R1WA 2FUMA 3PTGA 3T8OA 4BDCA 2GFSA 3F61A 3LMGA 3PP0A 5IQHA 4FTOA 4EZ7A 3PSBA 3AD6A 4JT3A 4G5JA 2F2UA 1OL1A 3AMBA 4ANLA 4E8AA 3SGCA 4LGHA 4IE9A 3V01A 5HLWA 5HU9A 2XVDA 4EOSA 5A6OA 4IAKA 2CKQA 4ZK5A 5M4UA 4BDGA 3PIZA 3D7ZA 3MFTA 1YDRE 5AM7A 4GT4A 4W4WA 3UODA 3K5VA 1KOAA 2YIQA 4NW6A 3K3JA 4EH6A 5F95A 3OWLA 5AV3A 3DV3A 2IVSA 4R78A 4D0WA 3RK5A 3D5VA 3QGYA 4IC8A 5CVHA 3PXKA 4AA5A 3U87A 2DQ7X 2X4ZA 3RP9A 1W84A 3BIZA 2W4KA 5FG8A 1XQZA 4K11A 3SW4A 4GG7A 3C7QA 2XZSA 4ZY5A 4D58A 1YXSA 1Y91A 4FBXA 2X1NA 4FSQA 4GV1A 4X21A 3HMOA 1GIJA 3TZMA 3I5NA 2UW8A 3UIUA 4GJ3A 4UMPA 3I7CA 4G3GA 4BI2A 3VULA 1XH9A 2WOTA 3AT3A 3PJ1A 4R77A 4HGEA 4IHPA 5IU2A 4ZJVA 5KBRA 4OBPA 5IG1A 3TZ8A 1H00A 3W2OA 1PMNA 5F9EA 1AQ1A 2QOFA 3DDPA 2B9IA 2HAKA 3PXFA 5EG3A 4MQ2A 3B2WA 3GU7A 3GEQA 2XNBA 2QHMA 2VD5A 2G1TA 4IVCA 5E1SA 4FA2A 4OTRA 1OVEA 2VTLA 1O9UA 4AA0A 3CTHA 3A60A 4C7TA 4WIHA 2PVKA 3MYGA 1WVXA 3O2MA 3A8WA 3C4FA 3QQLA 3TV7A 4EC9A 2HZNA 2PE2A 5CF5A 5DYJA 4S30A 2JGZA 1FPUA 4E6CA 4Z7HA 4BI0A 3KK9A 5HX6A 3PJCA 4F9BA 4XBRA 4X6RA 3VS2A 3ZC6A 4O7VA 2OICA 3PXQA 4WRGA 5M4CA 4YNEA 4EOPA 4RIYA 1ATPE 2WXVA 3R9OA 3LLTA 1URWA 1O6YA 4ZS4A 2EB3A 3SDJA 4H58A 4IAFA 4AS0A 4M68A 2PSQA 4O7SA 1FVVA 2BIKB 1B38A 2VWUA 4X7QA 2R0UA 1TKIA 1BYGA 2J51A 2WGJA 5K3YA 2BTSA 1GZNA 4QMYA 5CLPA 3R7IA 3R8UA 4DEDA 4O7TA 1PXOA 4MBLA 5EH0A 2ETRA 4O96A 1OIUA 4XG9A 4XV9A 1FMKA 4NT4A 1E1XA 4BL1A 4D2RA 4C8BA 5F1ZA 3NWWA 2JKMA 2R3QA 1M14A 3SV0A 4R7BA 2OFVA 4FT5A 4CG8A 4QMOA 5FEDA 4KIKB 4FF8A 5HVJA 2J90A 3ROCA 4Y5HA 3T9IA 3PYYA 5ANGA 3F7ZA 3MWUA 4ANBA 5E8WA 3TCPA 2UW5A 3F2NA 2BROA 5CU0A 5JN2A 5CAVA 4L46A 4QYHA 3VS5A 5K5XA 2R0IA 1AD5A 3D14A 3GFWA 4USDA 4A06A 2OJFE 4K6ZA 4MX9A 4RX7A 3DXQA 4J99A 3DXNA 5E90A 3ZM9A 4ZSJA 1NY3A 4FKUA 4EC8A 4NJDA 3FI3A 3PIYA 4K0YA 3VUGA 4APPA 3ZTXA 4C62A 5KHXA 2Z8CA 4LL5A 5HG9A 4ORKA 5EW3A 3CKXA 2BUJA 3TKIA 3DBFA 2VAGA 3NYOA 3D0EA 3NAYA 4YMJA 1WAKA 3M1SA 4PX6A 4FL2A 5I3RA 4FSUA 2YJSA 4ZZMA 2X2MA 4QMVA 4RIYB 3M42A 3P7CA 3QKMA 1WVYA 3AC8A 3WF6A 2IZTA 4M7IA 3UPZA 3QHWA 5LWNA 2F4JA 4PPCA 4XP2A 4D1XA 3WARA 1OUKA 5FXQA 3UNZA 4ZAUA 4OLIA 3ZS5A 5FM3A 1PXKA 2Z7QA 2R3GA 3VNTA 5CAOA 3RAHA 3LQ3A 2O5KA 2YACA 4JJRA 4ERWA 2YAAA 5LXMA 3NLBA 3ANQA 3R9NA 3RK7A 1O6LA 1YDSE 5AUXA 3UTOA 3N51A 5CYIA 3CXWA 4XLIA 4ZLOA 1QCFA 5IMEA 2ITTA 3FWQA 3Q6UA 4QOXA 5DG5A 3E8EA 3MV5A 1J1CA 4E6DA 5BVWA 3ORZA 4PTEA 4XP0A 1GOLA 5LVNA 2VRXA 3RBWA 2V0DA 4ENYA 3GFEA 1IA9A 2VU3A 2YEXA 4FG7A 4J71A 4QTCA 5KX8A 2OIDA 4YLLA 5DT4A 3F66A 4BIDA 4DGNA 2GU8A 4D5HA 4BDKA 3IOKA 3A61A 4FYOA 3I0QA 3ZO4A 5CEKA 4FGRA 3FKOA 3R1SA 3JYAA 4NKAA 3QKKA 2X9EA 3FMDA 1SM2A 3CGOA 2HY0A 3ZLWA 2UVXA 1XH6A 1S9JA 4LGGA 4BCIA 4C02A 3JPVA 4JG6A 5A14A 2J0JA 3ORLA 3MN3A 3GUBA 3VRYA 4EOIA 4YR8A 3EQFA 2OWBA 2ZMCA 4QYEA 5ANKA 5JFXA 5GIPE 4N70A 3OOMA 5M57A 5IQDA 3WF7A 3NUNA 2G2HA 1JKLA 4TYHB 4OAUC 4YNOA 3HDNA 3H9FA 4FT7A 4AGWA 4CNHA 2C5YA 4EBWA 4P2KA 4M14A 3MB6A 5CSVA 5A3XA 1SNUA 2PZYA 4FK6A 4ACCA 3WBLA 5CANA 1QPEA 1K2PA 2XIKA 3Q9WA 1XH7A 1YI6A 5C01A 3FBVA 2A1AB 4U43A 4BDHA 4IBMA 4U7ZA 3KVXA 4UV0A 4G6OA 3EJ1A 4I5MA 3RINA 2OU7A 2XH5A 5GJFA 1BL6A 5ICPA 3PLSA 3MESA 3LFAA 4Y46A 4TWCA 3RVGA 4EOOA 1FMOE 2OFUA 3LPBA 1M2QA 2W4JA 4D2WA 5IDNA 4TRLA 2G01A 3BHUA 3KXZA 4M3QA 5BVNA 3FHRA 1YOLA 2P0CA 2KULA 2WMSA 2BRGA 1XH5A 2FSTX 5EYDA 4RVMA 5TE0A 3VRZA 3CEKA 1CSNA 3AD4A 3MFRA 5EW9A 5M53A 3QCSA 2PZIA 5CSXA 3ZONA 3W1FA 4DEEA 4YZBA 3LJ0A 4NTSA 4L7FA 3GC8A 4ZP5A 5BYZA 4ACMA 4S31A 1T45A 2ITNA 5ANOA 5IH5A 4L3JA 3EH9A 3BWJA 2NPQA 1VYZA 4XS2A 3FI4A 4QP9A 3U9CA 4HGSA 3BX5A 4QMWA 3Q4ZA 2QVSE 3CY3A 2YCRA 5BVFA 5FTGA 4LYNA 3D15A 1M2PA 4KB8A 5DR9A 3R00A 4AAAA 3R7YA 5FDXA 1URCA 4TPTA 4DEIA 1DM2A 3OY1A 5HG5A 4RIXB 3TUBA 2Y4IC 3RCDA 5TR6A 1K3AA 4MXAA 4RWLA 1YQJA 5FM2A 2EB2A 2PMNX 3FMKA 2ZOQA 3NYXA 5DT3A 3I4BA 4FUYA 5FGKA 4PV0A 4KKGA 5AX3A 4RC3A 5BYLA 2JD5A 3DKOA 4CMTA 3SKCA 4BI1A 5AV2A 4FVRA 4DCAA 2QG5A 3CQEA 3NW5A 5CTPA 5EM5A 1R3CA 4F63A 1OKZA 5ANEA 3ORKA 5H9BA 4EBVA 2J0IA 5M44A 4BDBA 4BBMA 4GKHA 1H27A 3FLQA 5IUGA 5LMBA 4OTGA 3D2IA 4O27B 4R3PA 3UQFA 3FLZA 3MFSA 3FV8A 2WIPA 3OZ6A 4N4SA 3VC4A 2BRNA 4DFYA 5M06A 3UMXA 4CKJA 4QP6A 4QP1A 4P5ZA 2JDRA 3ROYA 2HCKA 4IAZA 3OTUA 4BCOA 5I4NA 5ITAA 3AGLA 2C0IA 1J7IA 3GVUA 4RWJA 5L2QA 4ZZNA 2AC5A 4FTUA 5I9YA 5CQUA 2R3JA 1BLXA 1HOWA 1RDQE 1IRKA 3AC3A 4OTHA 3RHKA 5JQ5A 5LJJA 3ZOSA 3UP7A 4HZSA 2YIRA 1RQQA 1XWSA 4CFVA 4FTNA 4GH2A 4PDPA 1VJYA 3ZEWA 2XEZA 2PVHA 5DE2A 2Z60A 2R3RA 3P0MA 3EQGA 3R30A 4NCTC 4R6VA 3EN6A 4FE2A 4UBAA 1OITA 1G5SA 1WVWA 1H1RA 2DWBA 2W1GA 3Q9YA 4AW5A 4D28A 2QOLA 5JFSA 3BGQA 2J2IB 3A7HA 2XKEA 1F3MC 2ZV8A 1NW1A 3LKMA 3ZRLA 2YN8A 4EI4A 3UO6A 3L1SA 1JLUE 4EJ7A 1ZYJA 5EYMA 3NYNA 4ARKA 3QTSA 5CU3A 5HNBA 3DGKA 5BQ0A 3IS5A 4FNWA 4DN5A 3TNIA 2X2KA 4FV1A 4C4FA 4X0MA 5GIOE 3DZOA 2UZBA 4W8DA 3RHXA 3OUNB 5LCKA 5JH6A 5I9VA 4PL4A 1IEPA 4JBPA 4PRJA 4RX9A 3CBLA 4FIIA 2XRWA 3I7BA 4GS6A 4NCTA 4RLKA 3DFCB 3ALNA 3GC9A 5J79A 3EZVA 2YZAA 5E91A 3RPOA 2JDSA 3LFFA 4FTJA 5CAQA 2BHHA 1PXIA 3DS6A 3ELJA 1VYWA 5I9UA 4XP3A 2BFYA 1GNGA 4ONAA 4HOKA 4QP4A 2BDFA 3R73A 4E5BA 5C27A 2WIHA 1H24A 3A7GA 3GQIA 3ZLYA 3BV2A 4NM5A 3WI6A 3CY2A 3TDWA 1P4FA 4GKIA 1QPCA 3NDMA 5E1EA 3IDCA 3ACJA 4GSBA 2CN5A 2CNUA 2YLEA 4FKTA 5C8KA 4BTFA 3HKOA 5EM6A 4DLIA 3V5TA 4MQ1A 3C0IA 5M07A 4W4XA 1XBAA 5AP1A 3Q32A 4K1BA 3ODYX 4RJ5A 3QD4A 2WHBA 2IZUA 5EKOA 5HICA 2VWXA 3V6RA 1A48A 2QONA 1T46A 4PNKA 1BX6A 4FTAA 3UGCA 5AV4A 5JFWA 1ZZLA 2JC6A 3TACA 3HL7A 5DN3A 3NRMA 5J9YA 3WZEA 3LXKA 1IA8A 3QD3A 5CEQA 3ULZA 2YDJA 4L6QA 4QTAA 2I40A 3CP9A 4RJ8A 4AZVA 1JWHA 3NNVA 4U6RA 3V5JA 4IB3A 4J8NA 3EN9A 4AW0A 3OBJA 4I6FA 4PUZA 2E9UA 3C4CA 4JIKA 4PMSA 2IW9A 4KBCA 1XHAA 3CTQA 3NUUA 2IZSA 5HTIA 5IQAA 4ZMEA 2JIIA 5DFPA 4BHZA 3IDBA 3NW6A 2BDWA 4IM0A 1BI7A 4KIPA 3KXGA 4ZEGA 3D5XA 2IVTA 4QQ5A 4O6LA 4E7WA 5E7RA 1OPLA 1YKRA 5CI6A 3MIYA 3O71A 4NFNA 2XNEA 4XYFA 3R8MA 4CVAA 2JAMA 3TKUA 4QMQA 3MA3A 4Q9ZA 2FSMX 4JL9A 4EYMA 1PF8A 5HCYA 3LCDA 4C58A 4M66A 4ZTMA 3LLAA 1Q8ZA 3ATSA 3A7FA 5ETCA 1E9HA 3WZDA 3CC6A 1R78A 3EZRA 2ZV9A 3QQJA 3QQFA 1FGIA 2AYPA 2R3FA 1SNXA 4Z55A 2PVLA 2YM7A 2HZ4A 3IONA 4Y83A 1OKWA 3OEZA 2A0CX 4X2NA 4EL9A 2WTKB 4FVPA 3WYYA 1NXKA 2W17A 3QCYA 4FSTA 2C6TA 3FLSA 4O0WA 3NCGA 2GDOA 4KKHA 4MAOA 5KKRB 3CGFA 1F0QA 2X81A 4FT9A 2QU6A 4F0FA 3QQHA 3MH1A 3LM5A 3AMYA 3I5ZA 2JKKA 1H8FA 3V5QA 4O0RA 2P3GX 4EZ5A 2WQBA 4JLCA 2B9JA 1E1VA 4ZJJA 4C36A 4W4VA 3KCFA 3ODZX 4YURA 5JGBA 3EQIA 2GNGA 2CLQA 1XH8A 2BCJA 3JS2A 4EK6A 3F2RA 3KB7A 4FV6A 4LL0A 4Y73A 4ZMFA 5IQIA 3EFKA 4FV9A 4F4PA 2CMWA 3QRUA 2QD9A 1QMZA 1Y8GA 4BTMA 4ANMA 3R7UA 4X2JA 4H36A 2IZRA 4M97A 4QMPA 4DT8A 5E8XA 1GAGA 1OBDA 2ETKA 1OL6A 4KNBA 4JS8A 3CLYA 3MH3A 3ZBXA 4G2FA 4G6NA 4L8MA 4BZOA 4CXAA 5I9ZA 5K4JA 4I23A 2C0OA 4M69A 4MYGA 4L45A 4A4XA 3BQRA 3KN6A 5AUUA 3IW7A 5EFQA 1TQPA 3L9PA 3W8QA 4BVUA 2QR7A 3IGGA 2GCDA 2OJ9A 3VWAA 4E3CA 5IA2A 4FEVA 4GFMA 2Z7SA 4BWPA 3UOJA 1XKKA 4CD0A 2I0VA 3I81A 4IB5A 2P2IA 3TV6A 4EK3A 3DBDA 3VUMA 2W06A 4R3RA 3R8PA 5CQWA 2YLFA 2HK5A 3JXWA 4L43A 5AAFA 1DI8A 4B6LA 2A4LA 1MUOA 4G3DA 1RJBA 2EXCX 1LPUA 3WF9A 1G8SA 2WTDA 1IG1A 5DHJA 1TVOA 3EN7A 1Q41A 5DEWA 3VUKA 4AGDA 4BBEA 4EK4A 4Q5HA 5DMZA 3KMWA 2CGUA 3LVPA 3SW7A 2ETMA 3SOCA 5LOHA 4D1SA 3MIAA 3UDBA 4ZSGA 3SRVA 4WNKA 5EHLA 3AC2A 3FY0A 5F20A 2OI4X 4MHAA 2XK6A 2WTCA 1ZLTA 3FJQE 3WILA 2RG6A 3IW5A 4F7JA 4K2RA 3KXXA 3CCNA 2WEVA 2WMAA 5EDPA 5AUZA 4I41A 2PZPA 2X4FA 3H3CA 4BHNA 3HUBA 5CZHA 2EXEA 4JRNA 1WBWA 2HW7A 3R6XA 4FYNA 4RLLA 2R9SA 4TNBA 5DNRA 3RAIA 5EKNA 3Q53A 4EH3A 2GQRA 4YHFA 4O7YA 3VBYA 2J5FA 3F3TA 4D9TA 4JG7A 3SXFA 4LOPA 1WBOA 4TY1A 4BZNA 3V5WA 4IJPA 4B4LA 3PSDA 5L6WL 4I3ZA 4AACA 4QNYA 4BCJA 3MFUA 3NSZA 4YC6A 3GB2A 5AM6A 5A4TA 2QG7A 1PHKA 1Y6BA 4U79A 1CTPE 1JKTA 4YSJA 2QC6A 4YC8A 3S4QA 3TV4A 4F1TA 4JBOA 4O82A 2WMTA 3KL8A 4CZYB 2B9FA 5AFVA 3SHEA 2OXDA 2WZJA 2ZB0A 3NYVA 3Q2JA 4GYIA 2VTHA 1M2RA 2C6DA 5ETAA 4M0YA 1GIHA 1MRVA 3F6XA 3PZHA 2QKRA 4AZTA 2VWWA 4X3FB 3T3UA 4HVIA 1U4DA 1VR2A 3Q96A 5EI8A 4M13A 3C4WA 4CYJA 4YO4A 1UV5A 3QRJA 3V51A 3NNWA 3TTJA 3NVKI 4CZUA 2VV9A 4ZS0A 5HO7A 1IAJA 2OIQA 1WBPA 4FIHA 4TNDA 3MGYA 3R01A 3EKKA 3CPCA 5CSPA 5D11A 3PJ3A 3GCVA 3L8PA 4A9YA 4FTTA 5AUYA 4FKRA 3ZUTA 3KKVA 2J50A 4XJ0A 2E9OA 2X7FA 4XG8A 4AF3A 4D2VA 4YJSA 4DFZE 3M2WA 4AGCA 2W5HA 1ZYLA 3D7TA 3E63A 3PWYA 4USFA 3FC1X 1OPKA 3QWKA 4BDDA 5LMKC 3MVMA 1YHSA 4GW8A 3FYKX 3U6JA 4XH6A 1EH4A 4ALVA 4LUDA 5K5NA 1H26A 2GTMA 3Q04A 5HCZA 5IUIA 2GNLA 3TEIA 2RFSA 4D1ZA 1UWHA 1ZY4A 2O3PA 2QOKA 3P5KA 5AP4A 4YJVA 4AFJA 4IX5A 2ZM4A 4EH9A 4WG3A 2GQGA 3SOAA 5D41A 3TKHA 4DGOA 2B4SB 2HZ0A 2UW9A 2ONLC 3A7IA 4RQVA 2BR1A 3V3VA 3MVJA 2H9VA 2VGOA 4UMUA 2O65A 4WA9A 1P5EA 1ZAOA 2CLXA 3PPZA 5TT7A 2W5AA 3UYSA 4CFXA 4F9WA 3G0EA 4UEUA 1PKDA 2QOOA 2W9FB 2FA2A 5CU6A 3UVQA 3RKBA 1PJKA 5HX8A 4DFXE 5LMKA 3HGKA 4RIWB 1XO2B 3NCZA 2UW0A 1H1WA 4RSSA 5J5TA 5KMLA 5EQEA 3QCXA 5KO1A 4JBQA 3EKNA 4BKYA 2WB8A 5FBOA 4RFZA 3ZM4A 4IC7A 4BB4A 2X7OA 5TO8A 5I3OA 4C4HA 2I0EA 2F2CB 4FIFA 2GNHA 3FMLA 3QA0A 3COHA 4FSYA 3VQUA 4CT2A 2CKOA 1FVRA 3IPHA 4KRDA 4QO9A 3VVHA 1G8AA 4EH7A 5DGZA 3BQCA 2QO2A 3LFEA 4ZLYA 3KULB 3Q60A 2VUWA 3SAYA 3RZBA 3PVGA 3BLQA 2Z02A 2RL5A 3KXMA 3LXNA 1KSWA 4C2VA 3ZCLA 3DPKA 4OTIA 2XIYA 5FBNC 4PL3A 2HW6A 5HG7A 3QQGA 1FVTA 3TZ7A 3LCKA 4V04A 5C03A 5DRDA 3PLAE 3RPRA 5D7VA 4EQUA 3NIEA 5BMSA 4D4SA 3DKGA 3B8QA 4UZDA 4CMUA 1U5QA 2W9ZB 5CVGA 3CJGA 4E4MA 3KRXA 3C0GA 4G17A 4K8AA 2PL0A 3ZO2A 4S34A 2ZAZA 1SVGA 4V05A 4P90A 4U0IA 3COMA 4EWQA 4WO5A 2YM5A 2DYLA 4I21A 4RQKA 1OB3A 2J7TA 4TYIA 5B7VA 5HIEA 4O2PA 3QUDA 4F64A 4V01A 5DPVA 2C5XA 3PSCA 3RCJA 4CCUA 4NM0A 4OTFA 1V0OA 4RPVA 4ZTQA 1ZY5A 2ITOA 3R21A 4QYFA 4CYIA 1H01A 3NAXA 2Q0NA 2Y8OA 3OY3A 4XRJA 5LVLA 2C5NA 2VX0A 2HY81 2GHLA 2W1FA 1FINA 4U8ZA 5M4IA 2WQNA 3FL4A 3LCSA 3PP1A 3ALOA 4X2GA 3UNJA 2X8EA 2R3KA 4I5PA 2IPXA 5E4HA 3BCEA 2JBOA 5DVRA 5AADA 2J5EA 4DH5A 1M7QA 4FOBA 5AUTA 2IJMA 2PMOX 2R3OA 3P1AA 5D12A 5J95A 3F3WA 3L8VA 1J1BA 5CAUA 4F6SA 5HIDA 3HZTA 3LAUA 1ZOGA 2IVUA 4J98A 3FQSA 2B53A 2EU9A 4FIJA 3QRTA 4GVJA 3PDTA 5DLSA 3DLSA 4U80A 2Y6OA 4EQCA 5FDPA 3QTWA 4FV4A 4YHJA 4HYUA 4ZY4A 2BRMA 2YM6A 4RWKA 3PVBA 4QMMA 5CZIA 2REIA 2UZTA 4EH2A 2I7QA 4IFGA 3DAKA 4GU9A 4NKSA 1YHWA 5CEOA 3AG9A 3W16A 4IADA 4E5WA 2YISA 2H34A 4R1VA 3A62A 4AT5A 4AT4A 2FVDA 4PDOA 5FQDC 5IH6A 4FIEA 3GCQA 4CTCA 3H30A 3DJ5A 4OT6A 3UOLA 2UV2A 3E64A 3F7WA 2JLDA 3HV3A 3PPKA 4I6HA 4AN9A 4FKSA 5JT2A 3S00A 1FBNA 4L3PA 4V0GA 3NNUA 4G6LA 4I93A 4NYEA 2W1CA 4R5YA 3C4EA 1ZRZA 3QZFA 3DT1A 5DH3A 4OBOA 2EUFB 3L9MA 2P2HA 3DNEA 3QTUA 4NEUA 2IG7A 4BZDA 4IANA 5I5ZA 3FXWA 3GGFA 2B55A 3OW4A 3LOKA 4EH4A 3QF9A 3MW1A 2OJIA 3BPRA 4IEBA 3ZFXA 5IA3A 3VO3A 4IXPA 3WF5A 5AIRA 3FUPA 4OTDA 5AA9A 3Q4CA 5E8YA 3C9WA 1Q24A 3F5UA 5TOZA 3I60A 4MNEA 5H8EA 4BRXA 3BEAA 1UU8A 4WUAA
chains in the Genus database with same CATH superfamily
2EVAA 4IMYA 4C3FA 4H05A 4XOYA 4UXQA 3FLYA 4LOOA 2R7BA 4EQMA 4TT7A 2QOQA 2W1IA 4K9YA 2QO7A 4G31A 4DTAA 4XG7A 1YXXA 2C5OA 5ACBC 4Z7GA 3BYUA 5DIAA 2PMIA 4JNWA 4QYYA 1OPJA 4BC6A 5CALA 2HWOA 4JOAA 2VX3A 4I0SA 2QI8A 2WO6A 3R7VA 4EWHA 2OF2A 2W7XA 4YHTA 3W32A 3AT2A 4WNPA 5M09A 5E8SA 4WOVA 4NK9A 4RVLA 4QEBA 3ZU7A 3N4VA 4EEVA 4LV8A 4YTCA 5E8ZA 3VBTA 4QQTA 3QD0A 2JEDA 5A6NA 2C3IB 3OXZA 2NP8A 1YWVA 3ZC5A 2XNNA 1Q8YA 1DS5A 3QC9A 4K18A 4JI9A 5BUEA 3QTIA 2R2PA 2WU7A 4NIFA 4RZWA 3GU8A 2XBJA 2QQ7A 2PHKA 4FV8A 2R3MA 3P4KA 5I9WA 3R2BA 1PY5A 4JIAA 2JAVA 5EK7A 1STCE 5HE3A 5KUPA 2CKPA 3NUXA 3R9RA 3VBWA 2Q0BA 4BDFA 2XNOA 2LAVA 3G90X 4J7BA 3R7EA 3UIBA 2IN6A 3JUHA 4NWMA 3GBZA 2RIOA 3ORTA 2ZJWA 3OWKA 3PZEA 4KWPA 1KE5A 4BY9E 4FTIA 4JBVA 4RC2A 2X0OA 4U45A 4XOZA 4KIOA 4OUCA 4BF2A 4MNEB 3CIKA 4F99A 3AC1A 4CFWA 4QP8A 1JBPE 1ST4A 4W9WA 5FWKK 4GIIA 2YCQA 4DT9A 2LGCA 4N0SA 2XK8A 5L2IA 3ETAA 4YLJA 4BYIA 2YA9A 2OXYA 2YM3A 1LP4A 3PIXA 4HVGA 2W99B 4IWOA 4RVTA 4O86A 1KUTA 3EQPA 1RW8A 2ITWA 4IVDA 4WRSA 5L2SA 4G9CA 3AC4A 4QRCA 1LR4A 1OGYA 2OO8X 3UIMA 1YOJA 4BWKA 2RGPA 4WSQA 3O0GA 1UNLA 3LCTA 2EXMA 5CENA 4RA4A 5C4LA 4FSMA 3O5AA 3GNIB 4AX8A 4BDEA 4O7ZA 4DGMA 3H9RA 4L44A 4N6YA 3W0PA 3QWJA 4GFOA 4TWPA 4TYGA 4I24A 3W2QA 3Q9ZA 4DHFA 3FMJA 3GOKA 2XB7A 5AR8A 3TWJA 2Z2WA 4CV9A 3IG7A 3QZGA 4I6LA 3D2KA 4XG2A 4F78A 4R7HA 1KWPA 2RFEA 1XMLA 3HVCA 4JDKA 3MS9A 5T68A 5B2MA 4L53A 1GZKA 1H25A 3ZZWA 4OGRA 1SVEA 2C30A 2CPKE 4PDSA 4AG8A 2RG5A 3OUKA 3KRLA 4MXXA 5JGDA 3T3VA 4O1OA 1YWRA 4JAIA 4EH8A 3Q5ZA 1L8TA 3BL7A 2VGPA 3WIGA 4O84A 4CSVA 2WTJA 4LM5A 4XRLA 4Y5QA 5CWZA 4DG3E 5CY3A 2AC3A 4E6QA 2ZB1A 5M08A 4YTIA 2CGXA 4AE9A 5HE0A 1ZZ2A 3SC1A 5I9XA 4BCKA 3LQ8A 4Z9LA 1KV2A 3E7VA 4XV3A 3W2SA 3MB7A 1Q61A 3PXYA 4IM2A 2PYWA 5DR2A 1UA2A 5A4EA 4L68A 2UVYA 1GZOA 4BDJA 2AEGA 5IQGA 3IKAA 4TXCA 2VTRA 3I0OA 5C1QB 5AAGA 4L67A 4Y72A 1M52A 5H8GA 2GPHA 3I1AA 5HBHA 2GFCA 2O0UA 5DA3A 4G9RA 4KS8A 4LG4A 4LMNA 3BYSA 1OIYA 4U9AA 4QPMA 2YIWA 3G9NA 4W8EA 2R64A 1ZMUA 3FZTA 4IIRA 4FZFB 1ZWSA 4XEYA 3EQHA 4M84A 2BRHA 3VBQA 3CJFA 5M56A 2HOGA 3O23A 4EOLA 3R9DA 3BYOA 1MQBA 5CI7A 1W83A 3QQKA 2GHMA 2QOBA 4B99A 5IA5A 3QFVA 4IH8A 3EQBA 4R7IA 1WBTA 2E9VA 2QOCA 2UZWE 3NPCA 4MD7E 3W2CA 4A9SA 2GS2A 4ACGA 4F7SA 1ERKA 4YJUA 1MQ4A 2QLUA 4DH8A 1V0PA 4USEA 5T6KA 4E4NA 4LFIA 4C4JA 4EHVA 3NUSA 3BLRA 3FEGA 2QURA 3LJ1A 5B2KA 2XF0A 2JDVA 3LMHA 1YWNA 5AIKA 3R1YA 3DFAA 3PY3A 3BU6A 3R1NA 5AA8A 3DA6A 3D9VA 3TDVA 5A9UA 3P23A 4D9UA 3FL5A 1PMUA 3Q4TA 4QP2A 4YPSA 5HU3A 3NX8A 5JEBA 4O0TA 3OCBA 5AR5A 3QRKA 5F94A 2CJMA 4LRJA 3S95A 3O17A 5HVKA 4FX3A 1PYEA 4L3LA 3WZJA 3LFNA 2CSNA 3KRJA 4JAJA 5J7HA 5AR4A 5B0XA 4HCTA 4BIBA 2B0QA 1OGUA 3C5IA 3HMMA 2XKCA 3BHYA 3IW8A 4ACDA 4NH1A 4QPSA 3FMNA 5IQEA 2BTRA 3TTIA 4AW2A 3UP2A 2X8DA 4IZ7A 2W96B 4YZMA 1H4LA 2GS6A 4RC4A 4U5JA 3RI1A 3FZOA 4JG8A 3EL7A 3TJDA 4DHZA 4FI1A 3MTFA 5IA0A 3SGCA 3HA6A 4QMUA 5HHWA 4F9YA 4OAVB 2OK1A 2VWIA 2BAKA 4QDVA 3CSVA 4ZTNA 1B39A 5HE2A 3UOHA 4KAOA 3ZRKA 4E1ZA 2RF9A 3EQDA 5AAEA 3BYVA 2XIRA 4LMUA 3HP2A 4PQNA 3OD6X 4DH3A 5JQ8A 4F9AA 2VO6A 4H1MA 4AA4A 2C3JA 4JR3A 4UWCA 5IH4A 2A19B 5LCJA 2OBJA 2GTNA 3ANRA 5LMAA 4NTTA 3ZFYA 4BCHA 3PJ8A 2ZVAA 3PRFA 2IO6A 2UW7A 1NT2A 4ERKA 2CN8A 4BCGA 5CF6A 5FLFA 4U42A 1U54A 2WNTA 3AXWA 3II5A 1Q5KA 5KMOA 5DWRA 5GNKA 2E9PA 2G9XA 3GXLA 3S2PA 3VBVA 5AX9A 4GCJA 4C35A 5DR6A 2CCHA 4FV5A 1JPAA 4MD8E 4MTAA 2VTNA 4U44A 4DHIB 2ZMDA 3N4UA 2VTQA 1W98A 3FLWA 4PP7A 2WMXA 5HNIX 4D2PA 3ORPA 3DY7A 2BIYA 2ZYBA 1H1QA 4N57A 1KE7A 4IZYA 4II5A 3HV6A 4FV7A 4F0IA 2PPQA 3HRFA 3SA0A 4KKEA 3TI1A 2C6LA 1J91A 1Z9XA 4X6QC 4UALA 1Q8UA 2E9NA 3MPTA 4ASZA 2BILB 2X6EA 4G34A 3RZFA 5KMMA 2FYSA 1R0PA 5BVKA 4XNEA 2ITVA 5EI2A 5E8UA 3P5JC 4AXAA 4C61A 1V1KA 2Y0AA 3OMVA 3O96A 5A4CA 4FG8A 2XCHA 2WPAA 3DAEA 5CT7A 3FMMA 2WMUA 3G6GA 1JSVA 3QRIA 4X2FA 3FHIA 3S0OA 4ANSA 4D4RA 4L42A 5CXZA 4N6ZA 4FZ6A 4DEAA 5JGAA 1XMMA 1JOWB 2VTTA 2HZIA 2YM8A 4FSWA 5BMMA 1R0EA 5H2UA 5IMXA 3F5GA 3VW6A 1W82A 4O83A 4Y8DA 5AV1A 4LV5A 1WFCA 3D5WA 4WSYA 3Q3BA 5DOSA 4FVQA 4UMRA 4YU2A 4U81A 1HCLA 3HLLA 4EOJA 4KIQA 3ZUVA 2H96A 4HNFA 4CKIA 4KRCA 3RPVA 3A2CA 3N9XA 4F09A 3JVSA 4W9XA 1SZMA 5AP7A 4E93A 3KCKA 2UZLA 1MP8A 4R5SA 2FSOX 1YI4A 5CAPA 3EYHA 4WNMA 3R28A 3LQ5A 4GJ2A 4O2ZA 3GT8A 3BKBA 4CCBA 2G2FA 4GG5A 5BVEA 4EOQA 4NL0A 1P14A 4FV2A 4BWXA 4HGTA 4U41A 1ZYDA 4ASDA 4AP7A 2WMVA 2OGVA 3WIKA 4QD6A 3HAMA 4BTKA 2XS0A 3U54A 3BYMA 3OBGA 4F70A 3MVLA 5IEVA 5E8TA 5TF9A 3CQWA 3VS3A 4AAYA 2WU6A 5BVOA 3HX4A 1NVQA 3Q2MA 1PMEA 1ZMWA 2Y4PA 3CR0A 4B8MA 2WQEA 1P4OA 1CDKA 3RALA 3MJ1A 1F5QA 2R3IA 3HDMA 3K3IA 3P79A 3VS4A 3FI2A 4P4CA 4RJ6A 1J7LA 2WEIA 3TNPC 3FZ1A 4CGAA 2C0TA 2QLQA 3ATTA 3QXPA 4IM3A 2PUIA 2JKQA 3QX2A 3BLHA 3QC4A 4FL1A 2YIYA 3R8LA 4B7TA 5C4KA 3GCPA 3ORMA 4J52A 3QL8A 4ZLZA 4E20A 3MPMA 4S33A 2F9GA 2WD1A 4X3FC 4FKWA 3MH2A 2XAOA 3C1XA 2CHLA 2VN9A 3MSSA 1OL5A 2UW3A 3MDYA 3F3UA 1H1SA 4RJ7A 4IQ6A 3Q9XA 2R3NA 3UOKA 2IW8A 4J53A 4Q2AA 3VBXA 2YM4A 3VJOA 3POOA 3KREA 2UVZA 1LEWA 2HXLA 3HYHA 4L52A 5DT0A 5K4IA 2GNFA 4EKLA 4AOIA 4RA5A 5FEQA 1UKIA 1H28A 1BL7A 4DBXA 1JKSA 5L3AA 1Z5MA 4AOTA 5A46A 3MY0A 1KE9A 1BMKA 3R1QA 2GMXA 2OF4A 5C26A 3UQCA 3DLZA 3OW3A 1WCCA 2J4ZA 5EHYA 4AE6A 3CPBA 4JDIA 4IW0A 4IX6A 3FXXA 5M4FA 3AGMA 1UWJA 2QNJA 3FSFA 3FZRA 3UG2A 5J8IA 3E93A 5FXSA 5KCVA 2OH0E 4M69B 4FNYA 4GYGA 5EW8A 3TZ9A 3OEFX 3I6UA 4L01A 4D4VA 2RFDA 3KXNA 4F1MA 1UKHA 3HP5A 3PG3A 4O7RA 2V62A 3O51A 4CFUA 3UVPA 2ZV7A 3ENMA 3F3VA 4DFBA 2OIBA 3R8VA 3H0ZA 3CE3A 5AUVA 3WZKA 4J95A 2W1ZA 5CEPA 2ITXA 3ZLSA 2WMWA 4GEOA 4UMTA 4O81A 3G0FA 4YJTA 2XUUA 2XK9A 4EYJA 5J9ZA 1CMKE 4RWIA 1YRPA 3S3IA 4C33A 2XKFA 3QAME 4G3EA 4YZCA 5IPJA 3UZTA 3KIOC 4FEXA 2VTSA 5D1JA 3TYKA 2G2IA 5CU2A 5KMIA 4CTBA 3QZIA 1ZXEA 1A06A 3DQWA 3VS0A 3BE9A 3N4TA 3KMMA 3OHTA 2UZOA 4O1PA 3A99A 3SX9A 4NM3A 4TZRA 3BZ3A 2EWAA 2YABA 1ZMVA 4ASXA 3ORNA 2F49A 5AP5A 3SRVB 4TYEA 1YDTE 2XEYA 5J87A 3V8SA 3L9NA 4ZOGA 3L8SA 4FICA 4FKLA 1X8BA 3L9LA 4X3JA 4H3PA 5G6VA 1W7HA 4FTLA 1H0VA 4S32A 3MPAA 5EDQA 5ACKA 3FC2A 2W0JA 3KFAA 4XX9A 3D5UA 4XV1A 3KN5A 4Z3VA 3H0YA 4P7EA 5D9HA 4DC2A 4MD9E 5KMKA 2GSFA 3V5PA 3P08A 4BCMA 3SG9A 2IEWA 3RNYA 5AWMA 1UVRA 4PPBA 1YW2A 3VHKA 1BKXA 4FT0A 2P33A 2WMQA 2X39A 4WKQA 4FR4A 5D10A 2HYYA 1OECA 3QUEA 1Y57A 3CTJA 3VF9A 3BRBA 3ZDIA 1WZYA 4QQJA 4UYAA 4FKPA 3BV3A 4JX3A 4E4LA 5HLPA 3U4WA 2IW6A 4XG4A 1Q4LA 3KRRA 4R8QA 5EDRA 4ZSLA 4IAIA 4F7NA 3P7BA 4ANQA 4D4YA 1XBCA 1DAYA 3EOCA 2YERA 3OT3A 4FTRA 5FP6A 2OZOA 3OWJA 4EZ3A 4G5PA 3TM0A 3U51A 4QP7A 4B9DA 1J7UA 1MRYA 5EYCA 3EL8A 4RX8A 4J8MA 4YJPA 3OXTA 5EM7A 3PVUA 4QPAA 3RM6A 3MTLA 1ZOEA 1RE8A 1M17A 5D7AA 3OTVA 2YCFA 1YOMA 4FEUA 1Q3WA 4FMQA 1LEZA 4IVAA 4I22A 4C34A 3MY5A 2JITA 2WTVA 3QA8A 4FZAB 4TWOA 3EWHA 3IO7A 3V5LA 3ZSHA 4CV8A 2JDTA 2C4GA 5DI1A 4UWYA 5K9IA 3DCVA 4I6QA 2ONLA 4XMOA 4QQCA 3VS7A 2XNPA 3NUPA 2FO0A 3ZDUA 2B1PA 4C0TA 3D83A 2OZAA 2W4OA 3LFCA 2R3HA 5IEXA 1FGKA 3D7TB 5CNNA 5AP0A 4D2SA 4PMPA 5HTBA 3ULIA 4W4YA 2VO0A 4DEGA 4CKRA 3RGFA 3TN8A 3C4XA 5HG8A 2UZVA 2XM9A 3VAPA 4KBKA 4EOMA 3C51A 3V04A 2VTMA 3UIXA 4FZDB 2J0KA 3QLFA 3BU5A 3Q5IA 4NSTA 3RAKA 4DEBA 5IZFA 4LDTA 4XBUA 2V55A 2X7GA 5IKWA 4BDAA 1SYKA 2J9MA 2WKMA 3EIDA 3NUYA 4PMTA 4QMNA 3IGOA 3QD2B 4FSNA 4BN1A 2VTPA 2I0YA 4HJOA 2B7AA 2PULA 3AKJA 1YI3A 2UZNA 1OMWA 3P7AA 3W2RA 4DFNA 4QTEA 3GU6A 2NRYA 3NZ0A 3IQ7A 3MA6A 3CD8A 4FTCA 3RTPA 2UW4A 3BE2A 2Y9QA 4HNIA 3AD5A 3CKWA 3DAJA 4ANOA 4DINA 3IECA 4O0YA 3THBA 3OXIA 4U3YA 4I94A 5J1VA 1QPJA 4EONA 3PUPA 4FIGA 3LW0A 4I1ZA 5FD2A 1W0XC 4XG6A 5GJGA 1JKKA 2OSCA 4KA3A 5KNJA 2DUVA 2IVVA 5H3QA 3FQHA 5HD7A 4AN3A 2R5TA 3QXOA 4O0XA 5LVMA 2C3KA 2YWVA 2CCIA 3RK9A 4GK2A 4KIKA 4FKIA 2JFMA 3VUIA 2UZUE 4I5HA 3G5DA 4M0ZA 2BRBA 5I0BA 4FUXA 4A9UA 2OZAB 5A54A 4DDGA 2PZRA 3Q52A 4BCQA 1JAMA 2W5BA 4ITIA 2XANA 3O50A 2H8HA 3QUPA 4OTPA 3WE8A 1Q97A 2RFNA 3COKA 5HE1A 5KZIA 3ZXZA 3AMAA 4ZJIA 4MWIA 4A9TA 4FEWA 5FXRA 4GK4A 3ZO3A 2PVYA 4TL0A 3R8ZA 2WTIA 4NW5A 4C59A 3GC0A 3G15A 1OL7A 4WBBB 3R0TA 4EORA 2VNWA 2O63A 5IISA 4GVAA 3ZRMA 5L6PA 2CNVA 5IA1A 4C57A 5L6OA 4JRVA 4F65A 4OTWA 3F88A 2B54A 5C8NA 3LXLA 1ZOHA 3FQEA 3DKCA 4J97A 4IDVA 1SVHA 5AV0A 1NVRA 1U59A 2BAQA 1VEBA 1IASA 4BFMA 3MH0A 4QYGA 1VZOA 1OZ1A 1PXMA 1VLRA 5EQPA 2JIUA 4BKZA 4IZAA 1I44A 5EM8A 5EQYA 4RIOA 3SXRA 2FB8A 1R39A 4IX4A 3E7OA 1Y6AA 3DBQA 4A7CA 5CEMA 3UBDA 4KUJA 5IQBA 5CSWA 3UG1A 2XBAA 2P4IA 3E3BX 2CKEA 1Q62A 2Z7LA 3VJNA 4PWNA 3ZYAA 4IACA 2A2AA 3FAAA 4GUEA 1J3HA 1CKPA 5L8KA 3ZSIA 4MNFA 3A8XA 5FP5A 5J1WA 4ZSEA 4QT1A 4U97A 3BGZA 3KY2A 5IQFA 4GFGA 3ZLXA 2XIZA 3HMIA 2O64A 2ZM3A 4HYIA 3RNIA 1JNKA 3G9LX 4R1YA 4ASEA 2HELA 5HBEA 5KBQA 4RJ4A 3FXZA 4MUQA 3MI9A 3O8TA 3LZBA 3QKLA 4XUFA 4FEQA 4BCNA 4BGHA 3TJCA 4WNOA 2VTAA 3COIA 3JY9A 4H39A 2ZDUA 1DAWA 3FZPA 4I0TA 1H07A 4DTKA 5E8VA 5BV3A 3UMWA 4FT3A 2ITQA 5IF1A 3CD3A 5LVOA 5TKDA 2AUHA 2YWPA 4O4BB 3SG8A 4O4EA 2W1EA 3NR9A 3C50A 4ZTSA 3NGAA 4FKQA 3OCSA 4E4XA 4AXDA 3C4ZA 4HZRA 2FH9A 4O7WA 3DXPA 2C1BA 3C5UA 3F82A 4O7NA 3AT4A 3UVRA 3PA3A 4H3BA 4GL9A 2PUNA 3DK3A 4PPAA 3HRCA 4D5KA 5JK3A 3PY0A 3HV7A 3SXSA 4UXLA 2Z7RA 2XK3A 1KOBA 3W0MA 3IDPA 4K33A 4FC0A 4TYHA 3IK3A 2FSLX 4TWNA 3JVRA 4RT7A 5KZ0A 5HO8A 2XJ0A 3PY1A 2WMRA 4FSRA 5ANJA 5A4QA 2OW3A 2QU5A 3F2AA 4FV0A 4NU1A 3DBEA 3UE4A 4BCFA 5KHWA 3ERKA 2ITZA 3I6WA 3MVHA 4O7LA 3RMFA 4RGJA 4MKCA 3ZFMA 5BPYA 1IAHA 3WOWA 5E9EA 4WBOA 1LUFA 4YTHA 4YP8A 4F6WA 5CF4A 2CDZA 1KE8A 4IAYA 4FNXA 4V0GB 1H08A 4I5CA 4MXCA 5JSMA 4OW8A 4S2ZA 4PMMA 1FQ1B 2RSVA 3RWQA 4MXZA 4RMZA 4KABA 1GZ8A 2YZLA 5KE0A 4RX5A 2BPMA 1PXNA 3E8DA 1JSTA 2Y6MA 2PVNA 3GC7A 3R63A 4BDIA 1YHVA 3ID6C 4YPDA 5ANDA 2BZJA 4L9IA 1Q3DA 2F57A 2VNYA 4KBAA 4E5AX 1OL2A 3A4OX 3RWPA 5BYYA 4DAWA 1UNGA 5LARA 2JKOA 3QTXA 3ZSGA 4IVBA 4KINA 1B6CB 2XKDA 1L3RE 3HA8A 4FSZA 2ITYA 4HPTE 4YGAA 5DRBA 4CFMA 1XR1A 4F6UA 4YTFA 3H9OA 4FKVA 1XH4A 2XJ2A 3OWPA 3W33A 1NA7A 2HWPA 1PMVA 3VHEA 5J5SA 5LQFA 3BI6A 3RPSA 5DEYA 4FODA 3QQUA 4AXCA 1WMKA 3K5UA 2VZ6A 5AUWA 4CZTA 5BX0A 4OT5A 5CU4A 4LI5A 4CEGA 3R04A 5GZ9A 5AR7A 4I4EA 2PUUA 3EFWA 3GU5A 1GY3A 4MXOA 4I4FA 2ESMA 3JR1A 4FGBA 3NFGB 3CS9A 3NFFB 4A07A 3E5AA 4YUQA 1REKA 4RIXA 3TL8A 4O21A 3D94A 1OKYA 2Y7JA 3ACKA 4E73A 2C6MA 4C4IA 3QTRA 1OM1A 4AZWA 4PDYA 3MJ2A 4B0GA 5CSHA 5HD4A 5J9LA 3ITZA 4LQMA 2NNWB 4EHGA 2JIVA 2VWYA 3TNQB 5L8LA 3NW7A 4XHKB 4P5QA 4LGDA 2JFLA 3RPYA 2C6IA 4NIFB 3ORIA 5HO6A 4BR3A 5AR2A 4DBNA 4GRBA 4E6AA 4YO6A 4DG0E 2RKUA 3PA5A 4H3QA 1PYXA 5JKGA 3W8LA 2BDJA 3ZO1A 2C3LA 4DF3A 5FTOA 2VX1A 3AQVA 4YJQA 5JRSA 2Q83A 4DFUA 2W05A 3CQUA 4YJNA 4WUNA 4ACHA 4ZTRA 3GENA 3T9TA 5HTCA 2UZDA 2ZDTA 2WAJA 1WBNA 3KQ7A 4QTBA 2GNJA 5JMSA 2VWBA 4UN0C 4PP9A 3W10A 3BELA 1SMHA 4NZWB 5CNOA 4BICA 4ITJA 4EH5A 2IWIA 4BCPA 5HEZA 3E3PA 4BKJA 3S1HA 5LWMA 4O38A 4CMOA 4UY9A 2VO7A 4D55A 4UX9A 2X8IA 4G3CA 4I20A 3POZA 4IB0A 4AT3A 3KVWA 4UB7A 3VONA 2ITPA 4C4EA 2XRUA 2C1AA 3QTQA 3U8WA 1Z57A 3E92A 3QGWA 2X2LA 1OIRA 3FYJX 3OCGA 3QYWA 5FTQA 3BBTB 2CGVA 3C0HA 4UYNA 3REPA 1Q99A 3VUTA 2DS1A 4BGGA 4O0VA 3DK6A 4FTMA 4BYJA 5KMJA 1PRYA 4YJOA 3B2TA 3BGPA 3A4PA 4O22A 3QHRA 3P86A 4F7LA 3SVVA 3DQXA 3NNXA 4RBLA 4GMYA 1XJDA 3TT0A 3W2PA 4ZZOA 2UZEA 3FZSA 1NVSA 2W1DA 5CASA 3UJGA 2R7IA 2VTJA 1ZARA 1ST0A 2VWVA 3PXRA 3EN4A 3BHHA 3QBNA 2QKWB 3VF8A 3EFJA 3VS6A 5L4QA 3HAVA 2C6EA 4ZTHA 1H1PA 2F7EE 4DYMA 4A9RA 4Y85A 5IA4A 3NVMB 4GU6A 3OG7A 3EHAA 2ZM1A 4LOQA 4YSMA 1MRUA 5BUIA 2XA4A 4DITA 1K9AA 3LFDA 4GT5A 3WF8A 4EOKA 2P55A 4ZIMA 3ORXA 3E8NA 5ETFA 4AZSA 3LMIA 4QMLA 4BIEA 3ET7A 4MBIA 5HNGA 3ZEPA 3W0RA 4HYSA 3TIYA 2C5VA 2E2BA 4HVSA 3R71A 4LUEA 2HIWA 2V7OA 5IDPA 4KS7A 5C9CA 3HV5A 2PVFA 2HXQA 4DGGA 3LJ2A 3P78A 2XYUA 3KU2A 3OROA 4YC3A 5IUHA 2XYNA 3KA0A 3UC4A 5F4NA 3NEWA 5FEEA 5HGIA 3KMUA 3F9NA 3DOGA 3EB0A 3KC3A 2C6KA 4QP3A 5HORA 4OR5A 4HYHA 4OBQA 2Y4IB 5L2WA 2XJ1A 4PNIA 3NMUF 3K2LA 1YXVA 3U9NA 2UUEA 4G3FA 3EN5A 3ZXTA 4NM7A 3EFLA 4AOJA 3DK7A 4ZTLA 4KSQA 5ANIA 4YBKA 3QZHA 1PXLA 5HI2A 2BKKA 2BZIB 3QYZA 4WHZA 1PXPA 5CXHA 1M7NA 2QODA 3VUHA 4B8LA 2BFXA 2WOUA 3IOPA 4L00A 5CVFA 3PG1A 4FOCA 4IWQA 1OBGA 5CS6A 2ACXA 4HCUA 4I0RA 1YXUA 3W55A 3HNGA 3O7LB 4XCUA 2BZKB 3TNHA 2VTOA 4WG5A 2WTKC 4UZHA 3WE4A 3UZPA 3M11A 5JZNA 4F08A 2NO3A 3LIJA 1G8JA 3KGAA 1GJOA 1HCKA 3LCOA 4JDHA 2H6DA 5CX9A 5G1XA 5K0KA 2ITUA 4I6BA 2ERZE 2I1MA 4TTHB 5E92A 4DFLA 1AGWA 5KKRC 4RG0A 4CLJA 1U5RA 1I09A 2CGWA 3O8PA 4D0XA 2XNMA 3GP0A 4FL3A 2XCKA 4FTKA 4M12A 3TUCA 3LFSA 5T3QA 4MEDA 4AWIA 1UNHA 2PMLX 1QL6A 4YLKA 3O7LD 1APME 3OF0A 4ALUA 4IAAA 4YZ9A 4D2TA 2OXXA 5GZAA 3KRWA 4EHEA 3UO4A 3V8TA 3OVVA 4GK3A 3VS1A 5IQCA 4DEHA 2V7AA 5FRIA 3AOXA 4HVHA 4GT3A 2J6MA 4DE4A 2YITA 2KTYA 3PA4A 4EK8A 1XBBA 4DHJA 3L8XA 3WYXA 2R3LA 1ND4A 3DBCA 1OUYA 3GQLA 4KSPA 3OC1A 4DTBA 3DKFA 4NJ3A 3EMGA 4CG9A 4FV3A 1QPDA 5C8MA 2A27A 3OS3A 1KV1A 5AP3A 1TZDA 2BMCA 4HCVA 4O0UA 4O91A 3OOGA 4RRVA 4MK0A 4TN6A 4DH1A 2WQMA 3OFMA 5HIBA 3VW8A 1PW2A 5EI6A 3QLGA 4MXYA 3BHVA 3E62A 3LE6A 4TYJA 3FE3A 4RJ3A 3HMPA 3QX4A 5HCXA 3TUDA 2X0GA 3ZUUA 3H4JA 2X6DA 3DJ6A 4R3CA 3UO5A 4FKJA 3BU3A 3HECA 4IWDA 1W2DA 4XLVA 5BNJA 3PJ2A 1WBSA 3UPXA 2HENA 3LHJA 2XNGA 2XMYA 1TQIA 2B9HA 2R4BA 3LFQA 5AP6A 1Q8WA 1GIIA 2OG8A 2WTWA 4CRSA 1BUHA 4F1OA 3NS9A 2J0MB 4EUUA 1IR3A 3UNKA 2QCSA 3UDZA 3R9HA 4ZSAA 4JVGA 4WD5A 3DB8A 5AEPA 3FI8A 4X2KA 4BTJA 4F0GA 4YJRA 2YAKA 4ITHA 5EHOA 2O8YA 3FPQA 2XP2A 3ZBFA 4HW7A 3U55A 1U54B 4NUSA 3FMEA 4XG3A 1O6KA 2C6OA 3KF7A 4O4CA 3EQCA 3BBWA 3RM7A 4AN2A 1JSUA 3FMHA 4IFCA 4MCVA 2XM8A 3O8UA 4A4LA 2QR8A 4PY1A 4DH7A 4XV2A 3GI3A 5KMNA 2OKRA 3DNDA 5L8JA 3UZRA 3PE1A 1FOTA 2F7XE 4FRFA 4C3RA 4HVDA 3UQGA 4Q9SA 1W8CA 4DA5A 3DJ7A 4BBFA 4GIHA 4M67A 3DTWA 4CLIA 4JXFA 4UMQA 3U4UA 2PZ5A 3VN9A 2C68A 3G51A 2I6LA 3R22A 3GCSA 4C4GA 5HZNA 2NRUA 2B52A 3PRIA 3FKNA 2GNIA 2X9FA 4YZNA 2CNQA 1H0WA 2YJRA 2BVAA 3WZUA 3ZH8A 4AZEA 5GZ8A 4FNZA 4UWBA 4IDTA 1Y8YA