2QOHA

Crystal structure of abl kinase bound with ppy-a
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
274
structure length
271
Chain Sequence
GSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Crystal Structure of the T315I Mutant of Abl Kinase
pubmed doi rcsb
source organism Mus musculus
total genus 83
structure length 271
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qohA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qohA01
5BVNA 2ERZE 1OUYA 3VHKA 3CS9A 3O8UA 5ETIA 3U87A 2VD5A 3ACKA 1UWHA 1VEBA 4C2VA 4FZFB 4CTBA 2BRBA 3IG7A 5ANIA 4O0UA 2OI4X 4DGGA 3QUPA 2B4SB 2W1DA 3KULB 2QO7A 2XCKA 3C5UA 5KMJA 4BYIA 4NM3A 3OXZA 3T3UA 4FKQA 3QQGA 2ZM1A 4LL5A 3CKWA 4X7QA 4FTTA 3RJCA 3UVPA 4FEWA 2FYSA 5I3RA 3TNHA 2AYPA 2B9HA 3OC1A 4QMWA 5IA1A 4PTCA 3ANRA 2C6TA 3ZLXA 3CKXA 4OTHA 4F0FA 3DJ7A 4LV5A 4D2PA 2BCJA 5JZNA 3GB2A 4RRVA 3G0FA 3ZC6A 4U80A 4Y73A 1YHWA 2ITWA 3I5NA 4E8AA 4G5PA 1U46A 5AP5A 4F9WA 3RPVA 1OITA 4BYJA 1ZYJA 4YMJA 3LXNA 5EQEA 3DK7A 3FZPA 5JQ5A 5LVPA 3UZTA 1A48A 2ZM3A 1M17A 1PXLA 2JD5A 5C8KA 2VTSA 1PXKA 1ZY5A 3AC3A 4HCTA 4IEBA 5FWKK 1VJYA 4RX5A 3PYYA 3QLFA 2O64A 3MW1A 3UG1A 4ACMA 3HMPA 4MTAA 3DXQA 4EC8A 2I40A 3KK8A 2UV2A 4I3ZA 3FV8A 3E5AA 3GFWA 2F57A 2PMIA 4YP8A 4EH6A 3O8TA 1JSUA 2GU8A 2WQEA 2XYNA 2XEYA 1J3HA 2BDWA 3FC1X 4XUFA 2XP2A 3E8DA 3EN7A 3G5DA 4DN5A 1Q24A 2WMAA 5BYLA 4IB0A 2OJFE 3HUBA 4N6YA 1OL6A 3R83A 3RZBA 3JY9A 3VNTA 2SRCA 4F65A 4Z7GA 3LFEA 3QRJA 2VTNA 5HVKA 2VNWA 3ZLSA 3BU6A 4XCUA 1CKPA 4O21A 3UIMA 5L6WL 3UTOA 5H8BA 2WU6A 3M2WA 4H1MA 5ANOA 3UC3A 2RF9A 3NUSA 4H3QA 5KZ0A 4YO6A 1BKXA 5EDQA 2UZNA 3RBWA 3QALE 5ACKA 2YLFA 2UVYA 3AGMA 4G9RA 3U6JA 2W4JA 5CNOA 1VYZA 3MB6A 5KMOA 4APCA 3NW6A 2PE0A 4BCMA 4MD9E 3DLSA 5H8EA 4GSBA 4JG6A 4YHJA 4JR3A 5L2QA 3FDNA 3F3TA 3QD2B 1JLUE 1MRVA 3BEAA 5IPJA 4FG8A 1WBVA 1EH4A 3D2IA 4GFGA 4GVAA 4YBKA 4ZOGA 4GK4A 4G6LA 2J5FA 4C4EA 3D0EA 5BVKA 1SVGA 3QUEA 3S2PA 4FEQA 3UE4A 3II5A 4IC7A 3HEGA 3NPCA 3L9PA 4IWDA 3SHEA 4MEDA 1B39A 5J9LA 2VO6A 2YLEA 4FZDB 2W06A 5FD2A 2FH9A 4D2VA 2YM7A 4G3DA 3RHXA 3D15A 1H07A 3TIZA 2VX1A 4XV1A 3WF5A 2ZV2A 2QOCA 5C8NA 4DEDA 4ENXA 3EZVA 3OY3A 4QQ5A 1URCA 4QNYA 3QQLA 1Q8TA 4LOPA 4WIHA 3S3IA 4YNOA 5DWRA 5IQFA 5EYCA 1J7UA 4MD7E 3MS9A 4L00A 3PJCA 4IZAA 4D0WA 3MVMA 4CYJA 4DTKA 4ZJIA 2UZLA 3FY2A 3LAUA 3VJNA 4TRLA 4FOCA 4EK6A 4UMTA 3GCUA 5ICPA 4J53A 3DTCA 1T46A 5DT3A 4CFXA 2C1BA 3QWKA 4W9WA 4E6DA 5BYYA 4FL1A 4AW2A 3UZRA 1OM1A 4F6WA 3V5PA 3TV7A 2HIWA 3SG8A 2R3LA 4XX9A 3D5WA 2RG6A 3K3IA 3P0MA 5M53A 4KNBA 5HZNA 3MY1A 2J0JA 3EQBA 5J95A 4PX6A 5C9CA 2PZRA 4F6UA 5BVFA 4BCQA 3WBLA 5AA8A 4EHZA 4GRBA 3NYNA 5J9ZA 3RK7A 3RKBA 4DG3E 3ZMMA 3CCNA 3DOGA 3SRVB 4W9XA 3ZSGA 1ZOGA 3DXPA 5LQFA 2P2HA 2PHKA 4MH7A 3TKUA 4RFYA 3TUCA 4D4YA 2XIKA 3FPQA 3PZEA 3OVVA 3E3PA 4OBOA 3AG9A 2ESMA 2FA2A 4TTHB 2WELA 3BQCA 3TDWA 5IA2A 5AAGA 5I0BA 4R5SA 3EQPA 3EN4A 1KV1A 3BQRA 3QRIA 4F7NA 3LXLA 5DIAA 3ZFYA 3GU6A 2R2PA 2R3IA 4JDJA 4J7BA 5KUPA 4YC3A 2BILB 4ACGA 1Y57A 3EWHA 4NFNA 5E8XA 1PMNA 5T6KA 3C0IA 4YHFA 3UNJA 3W1FA 4GV1A 3THBA 4QMPA 5IEVA 3F69A 5CU0A 4KIKA 2BTRA 3TM0A 1URWA 1P2AA 3QRTA 3VS7A 3UIUA 3S4QA 4C59A 2GFCA 2E9NA 3G90X 3L8VA 2HWOA 4CKJA 3QTZA 2XYUA 4AG8A 5LJJA 3TI1A 1KSWA 2BHEA 3PXKA 3GEQA 3K2LA 3EKKA 3QUDA 5I5ZA 5M51A 1U54A 2GCDA 5IA0A 2GNLA 5CVHA 5EKOA 3UOLA 4Z7HA 4FV6A 3A7JA 3PPKA 2QODA 3AD6A 3OS3A 3OUKA 4PY1A 3FJQE 2R7IA 4IH8A 4FTAA 3DJ5A 4I0SA 2IPXA 3E7OA 4PL3A 2JIUA 2XEZA 4PUZA 4USEA 1BX6A 4UYAA 3AQVA 4YJQA 4PMTA 5AM6A 2A0CX 4IIRA 4IADA 4RMZA 2Z02A 2PVLA 3QF9A 3TKIA 4WUAA 4ZTRA 1PXOA 1P4OA 3CY2A 3ATSA 1KV2A 3NSZA 3QHWA 4HGSA 2JITA 3VULA 5JT2A 2BAQA 3MA6A 2HY0A 1V0PA 2VWVA 2Z60A 3ZEPA 4M69A 5EQYA 4XRJA 4RA5A 4FIIA 5AADA 2CLQA 4XNEA 5CNNA 4BDJA 4ZIMA 2W1GA 5LARA 4PF4A 2X6DA 4TYHB 4QPMA 4CLJA 5JRQA 4DYMA 3I81A 4D55A 4IQ6A 3QX4A 3G51A 3F61A 5L2WA 3OWLA 2GNHA 2WMXA 4PDPA 5J7HA 2WGJA 2HXLA 4KRCA 3SDJA 1JVPP 3PSDA 3C0GA 3IW7A 1BLXA 3HRCA 5JFWA 2QR8A 3MVLA 4RBLA 1O6YA 3VQUA 5E8WA 2WTVA 4W8EA 3WYYA 1WBPA 3Q9XA 2VAGA 2WIHA 2Y7JA 5AX3A 1XH8A 4EOMA 3H9RA 3MH1A 4LV8A 2V62A 3FYKX 4FSNA 5BMMA 4M84A 4WBBB 2PK9A 5A6NA 2WMRA 2VTJA 3MH3A 2VTMA 4L7FA 4ONAA 4RC2A 5IMEA 1VR2A 3WZJA 4H58A 3PY3A 4HJOA 4HYIA 4BCNA 4OLIA 5C4LA 3VBTA 4F7JA 4F9AA 4IX4A 3ZFMA 1KUTA 3GXLA 1BMKA 4YTIA 4QMOA 1NVRA 3SD0A 1JNKA 2BDJA 3MV5A 3RNYA 3EQGA 3KRLA 2QHMA 4LRKA 4EH8A 4DTAA 4O6EA 4YBJA 4A9TA 1M7NA 1R0EA 1UWJA 4BC6A 3R04A 5CEKA 4F1TA 2QU6A 3D7ZA 1H1WA 1IA9A 5I4NA 3NLBA 3R01A 2W17A 3PXQA 1ND4A 5DYJA 2JKKA 1LP4A 1YHSA 4BHZA 3NWWA 4O7TA 4IAFA 3TZ9A 3NUPA 5JFXA 1OIUA 5DOSA 4AOIA 3KCFA 4QMYA 2PUNA 3P08A 2X8EA 2YA9A 4O7SA 4YJUA 5JSMA 4E1ZA 1WBTA 4H3PA 4O6LA 4RFMA 4ASXA 4DEEA 2JFMA 4YZ9A 4DITA 3D94A 3U8WA 2YM8A 3FKOA 3U4UA 2PSQA 3LFNA 4JG7A 3NZ0A 3BHHA 3FXWA 5CY3A 4C3RA 3COMA 4BFMA 4ID7A 4CMTA 4I21A 5CS6A 2F2UA 2ONLC 2ZDUA 1YXVA 5C01A 1XH4A 3MIYA 4DEAA 5TR6A 1SZMA 1YWNA 4L53A 4G17A 4BTKA 4K2RA 3PJ8A 3PXZA 4WOVA 2RL5A 4I41A 4L8MA 4UWYA 4UV0A 5K0KA 3RWQA 1SVEA 5J87A 1GZOA 3VWAA 4RIWA 1JOWB 2RG5A 4BWPA 1ZMVA 4KRDA 4YZBA 4WSYA 4GG5A 4LM5A 2NRYA 1PJKA 3R02A 5KHWA 2CGVA 4DCAA 3DK3A 1FBNA 4CQGA 2YZLA 4Y8DA 3KN5A 5DEWA 4CZYB 4OTPA 1PYXA 3VS1A 5LMAA 5B2LA 3R6XA 3BE9A 4IB5A 3Q4UA 1Q4LA 2QG5A 4K33A 1BYGA 5BYZA 2CNQA 4RJ3A 4FI1A 2BHHA 2KTYA 3IK3A 3PP0A 4FC0A 5K0XA 5AUWA 4AFEA 4LGDA 3Q4CA 4ZSEA 1OPKA 2YM3A 4MNEA 4XV2A 3RZFA 4W4WA 4UBAA 1IASA 5ANJA 3PSCA 3V51A 4FKUA 4FYOA 4EJNA 4O7LA 3IOKA 4MF1A 4EJ7A 5TO8A 3GOPA 4QMNA 1YVJA 4RC3A 4UYNA 3MY0A 3KRWA 2P4IA 4FT0A 4BN1A 3D5UA 4FNYA 3GFEA 2WQMA 1WCCA 4G9CA 2BZJA 3BI6A 4IXPA 3Q6WA 3F2NA 4QMVA 2WTDA 3G9LX 3OBGA 4W4VA 1Y6AA 4Y5HA 5AP4A 4K1BA 5CANA 5J1VA 3NX8A 2XZSA 2UZDA 2FVDA 4L3PA 3TEIA 2YIQA 3MTLA 2WU7A 1YDSE 4BBMA 3ITZA 3TZ7A 3HV3A 3QYZA 4NCTA 3VF8A 3I0OA 5AUVA 3I1AA 3LCSA 4AE9A 3TUBA 2WQOA 5AV1A 3ZO4A 3FI3A 1XH5A 2X7OA 1VZOA 4C38A 3ROYA 2IG7A 4JX7A 4UMRA 5D7VA 4FTMA 2A2AA 4L45A 1L8TA 5CT7A 3PLAE 4U97A 4HYSA 5HU3A 4TPTA 3V5LA 5CAQA 4PRJA 3BHVA 3NNWA 3PVWA 3OW3A 3MJ1A 4G6OA 1L3RE 1SNUA 4CD0A 2GS7A 3LJ0A 2YJRA 4JAJA 1U5QA 4QP3A 4UXLA 3SLSA 5CZHA 2VO0A 5CI7A 5AR7A 4NCTC 3PUPA 4FKOA 4I0TA 3W55A 1KE9A 2V0DA 3F7WA 3JUHA 4F63A 3WIGA 1P14A 3QCYA 5KO1A 4YZMA 2QC6A 4EWQA 5EM7A 4GVJA 3PDTA 4O91A 3SQQA 3U55A 3PIZA 1I09A 2GHLA 4FVPA 3SXSA 2YFXA 3NYVA 1XKKA 4FZ6A 2RKUA 2E2BA 2WMBA 4CT1A 5G1XA 5FEQA 2YZAA 2BRGA 4B0GA 4G3EA 4MXAA 2C6OA 1BL7A 3JY0A 3G33A 4KWPA 3PA4A 2V7AA 3F5UA 5DGZA 1BL6A 3QWJA 3PXRA 3FZSA 4LG4A 3R7UA 3V5JA 4AT5A 2UW5A 3OD6X 4HCVA 4C57A 4I5HA 4DH1A 2YM4A 4LGHA 2B53A 3CTHA 4XG8A 3C4WA 5HG7A 3UC4A 4O0WA 4G31A 3OY1A 4I6BA 4MVFA 5EYMA 4DFXE 1F3MC 2JDVA 3R8ZA 3H4JA 4ZY6A 2LGCA 4V0GB 5FBOA 3P4KA 2IO6A 2W5AA 4EI4A 4HPTE 1IA8A 4QYEA 4AU8A 1H27A 4R77A 1NXKA 3WZDA 4X2NA 2XMYA 2ZMCA 4O27B 5KKRC 3CPCA 2WD1A 2I0HA 2QVSE 3R7VA 1FPUA 3FBVA 3QCXA 2B9FA 2VO3A 3PJ2A 5HGIA 4ARKA 5CYIA 4X3FB 2CKEA 3C51A 2ZV9A 3LOKA 3ZO3A 4O83A 5CSHA 3V01A 4BI1A 4BCHA 4JI9A 3HX4A 5HESA 4NKSA 3IPHA 5JRSA 2Q83A 2BRNA 4FV5A 4FTJA 4GEOA 2WXVA 2J2IB 4LRJA 3ZDUA 2EXMA 1KE5A 3HP5A 3LHJA 2GNGA 3Q5ZA 3RCDA 3NYXA 4GYIA 2W0JA 4YTFA 4S32A 3UVRA 3QQFA 4B6LA 1PW2A 3KF4A 4GT4A 1RE8A 3P79A 1Z57A 2IW8A 5E9EA 4FKLA 4QD6A 3AT3A 1YW2A 2XNEA 2Y4IB 3OG7A 2XRWA 3O51A 4DEIA 4YJSA 5FM3A 1GAGA 1H1RA 4WNPA 4O1OA 2WAJA 2DQ7X 3MVHA 3BWJA 4NW6A 4YHTA 5C8MA 1ZYSA 3WF9A 3ZC5A 4EOQA 5HQ0A 3ALOA 3LE6A 4FKGA 3OWJA 2IZTA 4RT7A 2WQNA 5K4IA 4R1VA 2OJGA 4DFNA 3GCQA 3R28A 4QYGA 5CI6A 3IO7A 2V5QA 4BTJA 4FGRA 5AUXA 5AV2A 2GQRA 2BROA 2HYYA 3OEZA 4J97A 4N0SA 1H8FA 4B8MA 4C33A 2WO6A 3SW4A 5DR2A 5FXSA 3CQWA 3P7CA 4JQ7A 4AQCA 3F82A 4WG3A 2VTTA 5ANEA 3V6SA 1H00A 5HBEA 4EOPA 4QMXA 1KOAA 3A60A 1IR3A 3PXFA 4J8NA 4AT3A 3SXFA 3AD5A 1HCLA 4LOOA 2CKPA 3EHAA 2WMUA 3P78A 4WNKA 4USFA 2HELA 3MFTA 2C30A 4CLIA 2E9PA 4C4FA 5BQ0A 3EMGA 4BCJA 4IZ5A 1JSTA 1OL1A 2Z7RA 4MXZA 4USDA 4UEUA 3TACA 3GI3A 3IDCA 4BWKA 4XG7A 4D2RA 2B7AA 2VTHA 2VTOA 4TNDA 4U40A 4V04A 3R9OA 4CFFA 4FOBA 2OFUA 2UW7A 4ZZMA 3KXHA 4QNAA 4F7LA 4TKSA 3QYWA 2C5OA 1M2RA 4QMUA 4U44A 5M07A 3C0HA 3C1XA 3OP5A 4RPVA 2O5KA 4RX9A 5LOHA 2OLCA 5AFVA 4IFGA 2UZBA 2XK4A 3UBDA 2I7QA 3DB6A 1PMVA 4KIPA 4AN9A 3E8CA 5BUEA 2C0OA 3V6RA 4QPSA 3ZZEA 4OBPA 1ZZLA 2XNOA 5D7AA 2C6IA 2QOOA 2R3JA 3DCVA 3I60A 2IZUA 3EYHA 4FODA 4FMQA 4JLCA 4MXOA 2XKDA 3PE2A 2OJ9A 4BY9E 5JZJA 3R9HA 2P55A 3RAWA 4HVIA 4IFCA 4K18A 4LUEA 4BDBA 3RPYA 3NVKI 3NUXA 3OXIA 1KOBA 4GJ2A 4KIQA 3COHA 2P2IA 4M15A 3OWKA 3QKKA 3MN3A 2B0QA 1OECA 2H8HA 5E8SA 5HX8A 4CSVA 3EL8A 3E7VA 5TOZA 2VWZA 1WAKA 4FKIA 3R8UA 3BZ3A 3SOCA 4DH5A 1ZY4A 4JBVA 4WO5A 4DH8A 1U5RA 3T9TA 3RK5A 2W4KA 5EK7A 3O71A 4XG2A 5D1JA 2BVAA 4PL5A 3P7AA 5EG3A 3SG9A 4RJ4A 4WD5A 4CFWA 3RAIA 3EN6A 1OKVA 4TL0A 3OFMA 4K0YA 3IS5A 4YUQA 4M13A 4RX8A 3LMGA 4TWCA 3U6IA 5IMXA 3NCGA 4YLLA 3VS5A 3OCTA 5HNBA 3DBEA 4O22A 1U59A 3E92A 3O7LB 4BGHA 4FSZA 3OOMA 4EK4A 4J71A 3KFAA 4AZEA 2OBJA 2W9ZB 2VTAA 4UN0C 4AGWA 2R3FA 4XLVA 4BWXA 2XM9A 3ZO2A 3JXWA 4FV0A 2WHBA 3B2WA 4C02A 1OBDA 5HCXA 3I0QA 4QP2A 2YIWA 5KNJA 1JKTA 3GU4A 4ITHA 5AP7A 5AP0A 1Z9XA 3TJCA 3HNGA 2B54A 1W82A 3D5XA 3SV0A 4BDAA 4OUCA 3I7CA 3JVSA 3ORTA 3PA5A 3VUHA 5JGAA 4H36A 2R64A 4CCUA 2IVVA 5IQHA 3EFJA 4FUYA 4D2TA 4XG6A 3WARA 2OF2A 2F49A 3P1AA 5FXRA 5H2UA 5FEDA 1YXUA 2BRHA 4ANSA 5IEXA 2CGXA 3FWQA 2CKOA 4FNXA 1KE7A 2OGVA 3DLZA 4M14A 2PWLA 1FGIA 4MBJA 4YJVA 4HVDA 3VQHA 4EH9A 2XIZA 3LKMA 4FEVA 2XK6A 1YXSA 3FMMA 4IDVA 1APME 2OZAB 3R30A 3NAXA 1HOWA 4W4XA 2ZYBA 4FIGA 2ETRA 3T8OA 4OTRA 2NP8A 3HMOA 3LFDA 4KS7A 3PSBA 1FGKA 5B7VA 3V8WA 3CD8A 1JWHA 3O8PA 3R9NA 2CLXA 4A9YA 3PG3A 3LM5A 2R3PA 3DAJA 2ETMA 4N6ZA 4PDOA 1PF8A 2QI8A 3BBWA 5KKRB 2C3LA 4DFZE 2Y6MA 2WMVA 3WYXA 2WTCA 4IM2A 4PDSA 3V8TA 3SKCA 3D2KA 3WF7A 4I6FA 4ZLZA 4GUEA 3P7BA 4ZZOA 3W8QA 4C3FA 4BI0A 3O7LD 4ITJA 1R78A 4Q9SA 1TQPA 2C68A 4JG8A 4LFIA 4QTBA 5CSXA 3HAVA 4H1JA 3BLHA 4J8MA 3KRXA 4QP1A 4XHKB 4BVUA 2WMTA 5DA3A 4MAOA 4UZHA 3NR9A 3FMKA 3LM0A 5A4QA 3EFWA 4QMLA 1FMOE 4W4YA 2VWYA 3DU8A 4GU6A 4CFMA 3N9XA 3UO6A 2FSMX 2XK7A 3O0GA 3E87A 3PIXA 1REKA 3ETAA 1WBWA 3PZHA 4ZTQA 2PMLX 4FICA 4UWCA 5L6PA 5IZFA 5EM6A 4KBKA 4JRNA 4L43A 3RPOA 4CXAA 3QXOA 4QP6A 4KBCA 3VVHA 4UX9A 4ANBA 5IQAA 5E8UA 2I0EA 4S30A 3ZLYA 2E9OA 4FT5A 3UP2A 3AT2A 5C26A 4RJ7A 4UWBA 1RDQE 3NAYA 4GH2A 5FG8A 5CU2A 3PJ1A 3FL4A 5M08A 4HVSA 4FZAB 5J7BA 5DE2A 4FNZA 5GZ9A 4O86A 4JVGA 4MBLA 3ACJA 1GIJA 2Y9QA 3SXRA 1NT2A 1ZZ2A 1QL6A 4XYFA 2GMXA 3BIZA 3OTUA 4I22A 3F9NA 1JBPE 5CT0A 3VF9A 4Z16A 5IEYA 3BU5A 4PPCA 4YJOA 2JAMA 3A4OX 3TNPC 4O0SA 5J79A 5I3OA 2OIBA 2WMWA 4X6RA 1H25A 3EOCA 1XBCA 5ANGA 3HA8A 4FEUA 2WTKC 4TYIA 2QG7A 4EOKA 5FRIA 3HRBA 4O7NA 2VWWA 1DM2A 2UZWE 4OTDA 4FV9A 4Z9LA 4RJ6A 4EH2A 2C3KA 4QYFA 4IAAA 5FUTA 3NYOA 4O38A 3P23A 4AN3A 5CAPA 1ZMWA 4R7BA 2BAKA 3PA3A 4RSSA 4IHPA 1Q8ZA 5L2IA 2DYLA 3ZM4A 4JDIA 5CVGA 5HVYA 5HIDA 1UNLA 3GBZA 3GC0A 5AA9A 5IG1A 2GTNA 4AZSA 4CNHA 5HG9A 4U5JA 5CEQA 3GQIA 1F0QA 3ZO1A 4LGGA 4IVAA 2QOLA 3BGQA 4FT3A 4ANLA 2UZUE 3CPBA 2W1ZA 3WE4A 1V0BA 5A4TA 4R78A 5GIOE 1MQ4A 1SMHA 3CC6A 5BUIA 3U9CA 1QPDA 2QQ7A 3QFVA 1YI3A 3AXWA 4EUTA 1G5SA 2W1EA 3EQCA 1WBNA 4WKQA 3LCKA 4DFLA 4J52A 5LXMA 3PLSA 4ASDA 2YM6A 1H4LA 4AE6A 5EFQA 3FHIA 4C35A 4V05A 2GHGA 4BCGA 4ERKA 4WSQA 2VNYA 4QP8A 1CM8A 3OMVA 3FPMA 5CLPA 2X8DA 4YPDA 3FLSA 5AP2A 4EONA 3OBJA 5CEOA 3CR0A 1OVEA 2OU7A 5KCVA 5DLSA 4IC8A 3QA8A 5IDNA 3LXPA 3ID6C 4S34A 2EXCX 2PUUA 4YC8A 2XIXA 4K9YA 5IQEA 4PNKA 4O81A 3BEGA 3H0YA 2BTSA 1QPCA 4GYGA 4RVLA 4MQ1A 4BRXA 4QPAA 3W2QA 5EI8A 1YXXA 4P7EA 4GKHA 4O0VA 4ZXTA 5IISA 4ZTSA 4CG8A 4IANA 4X2GA 4X2KA 3WE8A 4YO4A 5HNIX 5FXQA 4QTEA 2WB8A 1YDRE 2H96A 2XH5A 2PZIA 4Y46A 4BTFA 2RFNA 3PPJA 1TVOA 4UMPA 4IVDA 4ACHA 2ITPA 5DRBA 4ACCA 5AJQA 3F3ZA 2AC5A 4I5CA 5CU6A 4GJ3A 5M4FA 5KMIA 3LW0A 2EU9A 4L52A 4L6QA 3I6UA 3FY0A 1UKHA 5A4CA 4M68A 4CGAA 3RALA 3SOAA 5H8GA 3UYTA 3OHTA 3C13A 4FA2A 2IZRA 1PHKA 3HYHA 3RM7A 4FTRA 4O7VA 2VWIA 2XF0A 4DEGA 5GJDA 4CKRA 4PWNA 3R71A 2B1PA 4OBQA 3UP7A 4DFYA 4ACDA 2BR1A 2RFDA 4II5A 4AGUA 4EEVA 5BVDA 3HDNA 2VN9A 1UNHA 3DJ6A 4FL3A 3ALNA 2PVJA 4D58A 3FMHA 4FG9A 1W84A 3M42A 4XP2A 3ZZWA 3UO4A 4DEHA 4O2PA 2XM8A 5ETAA 1OL7A 2GQSA 4LUDA 5F94A 2UZOA 3ENHA 3FAAA 1BI8A 4FGBA 3W2SA 4D5KA 4RIXA 2IVSA 1A06A 3LJ1A 4FVRA 5D41A 1M2QA 3VUMA 4J95A 3ORNA 4XOZA 4TYGA 2R3NA 3FMNA 3FYJX 3IQ7A 3DKFA 3LJ2A 4N4SA 3RPSA 5CXHA 3ZXTA 5IA5A 3CP9A 2WTIA 5HEZA 3Q2JA 5T3QA 3U6HA 2UW9A 3R2YA 4MBIA 4TXCA 2J90A 2VTQA 2LAVA 2JBPA 1G3NA 3MJ2A 3SX9A 3TN8A 4FSWA 3RPRA 2W5BA 4CFNA 2QURA 4RWIA 2CSNA 4ZLOA 4GMYA 4XOYA 1UNGA 3QAME 4FTIA 1AD5A 2YJSA 4ANNA 3VBWA 4JNWA 5I9VA 4ZAUA 2HW6A 3FZ1A 2WMQA 3NRMA 1XHAA 3GUBA 3F3WA 4FTNA 2VTRA 5FBNC 4L7SA 3H9FA 1Q8UA 2XNBA 2QKRA 4KBAA 4NWMA 4BDHA 1SVHA 4PMMA 5AAFA 4E6CA 5C1QB 2REIA 1TQMA 4RVMA 2WTWA 3BPRA 3I4BA 3NIZA 1UU3A 3T9IA 5CF4A 3DZOA 3KQ7A 4ANQA 4GU9A 1Q8WA 3KVXA 4E5AX 3NUAA 4YJTA 4FIEA 4BBFA 5HICA 1OPJA 3RMFA 4BZNA 1XBAA 2CN5A 2O65A 5DEYA 3ZTXA 4JDHA 5A46A 4TW9A 5T68A 3VS3A 3L9LA 4FSMA 3HECA 3AOXA 3C50A 3P5KA 4C8BA 4EOJA 1MRYA 3LFAA 3PXYA 3REPA 5GNKA 1IAJA 2FSOX 3DY7A 1PKDA 2PZYA 1Q3DA 3EQRA 4JBOA 3L9NA 4JBQA 3EQDA 2JFLA 2XBJA 2X1NA 4LMNA 1ZRZA 4OT6A 5DBXA 4DA5A 5JH6A 3BHUA 2G15A 4X3FA 4AA0A 5IA3A 4EOOA 3MA3A 4IB1A 3VUDA 3H9OA 3A7GA 4FX3A 4L42A 3JVRA 3QTSA 4Z55A 4KUJA 4PP9A 1M52A 4IVCA 4E6QA 3F5XA 1SM2A 1W83A 3M11A 3KXGA 4G3FA 3EH9A 5IQGA 2CPKE 3L8SA 2CJMA 2X6EA 3HMNA 2XKEA 4EQMA 4XBUA 2R3KA 2C6MA 1RW8A 4IW0A 3NW7A 3ZFXA 4BDFA 2BUJA 3LXKA 2C0TA 2ERKA 4TYJA 1Q8YA 4GG7A 1HCKA 2R3HA 4XP3A 4I6HA 3NDMA 3ORXA 1FQ1B 2JGZA 2OJJA 4QQJA 4YJNA 5CZIA 3QLGA 3E63A 3QZIA 4WUNA 2BDFA 5EH0A 3L1SA 1OKYA 3CE3A 3FHRA 3R22A 5DT4A 3ZHPC 2W4OA 5CF8A 5GINE 3O2MA 1Y8YA 4EHEA 4QP9A 2XIRA 4I24A 1CKJA 3CY3A 3R9RA 5ANKA 4YURA 2F7XE 3R8MA 1O6LA 2C5NA 5HBHA 3F88A 2XNMA 5ITAA 2O2UA 1H24A 3LQ5A 5CU4A 4BBEA 5K9IA 2HZIA 3EIDA 4QMMA 5LCJA 4AZVA 4C7TA 2ZOQA 3ZSHA 3H10A 4AN2A 3FEGA 4QMZA 5CWZA 1PXJA 2NPQA 3Q9YA 4FIJA 4MXCA 3TNQB 3C9WA 4CZTA 3S00A 3KC3A 4M7IA 1S9IA 3FKNA 2X9FA 5DNRA 3D7TA 1REJA 4D4RA 3E88A 2BZHB 5HX6A 3Q53A 2PY3A 2BKZA 1M7QA 2EUFB 2IN6A 2OH4A 2VZ6A 1W98A 1YXTA 4O0TA 4M66A 4PQNA 4IJ9A 5LVLA 2GNIA 5E90A 2YCQA 2UVXA 3A62A 3AC5A 3GC8A 4WBOA 4LMUA 3R21A 4FNWA 5L3AA 4M97A 2PVYA 4TZRA 2V7OA 4FL2A 4U8ZA 5HE1A 1ATPE 3UOJA 2PPQA 4RIYA 2GHMA 3LCTA 1M2PA 4D5HA 2W96B 4A9SA 4EH4A 3DBQA 3VBYA 2JIVA 1TQIA 3RHKA 5AV3A 4EOLA 4F70A 2W1HA 4CTCA 4FTOA 3LIJA 4EYJA 4CVAA 1H1QA 1ZOHA 4FKJA 3SGCA 3R8VA 3W32A 3DBDA 4FV4A 5LMKA 3E8NA 1RJBA 4ZJJA 5EYDA 1XR1A 3EN5A 3FSKA 5AR8A 4F1MA 5GZAA 3LMHA 4O0XA 3FI8A 2XIYA 2XK9A 4CYIA 4IWOA 4KKHA 4M12A 4TWNA 5L6OA 3A8WA 4I92A 2QO2A 4IWPA 2HOGA 4RZVA 3ZBXA 4CCBA 4DGMA 3VRYA 5AP6A 1ZMUA 5HORA 3QX2A 4E4XA 4Q5EA 2PMNX 2XNGA 4HZRA 4AW5A 4O1PA 2ITZA 3RK9A 4BZOA 3MPTA 1H0VA 4G34A 2R3GA 3KMUA 5HTIA 3RAHA 2X7FA 4UMQA 4E73A 4O84A 5BVEA 3TTIA 3PTGA 3UOKA 3AMYA 5A3XA 3AGLA 4NTSA 4QQTA 3IDBA 4ZSLA 4KINA 3BYSA 4HZSA 3QRKA 4PNIA 3W2OA 4AGDA 4ZSGA 4CKIA 4F1OA 4DF3A 2CMWA 3UZPA 4TNBA 4U3YA 4KD1A 1ZYCA 3V5TA 4DFBA 3A61A 3KK9A 4RWKA 4E3CA 4HGEA 4RG0A 3NUYA 2C0IA 2BPMA 3UPZA 4L67A 4MXXA 2DS1A 4QMSA 5DVRA 4BICA 5LMBA 5FTQA 5AAEA 4HPUE 3KXMA 1ZXEA 5KMKA 3KKVA 3G15A 4MCVA 3POZA 4U3ZA 3HKOA 3DZQA 3UDBA 4KIKB 2BKKA 3OTVA 4K11A 4Y83A 2W7XA 3C7QA 4YNEA 4IB3A 3IKAA 5A14A 3C5IA 4FKRA 3ZOSA 3KMWA 4AA4A 5KX8A 3HA6A 4YR8A 4M0ZA 4L3JA 5L2SA 3DS6A 3VW8A 2HCKA 2OZOA 4F99A 3DA6A 4JR7A 2F4JA 3I5ZA 4D4VA 5LVMA 3PRIA 1STCE 1U54B 2ZMDA 4OTIA 2X9EA 3H3CA 2ITQA 3B8QA 3QCQA 2ITNA 4FIHA 3SAYA 4IAKA 2GDOA 2OK1A 5EYKA 4BIEA 1PMUA 3FQEA 3UMXA 4IX3A 5I9UA 2QU5A 1TKIA 4QQCA 2ITUA 5AIKA 3KULA 4FK6A 2X2MA 4MNFA 3FL5A 4GS6A 3VN9A 3JPVA 4F08A 1H26A 1WMKA 2IVTA 3QQHA 3VW6A 3RNIA 1QMZA 4LI5A 2EB3A 3W2CA 4BDCA 1XJDA 2JAVA 2G2IA 4Y72A 2QHNA 3D14A 5CTPA 5GZ8A 1KWPA 4WNMA 1NY3A 3BU3A 3SVVA 1P5EA 5HLPA 4YZDA 3CXWA 3F5PA 3GCSA 4EL9A 2QR7A 5IQDA 3TWJA 5I9YA 4ZS4A 2PE1A 5CF5A 2GS6A 4QP7A 5CAVA 5LCKA 5J1WA 2I0YA 5EM8A 3R7GA 5EHYA 3CQEA 3VUKA 4EQUA 5FP6A 2PUPA 2PVMA 2XJ0A 3PJ3A 3UNKA 4IMYA 5JK3A 3ODYX 3BRBA 3Q5IA 4M69B 4ZMEA 3QQKA 4PMSA 5M55A 2HZ0A 3MH2A 4HW7A 3MH0A 1GZ8A 4M0YA 3OCSA 1YWVA 5E4HA 1LEWA 2X8IA 3WOWA 4DGLC 3CBLA 2Y8OA 4AT4A 4JS8A 1YDTE 2RFSA 3QGYA 2PZ5A 3NVMB 3HL7A 3HV6A 4IBMA 2UW8A 3ERKA 4XG9A 4ITIA 4PV0A 4F7SA 5EKNA 5AWMA 2PVFA 4A4XA 2QLQA 5EHLA 2RSVA 2O0UA 2YABA 5B2KA 4Q2AA 4OR5A 3PP1A 5BPYA 1DAWA 3HMMA 3U9NA 4O96A 3TZMA 3C4XA 2GFSA 4D2SA 3VUIA 5IU2A 4TY1A 3UOHA 4AAAA 4RIOA 1I44A 2C3JA 3VBXA 2WKMA 1UA2A 3EQFA 4FIFA 4H3BA 4EK3A 4RJ8A 5E7RA 3KB7A 1QPEA 3K5UA 4B4LA 3KL8A 3MI9A 3D4QA 2XUUA 4A7CA 4DG0E 2CGWA 2HENA 2H9VA 5HTBA 1IAHA 1R3CA 2BZIB 4AFJA 1NVSA 2C6KA 2C3IB 5GHVA 3ZUTA 4C4JA 2H6DA 4X6QC 5L2TA 3QD0A 3OWPA 3KN6A 5AR5A 2O3PA 5A9UA 2YERA 3NUNA 2HW7A 1V1KA 4FVQA 1J91A 3QTQA 4RWJA 1MUOA 1V0OA 3E3BX 4F09A 4TN6A 3Q3BA 4NM0A 1Q3WA 5M57A 5CQWA 3ZUUA 3AMAA 1WBSA 3WZEA 1IRKA 4XV9A 3LMIA 4G1WA 3LVPA 3QTIA 3P9JA 4WHZA 2UW0A 3W8LA 1AQ1A 2UUEA 3BV2A 2QOBA 1XH6A 4CMUA 1ZYLA 3R1QA 4I94A 1PXMA 3IGOA 3KA0A 4OTGA 4XV3A 3ZRKA 3HV7A 3M1SA 2X2KA 3QGWA 2J6MA 4F0IA 3DV3A 4BCKA 3KEXA 1K2PA 3FXXA 3UVQA 1OL5A 3CD3A 4ANMA 4CRSA 1AGWA 3GP0A 3S1HA 5FDXA 2PYWA 4G3CA 4E4LA 4BGGA 2PMOX 4E4MA 5HI2A 4BKYA 2W1IA 3ORIA 3VUGA 5A54A 5I9WA 5M4UA 1OBGA 5CAUA 4E6AA 3OUNB 4DGNA 4ZY4A 2OG8A 2QOQA 2JBOA 3QTRA 3ULIA 5JFSA 2JDRA 3D5VA 3MFSA 5J8IA 3A7HA 3LLTA 4WA9A 4XG4A 3C4FA 5FGKA 5E8VA 2CCHA 2G2FA 2W05A 4KSPA 4ZTHA 4WG4A 2B52A 2YITA 2Y0AA 3FZRA 2YIRA 5CXZA 2B9IA 3Q4TA 4LYNA 3F66A 4A9RA 1JAMA 2GQGA 5E1SA 4E20A 2YDKA 2FO0A 2O63A 4I4FA 3SRVA 3FI4A 5HO8A 4WRGA 1DS5A 3CIKA 4ERWA 4TWPA 3F3VA 5E8YA 4W8DA 1UU8A 3GU7A 5CF6A 2JDSA 3WF6A 1NA7A 4XH6A 5EI6A 4AXAA 4C36A 5HLWA 3FKLA 2HAKA 4XP0A 3ZYAA 4BGQA 5HD7A 2IW9A 1PMEA 3OT3A 4NU1A 2WEIA 4JX3A 2HXQA 4ZTNA 3UGCA 4F9YA 3E93A 3Q52A 3CLYA 4JL9A 2PVKA 4MNEB 1R39A 4G5JA 2QOKA 4J98A 3G2FA 5AEPA 4BDGA 2FGIA 4ORKA 5CALA 4YJPA 4QMTA 4CZUA 3W2PA 4MWIA 4V01A 3R7OA 3R1YA 3MFRA 3HDMA 3BWFA 4HGTA 4IE9A 3N4UA 2A4LA 4MK0A 5A6OA 4M8TA 2C5YA 5DG5A 4DGOA 3FZOA 3VBVA 4XMOA 3TIYA 2IWIA 2OSCA 4J1RA 2VO7A 4JDKA 5K3YA 2CNVA 1X8BA 4AUAA 5DPVA 2XA4A 3TKHA 3TUDA 2OWBA 2CDZA 3UQCA 3PY1A 3G9NA 4GIIA 3JS2A 3UMWA 3BYUA 1MRUA 4K77A 4U79A 5HCYA 2YIXA 3EN9A 2I6LA 4AA5A 3UQFA 4EHVA 1Y6BA 3DKOA 3IW4A 4AGCA 3U51A 4MF0A 4YSJA 3MESA 5H3QA 2BIYA 2WOTA 5TT7A 4E4NA 4YLKA 4I4EA 4U81A 4X2FA 4R3RA 2HK5A 3Q9WA 2DUVA 5EOBA 4PPAA 2W99B 3C4EA 3HUCA 3BLRA 2JDTA 3COKA 4I6QA 2CCIA 2YACA 4P5QA 4QTDA 3BHTA 3ZRMA 2G01A 4C37A 2VGOA 1XQZA 1YOLA 3FSFA 1OUKA 2IW6A 3OCGA 3IECA 4MD8E 5D11A 2VWXA 4AWIA 3IW6A 3BGPA 5IUHA 2WZJA 3A8XA 2ZB0A 1JKLA 1P4FA 4IAZA 4MX9A 2ITVA 5TF9A 4FTKA 5CASA 4FKSA 3ORLA 3V5QA 4U41A 1UV5A 4OTQA 4TYHA 4IZYA 3O23A 3GCVA 3TTJA 2YHVA 2OW3A 2VX3A 3H30A 5HO7A 2UVZA 1F5QA 4OT5A 3PFQA 4FTLA 2PTKA 4Y85A 5JFVA 3FMDA 3FC2A 4GFOA 4KB8A 4I5PA 5E92A 3MIAA 4DG2E 2YAKA 5AUYA 5L8JA 4DT9A 3A2CA 3CTQA 4R5YA 4APPA 1CKIA 4P2KA 1QPJA 2V22A 4J96A 4U43A 5F95A 3ZU7A 4CG9A 3KRRA 4EKKA 3GC7A 1LUFA 4FF8A 4QTCA 2JDOA 1GZNA 5KZIA 3WIKA 2WIPA 4BHNA 2YISA 3GC9A 3CJGA 4FSQA 4BCFA 5IH4A 5M4CA 1UU7A 2R3QA 5E1EA 5F9EA 3QXPA 4OW8A 3FI2A 5EDPA 2F7EE 4UB7A 4E5BA 3ATTA 4NZWB 2J7TA 1U4DA 2XBAA 3F6XA 4QYYA 5HLNA 5AP3A 2BALA 1UU9A 2EWAA 2J4ZA 3QTXA 4RZWA 4WRSA 5FQDC 5BVWA 5AM7A 4EH3A 2EVAA 2XS0A 3TV4A 5FDPA 2EXEA 4NIFB 3K5VA 2OFVA 3Q96A 4DH7A 1Q61A 3F3UA 3MGYA 3PWDA 4HNFA 4FG7A 1IG1A 3BLQA 4O7WA 2WTJA 3BKBA 5C27A 2R3MA 4EZ3A 4AZFA 4BI2A 3QZHA 3GCPA 2Q0BA 3VBQA 5DH3A 1ZAOA 1SNXA 5JMSA 5M06A 4NEUA 5J5TA 4C2WA 4YJRA 3ZUVA 1DAYA 4ZS0A 3DT1A 5HOAA 4FKTA 3Q2MA 1YOMA 4G3GA 3MWUA 4L44A 3I6WA 5HIEA 4FEXA 3NIEA 3QC4A 1SYKA 3FMEA 4UXQA 4IAYA 3VS0A 3EYGA 1CMKE 3WILA 2X2LA 2ITOA 2NRUA 4RX7A 1OMWA 4XJ0A 4DBNA 4DINA 4NL0A 3KXXA 1GIIA 2QCSA 2YWPA 3LZBA 4L46A 4FSTA 2YWVA 4FE2A 3RVGA 3TZ8A 3GU8A 4NW5A 2JEDA 2QOFA 5KMLA 3QQUA 4ZZNA 3RI1A 1K9AA 2WQBA 4C3PA 4EWHA 3B8RA 5AUUA 3F5GA 2XB7A 2UW3A 3N51A 2VGPA 5IDPA 4F4PA 4YSMA 3FQSA 4IACA 1JPAA 4ZMFA 3FLYA 4YZCA 2ZM4A 1WFCA 4N70A 1Q41A 2ZAZA 5HG8A 1YHVA 3QTWA 1PXPA 3BELA 3R1SA 4XBRA 3TG1A 2BFYA 4OAVB 3JYAA 1GOLA 2JC6A 2R5TA 4QOXA 1YKRA 1H0WA 4JXFA 3Q60A 4AOJA 3OEFX 4JQ8A 3NCZA 4CQEA 5JEBA 2C69A 5M4IA 3TV6A 2O8YA 4DC2A 3VO3A 4BB4A 4OGRA 2Z7QA 5LVNA 4YLJA 4EQCA 2PE2A 2Z7SA 3PVGA 4NM7A 3S0OA 2A1AB 3TNIA 4B99A 2YN8A 5HD4A 3VC4A 3QTUA 4X2JA 4DH3A 3PE1A 4F9BA 2VX0A 1YI4A 4RVTA 3DAKA 5GJFA 3MVJA 3OOGA 4QT1A 4BR3A 1MQBA 2YEXA 2R0UA 3GVUA 5TE0A 1G8AA 4JT3A 4IM0A 1YOJA 3ET7A 3QZGA 4IX5A 3MPMA 4MWHA 2HWPA 3HP2A 4A4OA 4OTWA 5JGDA 1JKSA 3R63A 3R8LA 3BV3A 3VAPA 2P33A 5BVOA 5AR4A 4P5ZA 4R7IA 3HZTA 4C61A 1JQHA 4FSRA 3UPXA 3RTPA 4NYEA 2B55A 2PVHA 5E91A 4D1SA 1CTPE 5I9XA 3KREA 5LVOA 4F6SA 5DN3A 3G6HA 4QTAA 3BBTB 3GNIB 1W7HA 5EW8A 1YRPA 4I93A 4BDEA 2VU3A 3HRFA 4GT3A 3ORPA 2Q0NA 1PXIA 3OT8A 4U7ZA 4BTMA 2J5EA 4XG3A 4YGAA 5DMZA 1E1VA 4N57A 3ZRLA 3DXNA 3R2BA 3DFCB 3ZS5A 3ZCLA 4BL1A 2G9XA 3VHEA 3MPAA 3BYMA 1OIRA 4PPBA 1FVRA 2QOIA 4NSTA 4G2FA 1OIYA 2OXDA 4BCIA 2I1MA 3R1NA 1XO2B 4R6VA 4Z3VA 3QKMA 4CRLA 2CKQA 3L8XA 3W2RA 4WNOA 4EYMA 3CJFA 3FXZA 2QLUA 3PY0A 5L8LA 4RQKA 1XBBA 3WZUA 4YZNA 3ZONA 5HE2A 4D2WA 2H34A 2FSLX 2ETKA 4KKEA 5HE0A 1J1CA 1H01A 2XJ2A 4BDKA 2C47A 3KGAA 5ANDA 2ZV7A 2C5XA 2NNWB 3GQLA 2CHLA 3D9VA 3QD4A 1Q97A 2IVUA 4FBXA 4I20A 2C1AA 3GENA 5HKMA 5E8TA 4C58A 1PKGA 4R7HA 1R0PA 3DBFA 1OGUA 4X3JA 3KU2A 4EH7A 5CEMA 5DFPA 4FV3A 4FSUA 4BKZA 2QKWB 4CFUA 4EK5A 1ZYDA 3SC1A 3ORKA 5D9HA 1JSVA 1QCFA 2ZVAA 5A4LA 2X81A 3QD3A 5AX9A 1PXNA 3KXNA 3EQIA 5CEPA 2VTIA 3DBCA 4JIAA 3MYGA 4GW8A 3A7FA 1XH9A 2CGUA 4V0GA 4BIBA 1FINA 1FOTA 3UIBA 5KMMA 3FLNC 3W18A 4DEBA 3OF0A 2F2CB 3PIYA 5FTOA 3R7IA 4PL4A 3PVUA 3Q4ZA 2OXYA 4HGLA 3AD4A 3T3VA 4NJ3A 3AC1A 3N4TA 1Y8GA 4F64A 3W16A 5IQBA 3OROA 2WEVA 5HHWA 2XKCA 3RINA 3ROCA 3C4CA 3Q32A 4AZWA 5BUJA 2W1CA 4ASZA 3HGKA 5EM5A 3IDPA 2PL0A 4KA3A 2XNPA 3IONA 4EKLA 3R7EA 3R8PA 3I79A 3UQGA 2Z8CA 3VS6A 2R3OA 3GOKA 3Q9ZA 1E1XA 2ZDTA 1XH7A 1PYEA 4FKVA 4FK3A 4XEYA 5KE0A 3HV4A 4CFVA 4PDYA 4OAUC 1H28A 3CEKA 4L3LA 1K3AA 5JGBA 3ZXZA 4C34A 4EOSA 4KKGA 5HBJA 4DT8A 4ZTLA 5CSPA 4E93A 4ANOA 2UW6A 1KE6A 2X7GA 3MSSA 2RFEA 2QONA 3ANQA 3NMUF 4X3FC 2OH0E 5K5NA 2OXXA 2BAJA 2F7ZE 3CQUA 4XLIA 4ALVA 5AV4A 4O7ZA 5CU3A 4E7WA 5M56A 4MHAA 3AC2A 2OF4A 2V55A 4DAWA 3UG2A 2HZ4A 2WTKB 1T45A 3BE2A 4FV1A 4DFUA 1B6CB 3VUTA 4GUBA 1Q62A 3BCEA 2GNJA 4TWOA 1RQQA 3TCPA 3FLWA 5HNGA 2Y4IC 2WFYA 3DNDA 1Q5KA 4EBVA 3A4PA 4OTFA 5HIBA 4AOTA 3E8EA 4CMOA 2X39A 3A7IA 3F7ZA 4NT4A 3BGZA 3FZTA 3DQXA 2CNUA 4C4HA 4LRMA 1ERKA 5BMSA 4L68A 2J0LA 5EW9A 2ONLA 1UVRA 4R1YA 3QHRA 2C4GA 1ZARA 3ORMA 5IA4A 5H9BA 3S95A 3LQ3A 2BMCA 5JN2A 2BIKB 1O6KA 1ZLTA 1H1PA 2YIYA 3ENMA 3O17A 4FV8A 4JAIA 4RVKA 5AIRA 5EW3A 5ACBC 5F20A 1DI9A 4HCUA 4A06A 5JQ8A 4O2ZA 4AS0A 2PULA 4DLJA 3SA0A 3LQ8A 4QRCA 2VWUA 3E62A 4L01A 3RWPA 4FTQA 5EQPA 3CSVA 3QKLA 5AP1A 4AF3A 3RAKA 4AX8A 5DRDA 3NGAA 4G6NA 1OI9A 4FYNA 5AMNA 1OPLA 5GJGA 2FUMA 1FVTA 4HOKA 4KABA 1J7IA 3QA0A 1Q99A 3FQHA 3DKCA 4RLLA 1PY5A 2VTLA 4RFZA 3NEWA 4YC6A 4BF2A 4HYHA 5LWMA 1GIHA 4G16A 5B2MA 4D9TA 5EI2A 1M14A 5IQIA 5KHXA 3RP9A 1OZ1A 2R9SA 3RGFA 3VIDA 2IJMA 1DI8A 4BDIA 3IW5A 3BYVA 2IZSA 3FUPA 3KY2A 2EB2A 1OKZA 1OL2A 2XVDA 2R0IA 3R00A 2YDJA 3RCJA 4NUSA 2C6LA 2ACXA 4JOAA 3MY5A 4E5WA 4DTBA 4QO9A 3ZEWA 5LMKC 4PMPA 3OXTA 3DNEA 3EQHA 3AT4A 4PTEA 1Z5MA 5IF1A 2VWBA 4O0RA 3UO5A 3L9MA 3I7BA 3FLZA 2I0VA 1OIQA 3FMLA 3ORZA 5F1ZA 4EHGA 1KE8A 1J7LA 2PUIA 4EUUA 2X4ZA 3ZLWA 5M09A 4B8LA 4IJPA 1YI6A 2CN8A 3LPBA 4GFMA 2OIQA 4D4SA 2XRUA 3KVWA 2YM5A 4Y5QA 4MKCA 4GKIA 2F9GA 1W0XC 2ZV8A 3DQWA 4JQEA 4QP4A 2UZTA 4U6RA 5BNJA 4GK2A 4I0RA 1OKWA 3DGKA 3MBLA 5CQUA 4BKJA 5EHOA 3G0EA 3WI6A 5BX0A 4UY9A 1J1BA 5J5SA 1WVXA 3TJDA 4EZ5A 5KBRA 3EFLA 4S2ZA 5AUZA 3DKGA 4CEGA 3GU5A 3PG1A 4DE4A 2ITXA 3IOPA 2GPHA 4RC4A 4FZ7A 1GZKA 2QO9A 2ZJWA 4NTTA 5AV0A 5CVFA 5FLFA 1CSNA 4FSYA 3IW8A 4HYUA 3KMMA 3QRUA 4KIOA 2BFXA 3OCBA 4LQMA 2OIDA 2R7BA 3QU0A 4UALA 1FVVA 3ZBFA 2YCSA 2JLDA 2X4FA 2E9VA 2WOUA 3MDYA 4F9CA 3ELJA 4YPSA 3TXOA 4EZ7A 2C6EA 4EK8A 5AR2A 2GSFA 3DK6A 2GS2A 1WVWA 3ODZX 4RIXB 3KRJA 2FB8A 4A4LA 3COIA 3KXZA 2HZNA 4KS8A 3F2RA 2XK3A 4I5MA 2QNJA 5FP5A 3DDPA 2FSTX 3POOA 3HAMA 3TDVA 3OZ6A 4O0YA 5CSWA 5DR9A 3P86A 2OZAA 3AC4A 3N4VA 3CGFA 4U9AA 2UZEA 4Y95A 3D83A 2XNNA 4RLKA 1LEZA 5M44A 3WZKA 1FMKA 3R73A 4FKPA 5CAOA 1NVQA 3R9DA 3HVCA 4R3CA 3DPKA 4AW0A 3V3VA 4DCEA 2A27A 4MQ2A 5L4QA 3L8PA 2JIIA 1BI7A 4C62A 4GT5A 5DI1A 3JR1A 1GNGA 5F4NA 3VS4A 4U42A 3HLLA 3B2TA 3QZFA 2YAAA 4NK9A 3DAEA 4ZSAA 4GK3A 1G8SA 2R4BA 3QCSA 3ZDIA 2HY81 4ZY5A 5KBQA 3AC8A 5I9ZA 4ZK5A 4JBPA 4D28A 3LFSA 2AC3A 3GT8A 3NUUA 4ENYA 5HU9A 2AUHA 2JKQA 4H05A 4I23A 2W5HA 2WPAA 3BYOA 4CV9A 5FEEA 3OW4A 2YCFA 4RJ5A 1UKIA 1GJOA 2XJ1A 4FV2A 3ULZA 2XCHA 4UZDA 5A4EA 4NH1A 1JKKA 4AP7A 5HTCA 2XKFA 4FTCA 2J9MA 3ZSIA 4BZDA 4DHFA 2B9JA 2WMSA 2NO3A 4FT9A 3BHYA 3VJOA 2YCRA 2VUWA 3TNWA 3G6GA 5CEIA 5IH5A 4L9IA 2Z2WA 3MFUA 5KMNA 3PPZA 3Q04A 4PTGA 2RGPA 2C5VA 4R3PA 3RM6A 4A9UA 4O7YA 3ZM9A 4IZ7A 3VRZA 2JKOA 2QD9A 4F0GA 4AACA 5GIPE 1PRYA 4HNIA 4NM5A 1W8CA 5DR6A 4C0TA 4U0IA 4NIFA 4P90A 2PZPA 4RWLA 3W33A 4C4GA 1A9UA 3KCKA 2JKMA 5TKDA 3EL7A 4CT2A 2W1FA 4O82A 4IVBA 5IH6A 2BZKB 4D0XA 3W10A 2G1TA 4EBWA 4EC9A 4TYEA 2OJIA 2VV9A 4E26A 5J9YA 2DWBA 4TT7A 3FMJA 1LPUA 2E9UA 3NNUA 5FM2A 1LR4A 4ZJVA 2ZB1A 1NW1A 2VTPA 4AW1A 2OO8X 4S33A 3FLQA 3O50A 4FR4A 4EORA 5IUGA 5K5XA 2C6DA 3K3JA 1Y91A 2J50A 4MXYA 5C03A 1ZOEA 5DT0A 4XS2A 2UW4A 1R1WA 1YWRA 4PP7A 1OB3A 4QMQA 2VRXA 2W9FB 3DTWA 5CSVA 5IUIA 3DB8A 3LFFA 4AZTA 4GL9A 5C4KA 1H08A 4H39A 4RQVA 5EOLA 5IQCA 1S9JA 4MYGA 3UODA 4ALWA 2J51A 2R3RA 1WVYA 3EJ1A 5D10A 4JRVA 3D7TB 3CTJA 1XWSA 1YQJA 3EKNA 4B9DA 4IAIA 1H1SA 3IGGA 4X0MA 4ZTMA 4YTCA 4NJDA 5E8ZA 1BUHA 2PVRA 2YDIA 4WG5A 3DFAA 5L8KA 5G6VA 4J99A 4GIHA 3Q6UA 2ITTA 3GGFA 4IWQA 2OICA 3V8SA 5LWNA 3NNVA 2G2HA 4RIYB 3WF8A 4HVGA 5JKGA 2Y4PA 1WZYA 4IDTA 4ZP5A 1E9HA 2A19B 4RIWB 4S31A 4ZEGA 3DDQA 4A07A 2GNFA 2Y6OA 5K4JA 4NKAA 3PWYA 3LFCA 4FUXA 4IM3A 5HCZA 4EH5A 3SW7A 1O9UA 4C4IA 4K8AA 4FTUA 3AMBA 3CGOA 5CENA 3O96A 4B7TA 4Q5HA 4Q9ZA 3ZH8A 3A99A 3HMIA 4JIKA 3LLAA 5B0XA 3VS2A 4I1ZA 5HO6A 2BRMA 2PVNA 4U45A 4BCOA 3EB0A 4M67A 5D12A 4D9UA 4ASEA 3NW5A 5FTGA 3C4ZA 3QL8A 3UIXA 4XRLA 2X0GA 4D1XA 2UZVA 2RIOA 3KF7A 3QBNA 4BCPA 5ETCA 4DLIA 4JJRA 3UYSA 2PU8A 1WBOA 4RGJA 3HV5A 3LCDA 1ZWSA 4FV7A 2KULA 4RA4A 4YU2A 4D1ZA 3LFBA 2GTMA 2ITYA 4FKWA 4ALUA 5DHJA 2P3GX 2XK8A 1GY3A 3F2AA 5HVJA 4R8QA 4BDDA 3MTFA 5HG5A 3UJGA 4ZSJA 3EFKA 1VYWA 2QOHA 4QYHA 3TL8A 3R0TA 2J0IA 4YTHA 4P4CA 5HE3A 3U54A 3EZRA 2J0MB 2OKRA 4NFMA 5IKWA 4UMUA 1MP8A 2J0KA 3QQJA 4KSQA 5EDRA 4O7RA 5ETFA 3PVBA 4M3QA 5CX9A 1B38A 3H0ZA 3TT0A 4ZLYA 4LOQA 4EOIA 3K54A 4KAOA 3E64A 1IEPA 4LL0A 3FE3A 4FT7A 1CDKA 2Z7LA 5AR3A 3LFQA 4IX6A 4DBXA 4CV8A 3V5WA 4WT6A 2WNTA 3BX5A 3NS9A 3U4WA 3PRFA 4K6ZA 4BIDA 3NNXA 3MB7A 2P0CA 3LCOA 4GCJA 4HVHA 3UNZA 4X21A 3QC9A 3V04A 5AUTA 3R7YA
chains in the Genus database with same CATH superfamily
5BVNA 2ERZE 1OUYA 3VHKA 3CS9A 3O8UA 5ETIA 3U87A 2VD5A 3ACKA 1UWHA 1VEBA 4C2VA 4FZFB 4CTBA 2BRBA 3IG7A 5ANIA 4O0UA 2OI4X 4DGGA 3QUPA 2B4SB 2W1DA 3KULB 2QO7A 2XCKA 3C5UA 5KMJA 4BYIA 4NM3A 3OXZA 3T3UA 4FKQA 3QQGA 2ZM1A 4LL5A 3CKWA 3TYKA 4X7QA 4FTTA 3RJCA 3UVPA 4FEWA 2FYSA 5I3RA 3TNHA 2AYPA 2B9HA 3OC1A 4QMWA 5IA1A 4PTCA 3ANRA 2C6TA 3ZLXA 3CKXA 4OTHA 4F0FA 3DJ7A 4LV5A 4D2PA 2BCJA 5JZNA 3GB2A 4RRVA 3G0FA 3ZC6A 4U80A 4Y73A 1YHWA 2ITWA 3I5NA 4E8AA 4G5PA 1U46A 5AP5A 4F9WA 3RPVA 1OITA 4BYJA 1ZYJA 4YMJA 3LXNA 5EQEA 3DK7A 3FZPA 5JQ5A 5LVPA 3UZTA 1A48A 2ZM3A 1M17A 1PXLA 2JD5A 5C8KA 2VTSA 1PXKA 1ZY5A 3AC3A 4HCTA 4IEBA 5FWKK 1VJYA 4RX5A 3PYYA 3QLFA 2O64A 3MW1A 3UG1A 4ACMA 3HMPA 4MTAA 3DXQA 4EC8A 2I40A 3KK8A 2UV2A 4I3ZA 3FV8A 3E5AA 3GFWA 2F57A 2PMIA 4YP8A 4EH6A 3O8TA 1JSUA 2GU8A 2WQEA 2XYNA 2XEYA 1J3HA 2BDWA 3FC1X 4XUFA 2XP2A 3E8DA 3EN7A 3G5DA 4DN5A 1Q24A 2WMAA 5BYLA 4IB0A 2OJFE 3HUBA 4N6YA 1OL6A 3R83A 3RZBA 3JY9A 3VNTA 2SRCA 4F65A 4Z7GA 3LFEA 3QRJA 2VTNA 5HVKA 2VNWA 3ZLSA 3BU6A 4XCUA 1CKPA 4O21A 3UIMA 5L6WL 3UTOA 5H8BA 2WU6A 3M2WA 4H1MA 5ANOA 3UC3A 2RF9A 3NUSA 4H3QA 5KZ0A 4YO6A 1BKXA 5EDQA 2UZNA 3RBWA 3QALE 5ACKA 2YLFA 2UVYA 3AGMA 4G9RA 3U6JA 2W4JA 5CNOA 1VYZA 3MB6A 5KMOA 4APCA 3NW6A 2PE0A 4BCMA 4MD9E 3DLSA 5H8EA 4GSBA 4JG6A 4YHJA 4JR3A 5L2QA 3FDNA 1TFFA 3F3TA 3QD2B 1JLUE 1MRVA 3BEAA 5IPJA 4FG8A 1WBVA 1EH4A 3D2IA 4GFGA 4GVAA 4YBKA 4ZOGA 4GK4A 4G6LA 2J5FA 4C4EA 1VLRA 3D0EA 5BVKA 1SVGA 3QUEA 3S2PA 4FEQA 3UE4A 3II5A 4IC7A 3HEGA 3NPCA 3L9PA 4IWDA 3SHEA 4MEDA 1B39A 5J9LA 2VO6A 2YLEA 4FZDB 2W06A 5FD2A 2FH9A 4D2VA 2YM7A 4G3DA 3RHXA 3D15A 1H07A 3TIZA 2VX1A 4XV1A 3WF5A 2ZV2A 2QOCA 5C8NA 4DEDA 4ENXA 3EZVA 3OY3A 4QQ5A 1URCA 4QNYA 3QQLA 1Q8TA 4LOPA 4WIHA 3S3IA 4YNOA 5DWRA 5IQFA 5EYCA 1J7UA 4DHJA 4MD7E 3MS9A 4L00A 3PJCA 4IZAA 4D0WA 3MVMA 4CYJA 4DTKA 4ZJIA 2UZLA 3FY2A 3LAUA 3VJNA 4TRLA 4FOCA 4EK6A 4UMTA 3GCUA 5ICPA 4J53A 3DTCA 1T46A 5DT3A 4CFXA 2C1BA 3QWKA 4W9WA 4E6DA 5BYYA 3W0OA 4FL1A 4AW2A 3UZRA 1OM1A 4F6WA 3V5PA 3TV7A 2HIWA 3SG8A 2R3LA 4XX9A 3D5WA 2RG6A 3K3IA 3P0MA 5M53A 4KNBA 5HZNA 3MY1A 2J0JA 3EQBA 5J95A 4PX6A 5C9CA 2PZRA 4F6UA 5BVFA 4BCQA 3WBLA 5AA8A 2IEWA 4EHZA 4GRBA 3NYNA 5J9ZA 3RK7A 3RKBA 4DG3E 3ZMMA 3CCNA 3DOGA 3SRVB 4W9XA 3ZSGA 1ZOGA 3DXPA 5LQFA 2P2HA 2PHKA 4MH7A 3TKUA 4RFYA 3TUCA 4D4YA 2XIKA 3FPQA 3PZEA 3OVVA 3E3PA 4OBOA 3AG9A 2ESMA 2FA2A 4TTHB 2WELA 3BQCA 3TDWA 5IA2A 5AAGA 5I0BA 4R5SA 3EQPA 3EN4A 1KV1A 3BQRA 3QRIA 4F7NA 3LXLA 5DIAA 3ZFYA 3GU6A 2R2PA 2R3IA 4JDJA 4J7BA 5KUPA 4YC3A 2BILB 4ACGA 1Y57A 3EWHA 4NFNA 5E8XA 1PMNA 5T6KA 3C0IA 4YHFA 3UNJA 3W1FA 4GV1A 3THBA 4QMPA 5IEVA 3F69A 5CU0A 4KIKA 2BTRA 3TM0A 1URWA 1P2AA 3QRTA 3VS7A 3UIUA 3S4QA 4C59A 2GFCA 2E9NA 3G90X 3L8VA 2HWOA 4CKJA 3QTZA 2XYUA 4AG8A 5LJJA 3TI1A 1KSWA 2BHEA 3PXKA 3GEQA 3K2LA 3EKKA 3QUDA 5I5ZA 5M51A 1U54A 2GCDA 1XMLA 5IA0A 2GNLA 5CVHA 5EKOA 3UOLA 4Z7HA 4FV6A 3A7JA 3PPKA 2QODA 3AD6A 3OS3A 3OUKA 4O4FA 4PY1A 3FJQE 2R7IA 4IH8A 4FTAA 3DJ5A 4I0SA 2IPXA 3E7OA 4PL3A 2JIUA 2XEZA 4PUZA 4USEA 1BX6A 4UYAA 3AQVA 4YJQA 4PMTA 2XAMA 5AM6A 2A0CX 3BLAA 4IIRA 4IADA 4RMZA 2Z02A 2PVLA 3QF9A 3TKIA 4WUAA 4ZTRA 1PXOA 1P4OA 3CY2A 3ATSA 1KV2A 3NSZA 3QHWA 4HGSA 2JITA 3VULA 5JT2A 2BAQA 3MA6A 2HY0A 1V0PA 2VWVA 2Z60A 3ZEPA 4M69A 5EQYA 3W0MA 4XRJA 4RA5A 4FIIA 5AADA 2CLQA 4XNEA 5CNNA 4BDJA 4ZIMA 2W1GA 5LARA 4PF4A 2X6DA 4TYHB 4QPMA 4CLJA 5JRQA 4O4CA 4DYMA 3I81A 4D55A 4IQ6A 3QX4A 3G51A 3F61A 5L2WA 3OWLA 2GNHA 2WMXA 4PDPA 5J7HA 2WGJA 2HXLA 4KRCA 3SDJA 1JVPP 3PSDA 3C0GA 3IW7A 1BLXA 3HRCA 5JFWA 2QR8A 3MVLA 4RBLA 1O6YA 3VQUA 5E8WA 2WTVA 4W8EA 3WYYA 1WBPA 3Q9XA 2VAGA 2WIHA 2Y7JA 5AX3A 1XH8A 4EOMA 3H9RA 3MH1A 4LV8A 2V62A 3FYKX 4FSNA 5BMMA 4M84A 4WBBB 2PK9A 5A6NA 2WMRA 2VTJA 3MH3A 2VTMA 4L7FA 4ONAA 4RC2A 5IMEA 1VR2A 3WZJA 4H58A 3PY3A 4HJOA 4HYIA 4BCNA 4OLIA 5C4LA 3VBTA 4F7JA 4F9AA 4IX4A 3ZFMA 1KUTA 3GXLA 1BMKA 4YTIA 4QMOA 1NVRA 3SD0A 1JNKA 2BDJA 3MV5A 3RNYA 3EQGA 3KRLA 2QHMA 4LRKA 4EH8A 4DTAA 4O6EA 4YBJA 4A9TA 1M7NA 1R0EA 1UWJA 4BC6A 3R04A 5CEKA 4F1TA 2QU6A 3D7ZA 1H1WA 1IA9A 5I4NA 3NLBA 3R01A 2W17A 3PXQA 1ND4A 5DYJA 2JKKA 1LP4A 1YHSA 4BHZA 3NWWA 4O7TA 4IAFA 3TZ9A 3NUPA 5JFXA 1OIUA 5DOSA 4AOIA 3KCFA 4QMYA 2PUNA 3P08A 2X8EA 2YA9A 4O7SA 4YJUA 2XARA 5JSMA 4E1ZA 1WBTA 4H3PA 4O6LA 4RFMA 4ASXA 4DEEA 2JFMA 4YZ9A 4DITA 3D94A 4DHIB 3U8WA 2YM8A 3FKOA 3U4UA 2PSQA 3LFNA 4JG7A 4LV7A 3NZ0A 3BHHA 3FXWA 5CY3A 4C3RA 3COMA 4BFMA 4ID7A 4CMTA 4I21A 5CS6A 2F2UA 2ONLC 2ZDUA 1YXVA 5C01A 1XH4A 3MIYA 4DEAA 5TR6A 1SZMA 1YWNA 4L53A 4G17A 4BTKA 4AXDA 4K2RA 3PJ8A 3PXZA 4WOVA 2RL5A 4I41A 4L8MA 4UWYA 4UV0A 5K0KA 3RWQA 1SVEA 5J87A 1GZOA 3VWAA 4RIWA 1JOWB 2RG5A 4BWPA 1ZMVA 4KRDA 1W2FA 4YZBA 4WSYA 4GG5A 4LM5A 2NRYA 1PJKA 3R02A 5KHWA 2CGVA 4DCAA 3DK3A 1FBNA 4CQGA 2YZLA 4Y8DA 1W2CA 3KN5A 5DEWA 4OTPA 4CZYB 1PYXA 3VS1A 5LMAA 5B2LA 3R6XA 3BE9A 4IB5A 3Q4UA 3AKLA 1Q4LA 2QG5A 4K33A 1BYGA 5BYZA 2CNQA 4RJ3A 4FI1A 2BHHA 2KTYA 3IK3A 3PP0A 4FC0A 5K0XA 5AUWA 4AFEA 4LGDA 3Q4CA 4ZSEA 1OPKA 2YM3A 4MNEA 4XV2A 3RZFA 4W4WA 4UBAA 1IASA 5ANJA 3PSCA 3V51A 4FKUA 4FYOA 4EJNA 4O7LA 3IOKA 4MF1A 4EJ7A 5TO8A 3GOPA 4QMNA 1YVJA 4RC3A 4UYNA 4JMQA 3MY0A 3KRWA 2P4IA 4FT0A 4BN1A 3D5UA 4FNYA 3GFEA 2WQMA 1WCCA 4G9CA 4AXEA 2BZJA 3BI6A 4IXPA 3Q6WA 3F2NA 4QMVA 2A98A 2WTDA 3G9LX 3OBGA 1Y6AA 4W4VA 4Y5HA 4K1BA 5AP4A 5CANA 5J1VA 3NX8A 2XZSA 2UZDA 2FVDA 4L3PA 3TEIA 2YIQA 3MTLA 2WU7A 1YDSE 4BBMA 3ITZA 3TZ7A 3HV3A 3QYZA 4NCTA 3VF8A 3I0OA 5AUVA 3I1AA 3LCSA 4AE9A 3TUBA 2WQOA 5AV1A 3ZO4A 3FI3A 1XH5A 2X7OA 1VZOA 4C38A 3ROYA 2IG7A 4JX7A 4UMRA 5D7VA 4FTMA 2A2AA 4L45A 1L8TA 5CT7A 3PLAE 4U97A 4HYSA 5HU3A 4TPTA 3V5LA 5CAQA 4PRJA 3BHVA 3NNWA 3PVWA 3OW3A 3MJ1A 4G6OA 1L3RE 1SNUA 4CD0A 2GS7A 3LJ0A 2YJRA 4JAJA 1U5QA 4QP3A 4UXLA 3SLSA 5CZHA 2VO0A 5CI7A 5AR7A 4NCTC 3PUPA 4FKOA 4I0TA 3W55A 1KE9A 2V0DA 3F7WA 3JUHA 4F63A 3WIGA 1P14A 3QCYA 5KO1A 4YZMA 2QC6A 4I6LA 4BJJA 4EWQA 5EM7A 4GVJA 3PDTA 4O91A 3SQQA 3U55A 3PIZA 1I09A 2GHLA 4FVPA 3SXSA 2YFXA 3NYVA 1XKKA 4FZ6A 2RKUA 2E2BA 2WMBA 4CT1A 5G1XA 5FEQA 2YZAA 2BRGA 4B0GA 4G3EA 4MXAA 4AQKA 2C6OA 1BL7A 3JY0A 3G33A 4KWPA 3PA4A 2V7AA 3F5UA 5DGZA 1BL6A 3QWJA 3PXRA 3FZSA 4LG4A 3R7UA 3V5JA 4AT5A 2UW5A 3OD6X 4HCVA 4C57A 4I5HA 4DH1A 2YM4A 4LGHA 2B53A 3CTHA 4XG8A 3C4WA 5HG7A 3UC4A 4O0WA 4G31A 3OY1A 4I6BA 4MVFA 5EYMA 4DFXE 3W0RA 1F3MC 2JDVA 3R8ZA 3H4JA 4ZY6A 2LGCA 4V0GB 5FBOA 3P4KA 2IO6A 2W5AA 4EI4A 4HPTE 1IA8A 4QYEA 4AU8A 1H27A 4R77A 1NXKA 3WZDA 4X2NA 2XMYA 2ZMCA 4O27B 5KKRC 3CPCA 2WD1A 2I0HA 2QVSE 3R7VA 1FPUA 3FBVA 3QCXA 2B9FA 2VO3A 3PJ2A 5HGIA 4ARKA 5CYIA 4X3FB 2CKEA 3C51A 2ZV9A 3LOKA 3ZO3A 4O83A 5CSHA 3V01A 4BI1A 4BCHA 4JI9A 3HX4A 5HESA 4NKSA 3IPHA 5JRSA 2Q83A 2BRNA 4FV5A 4FTJA 4GEOA 2WXVA 2J2IB 4LRJA 3ZDUA 2EXMA 1KE5A 3HP5A 3LHJA 2GNGA 3Q5ZA 3RCDA 3NYXA 4GYIA 2W0JA 4YTFA 4S32A 3UVRA 3QQFA 4B6LA 1PW2A 3KF4A 4GT4A 1RE8A 3P79A 1Z57A 2IW8A 5E9EA 4FKLA 4QD6A 3AT3A 1YW2A 2XNEA 2Y4IB 3OG7A 2XRWA 3O51A 4DEIA 4YJSA 5FM3A 1GAGA 1H1RA 4WNPA 4O1OA 2WAJA 2DQ7X 3MVHA 3BWJA 4NW6A 4YHTA 5C8MA 1ZYSA 3WF9A 3ZC5A 4EOQA 5HQ0A 3ALOA 3LE6A 4FKGA 3OWJA 2IZTA 4RT7A 2WQNA 5K4IA 4R1VA 2OJGA 4DFNA 3GCQA 3R28A 4QYGA 5CI6A 3IO7A 2V5QA 4BTJA 4FGRA 5AUXA 5AV2A 2GQRA 2BROA 2HYYA 3OEZA 4J97A 4N0SA 1H8FA 4B8MA 4C33A 2WO6A 3SW4A 5DR2A 5FXSA 3CQWA 3P7CA 4JQ7A 4AQCA 3F82A 4WG3A 4DHZA 2VTTA 5ANEA 3V6SA 1H00A 5HBEA 4EOPA 4QMXA 1KOAA 3A60A 1IR3A 3PXFA 4J8NA 4AT3A 3SXFA 3AD5A 1HCLA 4LOOA 2CKPA 3EHAA 2WMUA 3P78A 4WNKA 4USFA 2HELA 3MFTA 2C30A 4CLIA 2E9PA 4C4FA 5BQ0A 3EMGA 4BCJA 4IZ5A 1JSTA 1OL1A 2Z7RA 4MXZA 4USDA 4UEUA 3TACA 3GI3A 3IDCA 4BWKA 4XG7A 4D2RA 2B7AA 2VTHA 2VTOA 4TNDA 4U40A 4V04A 3R9OA 4CFFA 4FOBA 2OFUA 2UW7A 4ZZMA 3KXHA 4QNAA 4F7LA 4TKSA 3QYWA 2C5OA 1M2RA 4QMUA 4U44A 5M07A 3C0HA 3C1XA 3OP5A 4RPVA 2O5KA 4RX9A 5LOHA 2OLCA 5AFVA 4IFGA 2UZBA 2XK4A 3UBDA 2I7QA 3DB6A 1PMVA 4KIPA 4AN9A 3E8CA 5BUEA 2C0OA 3V6RA 4QPSA 3ZZEA 4OBPA 1ZZLA 2XNOA 5D7AA 2C6IA 2QOOA 2R3JA 3DCVA 3I60A 2IZUA 3EYHA 4FODA 4FMQA 4JLCA 4MXOA 2XKDA 3PE2A 2OJ9A 4BY9E 5JZJA 1G8JA 3R9HA 2P55A 3RAWA 4HVIA 4IFCA 4K18A 4LUEA 4BDBA 3RPYA 3NVKI 3NUXA 3OXIA 1KOBA 4GJ2A 4KIQA 3COHA 2P2IA 4M15A 3OWKA 3QKKA 3MN3A 2B0QA 1OECA 2H8HA 5E8SA 5HX8A 4CSVA 3EL8A 3E7VA 5TOZA 2VWZA 1WAKA 4FKIA 3R8UA 3BZ3A 3SOCA 4DH5A 1ZY4A 4JBVA 4WO5A 4DH8A 1U5RA 3T9TA 3RK5A 2W4KA 5EK7A 3O71A 4XG2A 5D1JA 2BVAA 4PL5A 3P7AA 5EG3A 3SG9A 4RJ4A 4WD5A 4CFWA 3RAIA 3EN6A 1OKVA 4TL0A 3OFMA 4K0YA 3IS5A 4YUQA 4M13A 4RX8A 3LMGA 4TWCA 3U6IA 3UDTA 5IMXA 3NCGA 4YLLA 2AEGA 3VS5A 3OCTA 5HNBA 3DBEA 4O22A 1U59A 3E92A 3O7LB 4BGHA 4FSZA 3OOMA 4AXCA 4EK4A 4J71A 3KFAA 4AZEA 2OBJA 2W9ZB 2VTAA 4UN0C 4AGWA 2R3FA 4XLVA 4BWXA 2XM9A 3ZO2A 3JXWA 4FV0A 2WHBA 3B2WA 4C02A 1OBDA 5HCXA 3I0QA 4QP2A 2YIWA 5KNJA 1JKTA 3GU4A 4ITHA 5AP7A 5AP0A 1Z9XA 3TJCA 3HNGA 2B54A 1W82A 3D5XA 3SV0A 4BDAA 4OUCA 3I7CA 3JVSA 3ORTA 3PA5A 3VUHA 5JGAA 4H36A 2R64A 4CCUA 2IVVA 5IQHA 3EFJA 4FUYA 4D2TA 4XG6A 3WARA 2OF2A 2F49A 3P1AA 5FXRA 5H2UA 5FEDA 1YXUA 2BRHA 4ANSA 5IEXA 2CGXA 3FWQA 2CKOA 4FNXA 1KE7A 2OGVA 3DLZA 4M14A 2PWLA 1FGIA 4MBJA 4YJVA 4HVDA 3VQHA 4EH9A 2XIZA 3LKMA 4FEVA 2XK6A 1YXSA 3FMMA 4IDVA 1APME 2OZAB 3R30A 3NAXA 1HOWA 4W4XA 2ZYBA 4FIGA 2ETRA 3T8OA 4OTRA 2NP8A 3HMOA 3LFDA 4KS7A 3PSBA 1FGKA 5B7VA 3V8WA 3CD8A 1JWHA 3O8PA 3R9NA 2CLXA 4A9YA 3PG3A 3LM5A 2R3PA 3DAJA 2ETMA 4N6ZA 4PDOA 1PF8A 2QI8A 3BBWA 5KKRB 2C3LA 4DFZE 2Y6MA 2WMVA 3WYXA 2WTCA 4IM2A 4PDSA 3V8TA 3SKCA 3D2KA 3WF7A 4I6FA 4ZLZA 4GUEA 3P7BA 4ZZOA 3W8QA 4C3FA 4BI0A 3O7LD 4ITJA 1R78A 4Q9SA 1TQPA 2C68A 4JG8A 4LFIA 4QTBA 5CSXA 3HAVA 4AAYA 4H1JA 3BLHA 4J8MA 3KRXA 4QP1A 4XHKB 4BVUA 2WMTA 5DA3A 4MAOA 4UZHA 3NR9A 3FMKA 3LM0A 5A4QA 3EFWA 4QMLA 1FMOE 4W4YA 2VWYA 3DU8A 4GU6A 4CFMA 3N9XA 3UO6A 2FSMX 2XK7A 3O0GA 3E87A 3PIXA 1REKA 3ETAA 1WBWA 3PZHA 4ZTQA 2PMLX 4FICA 4UWCA 5L6PA 5IZFA 5EM6A 4KBKA 4JRNA 4L43A 3RPOA 4CXAA 3QXOA 4QP6A 4KBCA 3VVHA 4UX9A 4ANBA 5IQAA 5E8UA 2I0EA 4S30A 3ZLYA 2E9OA 4FT5A 3UP2A 3AT2A 5C26A 4RJ7A 4UWBA 1RDQE 3NAYA 4GH2A 5FG8A 5CU2A 3PJ1A 3FL4A 5M08A 4HVSA 4FZAB 5J7BA 5DE2A 4FNZA 5GZ9A 4O86A 4JVGA 4MBLA 3ACJA 1GIJA 2Y9QA 3SXRA 1NT2A 1ZZ2A 1QL6A 4XYFA 2GMXA 3BIZA 3OTUA 4I22A 3F9NA 1JBPE 5CT0A 3VF9A 4Z16A 5IEYA 3BU5A 4PPCA 4YJOA 2JAMA 3A4OX 3TNPC 4O0SA 5J79A 5I3OA 4QDVA 2OIBA 2WMWA 4X6RA 1H25A 3EOCA 1XBCA 5ANGA 3HA8A 4FEUA 2WTKC 4TYIA 2QG7A 4EOKA 5FRIA 3HRBA 4O7NA 2VWWA 1DM2A 2UZWE 4OTDA 4FV9A 4Z9LA 4RJ6A 4EH2A 2C3KA 4QYFA 4IAAA 5FUTA 3NYOA 4O38A 3P23A 4AN3A 5CAPA 1ZMWA 4R7BA 2BAKA 3PA3A 4RSSA 4IHPA 1Q8ZA 5L2IA 2DYLA 3ZM4A 4JDIA 5CVGA 5HVYA 5HIDA 1UNLA 3GBZA 3GC0A 5AA9A 5IG1A 2GTNA 4AZSA 4CNHA 5HG9A 4U5JA 5CEQA 3GQIA 1F0QA 3ZO1A 4LGGA 4IVAA 2QOLA 3BGQA 4FT3A 4ANLA 2UZUE 3CPBA 2W1ZA 3WE4A 1V0BA 5A4TA 4R78A 5GIOE 1MQ4A 1SMHA 3CC6A 5BUIA 3U9CA 1QPDA 2QQ7A 3QFVA 1YI3A 3AXWA 4EUTA 1G5SA 2W1EA 3EQCA 1WBNA 4WKQA 3LCKA 4DFLA 4J52A 5LXMA 3PLSA 4ASDA 2YM6A 1H4LA 4AE6A 5EFQA 3FHIA 4C35A 4V05A 2GHGA 4BCGA 4ERKA 4WSQA 2VNYA 4QP8A 1CM8A 3OMVA 3FPMA 5CLPA 2X8DA 4YPDA 3FLSA 5AP2A 4EONA 3OBJA 5CEOA 3CR0A 1OVEA 2OU7A 5KCVA 5DLSA 4IC8A 3QA8A 5IDNA 3LXPA 3ID6C 4S34A 3W0QA 2EXCX 2PUUA 4YC8A 2XIXA 4K9YA 5IQEA 4PNKA 4O81A 3BEGA 3H0YA 2BTSA 1QPCA 4GYGA 4RVLA 4MQ1A 4BRXA 4QPAA 3W2QA 5EI8A 1YXXA 4P7EA 4GKHA 4O0VA 4ZXTA 5IISA 4ZTSA 4CG8A 4IANA 4X2GA 4X2KA 3WE8A 4YO4A 5HNIX 5FXQA 4QTEA 2WB8A 1YDRE 2H96A 2XH5A 2PZIA 4Y46A 4BTFA 2RFNA 3PPJA 1TVOA 4UMPA 4IVDA 4ACHA 2ITPA 5DRBA 4ACCA 5AJQA 3F3ZA 2AC5A 4I5CA 5CU6A 4GJ3A 5M4FA 5KMIA 3LW0A 2EU9A 4L52A 4L6QA 3I6UA 3FY0A 1UKHA 5A4CA 4M68A 4CGAA 3RALA 3SOAA 5H8GA 3UYTA 3OHTA 3C13A 4FA2A 3VONA 2IZRA 1PHKA 3HYHA 3RM7A 4FTRA 4O7VA 2VWIA 2XF0A 4DEGA 5GJDA 4CKRA 4PWNA 3R71A 2B1PA 4OBQA 3UP7A 4DFYA 4ACDA 2BR1A 2RFDA 4II5A 4AGUA 4EEVA 5BVDA 3HDNA 2VN9A 1UNHA 3DJ6A 4FL3A 3ALNA 2PVJA 4D58A 3FMHA 4FG9A 1W84A 3M42A 4XP2A 3ZZWA 3UO4A 4DEHA 4O2PA 2XM8A 5ETAA 1OL7A 2GQSA 4LUDA 5F94A 2UZOA 3ENHA 3FAAA 1BI8A 4FGBA 3W2SA 4D5KA 4RIXA 2IVSA 1A06A 3LJ1A 4FVRA 5D41A 1M2QA 3VUMA 4J95A 3ORNA 4XOZA 4TYGA 2R3NA 3FMNA 3FYJX 3IQ7A 3DKFA 3LJ2A 4N4SA 3RPSA 5CXHA 3ZXTA 5IA5A 3CP9A 2WTIA 5HEZA 3Q2JA 5T3QA 3U6HA 2UW9A 3R2YA 4MBIA 4TXCA 2J90A 2VTQA 2LAVA 2JBPA 1G3NA 3MJ2A 3SX9A 3TN8A 4FSWA 3RPRA 2W5BA 4CFNA 2QURA 4RWIA 2CSNA 4ZLOA 4GMYA 4XOYA 1UNGA 3QAME 4FTIA 1AD5A 2YJSA 4ANNA 3VBWA 4JNWA 5I9VA 4ZAUA 2HW6A 3TMOA 3FZ1A 2WMQA 3NRMA 1XHAA 3GUBA 3F3WA 4FTNA 2VTRA 5FBNC 4L7SA 3H9FA 1Q8UA 2XNBA 2QKRA 4KBAA 4NWMA 4BDHA 1SVHA 4PMMA 5AAFA 4E6CA 5C1QB 2REIA 1TQMA 4RVMA 2WTWA 3BPRA 3I4BA 3NIZA 1UU3A 3T9IA 5CF4A 3DZOA 3KQ7A 4ANQA 4GU9A 1Q8WA 3KVXA 4E5AX 3NUAA 4YJTA 4FIEA 4BBFA 5HICA 1OPJA 3RMFA 4BZNA 1XBAA 2CN5A 2O65A 5DEYA 3ZTXA 4JDHA 5A46A 4TW9A 5T68A 3VS3A 3L9LA 4FSMA 3HECA 3AOXA 3C50A 3P5KA 4C8BA 4EOJA 1MRYA 3LFAA 3PXYA 3REPA 5GNKA 1IAJA 2FSOX 3DY7A 1PKDA 2PZYA 1Q3DA 3EQRA 4JBOA 3L9NA 4JBQA 3EQDA 2JFLA 2XBJA 2X1NA 4LMNA 1ZRZA 4OT6A 5DBXA 4DA5A 5JH6A 3BHUA 2G15A 4X3FA 4AA0A 5IA3A 4EOOA 3MA3A 4IB1A 3VUDA 3H9OA 3A7GA 4FX3A 4L42A 3JVRA 3QTSA 4Z55A 4KUJA 4PP9A 1M52A 4IVCA 4E6QA 3F5XA 1SM2A 1W83A 3M11A 3KXGA 4G3FA 3EH9A 5IQGA 2CPKE 3L8SA 2CJMA 2X6EA 3HMNA 2XKEA 4EQMA 4XBUA 2R3KA 2C6MA 1RW8A 4IW0A 3NW7A 3ZFXA 4BDFA 2BUJA 3LXKA 2C0TA 2ERKA 4TYJA 1Q8YA 4GG7A 1HCKA 2R3HA 4XP3A 4I6HA 3NDMA 3ORXA 1FQ1B 2JGZA 2OJJA 4QQJA 4YJNA 5CZIA 3QLGA 3E63A 3QZIA 4WUNA 2BDFA 5EH0A 3L1SA 1OKYA 3CE3A 3FHRA 3R22A 5DT4A 3ZHPC 2W4OA 5CF8A 5GINE 3O2MA 1Y8YA 4EHEA 4QP9A 2XIRA 4I24A 1CKJA 3CY3A 3R9RA 5ANKA 3W0SA 4YURA 2F7XE 3R8MA 1O6LA 2C5NA 5HBHA 3F88A 2XNMA 5ITAA 2O2UA 1H24A 3LQ5A 5CU4A 4BBEA 5K9IA 2HZIA 3EIDA 4QMMA 5LCJA 4AZVA 3W0PA 4C7TA 2ZOQA 3ZSHA 3H10A 4AN2A 3FEGA 4QMZA 5CWZA 1PXJA 2NPQA 3Q9YA 4FIJA