2QOHA

Crystal structure of abl kinase bound with ppy-a
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
274
structure length
271
Chain Sequence
GSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVSAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proto-oncogene tyrosine-protein kinase ABL1
publication title Crystal Structure of the T315I Mutant of Abl Kinase
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 83
structure length 271
sequence length 274
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2007-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2qohA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2qohA01
3VQUA 3MIYA 3ZO4A 5LJJA 1Q8TA 1YOJA 3OT3A 4FODA 3FPQA 2RL5A 5L2TA 4EQUA 2BUJA 3FKLA 4F64A 4P2KA 3VS3A 1MRVA 4QTBA 3F7WA 2CKQA 2OIDA 4YMJA 4HGLA 3MS9A 2WGJA 3OT8A 5DR9A 3QAME 3EFJA 3JR1A 4OBPA 1GIHA 3FI4A 1YDRE 2Z7QA 1EH4A 2OJ9A 3ORIA 5HCYA 1T45A 3OCSA 3UJGA 5GINE 3BIZA 1E9HA 2J5EA 4CFXA 1VJYA 3BBWA 4FNZA 1PMEA 2QOQA 3QQGA 2Z60A 3R1SA 3G9NA 4RVLA 2ITVA 2YABA 5EM8A 2W1HA 4A4XA 3BLQA 4CKJA 4KUJA 4QMPA 4DBXA 5J7BA 5CX9A 4FEWA 4QMSA 3NVKI 3ODZX 1DI8A 4YTIA 4DFUA 3BKBA 3UQFA 3O96A 4U0IA 3LQ8A 4EH5A 3PWYA 1MRYA 3BGPA 5AIKA 2QG5A 5M4FA 4WUNA 3F3TA 3M11A 4BCFA 4LGDA 3SLSA 3D5UA 4A4OA 1YDTE 5IA1A 3ORPA 1GAGA 4GU9A 3LFDA 4F99A 4GJ2A 5FXSA 3PZHA 1NT2A 2WFYA 5FBNC 3U4WA 3NLBA 3E64A 3ZXZA 4ASDA 5DHJA 2R7BA 2Y4IB 3KK8A 3RVGA 1XJDA 4AA0A 5TOZA 4JJRA 4QP8A 2BZHB 4ZLOA 4WD5A 3HP5A 3TTJA 3OTVA 4RRVA 2QOCA 4QPMA 4YPSA 2B0QA 1YI3A 2IVTA 4IB1A 5AEPA 3IOKA 3ORXA 3BGZA 1KUTA 5DT4A 3DXPA 2WMVA 3W2RA 2I0VA 5C03A 5L6PA 4K8AA 5IH6A 4PDSA 4DYMA 3GU5A 2VNYA 4IX3A 4J8MA 3ENMA 3U55A 4FC0A 3VF9A 2BILB 2YJRA 3QLGA 4F0IA 5C4LA 3E5AA 3GCVA 3WZJA 5LVPA 2UZTA 3QCYA 4FK6A 3EN6A 2QLQA 1WBWA 3ORKA 3IDBA 3CCNA 3R71A 2CLQA 5HX8A 3ULZA 1IEPA 5M44A 4K33A 4MNEA 4HYHA 5L4QA 3EN5A 3ZDUA 4MF1A 4QYEA 5D10A 4XYFA 2BRMA 2QONA 4H36A 4S32A 4UZHA 4BCOA 3RCDA 5BUEA 1Z9XA 1YWNA 4NH1A 1YWVA 3NYXA 3QRIA 3DU8A 3FWQA 3LW0A 3AT4A 2RG5A 2WPAA 3HV7A 5EOLA 4ACHA 3MN3A 3E63A 3R8PA 3SX9A 3G33A 2ERZE 2UW3A 5B2KA 1H26A 4M68A 2JFLA 1UU7A 5LVLA 1WCCA 4FG7A 4S2ZA 4UZDA 4F70A 2VX1A 4K77A 3TKHA 5LVOA 5ICPA 4IFGA 4BI0A 4AA5A 3LXLA 4AT5A 3AG9A 5HTBA 4R3RA 3SG9A 4I94A 4WNMA 5BX0A 4XEYA 3GBZA 3LLAA 2R0IA 3CD8A 5HNIX 2BHHA 4AOIA 3MTFA 2W4OA 3SRVA 4J52A 5DEWA 3G0EA 2CJMA 3EKKA 3OXIA 4I0TA 2R2PA 2FSMX 5L2WA 3ZM9A 4GW8A 2J0LA 3EB0A 4Y95A 4KS8A 5EM5A 2Q83A 3BYSA 1W8CA 4F1TA 5I5ZA 4PX6A 3BEAA 3DAEA 2PE0A 2REIA 3NCZA 3UZRA 3D83A 3LFFA 1KE6A 1OUKA 3QA0A 4TPTA 4C4IA 2OG8A 4MXAA 4ITIA 3I5NA 5CI7A 4RVKA 3C5UA 4DEGA 2BIKB 5FXRA 4ASEA 3CKWA 3JVSA 2YIWA 2XIXA 3RM7A 3VNTA 4E73A 1PXIA 2QG7A 5FQDC 1GZOA 5DLSA 4FT3A 4XV3A 4APCA 3TIZA 4DGNA 4O0WA 3R04A 3LVPA 5EK7A 5BVNA 3Q4CA 3AOXA 3TN8A 4O0RA 3BQRA 3PIZA 4PV0A 4MTAA 1LEZA 2VTMA 4EQCA 5KHWA 4Z7GA 1JPAA 4WG4A 4MH7A 4DTKA 3MTLA 2OWBA 4A9RA 4ACCA 4IM3A 2Q0NA 3GU7A 2PMIA 3A4PA 4GT4A 4ITHA 3QTWA 4FA2A 3QTXA 5GNKA 4DITA 3MB6A 3U6HA 3ZLWA 1WBTA 2YLFA 3CGOA 5DT3A 2WTKC 4QOXA 2UW7A 3F2RA 2YCRA 1H01A 1QL6A 3BI6A 1I44A 4D4SA 3Q6UA 5HLWA 1S9JA 4JDJA 4I20A 5ANOA 4CMTA 4E7WA 2UW0A 5I9ZA 2CLXA 4FTUA 3MIAA 4FSYA 3OBJA 1BI8A 4D2VA 4IJ9A 5C8MA 1Q8UA 3R7OA 1IAJA 2VWVA 3IW5A 3LAUA 4X0MA 1W82A 3F3UA 4NIFA 4X3FB 5DVRA 3R01A 4C33A 4FOCA 5J9YA 3WYYA 5DNRA 3DB6A 1OL5A 4BZDA 4BFMA 4RX5A 2GNHA 4YJOA 1R0EA 3ALOA 3OEZA 4FKVA 3ZSIA 4O27B 3WI6A 4QMMA 4F7NA 3BHHA 3CBLA 5AV3A 3LMHA 4DINA 5DRBA 5J87A 4FE2A 4O7SA 2W1CA 2G9XA 3TDVA 3WF7A 2C6DA 1KOAA 2WMAA 3QYWA 1UWJA 4K11A 4IHPA 3MH2A 2F9GA 2FB8A 5M57A 4J99A 5M4CA 4D4VA 1FGKA 1IAHA 3SXFA 2VO6A 1Q8WA 4FKRA 4ZZMA 5HZNA 2VTPA 5HE3A 3C0IA 1H00A 3ZH8A 4EJ7A 3O7LB 4L52A 2F4JA 5AADA 5IQHA 3PFQA 3B2TA 3FZPA 3O0GA 5E1SA 3W2OA 5HU9A 4IC7A 4ALUA 5IQCA 5AP1A 3O17A 4FZ7A 5DEYA 2ZVAA 3WZEA 4DH5A 3ZFYA 3LHJA 2UVZA 2BAQA 3R2YA 3HLLA 4FTMA 1H27A 3C51A 3LFSA 1GY3A 1M17A 2FH9A 2XKEA 1BL6A 3D7TB 1Q4LA 3I0QA 5CQWA 5HVYA 2J0JA 4NKSA 2B9IA 2I7QA 3N9XA 4UALA 3GT8A 4RJ8A 2J0KA 1OIUA 3TIYA 5CF6A 3BWJA 5M55A 2QO7A 4LV8A 2HENA 2XIZA 3IW7A 4QYHA 4TRLA 4FEVA 4IZAA 4KRDA 4O7TA 4QYYA 5EHLA 3W2CA 3F9NA 4E5BA 4QQTA 1SVHA 1PXPA 5HTIA 5M07A 2WMWA 4JX3A 4YJNA 4JRNA 4D2RA 1J3HA 3EN7A 3M42A 3OVVA 3QGWA 4PRJA 3OZ6A 5AR7A 4UXQA 1PF8A 3FPMA 2YWPA 5E8SA 2BTSA 2IVVA 5EQYA 2BZKB 4UBAA 2EB2A 2W1IA 2YZAA 2GHGA 4YZDA 3GOKA 3NUXA 3D7ZA 3RCJA 4A9TA 1JKSA 2IPXA 1J7LA 4RIYB 5H9BA 5C27A 3BBTB 1WBPA 2FYSA 3GFWA 3WOWA 2R3QA 2UVXA 5AP4A 4F6UA 4LRMA 5BMSA 3GEQA 3HECA 2BPMA 1JOWB 4Q9SA 2IW9A 3PWDA 4FKSA 3E8DA 5CTPA 3ZLSA 3GC0A 4ZSAA 2VO0A 4CFNA 4BDKA 4NZWB 3AD6A 3ZDIA 5JZJA 4DEDA 2PPQA 1P2AA 1DI9A 3SV0A 3ZUUA 1RDQE 4MD8E 1SVEA 4QP2A 5FD2A 1V1KA 2W96B 3ZRLA 4HVHA 1ZMVA 5CZHA 4ID7A 5CF4A 4HGSA 5HTCA 3IOPA 2UW9A 2ITYA 4RLKA 4CYJA 3HRBA 1JVPP 3OW4A 3DJ7A 3OXTA 3PVWA 3IECA 3V01A 2G2HA 3NVMB 3IS5A 3UOHA 4H05A 4D4YA 3GC9A 4OGRA 4DG0E 2PZYA 3CP9A 4R5SA 4UWYA 5EOBA 3PY0A 4ZTNA 3ZBFA 4TYHA 4FGRA 4E20A 3BV3A 3FMHA 3UP2A 3FXWA 3ZFXA 4JIAA 4EZ3A 3K2LA 1XH5A 2UZNA 3RWQA 4AT3A 3MESA 4FTIA 1XBAA 3QTIA 4NW6A 5HNBA 4IMYA 3QWJA 4ANOA 4BDIA 4R7IA 2J0MB 2BZJA 4TW9A 3LPBA 2X2MA 3EMGA 5IG1A 3GCQA 4FF8A 1YXUA 5HLPA 2PVRA 3U8WA 3JVRA 3H4JA 2HWOA 4EH3A 1SNXA 3TNIA 5J8IA 2CGWA 2HY0A 4YHTA 4USEA 2OICA 5FUTA 4I5CA 3W10A 3VRZA 3BLHA 1ZY5A 3KVXA 4W4XA 4QQJA 2CKOA 4KSPA 3EZRA 4F7LA 4FV4A 3ZHPC 5JK3A 3I7BA 1K9AA 2JKKA 4BBEA 2NO3A 1YKRA 1LUFA 2JLDA 2DQ7X 5HI2A 3VO3A 4CGAA 4DA5A 4A9UA 5L3AA 2OF4A 3GCPA 5DE2A 2PMOX 3VRYA 5AP3A 1PJKA 4D1XA 4MHAA 3JYAA 2PMLX 1B6CB 2AC3A 4XG8A 2ZDUA 3FMNA 3FUPA 4DGGA 4GRBA 4U42A 5GJDA 2E9OA 3VWAA 4O22A 4C38A 4FKPA 3IGGA 4J1RA 4TWCA 2O3PA 3H9OA 3R28A 4FVQA 2CMWA 4NJDA 4C4HA 3P7AA 2FUMA 1H08A 4F7JA 2C5OA 3DKFA 2ETRA 4F6SA 3E62A 5FWKK 1PYEA 2RIOA 4X6QC 3ORMA 4ZTHA 3NGAA 5AUWA 5I9UA 5IU2A 5EI6A 1H1SA 4BTFA 3F7ZA 1RJBA 2R3LA 4PY1A 5A3XA 3TT0A 2BDJA 1WVXA 5KCVA 1YI6A 4PQNA 3CTHA 4EHZA 1VYWA 3OWPA 4PDPA 3PTGA 5FBOA 2YM6A 3C0HA 5CLPA 3G0FA 2XP2A 3ITZA 3NNXA 4OTGA 2R3PA 1H07A 4EOQA 2PZRA 5CY3A 2FVDA 3PA5A 2XK8A 3D14A 3VF8A 5J1VA 5C8NA 3UPZA 5JT2A 2GPHA 2Y4IC 2YM7A 1NW1A 1NVSA 1MRUA 3R7GA 1KE9A 2UZEA 2V62A 4BCQA 1ZXEA 4LV5A 3NW5A 4YTCA 3EFLA 3AMAA 2GMXA 2XMYA 3L9LA 4CD0A 5AP7A 5KMMA 2OZAB 4AWIA 2CN5A 1UVRA 5DOSA 4L44A 4CVAA 1K3AA 2W9ZB 3NCGA 4GUBA 4KRCA 4NTTA 4BI2A 2YDIA 1UWHA 3FZOA 3LMGA 4XG7A 4NYEA 4IFCA 4O2PA 3F69A 4FV9A 2VTLA 4FIGA 3UMWA 2OJIA 3FI8A 3IGOA 2J2IB 4U8ZA 3KF4A 3ROYA 2BFYA 2F7XE 3W2PA 1F0QA 2YDKA 4DHFA 1WZYA 4MQ2A 3KB7A 1MUOA 5KBRA 4DFZE 1UV5A 4O21A 2OFUA 3EYHA 4II5A 4EH9A 4FOBA 3ZO3A 3FLQA 1Y8GA 3OMVA 2VZ6A 3ZO2A 5AUYA 4AGWA 3SHEA 2RFEA 4Q9ZA 1Z5MA 4YJUA 4YJTA 5CF5A 2R3HA 3HYHA 4NKAA 3BHVA 5J1WA 4O0UA 4TYJA 2EU9A 3ZUVA 3C5IA 3NUYA 5FP5A 5HBEA 4DEBA 3OXZA 1CDKA 3QC9A 4G17A 5BYZA 4D9UA 4KIKA 3OEFX 4D4RA 3QFVA 4EBVA 3HAVA 4I4FA 4EKKA 1ZAOA 4RJ6A 3BYUA 3A7JA 1OKWA 4FUXA 1JKKA 2QO2A 4GCJA 4MCVA 3RGFA 2F49A 3KEXA 4YC6A 4J98A 3VBXA 4O7NA 4BGGA 2YM8A 3SKCA 5GJGA 4MKCA 1VYZA 1OIYA 3HV4A 3ZBXA 4UX9A 2JIVA 2VTSA 4M8TA 4X3JA 1QPEA 3LFQA 4BCIA 3ZC5A 4BDCA 3O8PA 2VN9A 3VUIA 2DWBA 3U6JA 4JG7A 3D2KA 3JY9A 4ZIMA 3PXFA 5K4JA 4K18A 3EH9A 5CNNA 3O50A 4KB8A 3AT3A 5JFVA 3Q9XA 2IVUA 3FLSA 3HA8A 3D2IA 3KK9A 4BCKA 4RX9A 4M67A 1FVTA 2ITUA 4I41A 4FSWA 4TYIA 5T3QA 4MK0A 4HCUA 4IVDA 2PVKA 4ZTLA 2YHVA 5M06A 3TUCA 1TQMA 3S00A 4LG4A 2ZM3A 5E8YA 3LCOA 4IZYA 5I3RA 4AT4A 4BKJA 2OKRA 4D2SA 5ANJA 4W4VA 4I24A 3C9WA 4I23A 3R7IA 2QOHA 5JQ5A 2O65A 4M14A 3UIMA 1J7UA 2ESMA 4AN2A 4PPBA 3KFAA 4S34A 2RSVA 2P4IA 3TG1A 4BIDA 4ZMEA 3CQUA 5CT0A 1OB3A 4HJOA 1WBSA 4H58A 3F82A 3FHRA 3LFAA 3A2CA 5CEMA 3KRWA 3F2NA 4E6DA 3IPHA 3QZHA 4P5QA 2PVJA 5EDQA 3RPVA 2JIIA 4O0YA 3COIA 4ASZA 1XH6A 4LI5A 2YITA 5JKGA 3ORTA 3UO4A 4ACDA 2QLUA 5L6OA 3UNJA 2CCHA 4O7VA 4ERKA 1U54A 1ZLTA 3OBGA 3QQHA 4J7BA 5IZFA 2QKWB 4RWKA 4JDIA 1JQHA 4YSMA 3GENA 4CT1A 5JMSA 3CSVA 1WAKA 2WEIA 5F4NA 1H0WA 2C0IA 4MXCA 2UVYA 4L3LA 4FKIA 5EHOA 4G6OA 5JEBA 4Y73A 3P0MA 3ERKA 4U45A 3O2MA 2VAGA 2YAKA 3KKVA 4PWNA 3ID6C 3KMUA 2HW7A 4ZJIA 4CCUA 5AM6A 3E87A 2R9SA 4DFNA 4UY9A 3LQ3A 2WQMA 4BDFA 4MXXA 3UGCA 3ZEWA 4MBLA 3HV6A 4BI1A 3FY0A 5IH4A 5HG7A 4J8NA 3AD5A 4GG7A 3WF6A 3P78A 3ZM4A 1GZ8A 2W5HA 5ACBC 4BZNA 4C7TA 3SG8A 3OWLA 1U5RA 4CZTA 3TZ8A 3TJCA 4C2VA 1SVGA 4IADA 4FTNA 4YGAA 2OXYA 2A0CX 4OT6A 3WE8A 4DE4A 2HWPA 2Y4PA 2GFCA 4L7SA 3ZZEA 2JDRA 5LQFA 4UV0A 5KMKA 3MSSA 5L8LA 3DS6A 3BZ3A 4O38A 4EWHA 4X6RA 1CM8A 5BVKA 2XYUA 4QD6A 4MYGA 4TY1A 3KF7A 3HRCA 4H3QA 1BMKA 4DTAA 3FXXA 4PPCA 4W9XA 5FXQA 1Q5KA 3QGYA 3ORLA 4BCGA 5EQPA 4L00A 5AM7A 5CSPA 3EQPA 3SOAA 4FV6A 5AV4A 2HOGA 5HICA 4U7ZA 2XKDA 5IA5A 3EOCA 5EKNA 1LPUA 3AMYA 3CJFA 5FP6A 2J50A 1YOMA 3S2PA 4RWJA 3UQGA 2ACXA 2WTIA 3WE4A 1RW8A 3DBDA 1Y91A 3TKUA 3CJGA 3E7OA 4DC2A 2YJSA 2P2HA 2J90A 3KU2A 3NAYA 4I1ZA 4YHFA 3TJDA 3TZMA 4PTEA 3UMXA 5TE0A 4O7LA 3UZTA 5IPJA 4CXAA 3LLTA 3V8SA 4GS6A 4HVGA 5CT7A 5LVMA 4Z7HA 4D55A 4XOYA 5CS6A 5HIEA 5IDPA 3FY2A 4L01A 4B99A 3HMPA 2I1MA 1R0PA 3PA3A 3SC1A 4NUSA 1PY5A 3FLYA 3Q4TA 4AA4A 1SZMA 3KC3A 3FI2A 3PRFA 4B8LA 4LUDA 3R9HA 5BPYA 1M52A 2BROA 2XB7A 2HK5A 3Q2MA 3DTCA 5JFXA 2F2UA 1PYXA 5EKOA 4E4NA 5CALA 2BKZA 3UIUA 4LL0A 3POOA 5IQFA 3IONA 3GFEA 4IWOA 5E8UA 4BIBA 5I0BA 3K3JA 4YBKA 5ANGA 2WMXA 4X2JA 4Z9LA 1FMOE 2X7OA 2XVDA 3DB8A 3NIEA 2YCSA 5GZ9A 2WAJA 3PIXA 3QRKA 3L8SA 3H9FA 3HEGA 3VHEA 1GIIA 2QI8A 4RIWA 4WBOA 2DYLA 4EOKA 1H1QA 3RK7A 1JKTA 3A7FA 3WF8A 1RQQA 4RIWB 2W0JA 3D5VA 4N70A 2LAVA 3EIDA 3NX8A 4M0ZA 2OIQA 2VTNA 2WZJA 5D7VA 2YZLA 2QOOA 2ZV2A 4MD7E 4IM2A 3GCSA 3N4TA 5LCKA 4O83A 3PSCA 3BU5A 5D1JA 4GEOA 4XH6A 3QL8A 4GVJA 3COMA 3Q04A 1XR1A 3HV3A 4X2GA 5L8KA 3PRIA 3D9VA 4R3CA 3NNUA 3NR9A 4RGJA 1KE8A 3NW6A 3HDMA 4QRCA 3IW6A 4W4YA 5BYYA 3R9OA 2WQOA 5E8WA 2WQBA 3UVPA 5KMLA 4H39A 4AZTA 2OJJA 4X2KA 5EG3A 4O82A 4DFBA 1ZYDA 3HDNA 3BRBA 3PJ1A 3T3VA 4RWIA 2CSNA 4IAAA 4G6LA 4B0GA 2B53A 3QCQA 2XZSA 1YHVA 5HE2A 4FSMA 4LOOA 4CLJA 1XO2B 3GB2A 3C4EA 4MEDA 2BRGA 3MA3A 3RHKA 3D4QA 4FSZA 3N4VA 5AV2A 4ZS4A 2X8EA 1QPCA 5AFVA 4BRXA 3VQHA 5IQBA 1WBOA 5M53A 4CG9A 3IW4A 4QP7A 4BVUA 4D5KA 2G2IA 3MPMA 3R7VA 4C02A 2HXQA 5AA8A 4CTCA 2GCDA 2C5XA 4YR8A 4CKRA 1MQBA 5A6OA 3EQGA 4UWBA 3ETAA 1M2PA 3VC4A 2H6DA 2OGVA 5HLNA 2YM5A 1TKIA 3RTPA 4OAVB 1NA7A 5BUIA 4LMNA 4RBLA 4OAUC 4NT4A 4D9TA 3AC1A 3ORZA 4F08A 3PZEA 3UVRA 4DBNA 4WG5A 3AT2A 3DZOA 4PMTA 4S33A 2QCSA 2WMSA 4WKQA 5AV0A 4MNEB 3UDBA 2UW4A 5KX8A 3WZKA 5E8VA 3ZLYA 2JITA 4WO5A 1FINA 3Q4ZA 5M08A 3FC2A 3SW7A 2WD1A 3O23A 4G3FA 2H9VA 3D0EA 4IAZA 4UEUA 4C4GA 2VNWA 4MQ1A 2BFXA 3P4KA 4U5JA 3V6SA 1UNGA 5CQUA 1OUYA 2GHMA 3KA0A 3OHTA 4YPDA 5KBQA 3VJOA 3COKA 3FSKA 3LCDA 5E8XA 3UBDA 3H0ZA 5J5TA 4QMXA 2X2KA 4RQVA 4BWXA 5D9HA 4HCTA 4L53A 3V51A 4EQMA 4BWKA 3CD3A 3WARA 3PPKA 3LXPA 4JVGA 3GQIA 3RNIA 4CSVA 3OW3A 4L3JA 5HEZA 3VS6A 4ZZOA 3AC2A 3F2AA 4BHZA 1JLUE 5CAQA 2HYYA 4DEAA 4BYIA 2B9FA 2VWYA 4YURA 3CEKA 4CV8A 2PUNA 1R78A 3CPBA 3SRVB 4BDHA 2W99B 4UMRA 4XOZA 2YIYA 2HZNA 2R3MA 2RG6A 2ONLC 3EN9A 4YUQA 3O8UA 4FTRA 3BX5A 4AE6A 2E2BA 3ENHA 4TT7A 1XH7A 2VWWA 2FO0A 4O91A 2XM9A 4LGGA 2GNFA 4NCTC 4XNEA 2CGUA 2FGIA 3R1YA 5LXMA 4G16A 3FJQE 3I81A 2WQNA 5FRIA 1H1WA 3NYVA 4CRLA 5HO7A 3SW4A 2I40A 3C4WA 3W16A 4RSSA 2XKFA 3BU3A 4RVTA 4AZVA 5BVOA 4ZTRA 1LP4A 3O71A 3KXZA 3R02A 4U6RA 4OTRA 3R8ZA 2OFVA 1ND4A 4IB3A 1Q3WA 3ATSA 4HPUE 4RJ3A 2XK3A 5HCXA 4P90A 4H3PA 4NM0A 3EQRA 3I7CA 4QP9A 5J9LA 2ZYBA 5TKDA 4GKIA 4JT3A 3DBEA 5C01A 5KMIA 4ZSGA 4TNBA 3DLZA 2J6MA 3V5JA 3GCUA 4L46A 5HG5A 5FTOA 4CLIA 4V01A 4JBPA 2WB8A 4I3ZA 4ALVA 3FZSA 4NTSA 3RJCA 2Q0BA 3ZYAA 2NNWB 4IVCA 4AW5A 1YVJA 4U43A 5DA3A 1HCKA 5AWMA 5EYMA 3D94A 3EFWA 5CSHA 4KIPA 3PVBA 3TUBA 2X2LA 2VWBA 4OTHA 4BDAA 4F65A 5GHVA 4LMUA 4RFYA 4DFXE 2GQSA 4WBBB 3I1AA 2OIBA 2W4JA 4G3GA 3C4XA 5D11A 3RP9A 1PRYA 4MBIA 4MAOA 4DG2E 1YHSA 5CU3A 4FNWA 3Q9WA 2BZIB 3KXHA 4WHZA 3ZO1A 3LXKA 2C30A 4NIFB 2UZVA 2Y6OA 2P3GX 4E4LA 5K4IA 5CWZA 2HZIA 5DT0A 2C6KA 4H3BA 1Y6BA 2Y9QA 3H30A 4QMYA 3MPTA 1W84A 2I0YA 4FSRA 3EL7A 1H4LA 3G6HA 3QWKA 4IE9A 4JX7A 4QPAA 1NXKA 3DXNA 3F5PA 3F88A 4OT5A 2KULA 5ANEA 3R2BA 1QCFA 3W2QA 5CANA 3U6IA 4RC3A 3REPA 4R8QA 1BLXA 3FI3A 4DH1A 4ZLZA 4EC8A 4QMZA 2XIYA 3OY3A 4QPSA 3C4CA 5I4NA 4YZ9A 2ETMA 3DNDA 3QQUA 3DJ5A 3UIBA 1AD5A 2FSOX 4S31A 4DH8A 4M66A 3MFTA 2EB3A 4L43A 4NFMA 4UWCA 3QHRA 3VBVA 3VUDA 3KULA 2C5YA 2PMNX 3PXKA 3QD3A 4QMVA 3RHXA 5B2LA 5FDPA 1OIQA 1KE7A 2NPQA 1OPJA 3VS0A 3KULB 2XK4A 2EXCX 2WNTA 4FYNA 5I3OA 1OBDA 3G5DA 3DFCB 3MWUA 1ZZLA 3Q2JA 5GIOE 1PKGA 2B54A 3QXOA 4I6BA 4RIXA 4FG8A 2X9EA 4E4XA 4IXPA 4QP6A 4WRSA 4Q5HA 3VBQA 4DTBA 3EQBA 4QNYA 2WOTA 2QKRA 2YA9A 3DA6A 4JS8A 2UW5A 3KXGA 4NM7A 4M15A 3BE2A 2CNUA 3OUNB 2JC6A 2VTTA 1H28A 4YJRA 3EFKA 2NRYA 1Q8ZA 4NSTA 2YDJA 3VW6A 3VUTA 5HKMA 2VWUA 4O0TA 2EXMA 4OTPA 4GKHA 2V22A 3AC8A 3SD0A 1OKVA 4XG4A 3VBWA 4AX8A 2HAKA 3H0YA 3TUDA 2VX0A 2X4ZA 3IDPA 4HW7A 4F63A 3AGMA 5ITAA 4DFLA 2ERKA 2O2UA 2WTVA 3R9DA 4IX6A 3HV5A 4Y5QA 1APME 5H8GA 4AN3A 3DV3A 1O9UA 4M84A 3NMUF 3QXPA 3V5TA 2C69A 5TT7A 3KMMA 4YJVA 2EWAA 4EOPA 4F9BA 4AXAA 5KHXA 4TN6A 5KZIA 3NZ0A 3KREA 3FC1X 4ONAA 4QP1A 5A4TA 5AR8A 4ASXA 4BYJA 4BBFA 2IW8A 5HO8A 4RWLA 3OWKA 2QHMA 4YNEA 2VWIA 5IUGA 2WOUA 4AP7A 5B7VA 4RJ5A 2WMRA 5I9YA 4BGQA 3DPKA 3EQHA 4GFGA 1V0OA 2UW8A 3F5UA 3K54A 2HCKA 4BICA 3NUPA 3P1AA 2P55A 4O1OA 3LIJA 3VS2A 5LMKA 2NP8A 3FDNA 2G15A 2R3OA 3PLSA 2ITWA 4CFUA 5K0KA 2XCHA 3ZU7A 1TQPA 5BVWA 5FTQA 5HQ0A 3D5WA 3KRXA 3E88A 4C57A 3LJ1A 3CR0A 3QQJA 4LUEA 1B38A 1QPDA 3QUDA 3FMDA 5IEXA 4EH6A 4J95A 4PDOA 5CSVA 5EI2A 5DPVA 4BGHA 2G01A 3R83A 2Y8OA 1IR3A 4V04A 1PW2A 3PPZA 3QD0A 3RKBA 4BCNA 3CQEA 3FQHA 3F66A 4FL1A 4A9SA 1Q24A 4TYHB 2J7TA 2CGXA 1ZRZA 3KL8A 5KKRB 4R78A 3HNGA 4EOJA 3U4UA 4EL9A 3SAYA 4PL4A 4QMTA 3V5PA 3R7YA 4BDDA 3DDQA 3JUHA 3I6UA 4P4CA 5AV1A 4EWQA 4UMPA 4FBXA 4XP0A 3CY2A 4EHVA 4R77A 2UW6A 4G3DA 3RNYA 3LZBA 4FT9A 5AIRA 2IG7A 4IC8A 2ZM4A 4YZNA 4FSTA 2PE1A 1IASA 2OBJA 3FMKA 3OOMA 4FX3A 4D0WA 4WA9A 4F9AA 3PG3A 3IK3A 3P86A 3UQCA 3MBLA 2AUHA 4C37A 3R9RA 2F7ZE 5J5SA 2IVSA 4PMSA 3QA8A 4MXZA 4IB5A 4CQEA 3Q32A 2ZB1A 1UU8A 3SOCA 4YTHA 1JSVA 2ZJWA 2H8HA 4FKJA 4HVDA 3VUKA 4DGMA 4BR3A 4E6CA 3UG1A 1Y6AA 1SYKA 3KMWA 3RK5A 3Q60A 2XKCA 3PG1A 5HE1A 3BQCA 3P7BA 3PLAE 4I4EA 4QP4A 1WFCA 3MFRA 4ZS0A 5E8TA 2BR1A 2XBAA 4I5PA 2JBPA 3LMIA 2IZRA 2WKMA 3LCTA 2UZDA 3PXQA 4RA4A 2GNJA 1FVRA 1ZYJA 4X2NA 3GQLA 2IO6A 4JAIA 4KBAA 4AW0A 2FSLX 1XKKA 2PVHA 5AX9A 4D28A 2BKKA 4XRJA 2XK7A 4BC6A 3R00A 1J7IA 2PYWA 4ZOGA 4EH7A 5CXHA 2H96A 2GS7A 1CKPA 4FV8A 4L68A 3KXXA 2QVSE 3QUEA 4FZFB 3O51A 2W06A 1SNUA 5AA9A 4KBKA 2ZMCA 4GT5A 3RAWA 2R5TA 2VUWA 2ITQA 2W9FB 3ZMMA 4YC3A 5IA4A 1XH9A 2AYPA 3MH1A 4FVRA 1OGUA 3DOGA 2CGVA 2RFNA 2VTRA 3CPCA 3IDCA 3CKXA 3HA6A 4J53A 4WRGA 3U9NA 4IIRA 4NU1A 4K2RA 5HG9A 4IM0A 4ENYA 2WEVA 2XEYA 3A62A 3WYXA 4QMNA 3LFEA 4FZDB 2QU5A 4QO9A 2X1NA 5CI6A 4BL1A 2EVAA 3PY3A 1OIRA 4PP7A 5LWNA 2PL0A 2RF9A 2C5VA 3CGFA 3OUKA 3QCXA 4GSBA 1ZMWA 4GUEA 5AAGA 2V55A 3RWPA 3KRLA 3UVQA 5CYIA 1M2QA 4FKWA 3I79A 4XP2A 2XJ2A 4JQ8A 5GIPE 5IEYA 2VGPA 4ACGA 5HVKA 3H9RA 4USDA 4O7ZA 3B8QA 2YACA 2GTNA 4JOAA 1JSUA 3UZPA 4C34A 4E8AA 2R64A 3LJ0A 3F6XA 1XQZA 2QODA 4RQKA 4EUUA 5A4CA 4XP3A 1KE5A 1ZARA 2VD5A 3L9PA 4MX9A 4TWNA 3DLSA 5J7HA 3UYSA 3TV6A 4M12A 2BRBA 5CAOA 5HORA 4QYGA 4D1ZA 5BYLA 3MVLA 2XM8A 4H1JA 3GGFA 5C9CA 4EH8A 4QTEA 2XCKA 5ETCA 3ULIA 2RGPA 3QD2B 4FTTA 4LOQA 1WVYA 5L6WL 4AZFA 3KGAA 5JFSA 3QBNA 4GFOA 5CAVA 2JDOA 4UB7A 5AUXA 4TYEA 3Q96A 5J79A 4U44A 5EYCA 1DAWA 4ZEGA 4BTKA 4DH7A 4PTGA 4FGBA 5JRSA 3FMMA 1OL7A 2E9VA 3VS4A 4TXCA 3R9NA 2WXVA 5EW9A 3ELJA 3ORNA 2YAAA 3LXNA 4KIKB 4F9YA 5CSXA 4OR5A 4G3CA 2C6IA 5C26A 3EQFA 3Q9YA 3PSBA 3PXYA 1JKLA 3A4OX 3BE9A 4FIEA 1CSNA 4HZSA 4IAIA 5E92A 5EHYA 3K3IA 4A07A 5BQ0A 3QZFA 5IDNA 3PSDA 3HP2A 1STCE 3BV2A 3F5XA 4WT6A 4FIFA 3T9IA 1OI9A 2PVMA 3QKLA 5B2MA 5BNJA 5JRQA 4GVAA 2CKEA 2YFXA 4Y85A 5CNOA 4CQGA 3AD4A 4JG8A 4FIJA 4E26A 2PUUA 3QU0A 1KV1A 1A06A 4DAWA 1GZNA 4RG0A 4YTFA 3MJ2A 2B55A 3FLNC 3KQ7A 2RKUA 1DAYA 3MVHA 2XK6A 3QCSA 4OW8A 4ITJA 4AGUA 5M4UA 5CENA 3RPOA 5D41A 4ZSJA 5I9VA 4G5JA 4OBQA 4QTAA 4QT1A 4CZUA 1PMUA 4IQ6A 4UYNA 3ATTA 5DH3A 4XCUA 4V0GA 4JG6A 4EOOA 4W4WA 4B9DA 1R39A 2HELA 4EEVA 5KMOA 4V0GB 5AP0A 2XEZA 4BDJA 3OF0A 1GNGA 3DTWA 5JN2A 4BDBA 4BCMA 4LRKA 4X7QA 1U5QA 1XHAA 4O84A 3UP7A 2R7IA 2X0GA 5FG8A 4YHJA 3C13A 4C4JA 1OVEA 5ANIA 4EORA 4N4SA 3E7VA 3I5ZA 5A4QA 3UTOA 4EJNA 2UZWE 4USFA 1W0XC 3ZRKA 4XRLA 2R3JA 3PE2A 5IEVA 4ANSA 2ZV7A 4XMOA 2Z02A 1OM1A 1LR4A 3GU6A 4QMLA 1FOTA 4L3PA 4XUFA 5EDRA 5KZ0A 3TACA 4DG3E 3SVVA 2Z7SA 5CASA 3E93A 3EL8A 3QQFA 1MQ4A 2O64A 2QU6A 5AR2A 4O0SA 3C50A 3G2FA 1JAMA 1YRPA 3VAPA 5HBJA 5IUIA 4FYOA 4IX4A 1R3CA 1U54B 1YW2A 1A9UA 4PP9A 5CEQA 3ZEPA 2VGOA 5A4LA 4C3PA 1B39A 4IB0A 3C4ZA 3I6WA 3GC7A 3CE3A 3OY1A 3HMIA 3ZXTA 3OD6X 2XUUA 4FV5A 3P23A 4Z3VA 4BTMA 4HYIA 4AW1A 2UZBA 2OO8X 3DKCA 4Y5HA 3W2SA 5CAPA 1P4FA 2CKPA 4QYFA 5A9UA 2XNGA 3Q4UA 5FEQA 4XS2A 3UOLA 1E1XA 5FEEA 3TL8A 3QLFA 4JNWA 5HGIA 4UXLA 2HZ0A 4I93A 4U3YA 4XV9A 2GNGA 3NPCA 2OH4A 3MY1A 5CU4A 5J95A 1KSWA 2B4SB 4IBMA 5HU3A 3NUAA 1BKXA 5C8KA 3RK9A 3FSFA 2C6MA 3NYOA 5EQEA 4OTIA 3P79A 2W05A 4KKEA 2X7GA 3OROA 2VTOA 3UO6A 3N4UA 3OCTA 3AGLA 2OU7A 4FZAB 4KINA 1RE8A 4PUZA 4TL0A 1PXNA 4BBMA 2VX3A 2ZAZA 2W1DA 1L8TA 2R3RA 5DFPA 2BALA 5HESA 2JKQA 4HVIA 3MY5A 4HYUA 4KBCA 4MNFA 5BVFA 4FT0A 4AOTA 5DR6A 2PSQA 4CNHA 5M56A 4R6VA 4AU8A 3L8VA 4AF3A 2V5QA 3CXWA 3W32A 1ERKA 4YJPA 3VUGA 3DT1A 2X8DA 3TV4A 5C4KA 2C47A 2O5KA 2HZ4A 4N6ZA 3ZS5A 5A4EA 3H10A 4U80A 5GZAA 4DT8A 3R8UA 4K0YA 4I5HA 4YZBA 3BPRA 3WILA 2J4ZA 3II5A 4GYIA 3TNPC 5K9IA 5A46A 5A54A 4IJPA 2PK9A 1BL7A 1U59A 5G1XA 1CMKE 4AG8A 2CHLA 2QOFA 5JZNA 1H0VA 5CAUA 4BDGA 1PXLA 2WELA 2WMUA 3TXOA 4HYSA 1W98A 4AW2A 2G2FA 4BZOA 1YQJA 1KV2A 4YZCA 3VULA 4C36A 3A60A 2CN8A 3QQLA 2I0HA 4O2ZA 5TO8A 3R8MA 3VN9A 1X8BA 2X9FA 5K0XA 4FKTA 2GU8A 4D2WA 4M0YA 1JSTA 4FSUA 1MP8A 3L8PA 3W55A 4ANQA 3QTZA 5CEOA 4ENXA 2C3LA 4EUTA 3PYYA 3FQEA 4ERWA 1M7NA 2E9UA 3TV7A 1R1WA 2XNNA 4OTQA 3F3ZA 5LMKC 4DGOA 2XA4A 5JGBA 3HGKA 3JY0A 5ANDA 3UE4A 2I6LA 3Q5ZA 3QYZA 4GG5A 4EK4A 4JAJA 2W5BA 3ANQA 4RJ4A 4F09A 2PVNA 3G15A 3FE3A 4EC9A 4XG3A 4I0RA 5IUHA 1KOBA 4JRVA 3UOKA 5KUPA 2ITOA 3ACKA 4O0VA 4BB4A 4FEQA 5FM2A 2PE2A 3AXWA 2V0DA 4Q2AA 4BN1A 3FKOA 4DLJA 4TYGA 4RC2A 3PP1A 5AR4A 4E5AX 4HGTA 2RFSA 5KKRC 3I4BA 4D2PA 4DEHA 3RINA 5CU2A 2WTWA 4JXFA 3OWJA 4C0TA 3MA6A 3U87A 4V05A 3SXRA 4EH2A 4F6WA 3EKNA 3L9NA 3QTSA 3SXSA 1PHKA 2DS1A 3DQXA 3A8WA 3A7IA 5KO1A 4XJ0A 5DN3A 3MYGA 1OL6A 3R7UA 5CF8A 3KVWA 1M14A 3OTUA 4I92A 4KWPA 4UN0C 3E8CA 2OK1A 2FA2A 3KCFA 4BCHA 3E8NA 2WIHA 1PXOA 4BIEA 4U41A 1U4DA 3W1FA 4IAFA 2HW6A 4O7RA 4FV0A 4YO6A 3MVJA 4BY9E 4FV1A 5JGDA 3I0OA 3QKMA 2GDOA 3MI9A 4DCEA 4ZY5A 1NY3A 2XH5A 2XNPA 2NRUA 4HOKA 3NUNA 3ODYX 3VBTA 4AE9A 4YJQA 3QTUA 3D15A 2GHLA 3NRMA 4HVSA 2P0CA 4PF4A 4EHGA 3NWWA 1J1CA 1JNKA 2R3NA 3QD4A 2PZIA 3V5WA 4LRJA 2JBOA 3P5KA 2BDWA 2QURA 4IW0A 4XV2A 5H3QA 3DAKA 4F7SA 2BMCA 5AP6A 2JGZA 3DNEA 3FKNA 3DY7A 4FV2A 4I6FA 3AQVA 3B2WA 4L67A 4WNPA 3HL7A 4KABA 3MGYA 4K1BA 1G8SA 5F94A 4MWIA 1SMHA 2ETKA 4GL9A 3KCKA 3QHWA 4KA3A 1IA9A 4YU2A 2R4BA 4XLIA 3GC8A 4J97A 5F20A 4Z16A 2Z7RA 3OOGA 3BHYA 3GOPA 3OCGA 1WVWA 4KS7A 3ZUTA 4FVPA 3HAMA 2W7XA 2BTRA 4EZ7A 2A19B 1J1BA 5LVNA 4ZSLA 2XS0A 2XIRA 2QOKA 2GS6A 4P5ZA 3IQ7A 1Y8YA 4R5YA 1JWHA 4DF3A 2KTYA 1K2PA 2VTIA 5T68A 1PMVA 3EYGA 5KMNA 4KIOA 4F1OA 2X6EA 3PY1A 1U46A 1OITA 2CNQA 4RLLA 3THBA 3NNWA 3RZFA 4ZJJA 2C4GA 4WG3A 3PVUA 3FAAA 4FV3A 4N0SA 1W7HA 4NWMA 4BKYA 5DMZA 4EOSA 1VR2A 4YC8A 2J9MA 4RT7A 3E3BX 4RPVA 3F61A 3QRTA 3EN4A 2QOIA 2PVFA 4GJ3A 3DK6A 3GU4A 3UNZA 4EYJA 1Q97A 2A2AA 3R8VA 5DIAA 1H8FA 4G1WA 5DWRA 5B0XA 4E6QA 2WTDA 3N51A 1YWRA 4QP3A 5LOHA 2JFMA 3OP5A 4PDYA 2PTKA 3RM6A 2H34A 5GZ8A 1PMNA 2JKMA 4GK4A 4BKZA 4C3RA 1V0BA 2W1EA 1PXMA 1Q41A 4DEIA 5I9WA 5E7RA 1OBGA 2ZMDA 3T3UA 2BAKA 3PIYA 4L8MA 4JLCA 3VUMA 3B8RA 4M3QA 5CXZA 3F3VA 2IWIA 4CT2A 2BAJA 3WIKA 5E1EA 2UZLA 4A9YA 4ANMA 2FSTX 5HOAA 3QTQA 1M7QA 1CKJA 4GV1A 4KIQA 5JFWA 1PXJA 3DDPA 2R3GA 3UG2A 5AUUA 3M1SA 2OJFE 4DGLC 4R1VA 2XNOA 4IDTA 4OTDA 3NAXA 1UNHA 5L8JA 5T6KA 3R21A 1J91A 3VIDA 5DYJA 2YEXA 2BRHA 2YM4A 3G6GA 2C6EA 4FTLA 1NVRA 4U97A 5ETFA 3VS5A 3BELA 4GFMA 5I9XA 2PU8A 4O81A 4O86A 3V04A 3AC5A 2GFSA 1Q61A 4FTOA 3AMBA 2GS2A 5E8ZA 5HG8A 4F0GA 1G3NA 4DH3A 3NSZA 1HOWA 3QC4A 3ROCA 5DR2A 3V5QA 1FVVA 5AX3A 1W83A 5FLFA 4L42A 4ZP5A 4KSQA 3V6RA 4XHKB 1XH8A 4CMOA 2O0UA 4I0SA 4L45A 2O8YA 4G5PA 3V8TA 4HPTE 5E90A 2BCJA 4AZWA 4BF2A 1GOLA 5GJFA 3WBLA 4NJ3A 4EH4A 5JQ8A 4CTBA 3R30A 5KNJA 5HD7A 5IMXA 3CC6A 3DQWA 4JQEA 2WU7A 3EWHA 4D2TA 4IEBA 4F9WA 5CEPA 5IQAA 4ZMFA 4EK5A 2J5FA 2V7AA 1UKHA 3F3WA 3BWFA 4AS0A 5E4HA 2E9NA 3K5VA 1Q62A 2QOBA 4P7EA 3UYTA 3UPXA 3KXNA 2BHEA 3E92A 3LM0A 2O63A 2VWZA 2QC6A 4FL3A 4G6NA 4C8BA 2IZSA 4QMQA 3TI1A 4EBWA 1UA2A 4LFIA 1OL1A 4Y83A 1P4OA 5DGZA 3BHTA 4B4LA 4ZTMA 4FKGA 4KD1A 2XJ0A 3PJ2A 3HUBA 4X3FA 3OCBA 4A4LA 2C3KA 4BDEA 3FV8A 2J0IA 1FBNA 3FBVA 1UU3A 4AFEA 4CEGA 3KXMA 4OTWA 2PHKA 4RA5A 3FMEA 4RIOA 4XV1A 5AP2A 5FDXA 3RAHA 2F7EE 3S0OA 4GH2A 2C0OA 3FEGA 3CTQA 4YNOA 2PUPA 4C58A 3EJ1A 4FTQA 3JS2A 4A7CA 3ZCLA 4EOIA 3SA0A 4GIHA 3FZ1A 3TEIA 4RX7A 4O1PA 1GIJA 2C1BA 4RVMA 3AC4A 3DZQA 2ITTA 4CFMA 3NNVA 1BUHA 3S1HA 3T8OA 2IN6A 3MFUA 3BEGA 2EXEA 3OG7A 5HCZA 4EHEA 5K5XA 1G8AA 5IQIA 5KMJA 4LQMA 1BI7A 3C0GA 4RIXB 3IW8A 5CU0A 4QNAA 1OPKA 2YLEA 4NM5A 3TZ9A 2CPKE 3T9TA 2C3IB 3LCSA 3FL5A 5ETIA 3DBQA 3ALNA 4XG6A 3TM0A 4HCVA 3KN6A 3UC3A 4CFFA 2JAVA 3KRRA 3MB7A 5H8EA 3D7TA 4W9WA 4ZXTA 4IAYA 4W8DA 3ZOSA 4NFNA 4FK3A 5AUTA 3EHAA 2QHNA 3PXRA 2W17A 3K5UA 2OSCA 2I0EA 5DG5A 4MD9E 4O6LA 4BCPA 3UODA 4DLIA 5FM3A 2XYNA 3F5GA 4TZRA 3ZRMA 1Z57A 1ZOGA 4C3FA 4F9CA 2OLCA 4RC4A 4IVBA 4Z55A 3D5XA 4ZJVA 3LOKA 2X39A 3KN5A 2W4KA 5H8BA 3WZDA 2BVAA 1REJA 3VHKA 2JD5A 2SRCA 4RJ7A 2VTQA 3NDMA 3HMMA 5ANKA 2PVYA 3UC4A 3QZGA 3Q9ZA 4I6HA 3FYJX 3LM5A 4HNIA 4K9YA 2F2CB 4ALWA 2HY81 3OFMA 1XWSA 4R7HA 3TCPA 4E4MA 4RIYA 4LM5A 3NYNA 4U81A 5HIDA 3ZONA 3MFSA 4MVFA 4JIKA 4ZSEA 5HX6A 2Z2WA 5L2QA 5K5NA 1S9IA 4H1MA 4XG9A 5EYKA 3RI1A 2CDZA 4FTAA 4U79A 4XLVA 4C2WA 4C59A 5CZIA 4FNYA 4EKLA 4XBRA 4RMZA 1QPJA 4QMOA 3I60A 3A7GA 2A1AB 5L2IA 3ZFMA 3G51A 4GYGA 2XNBA 4YP8A 2YCQA 3GI3A 4FMQA 2C0TA 3HKOA 1TVOA 4YO4A 4D5HA 5EFQA 4NL0A 4UMQA 2E9PA 4TTHB 2OH0E 4FKLA 4JBQA 4JDKA 4PL3A 3TZ7A 4IWPA 4S30A 5M09A 1WBNA 2C1AA 4BCJA 3DGKA 4ZK5A 4E1ZA 4JL9A 2YERA 4K6ZA 4OUCA 3FZTA 1LEWA 2W5AA 2ZV8A 5C1QB 2OI4X 2VTJA 4RFZA 5DBXA 3PDTA 5D7AA 2HXLA 4DN5A 5IMEA 2OW3A 2Y7JA 2ITPA 5EW8A 3PXZA 1AGWA 4Y72A 3MV5A 2IZTA 1AQ1A 3DAJA 2R3FA 3IG7A 2HIWA 2PZPA 3FZRA 4WSQA 3LJ2A 3PJCA 4AACA 2PY3A 2OZOA 3QKKA 4JQ7A 4ZLYA 2XIKA 2XF0A 1L3RE 3R63A 1CKIA 3OS3A 1UKIA 1P14A 5G6VA 5JSMA 5K3YA 3WF5A 3ZC6A 1A48A 1ZYLA 2B1PA 3TKIA 4ANBA 2OXXA 5L2SA 2VWXA 5AUVA 4FSNA 1OPLA 4DT9A 2GSFA 4IZ7A 4CYIA 3LFNA 2ZV9A 3EQDA 4OBOA 4QMUA 4ORKA 4QMWA 4FKQA 5EH0A 4ZY6A 4AGCA 5F1ZA 3HX4A 3EQCA 3MH3A 3R22A 1O6KA 3TNWA 4FL2A 3UOJA 4PPAA 4F0FA 3G9LX 2IW6A 3OC1A 3ZSGA 3HVCA 2ITXA 4FG9A 3SQQA 2J51A 4FR4A 4W8EA 3SDJA 2BDFA 5IF1A 2PZ5A 4AOJA 1M2RA 4EI4A 3QALE 1IA8A 5IKWA 4FTKA 4EOLA 4U9AA 2V7OA 4G34A 2X4FA 5A14A 2UV2A 4IAKA 2XRWA 2B52A 4BTJA 3FYKX 2VU3A 3Q52A 3PJ8A 2DUVA 3Q5IA 3CQWA 1ZOEA 3S4QA 4CZYB 1I09A 3DBFA 2YIXA 5DRDA 5F9EA 2EUFB 3Q6WA 5HBHA 3RZBA 4F1MA 3Q53A 3A61A 5CEKA 4JBVA 2YN8A 3NS9A 4ANLA 3A8XA 3R73A 4ZZNA 5BMMA 3RAIA 4PTCA 2PUIA 4MF0A 4YZMA 4E5WA 4D58A 4N57A 3VBYA 2ITZA 3GVUA 3FQSA 3NW7A 4PNIA 4PNKA 3GNIB 4TWPA 3ANRA 3CY3A 3IO7A 5HVJA 2AC5A 1OKZA 2VTHA 2ITNA 4RFMA 5LWMA 4RZVA 4O96A 4MXYA 3IKAA 3UO5A 4IACA 4TNDA 4I22A 1IG1A 4L7FA 2UUEA 5CSWA 2GQRA 3HMNA 3EQIA 4CRSA 3H3CA 1TQIA 3TNHA 3RMFA 3UNKA 3L1SA 3JXWA 4AZSA 3A7HA 2GQGA 2XRUA 4IANA 3L9MA 4U40A 5CEIA 3M2WA 5KE0A 4KAOA 5LMAA 2WTJA 4ANNA 4GU6A 1SM2A 2P2IA 3O7LD 5FGKA 5IA3A 4ZTQA 2JKOA 3GP0A 4NK9A 2UZUE 5CVFA 3VW8A 3LKMA 2OZAA 4FICA 2WO6A 3ZZWA 2WMQA 4J71A 2C6OA 1REKA 3BYOA 1OL2A 4GK2A 2IZUA 3LE6A 4LYNA 2WMTA 4X2FA 2ONLA 3E3PA 3VUHA 4C61A 3MVMA 2WHBA 4TWOA 3TWJA 1XH4A 3ZLXA 4M97A 2A27A 2GNLA 4NCTA 3KRJA 4G9CA 1OMWA 4ARKA 4M69A 3PPJA 4O0XA 3S95A 3TDWA 5A6NA 2YM3A 4APPA 4B8MA 4M69B 1O6LA 3EZVA 3MDYA 2ZM1A 4AGDA 4AN9A 5BUJA 3PA4A 2B7AA 1OZ1A 3V8WA 5BVEA 5CU6A 2YISA 5H2UA 1G5SA 3NIZA 3TNQB 2JEDA 1H24A 4AZEA 5LMBA 4AAAA 5M4IA 4DEEA 2X8IA 1ZYCA 3DCVA 3DK3A 4KKHA 4GT3A 2C6LA 4CFVA 1ZOHA 2X6DA 3HZTA 3KY2A 3P7CA 3BLRA 2X7FA 3R6XA 4M13A 2VRXA 5EDPA 4IZ5A 3GU8A 4YLLA 1YI4A 4FKOA 3DJ6A 2JDSA 5FEDA 4G3EA 1YOLA 1ZY4A 4JR7A 4YBJA 3FLZA 4PMMA 2Y6MA 2WTKB 3TTIA 3QZIA 1FMKA 5CVHA 3FLWA 4L9IA 4RZWA 4G2FA 4BHNA 3ET7A 5EYDA 3VVHA 1F5QA 3LQ5A 5IQEA 2QD9A 2QR7A 4XX9A 4D0XA 3FMLA 4LL5A 4TKSA 5EI8A 4C35A 4YSJA 3MW1A 1WMKA 1F3MC 3JPVA 3QX4A 1URWA 5TR6A 1URCA 3QRUA 4KKGA 3AC3A 1FQ1B 2WTCA 4R1YA 2VV9A 1XBCA 3GXLA 3PP0A 3QX2A 4CKIA 1Q3DA 1Q8YA 2VTAA 4C4EA 1P5EA 4CFWA 5HHWA 4JDHA 3W18A 4EK6A 1WBVA 3BYVA 4IWDA 3DBCA 4I5MA 4G31A 4O6EA 4C62A 4NM3A 5AMNA 3W8LA 4U3ZA 4UYAA 4WIHA 1QMZA 2C6TA 5J9ZA 2WQEA 1BX6A 4WOVA 4FEXA 4JBOA 4PMPA 4WNOA 3QF9A 4OLIA 3CLYA 2B9HA 5E91A 4E3CA 2BRNA 5HNGA 4ACMA 3PE1A 2X81A 3W8QA 3FHIA 4J96A 4LGHA 3G90X 3Q3BA 4HNFA 5EW3A 4UMTA 4AQCA 2R0UA 4FI1A 5FTGA 1H1PA 3RALA 1ZZ2A 3CS9A 2BIYA 4NW5A 4WSYA 5AAFA 4FIHA 4CV9A 3R7EA 4IH8A 4QTCA 4O7WA 1YXSA 1E1VA 5AUZA 3CTJA 4F4PA 2QO9A 3P9JA 2C5NA 2Z8CA 1IRKA 2LGCA 4AFJA 3VS1A 4E6AA 1UU9A 3NUUA 1DS5A 5HE0A 1H25A 1H1RA 2JIUA 4XG2A 4ZAUA 3C4FA 4A06A 3QRJA 4LOPA 4WNKA 4FTJA 4L6QA 5M51A 5JH6A 4UMUA 4DFYA 3NEWA 3C7QA 2XBJA 3ZSHA 2WU6A 1OECA 2QOLA 1HCLA 4HZRA 4JI9A 4ZTSA 5HO6A 3V3VA 3ZTXA 3HUCA 2CNVA 3R1QA 1V0PA 5F95A 3LFBA 2R3KA 4FT7A 3COHA 2GTMA 3U51A 5IQDA 2ZOQA 3R8LA 2VO7A 4FTCA 4WUAA 4X3FC 1Y57A 2RFDA 3C1XA 4FKUA 4MWHA 1O6YA 1PXKA 3QQKA 4XBUA 3RPRA 2G1TA 2P33A 4X21A 4FSQA 3PUPA 2JDVA 1ZMUA 2VO3A 1ZYSA 4PL5A 2GNIA 3BYMA 5AAEA 3BHUA 4EK3A 1T46A 4NEUA 5HIBA 4DCAA 4GMYA 4Y46A 3R0TA 1UNLA 2JDTA 4Q5EA 1YXVA 1YXXA 1ZWSA 2ZB0A 4Y8DA 5AR3A 4QTDA 4IDVA 4MXOA 2PULA 5AP5A 3BGQA 2PWLA 4EOMA 1YXTA 2XK9A 3RPYA 2XNMA 5AR5A 5TF9A 2OF2A 4I6QA 5EM7A 3DKOA 2Z7LA 1ATPE 4CCBA 3BCEA 3FMJA 4B6LA 3FL4A 4FT5A 4GIIA 5EM6A 5LARA 3U9CA 5LCJA 5AJQA 3WZUA 4IWQA 4C4FA 1Q99A 4R7BA 3QTRA 5IH5A 3ACJA 3WF9A 3S3IA 5ACKA 3CIKA 1GZKA 4YLJA 3MY0A 5IA0A 2OJGA 4ZY4A 4E93A 3PJ3A 2UZOA 4EYMA 1CTPE 2F57A 4IVAA 4CG8A 1GJOA 5IISA 1BYGA 4N6YA 4AUAA 1FGIA 4FZ6A 4EK8A 5ETAA 3W33A 5IQGA 2QNJA 4FNXA 4GK3A 4KNBA 4HGEA 1YDSE 2CCIA 4O7YA 2W1GA 3POZA 2W1ZA 5HD4A 5IA2A 3SGCA 3RPSA 1VZOA 3MPAA 2WMBA 2A4LA 1PKDA 2C68A 4YJSA 2YCFA 2XJ1A 1KWPA 3GUBA 1YHWA 2YWVA 3VJNA 2C3JA 3QUPA 4IX5A 3UIXA 4CMUA 1DM2A 4OTFA 1XBBA 3DKGA 3L8XA 2YIQA 3A99A 4QQ5A 4R3PA 2XNEA 4MBJA 3HRFA 3WIGA 4FUYA 1FPUA 2QQ7A 2W1FA 4QQCA 3VS7A 3P08A 3HMOA 4YLKA 4D1SA 5DI1A 2WIPA 5E9EA 3E8EA 3DXQA 4I21A 5D12A 4M7IA 3O8TA 2ZDTA 2PVLA 3DFAA 2QR8A 5CVGA 3LFCA 1VEBA 4BWPA 2R3IA 4RX8A 3PVGA 4B7TA 2YIRA 3MH0A 4EONA 3R1NA 3NUSA 3RAKA 3MJ1A 4FEUA 3V5LA 3BU6A 4JR3A 4FIIA 4G9RA 4EZ5A 2Y0AA 2IJMA 1JBPE 5BVDA 2B9JA 2OXDA 1NVQA 3LCKA 4FV7A 3FXZA 3DK7A 5JGAA 1OKYA 3U54A 2JAMA 3RBWA
chains in the Genus database with same CATH superfamily
3VQUA 3MIYA 3ZO4A 2IEWA 5LJJA 1Q8TA 1YOJA 3OT3A 4FODA 3FPQA 2RL5A 5L2TA 4EQUA 2BUJA 3FKLA 4F64A 4P2KA 3VS3A 1MRVA 4QTBA 3F7WA 2CKQA 2OIDA 4YMJA 3W0OA 4HGLA 3MS9A 2WGJA 3OT8A 5DR9A 3QAME 3EFJA 3JR1A 4OBPA 1GIHA 3FI4A 1YDRE 2Z7QA 1EH4A 2OJ9A 3ORIA 5HCYA 1T45A 3OCSA 3UJGA 5GINE 3BIZA 1E9HA 2J5EA 4CFXA 1VJYA 3BBWA 4FNZA 1PMEA 2QOQA 3QQGA 2Z60A 3R1SA 3G9NA 4RVLA 2ITVA 2YABA 5EM8A 2W1HA 4A4XA 3BLQA 4CKJA 4KUJA 4QMPA 4DBXA 5J7BA 5CX9A 4FEWA 4QMSA 3NVKI 3ODZX 1DI8A 4YTIA 4DFUA 3BKBA 3UQFA 3O96A 4U0IA 3LQ8A 4EH5A 3PWYA 1MRYA 3BGPA 5AIKA 2QG5A 5M4FA 4WUNA 3F3TA 3M11A 4BCFA 4LGDA 3SLSA 3D5UA 4A4OA 1YDTE 5IA1A 3ORPA 1GAGA 4GU9A 3LFDA 4F99A 4GJ2A 5FXSA 2AQXA 3PZHA 1NT2A 2WFYA 5FBNC 3U4WA 3NLBA 3E64A 3ZXZA 4ASDA 5DHJA 2R7BA 2Y4IB 3KK8A 3RVGA 1XJDA 4AA0A 5TOZA 4JJRA 4QP8A 2BZHB 4ZLOA 4WD5A 3HP5A 3TTJA 3OTVA 4RRVA 2QOCA 4QPMA 4YPSA 2B0QA 1YI3A 2IVTA 4IB1A 1TZDA 5AEPA 3IOKA 3ORXA 3BGZA 1KUTA 5DT4A 3DXPA 2WMVA 3W2RA 2I0VA 5C03A 5L6PA 4K8AA 5IH6A 4PDSA 4DYMA 3GU5A 2VNYA 4IX3A 4J8MA 3ENMA 3U55A 4FC0A 3VF9A 2BILB 2YJRA 3QLGA 4F0IA 5C4LA 3E5AA 3GCVA 3WZJA 4DDIA 5LVPA 2UZTA 3QCYA 4FK6A 3EN6A 2QLQA 1WBWA 3ORKA 3IDBA 3CCNA 3R71A 2CLQA 5HX8A 3ULZA 1IEPA 5M44A 4K33A 4MNEA 4HYHA 5L4QA 3EN5A 3ZDUA 4MF1A 4QYEA 5D10A 4XYFA 2BRMA 2QONA 4H36A 4S32A 4UZHA 4BCOA 3RCDA 5BUEA 1Z9XA 1YWNA 4NH1A 1YWVA 3NYXA 3QRIA 3DU8A 3FWQA 3LW0A 3AT4A 2RG5A 2WPAA 3HV7A 5EOLA 4ACHA 1XMMA 3MN3A 3E63A 3R8PA 3SX9A 3G33A 2ERZE 2UW3A 5B2KA 1H26A 4M68A 2JFLA 1UU7A 5LVLA 1WCCA 4FG7A 4S2ZA 4UZDA 4F70A 2VX1A 4K77A 3TKHA 5LVOA 5ICPA 4IFGA 4BI0A 4AA5A 3LXLA 4AT5A 3AG9A 5HTBA 4R3RA 3SG9A 4I94A 4WNMA 5BX0A 4XEYA 3GBZA 3LLAA 2R0IA 3CD8A 5HNIX 2BHHA 4AOIA 1G8JA 3MTFA 2W4OA 3SRVA 4AAYA 4J52A 5DEWA 3G0EA 2CJMA 3EKKA 3OXIA 4I0TA 2R2PA 2FSMX 5L2WA 3ZM9A 4GW8A 2J0LA 3EB0A 4Y95A 4KS8A 5EM5A 2Q83A 3BYSA 1W8CA 4F1TA 5I5ZA 4PX6A 3BEAA 3DAEA 2PE0A 2REIA 3NCZA 3UZRA 3D83A 3LFFA 1KE6A 1OUKA 3QA0A 4TPTA 4C4IA 2OG8A 4MXAA 4ITIA 3I5NA 5CI7A 4RVKA 3C5UA 4DEGA 2BIKB 5FXRA 4ASEA 3CKWA 3JVSA 2YIWA 2XIXA 3RM7A 3VNTA 4E73A 1PXIA 2QG7A 5FQDC 1GZOA 5DLSA 4FT3A 4XV3A 4APCA 3AKKA 3TIZA 4DGNA 4O0WA 3R04A 3LVPA 5EK7A 5BVNA 3Q4CA 3AOXA 3TN8A 4O0RA 3W0RA 3BQRA 3PIZA 4PV0A 4MTAA 1LEZA 2VTMA 4EQCA 5KHWA 4Z7GA 1JPAA 4WG4A 4MH7A 4DTKA 3MTLA 2OWBA 4A9RA 4ACCA 4IM3A 2Q0NA 3GU7A 2PMIA 3A4PA 4GT4A 4ITHA 3QTWA 4FA2A 3QTXA 5GNKA 4DITA 3MB6A 3U6HA 3ZLWA 3W0PA 1WBTA 2YLFA 3CGOA 5DT3A 2WTKC 4QOXA 2UW7A 3F2RA 2YCRA 1H01A 1QL6A 3BI6A 1I44A 4D4SA 3Q6UA 5HLWA 1S9JA 4JDJA 1ST4A 4I20A 5ANOA 4CMTA 4E7WA 2UW0A 5I9ZA 2CLXA 4FTUA 3MIAA 4FSYA 3OBJA 1BI8A 4D2VA 4IJ9A 5C8MA 1Q8UA 3R7OA 1IAJA 2VWVA 3IW5A 3LAUA 4X0MA 1W82A 3F3UA 4NIFA 4X3FB 5DVRA 4DDGA 3R01A 4C33A 4FOCA 5J9YA 3WYYA 5DNRA 3DB6A 1OL5A 4BZDA 4BFMA 4RX5A 2GNHA 4YJOA 1R0EA 3ALOA 3OEZA 4FKVA 3ZSIA 4O27B 3WI6A 4QMMA 4F7NA 3BHHA 3CBLA 5AV3A 3LMHA 4DINA 5DRBA 5J87A 4FE2A 4O7SA 2W1CA 2G9XA 3TDVA 3WF7A 2C6DA 1KOAA 2WMAA 3QYWA 1UWJA 4K11A 4IHPA 3MH2A 2F9GA 2FB8A 5M57A 4J99A 5M4CA 4D4VA 1FGKA 1IAHA 3SXFA 2VO6A 1Q8WA 4FKRA 4ZZMA 5HZNA 2VTPA 5HE3A 3C0IA 1H00A 3ZH8A 4EJ7A 3O7LB 4L52A 2F4JA 5AADA 5IQHA 3PFQA 3B2TA 3FZPA 3O0GA 5E1SA 3W2OA 5HU9A 4IC7A 4ALUA 5IQCA 5AP1A 3O17A 4FZ7A 5DEYA 2ZVAA 3WZEA 4DH5A 3ZFYA 3LHJA 2UVZA 2BAQA 3R2YA 3HLLA 4FTMA 1H27A 3C51A 3LFSA 1GY3A 1M17A 2FH9A 2XKEA 1BL6A 3D7TB 1Q4LA 3I0QA 5CQWA 5HVYA 2J0JA 4NKSA 2B9IA 2I7QA 3N9XA 4UALA 3GT8A 4RJ8A 2J0KA 1OIUA 3TIYA 5CF6A 3BWJA 4AXDA 5M55A 2QO7A 4LV8A 2HENA 2XIZA 3IW7A 4QYHA 4TRLA 4FEVA 4IZAA 4KRDA 4O7TA 4QYYA 5EHLA 3W2CA 3F9NA 4E5BA 4QQTA 1SVHA 1PXPA 5HTIA 5M07A 2WMWA 4JX3A 4YJNA 4JRNA 4D2RA 1J3HA 3EN7A 3M42A 3OVVA 3QGWA 4PRJA 3OZ6A 5AR7A 4UXQA 1PF8A 3FPMA 2YWPA 5E8SA 2BTSA 2IVVA 5EQYA 2BZKB 4UBAA 2EB2A 2W1IA 2YZAA 2GHGA 4YZDA 3GOKA 3NUXA 3D7ZA 3RCJA 4A9TA 1JKSA 2IPXA 1J7LA 4RIYB 5H9BA 5C27A 3BBTB 1WBPA 2FYSA 3GFWA 3WOWA 2R3QA 2UVXA 5AP4A 4F6UA 4LRMA 5BMSA 3GEQA 3HECA 2BPMA 1JOWB 4Q9SA 2IW9A 3PWDA 3PFYA 4FKSA 3E8DA 5CTPA 3ZLSA 3GC0A 4ZSAA 2VO0A 4CFNA 4BDKA 4NZWB 3AD6A 3ZDIA 5JZJA 4DEDA 2PPQA 1P2AA 1DI9A 3SV0A 3ZUUA 1RDQE 4MD8E 1SVEA 4QP2A 5FD2A 1V1KA 2W96B 3ZRLA 4HVHA 1ZMVA 5CZHA 4ID7A 5CF4A 4HGSA 5HTCA 3IOPA 2UW9A 2ITYA 4RLKA 4CYJA 3HRBA 1JVPP 3OW4A 3DJ7A 3OXTA 3PVWA 3IECA 3V01A 2G2HA 3NVMB 3IS5A 3UOHA 4H05A 4D4YA 3GC9A 4OGRA 4DG0E 2PZYA 3CP9A 4R5SA 4UWYA 5EOBA 3PY0A 4ZTNA 3ZBFA 4TYHA 4FGRA 4E20A 3BV3A 3FMHA 3UP2A 3FXWA 3ZFXA 4JIAA 4EZ3A 3K2LA 1XH5A 2UZNA 3RWQA 4AT3A 3MESA 4FTIA 1XBAA 3QTIA 4NW6A 5HNBA 4IMYA 3QWJA 4ANOA 4BDIA 4R7IA 2J0MB 2BZJA 4TW9A 3LPBA 2X2MA 3EMGA 5IG1A 3GCQA 4FF8A 1YXUA 5HLPA 2PVRA 3U8WA 3JVRA 3H4JA 2HWOA 4EH3A 1SNXA 3TNIA 5J8IA 2CGWA 2HY0A 4YHTA 4USEA 2OICA 5FUTA 4I5CA 3W10A 3VRZA 3BLHA 1ZY5A 3KVXA 4W4XA 4QQJA 2CKOA 4KSPA 3EZRA 4F7LA 4FV4A 3ZHPC 5JK3A 3I7BA 1K9AA 2JKKA 4BBEA 2NO3A 1YKRA 1LUFA 2JLDA 2DQ7X 5HI2A 3VO3A 4CGAA 4DA5A 4A9UA 5L3AA 2OF4A 3GCPA 5DE2A 2PMOX 3VRYA 5AP3A 1PJKA 4D1XA 4MHAA 3JYAA 2PMLX 1B6CB 2AC3A 4XG8A 2ZDUA 3FMNA 3FUPA 4DGGA 4GRBA 4U42A 5GJDA 2E9OA 3VWAA 4O22A 4C38A 4FKPA 3IGGA 4J1RA 4TWCA 2O3PA 3H9OA 3R28A 4FVQA 2CMWA 4NJDA 4C4HA 3P7AA 2FUMA 1H08A 4F7JA 2C5OA 3DKFA 2ETRA 4F6SA 3E62A 5FWKK 1PYEA 2RIOA 4X6QC 3ORMA 4ZTHA 3NGAA 5AUWA 5I9UA 5IU2A 5EI6A 1H1SA 4BTFA 4AXFA 3F7ZA 1RJBA 2R3LA 4PY1A 5A3XA 3TT0A 2BDJA 1WVXA 5KCVA 1YI6A 4PQNA 3CTHA 4EHZA 1VYWA 3OWPA 4PDPA 3PTGA 5FBOA 2YM6A 4AXEA 3C0HA 3TYKA 5CLPA 3G0FA 2XP2A 3ITZA 3NNXA 4OTGA 2R3PA 1H07A 4EOQA 2PZRA 5CY3A 2FVDA 3PA5A 2XK8A 3D14A 3VF8A 5J1VA 5C8NA 3UPZA 5JT2A 2GPHA 2Y4IC 2YM7A 1NW1A 1NVSA 1MRUA 3R7GA 1KE9A 2UZEA 2V62A 4BCQA 1ZXEA 4LV5A 3NW5A 4YTCA 3EFLA 3AMAA 2GMXA 2XMYA 3L9LA 4CD0A 5AP7A 5KMMA 2OZAB 4AWIA 2CN5A 1UVRA 5DOSA 4L44A 4CVAA 1K3AA 2W9ZB 3NCGA 4GUBA 4KRCA 4NTTA 4BI2A 2YDIA 1UWHA 3FZOA 3LMGA 4XG7A 4NYEA 4IFCA 4O2PA 3F69A 4FV9A 2VTLA 4FIGA 3UMWA 2OJIA 3FI8A 3IGOA 2J2IB 4U8ZA 4DHZA 3KF4A 3ROYA 2BFYA 2F7XE 3W2PA 1F0QA 2YDKA 4DHFA 1WZYA 4MQ2A 3KB7A 1MUOA 5KBRA 4DFZE 1UV5A 4O21A 2OFUA 3EYHA 4II5A 4EH9A 4FOBA 3ZO3A 3FLQA 1Y8GA 3OMVA 2VZ6A 3ZO2A 5AUYA 4AGWA 3SHEA 2RFEA 4Q9ZA 1Z5MA 4YJUA 4YJTA 5CF5A 2R3HA 3HYHA 4NKAA 3BHVA 5J1WA 4O0UA 4TYJA 2EU9A 3ZUVA 3C5IA 3NUYA 5FP5A 5HBEA 4DEBA 3OXZA 1CDKA 3QC9A 4G17A 5BYZA 4D9UA 3BL7A 4KIKA 3OEFX 4D4RA 3QFVA 4EBVA 3HAVA 4I4FA 4EKKA 1ZAOA 4RJ6A 3BYUA 3A7JA 1OKWA 4FUXA 1JKKA 2QO2A 4GCJA 4MCVA 3RGFA 2F49A 3KEXA 4YC6A 4J98A 3VBXA 4O7NA 4BGGA 2YM8A 3SKCA 5GJGA 4MKCA 1VYZA 1OIYA 3HV4A 3ZBXA 4UX9A 2JIVA 2VTSA 4M8TA 4X3JA 1QPEA 3LFQA 4BCIA 3ZC5A 4BDCA 3O8PA 2VN9A 3VUIA 2DWBA 3U6JA 4JG7A 3D2KA 3JY9A 4ZIMA 3PXFA 5K4JA 4K18A 3EH9A 5CNNA 3O50A 4KB8A 3AT3A 5JFVA 3Q9XA 2IVUA 3FLSA 3HA8A 3D2IA 3KK9A 4BCKA 4RX9A 4M67A 1FVTA 2ITUA 4I41A 4FSWA 4TYIA 5T3QA 2X0QA 4MK0A 4HCUA 4IVDA 2PVKA 4ZTLA 2YHVA 4O4DA 5M06A 3TUCA 1TQMA 3S00A 4LG4A 2ZM3A 5E8YA 3LCOA 4IZYA 5I3RA 4AT4A 4BKJA 2OKRA 4D2SA 5ANJA 4W4VA 4I24A 3C9WA 4I23A 3R7IA 2QOHA 5JQ5A 2O65A 4M14A 3UIMA 1J7UA 2ESMA 4AN2A 4PPBA 3KFAA 4S34A 2RSVA 2P4IA 3TG1A 1W2DA 4BIDA 4ZMEA 3CQUA 5CT0A 1OB3A 4HJOA 1WBSA 4H58A 3F82A 3FHRA 3LFAA 3A2CA 5CEMA 3KRWA 3F2NA 4E6DA 3IPHA 3QZHA 4P5QA 2PVJA 5EDQA 3RPVA 2JIIA 4O0YA 3COIA 4ASZA 1XH6A 4LI5A 2YITA 5JKGA 3ORTA 3UO4A 4AQKA 4ACDA 2QLUA 5L6OA 3UNJA 2CCHA 2ZFYA 4ERKA 1U54A 1ZLTA 3OBGA 3QQHA 4J7BA 5IZFA 2QKWB 4RWKA 4JDIA 1JQHA 4YSMA 3GENA 4CT1A 5JMSA 3CSVA 1WAKA 2WEIA 5F4NA 1H0WA 2C0IA 4FRFA 2UVYA 4MXCA 4L3LA 4FKIA 5EHOA 4G6OA 5JEBA 3O5AA 4Y73A 3P0MA 3ERKA 4U45A 3O2MA 2VAGA 2YAKA 3KKVA 4PWNA 3ID6C 3KMUA 2HW7A 4ZJIA 4CCUA 5AM6A 3E87A 2R9SA 4DFNA 3AKLA 4UY9A 3LQ3A 2WQMA 4BDFA 4MXXA 3UGCA 3ZEWA 4MBLA 3HV6A 4BI1A 3FY0A 5IH4A 5HG7A 4J8NA 3AD5A 4GG7A 3WF6A 3P78A 3ZM4A 1GZ8A 2W5HA 5ACBC 4BZNA 4C7TA 3SG8A 3OWLA 1U5RA 4CZTA 3TZ8A 3TJCA 4C2VA 1SVGA 4IADA 4FTNA 4YGAA 2OXYA 2A0CX 4OT6A 3WE8A 4DE4A 2HWPA 2Y4PA 2GFCA 4L7SA 3ZZEA 2JDRA 5LQFA 4UV0A 5KMKA 3MSSA 5L8LA 3DS6A 3BZ3A 4O38A 4EWHA 4X6RA 1CM8A 5BVKA 2XYUA 4QD6A 4MYGA 4TY1A 3KF7A 3HRCA 4H3QA 1BMKA 4DTAA 3FXXA 4PPCA 4W9XA 5FXQA 1Q5KA 3QGYA 4O4FA 3ORLA 4BCGA 3BLAA 5EQPA 4L00A 5AM7A 5CSPA 3EQPA 3SOAA 4FV6A 5AV4A 2HOGA 5HICA 4U7ZA 2XKDA 5IA5A 3EOCA 5EKNA 1LPUA 3AMYA 3CJFA 5FP6A 2J50A 1YOMA 3S2PA 4RWJA 3UQGA 2ACXA 2WTIA 3WE4A 1RW8A 3DBDA 1Y91A 3TKUA 3CJGA 3E7OA 4DC2A 2YJSA 2P2HA 2J90A 3KU2A 3NAYA 4I1ZA 4YHFA 3TJDA 3TZMA 4PTEA 3UMXA 5TE0A 4LDTA 4O7LA 3UZTA 5IPJA 4CXAA 3LLTA 3V8SA 4GS6A 4HVGA 5CT7A 5LVMA 4Z7HA 4D55A 4XOYA 5CS6A 5HIEA 5IDPA 3FY2A 4L01A 4B99A 3HMPA 2I1MA 1R0PA 3PA3A 3SC1A 4NUSA 2NYAA 1PY5A 3FLYA 3Q4TA 4AA4A 1SZMA 3KC3A 3FI2A 3PRFA 4B8LA 4LUDA 3R9HA 5BPYA 1M52A 2BROA 2XB7A 2HK5A 3Q2MA 3DTCA 5JFXA 2F2UA 1PYXA 5EKOA 4E4NA 5CALA 2BKZA 3UIUA 4LL0A 3POOA 5IQFA 3IONA 3GFEA 4IWOA 5E8UA 4BIBA 5I0BA 3K3JA 4YBKA 5ANGA 2WMXA 4X2JA 4Z9LA 1FMOE 2X7OA 2XVDA 3DB8A 3NIEA 2YCSA 2XAMA 5GZ9A 2WAJA 3PIXA 3QRKA 3L8SA 3H9FA 3HEGA 3VHEA 1GIIA 2QI8A 4RIWA 4WBOA 2DYLA 4EOKA 1H1QA 3RK7A 1JKTA 3A7FA 3WF8A 1RQQA 4RIWB 2W0JA 3D5VA 4N70A 2LAVA 3EIDA 3NX8A 4M0ZA 2OIQA 2VTNA 2WZJA 5D7VA 2YZLA 2QOOA 2ZV2A 4MD7E 4IM2A 3GCSA 3N4TA 5LCKA 4O83A 3PSCA 3BU5A 5D1JA 4GEOA 4XH6A 3QL8A 4GVJA 3COMA 3Q04A 1XR1A 3HV3A 4X2GA 5L8KA 3PRIA 3D9VA 4R3CA 3NNUA 3NR9A 4RGJA 1KE8A 1W2FA 3HDMA 3NW6A 3IW6A 4QRCA 4W4YA 3R9OA 2WQOA 5BYYA 5E8WA 2WQBA 3UVPA 5KMLA 4H39A 4AZTA 2OJJA 4X2KA 5EG3A 4O82A 4DFBA 1ZYDA 3HDNA 3BRBA 3PJ1A 3T3VA 4RWIA 2CSNA 4IAAA 4G6LA 4B0GA 2B53A 3QCQA 2XZSA 1YHVA 5HE2A 4FSMA 4LOOA 4CLJA 1XO2B 3GB2A 3C4EA 4MEDA 2BRGA 3MA3A 3RHKA 3D4QA 4FSZA 3N4VA 5AV2A 4ZS4A 2X8EA 1QPCA 5AFVA 4BRXA 3KIOC 3VQHA 5IQBA 1WBOA 5M53A 4CG9A 3IW4A 4QP7A 4BVUA 4D5KA 2G2IA 3MPMA 3R7VA 4C02A 2HXQA 5AA8A 4CTCA 2GCDA 2C5XA 4YR8A 4CKRA 1MQBA 5A6OA 3EQGA 4UWBA 3ETAA 1M2PA 3VC4A 2H6DA 2OGVA 5HLNA 2YM5A 1TKIA 3RTPA 4OAVB 1NA7A 5BUIA 4LMNA 4RBLA 4OAUC 4NT4A 4D9TA 3AC1A 3ORZA 4F08A 3PZEA 3UVRA 4DBNA 4WG5A 3AT2A 3DZOA 4PMTA 4S33A 2QCSA 2WMSA 4WKQA 3UDSA 5AV0A 4MNEB 3UDBA 2UW4A 5KX8A 3WZKA 5E8VA 3ZLYA 2JITA 4WO5A 1FINA 3Q4ZA 5M08A 3FC2A 3SW7A 2WD1A 3O23A 4G3FA 2H9VA 3D0EA 4IAZA 4UEUA 4C4GA 2VNWA 4MQ1A 2BFXA 3P4KA 4U5JA 3V6SA 1UNGA 5CQUA 1OUYA 2GHMA 3KA0A 3OHTA 4YPDA 5KBQA 3VJOA 3COKA 3FSKA 3LCDA 5E8XA 3UBDA 3H0ZA 5J5TA 4QMXA 4I6LA 3W0SA 2X2KA 4RQVA 4BWXA 5D9HA 4HCTA 4L53A 3V51A 4EQMA 4BWKA 3CD3A 3WARA 3PPKA 3LXPA 4JVGA 3GQIA 3RNIA 4CSVA 3OW3A 4L3JA 5HEZA 3VS6A 4ZZOA 3AC2A 3F2AA 4BHZA 1JLUE 5CAQA 2HYYA 4DEAA 4BYIA 2B9FA 2VWYA 4YURA 3CEKA 4CV8A 2PUNA 1R78A 3CPBA 3SRVB 4BDHA 2W99B 4UMRA 4XOZA 2YIYA 2HZNA 2R3MA 2RG6A 2ONLC 3EN9A 4YUQA 3O8UA 4FTRA 3BX5A 4AE6A 2E2BA 3ENHA 4TT7A 1XH7A 2VWWA 2FO0A 4O91A 2XM9A 4LGGA 2GNFA 4NCTC 4XNEA 2CGUA 4QEBA 2FGIA 3R1YA 5LXMA 4G16A 3FJQE 3I81A 2WQNA 5FRIA 1H1WA 3NYVA 4CRLA 5HO7A 3SW4A 2I40A 3C4WA 3W16A 4RSSA 2XKFA 3BU3A 4RVTA 4AZVA 5BVOA 4ZTRA 1LP4A 3O71A 3KXZA 3R02A 4U6RA 4OTRA 3R8ZA 2OFVA 1ND4A 4IB3A 1Q3WA 3ATSA 4HPUE 4RJ3A 4DHIB 2XK3A 5HCXA 4P90A 4H3PA 4NM0A 3EQRA 3I7CA 4QP9A 5J9LA 2ZYBA 5TKDA 4GKIA 4JT3A 3DBEA 5C01A 5KMIA 3W0MA 4ZSGA 4TNBA 3DLZA 2J6MA 3V5JA 3GCUA 4L46A 5HG5A 5FTOA 4CLIA 4V01A 4JBPA 2WB8A 4I3ZA 4ALVA 3FZSA 4NTSA 3RJCA 2Q0BA 3ZYAA 2NNWB 4IVCA 4AW5A 1YVJA 4U43A 5DA3A 1HCKA 5AWMA 5EYMA 3D94A 3EFWA 5CSHA 4KIPA 3PVBA 3TUBA 2X2LA 2VWBA 4OTHA 4BDAA 4F65A 5GHVA 4LMUA 4RFYA 4DFXE 2GQSA 4WBBB 3I1AA 2OIBA 2W4JA 4F78A 4G3GA 3C4XA 5D11A 3RP9A 1PRYA 4MBIA 4MAOA 4DG2E 1YHSA 5CU3A 4FNWA 3Q9WA 2BZIB 3KXHA 4WHZA 3ZO1A 3LXKA 2C30A 4NIFB 2UZVA 2Y6OA 2P3GX 4E4LA 5K4IA 5CWZA 2HZIA 5DT0A 2C6KA 4H3BA 1Y6BA 2Y9QA 3H30A 4QMYA 3MPTA 1W84A 2I0YA 4FSRA 3EL7A 1H4LA 3G6HA 3QWKA 4IE9A 4JX7A 4QPAA 1NXKA 3DXNA 3F5PA 3F88A 4OT5A 2KULA 5ANEA 3R2BA 1QCFA 3W2QA 5CANA 3U6IA 4RC3A 3REPA 4R8QA 5IQAA 1BLXA 3FI3A 4DH1A 4ZLZA 4EC8A 4QMZA 3TMOA 2XIYA 3OY3A 4QPSA 3C4CA 5I4NA 4YZ9A 2ETMA 3DNDA 3QQUA 3DJ5A 3UIBA 1AD5A 2FSOX 4S31A 4DH8A 4M66A 3MFTA 2EB3A 4L43A 4NFMA 4UWCA 3QHRA 3VBVA 3VUDA 3KULA 2C5YA 2PMNX 3PXKA 3QD3A 4QMVA 2AEGA 3RHXA 5B2LA 5FDPA 1OIQA 1KE7A 2NPQA 1OPJA 3VS0A 3KULB 2XK4A 2EXCX 2WNTA 4FYNA 5I3OA 1OBDA 3G5DA 3DFCB 3MWUA 1ZZLA 3Q2JA 5GIOE 1PKGA 2B54A 3QXOA 4I6BA 4RIXA 4FG8A 2X9EA 4E4XA 4IXPA 4QP6A 4WRSA 4Q5HA 3VBQA 4DTBA 3EQBA 4QNYA 2WOTA 2QKRA 2YA9A 3DA6A 4JS8A 2UW5A 3KXGA 5BV3A 4NM7A 4M15A 3BE2A 2CNUA 3OUNB 2JC6A 2VTTA 1H28A 4YJRA 3EFKA 2NRYA 1Q8ZA 4NSTA 2YDJA 3VW6A 3VUTA 5HKMA 2VWUA 4O0TA 2EXMA 4OTPA 4GKHA 2V22A 3AC8A 3SD0A 1OKVA 4XG4A 3VBWA 4AX8A 2HAKA 3H0YA 3TUDA 2VX0A 2X4ZA 3IDPA 4HW7A 4F63A 3AGMA 5ITAA 4DFLA 2ERKA 2O2UA 2WTVA 3R9DA 4IX6A 3HV5A 4Y5QA 1APME 5H8GA 4AN3A 3DV3A 1O9UA 4M84A 3NMUF 3QXPA 4QDEA 3V5TA 2C69A 5TT7A 3KMMA 4YJVA 2EWAA 4EOPA 4F9BA 4AXAA 5KHXA 4TN6A 5KZIA 3NZ0A 3KREA 3FC1X 4ONAA 4QP1A 5A4TA 5AR8A 4ASXA 4BYJA 4BBFA 2IW8A 4O4CA 5HO8A 4RWLA 3OWKA 2QHMA 4YNEA 1XMLA 2VWIA 5IUGA 2WOUA 4AP7A 5B7VA 4RJ5A 2WMRA 5I9YA 4BGQA 3DPKA 3EQHA 4GFGA 1V0OA 2UW8A 3F5UA 3K54A 2HCKA 4BICA 3NUPA 3P1AA 2P55A 4O1OA 3LIJA 3VS2A 5LMKA 2NP8A 3FDNA 2G15A 2R3OA 3PLSA 2ITWA 4CFUA 5K0KA 2XCHA 3ZU7A 1TQPA 5BVWA 5FTQA 5HQ0A 3D5WA 3KRXA 3E88A 4O4EA 4C57A 3LJ1A 3CR0A 3QQJA 4LUEA 1B38A 1QPDA 3QUDA 3FMDA 5IEXA 4EH6A 4J95A 4PDOA 5CSVA 5EI2A 5DPVA 4BGHA 2G01A 3R83A 2Y8OA 1IR3A 4V04A 1PW2A 3PPZA 3QD0A 3RKBA 4BCNA 3CQEA 3FQHA 3F66A 4FL1A 4A9SA 1Q24A 4TYHB 2J7TA 2CGXA 1ZRZA 3KL8A 5KKRB 4R78A 3HNGA 4EOJA 3U4UA 4EL9A 3SAYA 4PL4A 4QMTA 3V5PA 3R7YA 4BDDA 3DDQA 3JUHA 3I6UA 4P4CA 5AV1A 4EWQA 4UMPA 4FBXA 4XP0A 3CY2A 4EHVA 4R77A 4BJJA 2UW6A 4G3DA 3RNYA 3LZBA 4FT9A 5AIRA 2IG7A 4IC8A 2ZM4A 4YZNA 4FSTA 4BJJB 2PE1A 3NFGB 1IASA 2OBJA 3FMKA 3OOMA 4FX3A 4D0WA 4WA9A 4F9AA 3PG3A 3IK3A 3P86A 3UQCA 3MBLA 2AUHA 4C37A 3R9RA 2F7ZE 5J5SA 2IVSA 4PMSA 3QA8A