4BKZA

Crystal structure of unphosphorylated maternal embryonic leucine zipper kinase (melk) in complex with a benzodipyrazole inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
333
structure length
309
Chain Sequence
KDYDELLKYYELHETIGTGAKVKLACHILTGEMVAIKIMDKNTLLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCASLAYAAPELIQGGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insight Into Maternal Embryonic Leucine Zipper Kinase (Melk) Conformation and Inhibition Towards Structure- Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords MATERNAL EMBRYONIC LEUCINE ZIPPER KINASE
total genus 104
structure length 309
sequence length 333
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bkzA00
2R0UA 2UW4A 1FGIA 3FSFA 4C2WA 2YEXA 4LL5A 4X0MA 4MQ2A 4D4RA 2R7BA 3DNDA 5DGZA 1LEZA 2RSVA 4AOIA 5LMBA 5HGIA 3FMEA 3H30A 2CKEA 5IEYA 2JEDA 3CC6A 1OIQA 1ZMUA 5C1QB 3WBLA 3OVVA 3TKHA 3DK3A 5FM3A 1B38A 2NO3A 4IDTA 4DC2A 4CLJA 4LI5A 3O7LB 3GENA 1NVQA 1WBVA 2B9FA 3IW6A 4U0IA 4CMOA 4UWCA 2R4BA 5AEPA 5KHXA 4FT9A 3LW0A 1QCFA 5FGKA 1YOMA 2VNWA 1Q3DA 3MBLA 3D7TA 4IX5A 4QPSA 4X2FA 4E26A 2IZTA 1STCE 4ZTNA 2B53A 3VHEA 5HQ0A 5B0XA 1REJA 4YNOA 4DH7A 3MH1A 3TUCA 4G6NA 1KOAA 2WMXA 3A2CA 3HGKA 2R3HA 1PY5A 2G15A 2Z2WA 3EN4A 2G2IA 1PXJA 3PWYA 3QRTA 5IA5A 3QD0A 4BDHA 2X1NA 3MW1A 5EI8A 2OXXA 3VBWA 4MXXA 1GZOA 4F65A 5EKNA 3DKOA 4S31A 4YHFA 3H9FA 5HX8A 5FBOA 2QU6A 4KNBA 3AC1A 3PG3A 4FSTA 4BCIA 2X6DA 4KD1A 3MN3A 3P7AA 4O0VA 4FR4A 3ULIA 4YC8A 3QZHA 4RVTA 1CKJA 4Y8DA 3M1SA 4EK6A 3F3WA 1YOLA 2JKKA 4FL3A 3WYXA 4C2VA 4D2PA 3D2KA 2UZUE 3DBEA 2Y0AA 3L8VA 5LOHA 3KXNA 3H0ZA 3TNIA 4HVSA 4FI1A 3ERKA 2HOGA 5AV2A 4BRXA 4CFWA 2W1FA 1WBWA 4EWHA 1JPAA 4IWQA 3HA8A 4I94A 3ORXA 5CZIA 4R6VA 2C0OA 4DN5A 5KBQA 4QMXA 3W10A 3N51A 3PXQA 4O22A 2YM4A 5HKMA 1Q5KA 1LP4A 3ORIA 3A8XA 3FJQE 3LCKA 3D5XA 3LVPA 4ZXTA 3VUDA 4E1ZA 3M11A 4GSBA 2J0MB 2J5EA 3TWJA 4BDAA 3IDCA 4EWQA 5IA3A 4MQ1A 4LMNA 3RPYA 4X3JA 3ODZX 3ZLXA 4JAJA 4XX9A 3DGKA 2CGUA 4EH9A 3E8NA 2B9HA 3TJCA 5M4CA 4FNWA 4XOYA 3UPZA 3GQLA 3NUPA 4F70A 4B99A 3DAKA 4OT6A 2CJMA 3VS0A 3QWJA 5DVRA 3GU7A 3DFAA 4RWIA 4F9WA 4NKAA 2VTHA 2WZJA 4IVAA 5DH3A 3DQWA 4WUAA 2I6LA 2W1HA 3MI9A 4O91A 3UE4A 3W1FA 3RMFA 5JFWA 4K33A 4FVQA 3QAME 3L9MA 2BR1A 4IVCA 4FK6A 3Q60A 3PSDA 4D4YA 3R9NA 4M84A 5HU9A 2XVDA 3MH3A 4MD9E 4WO5A 4BCPA 3MYGA 4I4FA 3UDBA 3OP5A 5A6OA 1VYZA 3DBQA 3CQWA 3QHWA 4XV9A 4IB1A 4N70A 4XNEA 4JNWA 4RC2A 2WMSA 1REKA 3AGMA 4C62A 4DCEA 2OFVA 1M2QA 3D5WA 4EH8A 5A4LA 3VBTA 3F5UA 4MXOA 1Q3WA 4PY1A 3OXZA 3ZLYA 4JX3A 2GHGA 3AC8A 3U6IA 2Y8OA 3I81A 4EQCA 3TG1A 3IS5A 4OTWA 4DGOA 1YXSA 4TYHA 3QCQA 2I1MA 4D2VA 4FTTA 3RTPA 3FWQA 1OI9A 2VTRA 4H1MA 4LMUA 2X2LA 4YLLA 5HIBA 3RNIA 4OTGA 2ITPA 1WVXA 4FIJA 4L44A 4BI2A 3LFFA 3AC2A 2F9GA 1M17A 3TEIA 3JY0A 4FTUA 2HCKA 2GHLA 4R1YA 3W2OA 3ZSGA 4X21A 2ZDUA 5GHVA 2PTKA 4XV1A 5CU6A 2X7FA 3MSSA 5ETFA 3C4WA 3KY2A 4BCKA 4DG3E 4CQGA 2GQGA 3IDPA 4EK8A 2W7XA 3H10A 2BZKB 4ZSEA 4JRNA 5A3XA 3RPRA 3CQUA 3I6WA 2GFSA 1Z9XA 3LE6A 4G3CA 4PQNA 4WKQA 4AW0A 4F6UA 2X2KA 1YWNA 3QWKA 4YBKA 3A99A 5AUZA 4BZNA 5AUXA 3EL7A 3RALA 3TXOA 2XBJA 4CRSA 4BCFA 1MRYA 2RG5A 4ZTHA 2ETMA 4CZUA 1UKHA 3FZOA 3OTVA 2QOLA 2H6DA 3QU0A 5DI1A 3FMDA 1MRVA 3W8QA 4UMUA 4PP9A 4ITIA 4GT3A 2J9MA 4G3EA 3EJ1A 4I93A 5CVFA 2QHMA 4EUUA 4II5A 5ICPA 4E5BA 5H9BA 5J1VA 2F7XE 2ESMA 4ZLYA 4BIBA 4I6BA 4JXFA 5HO7A 3UMWA 4D1XA 4CMUA 3DZQA 3E92A 3EOCA 3RPSA 1SMHA 2ZMDA 2R3QA 5KCVA 3OY3A 2AC3A 4IJ9A 4QYGA 4ACGA 2C0IA 4C36A 5KUPA 4AZEA 2ITQA 3FYKX 4CD0A 3H3CA 3NW5A 4OR5A 5AA8A 3EYHA 5BUIA 1RJBA 2H34A 4B6LA 4BCHA 4HCTA 2JD5A 3Q52A 4L00A 4RIXB 2YABA 4UXLA 2WMQA 1BX6A 3I4BA 5I5ZA 4BCMA 3QUDA 2EB3A 2JAVA 2QO9A 1WVWA 3LCTA 4LRJA 2RF9A 4U5JA 1DI8A 1ZZ2A 1UA2A 5DIAA 1VEBA 4YURA 3G0FA 3K2LA 2J0LA 3DJ6A 4RIWA 1W83A 4V04A 5AM7A 4L52A 2ZV2A 3AD5A 4FT0A 2C6EA 4FKJA 5DR9A 3RWQA 5G1XA 4MWIA 1ATPE 2C6OA 4YJVA 5DT0A 3EN9A 5HU3A 3E7OA 4B9DA 5TE0A 3KN5A 4NUSA 5AAFA 3GB2A 3E8EA 3QZIA 1Z57A 3CEKA 4RJ5A 5CU3A 3ZXTA 3UVPA 4K18A 4QMSA 5D12A 4FIEA 2PUUA 4XS2A 4AT5A 4J71A 4ITJA 4K2RA 3MTFA 4U80A 4AE6A 4FGBA 2NPQA 4E6DA 3PIYA 4NEUA 4CFVA 3FY0A 1T46A 4ZZNA 4ZEGA 5CXZA 1GIJA 4HVIA 2QOCA 1BUHA 2YACA 5HLWA 4UMTA 2XRUA 4KBAA 2W9FB 2BHEA 3CGOA 3OT3A 4G17A 4F99A 4AP7A 4B8LA 2XRWA 3MJ1A 3LJ0A 4EH6A 3BYMA 4KWPA 4O0RA 4H3QA 5EM6A 1QMZA 4WA9A 4XG2A 1M7QA 4KIKA 1W8CA 4DEEA 3W8LA 1B6CB 3ANRA 3CS9A 3C4FA 2XP2A 4FTMA 2JIUA 4HJOA 4LGDA 2YITA 2FSMX 4NIFB 3UP7A 3MFTA 4GYIA 3ELJA 3OCTA 4RVLA 4TWOA 1OECA 5IF1A 3MIAA 2XNMA 4M68A 4AGWA 2DQ7X 1YI3A 3MFRA 2ITUA 5A14A 3DKGA 4MVFA 5CAQA 2R3FA 4ZSLA 3AG9A 3I5ZA 2JFLA 2OF4A 3W2QA 4YU2A 5A46A 1Q62A 1RE8A 2WTWA 3KRRA 5DG5A 3F9NA 3ZZEA 5EW3A 1L3RE 1OL7A 1S9IA 1URWA 1DM2A 3A62A 4ZJVA 3RPVA 3A7HA 2Z60A 1S9JA 4U45A 1BKXA 3UYSA 3NYXA 3POZA 3ZDUA 4BDJA 3C13A 5KX8A 4FKWA 3R9DA 2W5AA 4UYAA 4OW8A 2VUWA 4ZS0A 2GNIA 2PSQA 3OWPA 3RI1A 4CYIA 2BAKA 3DU8A 3FQSA 2C3JA 5K5NA 5AV1A 5DMZA 3U6HA 3HMMA 4PTGA 1ZLTA 2UW9A 3DDPA 3IPHA 3B2TA 4TWCA 3UGCA 4BTKA 5B7VA 5BVFA 4HVDA 4Z7HA 2UZNA 3GCSA 2WQOA 3QBNA 1A06A 2W4OA 1FOTA 5C8NA 4UWYA 4Z7GA 3HV5A 3UIBA 3IG7A 3EKNA 4FZ7A 4AN9A 1WMKA 2G1TA 3G0EA 3CCNA 2JKMA 2PVMA 3GC7A 3L8PA 4I4EA 4FA2A 4JQ7A 4KBCA 2QQ7A 3BE9A 4XHKB 3TT0A 4E6AA 2WPAA 4C4HA 1SNUA 4EONA 4QMTA 3OEZA 3HV4A 3MY5A 4JDHA 1AD5A 4JVGA 4APCA 2IW6A 4OBPA 2PMLX 3T3UA 3UZPA 2J0KA 4M66A 3PWDA 4MX9A 4LOQA 5DRDA 3SAYA 4OBOA 3UQFA 1WFCA 3TZ9A 4UV0A 4LRMA 4M8TA 3KRXA 4QTBA 4C58A 2HXLA 2XA4A 4NM7A 5ANEA 3TNWA 2XIRA 4FV2A 4A9YA 3GP0A 4BCJA 2WTJA 5DN3A 5A9UA 2VTQA 3QD4A 3U8WA 4IB5A 2OFUA 2JDTA 2R0IA 2HZ4A 2VWXA 3PY0A 5DBXA 3F88A 2XK6A 4RVMA 4PDSA 1XR1A 3MY0A 3ORKA 5C9CA 4BCGA 4UN0C 1JKKA 3DAEA 5D9HA 5AP4A 2UZEA 4I20A 4EHGA 4QMQA 5KMOA 4ASZA 4C3PA 4YUQA 3PXRA 2QG5A 2QLUA 4R5SA 5L8KA 3BEAA 3F61A 4FSUA 4D2RA 4XG6A 1OIYA 4IX4A 2VV9A 2UZWE 1O6LA 4CFNA 4JBQA 3NAXA 1F3MC 3LAUA 3EQIA 3G33A 1GJOA 3FAAA 2O5KA 3QA0A 5ANGA 5HE3A 1Q4LA 3A7FA 2C5YA 3D2IA 4EOJA 4RBLA 3ODYX 1O9UA 3U9NA 3NW7A 4D1SA 1H01A 2P33A 3D9VA 3V5LA 5E1SA 4Z9LA 4C4GA 3U9CA 4NK9A 3PRFA 3QTZA 2WEVA 4ZZMA 2Z7LA 1KSWA 3UVQA 4M15A 3PIXA 3F6XA 4MNFA 5CEIA 4P4CA 5E8VA 1PW2A 2Q0NA 4BDEA 4C37A 4BI1A 1R1WA 4DGNA 2RFDA 4ANSA 1ZOGA 4FF8A 1DI9A 5IG1A 1SVHA 2BUJA 1XHAA 2PVRA 4KSPA 4F0GA 3FL4A 3A7IA 2JDSA 1KOBA 2RIOA 4C4EA 3V5TA 5A4QA 2J2IB 4IAYA 2WQNA 3BCEA 3FMKA 4ACCA 2WAJA 2C1BA 2CGWA 2DUVA 5EDRA 2KULA 3OW3A 1H26A 2XIZA 5K5XA 5LMKA 1OKVA 4QO9A 4FX3A 4D1ZA 2PZYA 2X4FA 1XH5A 2YLEA 5E90A 1IG1A 4TXCA 2ZAZA 3IW5A 4EKLA 4JG7A 4C59A 4M14A 2ONLA 4FV0A 4AGCA 4FSZA 3PXKA 1DS5A 3SOCA 4IC8A 4EHVA 4BWXA 2IN6A 3A4PA 3EQPA 4I41A 4DGMA 3SOAA 1J3HA 2PVJA 5DT4A 4D55A 2ZB0A 4YTCA 3R28A 4YTHA 4C0TA 5E7RA 2OJGA 4RSSA 4E7WA 4NJ3A 1BMKA 1OL1A 5DWRA 4I6FA 4Z16A 3PE2A 1FQ1B 4NSTA 2OI4X 4MHAA 2YDIA 3IW7A 5CAPA 4YHJA 2YLFA 3E62A 3T9IA 1PKGA 4IAIA 1PKDA 2ITYA 4IQ6A 3VBVA 2F49A 5TO8A 2YISA 1KE7A 3D7ZA 4EZ5A 4HGEA 1I44A 3QALE 2DYLA 3QQKA 5KBRA 3C4EA 1ERKA 3CKWA 5H8GA 3PG1A 3QD2B 2FSOX 4FSQA 2GS7A 3UNKA 4FG7A 2HY0A 3Q9YA 4BKZA 4ASEA 4IAZA 1H08A 1OKZA 2BZHB 4L42A 3GCUA 2B9IA 3UG1A 5M4UA 4NW5A 4DLIA 4N4SA 3I7BA 3NUSA 3TUBA 1Q8UA 3TACA 3L8XA 2GS6A 2R3KA 3PY3A 4FT3A 4MF1A 4XOZA 4CEGA 4C35A 2XYUA 2PMIA 1UWHA 5CU2A 4EH3A 5AR4A 2W1DA 3FZ1A 2HZNA 4GH2A 4G6LA 4FSNA 4H58A 5EI2A 3B8QA 3EHAA 3ZU7A 3HV6A 4MBIA 3FMJA 1PXNA 4PMSA 5LARA 3V8WA 2OZOA 3E63A 3V6RA 1CMKE 3I1AA 5CSPA 4X7QA 1ZOHA 4FT5A 2WTKC 2VGOA 4TN6A 3VF8A 2C68A 3QA8A 4G31A 5HX6A 4PNIA 3O51A 1WBOA 3OD6X 2I40A 2QR7A 3C50A 3ZC6A 3DK7A 3DA6A 4TY1A 2VRXA 3IKAA 4KBKA 5FDXA 5B2KA 2BIYA 5J9ZA 4X6RA 4AOJA 2O8YA 1OM1A 3GCQA 4ZSJA 3V8SA 2XKCA 3FZRA 4GIHA 3ZO2A 5ANKA 3FLYA 3G9NA 3UODA 3G2FA 4FKTA 3MPMA 4QTDA 4FKLA 1UU8A 3R1NA 4FVPA 2IVUA 3I79A 4A07A 4A7CA 5AUTA 1FGKA 4IB0A 2O0UA 4EUTA 1OKYA 4MXZA 5BNJA 2YM8A 3OWJA 5HBJA 1FINA 1I09A 2C5OA 1XJDA 4EZ7A 3KRLA 1PYEA 2VO3A 4PWNA 4ANMA 3HEGA 2YIXA 5GJFA 3CLYA 3LIJA 2R2PA 4F7SA 3FKOA 2BHHA 1ZYLA 4TYGA 5J9LA 4JQ8A 5M51A 2OXDA 2XNNA 1OIRA 4EZ3A 3VJOA 3G5DA 4BHZA 3DLZA 3A4OX 2WTKB 4YHTA 3FMMA 2EUFB 1GIIA 3CJGA 2O63A 4PRJA 2C4GA 1XBBA 2X9EA 2UZOA 1OPLA 3OG7A 4IX3A 5LVNA 2WMVA 5TKDA 4EI4A 5CF5A 2RFSA 4B0GA 5J5TA 4NM5A 4YZBA 5JK3A 4K6ZA 3U87A 2QOFA 4UB7A 2FGIA 4W9WA 5CLPA 4I22A 3P08A 4XV2A 5FXRA 4O2ZA 4RQKA 5B2MA 4P7EA 4BZDA 2OU7A 4YGAA 3BGZA 1RQQA 2X9FA 4IM3A 1QPCA 3LQ8A 3HV7A 1Q8WA 2UW5A 2XEZA 2EXCX 3EYGA 3H0YA 3SC1A 3WIGA 2A1AB 2Z8CA 4FICA 2AC5A 4RWKA 2I0HA 5BX0A 4F0FA 3DDQA 4QPAA 2XF0A 3TIZA 5I4NA 3P79A 3RINA 3PLSA 3MFSA 3QXPA 3G51A 3THBA 4XEYA 4XYFA 4QMUA 4S30A 4A9SA 2WELA 2AUHA 2W9ZB 3KGAA 4XG7A 4F4PA 2C69A 3I7CA 3RHXA 1M7NA 3PE1A 2WHBA 3G90X 4PL5A 3RKBA 3UG2A 5CANA 4X3FA 4ZJIA 4HGLA 4UMPA 3E87A 4EJNA 4CVAA 2VTMA 4NFMA 5F94A 3UIXA 4C4JA 5FXQA 5LVPA 4HGSA 3S00A 4YTIA 1Q8YA 3GBZA 3KRJA 3OUNB 1UWJA 3LCOA 3W33A 1DAYA 3BHTA 2C6DA 2YDJA 2REIA 3LPBA 3ZBXA 4QQCA 4F9CA 4F7JA 2O64A 3DB6A 3DTCA 5F1ZA 5JGDA 4U97A 4KRDA 1X8BA 3BWJA 4C4FA 4ZOGA 4PNKA 3TZ8A 1OPKA 4M0ZA 2XK3A 4CV8A 2WMUA 1XQZA 3U51A 4BL1A 3MGYA 3NEWA 4LYNA 3QCYA 3O8PA 4P5ZA 4N6ZA 1JQHA 4YJOA 5H8BA 3R7UA 2QOQA 4WNOA 2VTAA 3AD6A 1CTPE 3R2BA 3VO3A 3ZSIA 4F7NA 2ZJWA 2X2MA 4R3CA 4L3JA 3VUMA 3MIYA 3R8VA 4D2TA 3DOGA 5AV3A 4YR8A 4G16A 1ZMWA 2X0GA 4C02A 3CGFA 4WNKA 3HDNA 5HVKA 4X2GA 1VR2A 4M69B 1NY3A 2YHVA 2W4KA 1E1XA 5I3OA 4AX8A 3QLFA 4CV9A 4GFGA 5H3QA 1LR4A 4ANQA 2YFXA 4ZP5A 5FG8A 1J1CA 2QLQA 3O8UA 3O7LD 5HLNA 3MVMA 2G01A 3OXTA 1OGUA 2F7ZE 2WGJA 3MH0A 1KE8A 3PZEA 1GIHA 5JKGA 2R3RA 3SXFA 3VWAA 4I92A 3R1YA 4FV1A 4I0RA 4XH6A 3VUKA 5AX9A 4EQUA 4DEGA 1ZMVA 1BYGA 3BU3A 4EEVA 4AW1A 3LFCA 3BHHA 5CWZA 3QQHA 4FG8A 4S32A 2RL5A 3F69A 2R9SA 3QX2A 3WZDA 2PVKA 2PVNA 4KRCA 2RGPA 2YWPA 4IFGA 4RGJA 4BGQA 3V5JA 4I23A 5CSXA 2O3PA 2ETKA 4CFXA 3GVUA 1CKIA 1AQ1A 2RFEA 5EKOA 3TL8A 5HNIX 3WF9A 4TWNA 2JLDA 2W17A 4GU6A 4Q2AA 5JMSA 4EH7A 1W0XC 4RVKA 4ALUA 2IWIA 3CQEA 2X8DA 3QQGA 1GZNA 1PYXA 2CHLA 3PP0A 4H1JA 4XCUA 3W2CA 4JQEA 4BYIA 3T8OA 4BDGA 1YI6A 4AGUA 3MV5A 3MWUA 4AQCA 4F1TA 3SW4A 4HGTA 4C4IA 5JSMA 4ZJJA 4U42A 2PMNX 4L45A 4DFNA 4RT7A 2WD1A 3G9LX 4QYYA 5GZ8A 4L8MA 5CSVA 4O0UA 4IM0A 3T9TA 1H0VA 2NRUA 5K0XA 4FL2A 2BALA 2CN5A 4O0TA 3BGPA 5LQFA 4YJSA 3CTJA 4BTFA 4DEIA 3O0GA 2FSTX 4FKPA 3FI2A 4J95A 2PHKA 4F63A 4IDVA 4ZY5A 1Y6AA 5BUEA 4USDA 4LM5A 4G34A 3FC1X 1K2PA 4RX7A 3DY7A 4H39A 2ZV8A 4UWBA 3RM7A 4BBFA 2O2UA 4QYHA 3V6SA 4GMYA 4Y73A 2BDJA 3RK9A 4B7TA 1XH7A 4FKUA 5IISA 5LWMA 4F7LA 2FO0A 1FMOE 2C6KA 2XZSA 4LGGA 4FZDB 4QMLA 3E3BX 3O2MA 4EOQA 4L6QA 3PJ8A 4IZYA 4R5YA 4CYJA 4E4NA 3R22A 3JY9A 4E6CA 5JGBA 3T3VA 2EWAA 3LXLA 4PDPA 5HG8A 4K0YA 3DCVA 2GSFA 2XNOA 4R3PA 5LVMA 2HW6A 2XIXA 2BDWA 4V05A 5AP7A 4YP8A 4UX9A 5BVDA 3F3TA 2FSLX 2WQEA 4ENXA 4QNYA 3OFMA 1OPJA 3MTLA 3PSBA 4IB3A 4QMNA 4GVJA 1SVGA 4RWLA 3IW8A 5LVLA 4AZSA 2PL0A 3IO7A 3Q4ZA 5DFPA 3ZDIA 3A61A 3NCZA 1HOWA 2AYPA 1NVRA 4W4XA 2W05A 4XP2A 2I0YA 4FTRA 2NP8A 2QHNA 3Q9XA 4G3DA 3SRVB 4ZLZA 5CU0A 4RZWA 3JVSA 2OH0E 3ZRMA 3FLSA 4AZFA 3LLTA 3Q9WA 3VC4A 1P14A 3WYYA 1XBAA 3HRBA 4QP2A 3NLBA 3O8TA 4DFLA 4FV3A 3CE3A 2G9XA 4GG7A 4BIDA 2CGVA 4DGLC 2XK4A 3NSZA 4CKJA 4OAVB 2E9OA 3KXXA 4DH8A 3F5XA 3F3ZA 2WU6A 4YJTA 4ALWA 5JN2A 4E4LA 5CT7A 2JKOA 3TJDA 5L4QA 4QMWA 3ZONA 2B55A 4WUNA 1TQIA 2IZRA 3MJ2A 4JIKA 2IW8A 4FC0A 3RWPA 1ZXEA 3C4XA 5A4EA 3CY2A 2YN8A 3II5A 4FNXA 3COMA 3RHKA 2GU8A 4DG2E 5CEKA 4TNDA 3R8UA 5LCJA 4EBWA 2X7OA 4PUZA 2VTJA 1ZARA 3E93A 4C57A 4GFOA 4FV6A 1UV5A 4WG3A 3LHJA 1CM8A 4RWJA 5IA0A 1E9HA 1UKIA 4GW8A 4JI9A 3NW6A 5KMLA 5CQUA 4KSQA 4EQMA 1UNLA 4MK0A 4IIRA 5I9XA 3ENHA 2XEYA 2WMWA 3PVUA 4RJ8A 3KMWA 2XJ2A 3R71A 5AP3A 2ZV9A 3QKMA 3P9JA 3R21A 3KF7A 3O17A 5JZNA 3W32A 3E3PA 3L9PA 4OUCA 5I9YA 4WIHA 5IA2A 3DXNA 4NKSA 3WARA 5AR8A 4GG5A 4JBVA 1SZMA 3LXPA 4O27B 5KMJA 5EM7A 3RZBA 3HMPA 3GFEA 2WMRA 4FV5A 4XUFA 3VVHA 4ASXA 2YCQA 3D15A 2J0JA 3NYNA 2OXYA 4D4SA 4BF2A 5J8IA 3H4JA 1JBPE 3LFAA 3UQCA 5TT7A 4C8BA 4H3PA 3QFVA 3OOMA 4GIIA 3U4WA 3ZS5A 3Q2MA 1H28A 4G3FA 1M52A 3VS1A 3ITZA 1UNGA 3R7VA 5AP1A 1OUKA 1OMWA 2FA2A 4PPCA 3SXSA 5AA9A 1W84A 1OITA 2XMYA 3DV3A 3TV4A 1PXKA 2XK9A 2O65A 2OJFE 4JG6A 5EYDA 2OICA 5HCYA 3F66A 3D14A 4YZCA 4BI0A 4JR7A 4IHPA 3O23A 4U41A 4F6WA 2EXEA 4PTEA 4F9AA 4HNIA 4CRLA 3RZFA 2BFYA 5C01A 4D5HA 4DLJA 2ETRA 3BU6A 5IUGA 2V55A 3WE4A 3TV6A 2Y4PA 2WQBA 5JRSA 4PF4A 2UVYA 2J90A 4Q5HA 3RNYA 4D9TA 4FTNA 5FTQA 3WI6A 4XLIA 4CNHA 1VZOA 1GNGA 4OTPA 5TR6A 3V5QA 4AA0A 3TKUA 3TZMA 5ANOA 3WE8A 1JSUA 2JFMA 5IH6A 4Y95A 1H8FA 5CNNA 2VU3A 3JXWA 1M14A 3DJ7A 2OJIA 4BKJA 4I6QA 1H4LA 2VWVA 5IKWA 3P5KA 4G3GA 5L8LA 5AADA 1PMVA 4QOXA 3QKLA 5CEOA 3O96A 3FQEA 4A9UA 3LMGA 4RMZA 4MD7E 3EL8A 2QOIA 3U4UA 1BL6A 5E8SA 4KINA 1CDKA 4ZTMA 4ID7A 5C26A 4YSMA 4HNFA 4HZSA 4FTAA 2GNJA 4P5QA 2C0TA 3F5GA 4QMZA 4XRLA 5ANIA 4EORA 3BHYA 2X39A 3LFEA 3ZCLA 4JLCA 5FD2A 1WCCA 5CF6A 2QKRA 4ACHA 2VNYA 3NNXA 4AXAA 3Q32A 3OW4A 3CTHA 3S95A 2VD5A 4IE9A 2OIDA 5JFXA 2VTNA 4WSQA 3FKNA 3JVRA 2UW7A 5HESA 2QURA 1HCLA 4RRVA 1P5EA 3QTQA 4FBXA 4R7HA 4AT4A 2F2CB 5JGAA 2ZDTA 3P78A 3NNUA 4KIKB 5GZ9A 2XNBA 4QTAA 3AT2A 2OJ9A 3GQIA 3L1SA 4WRSA 5EI6A 3VAPA 2C6MA 2ERKA 5IDNA 2DWBA 2VO0A 2WTDA 3AMBA 3E5AA 4YLJA 3TTJA 2JGZA 4XP0A 5TOZA 3RVGA 3QL8A 2C6IA 3ZXZA 1Y6BA 2VGPA 4CT1A 2X7GA 4HCVA 4RC3A 3HV3A 4X2JA 5CVHA 1ZYSA 4TKSA 4IAKA 4TZRA 5FP6A 4O0YA 5ANDA 2GTNA 3FLQA 5CI7A 4YO6A 4IFCA 4AACA 2W1ZA 2ZVAA 1JKTA 4RC4A 4ASDA 5L2QA 3IQ7A 2ITVA 3H9OA 4I3ZA 4XMOA 2ZOQA 4NT4A 3SHEA 4HVHA 3V5PA 4J97A 4U44A 2CLQA 3ZO1A 3KK8A 1YDRE 1IRKA 3OTUA 5E91A 4I24A 4HPUE 4U7ZA 3DAJA 4WNMA 2HZ0A 2JBPA 3F2NA 4GV1A 2XB7A 4EBVA 3AT3A 2HIWA 3UNZA 4BN1A 5TF9A 2QR8A 4UEUA 3UC4A 2BRHA 2BTRA 2XKEA 3OUKA 1LUFA 2YM3A 4DH3A 4EYJA 4ZZOA 3OT8A 5AR7A 3KRWA 4X2NA 2XBAA 4L53A 3K5VA 3R7GA 2PE0A 1ZYCA 3OWLA 3OWKA 2B7AA 1W7HA 4ENYA 4ARKA 4EYMA 3EIDA 5AX3A 2IZSA 1H25A 5CALA 5KMNA 4AS0A 1Q61A 2QD9A 2QODA 3B2WA 4GJ3A 4A4XA 3OBGA 4LOPA 5GZAA 5IEVA 1GZ8A 5BMSA 3Q3BA 4GT5A 3TNHA 3KKVA 3NIEA 4CSVA 1GAGA 3F82A 3TV7A 5ETAA 2JDRA 2RKUA 4J1RA 5ETIA 1CKPA 3OZ6A 1M2PA 4FOBA 4N0SA 4R8QA 5L3AA 3TNQB 1R39A 2R5TA 5H8EA 2W96B 3GC8A 4TTHB 3I5NA 4YZDA 1TKIA 2BROA 3GGFA 3QRUA 5GNKA 3PPKA 3FPQA 1XO2B 3FMLA 4KA3A 3RAIA 3W2PA 1Y8GA 3EMGA 4D0XA 1ZYDA 2XJ1A 2B1PA 4D2SA 4DGGA 4YJNA 1Q24A 5J95A 5BPYA 5EW8A 1LEWA 4UXQA 4JR3A 2I0EA 4L3LA 4JBOA 2ACXA 4C3FA 4F1MA 4AFJA 4CCUA 4HCUA 1PMUA 2ITOA 4RJ3A 2UZDA 1R78A 4FMQA 4WT6A 3SW7A 5AUWA 4FSYA 4IMYA 4E4MA 4CZTA 3HECA 4Q5EA 5E8XA 1PXLA 5M44A 5LWNA 1JKLA 3VRZA 1ZY5A 4XV3A 3SD0A 3I6UA 2QOOA 3C4ZA 1YHSA 3COIA 4CQEA 3GUBA 3PJ1A 2C3LA 2R3JA 2JITA 3F7WA 4QQTA 3R7YA 4EH4A 5AP5A 1JVPP 1YHWA 4E4XA 1KWPA 4U40A 3HX4A 3FZPA 2CN8A 1YW2A 4BC6A 4NM0A 5HBHA 5AUUA 2GTMA 3LFDA 5CI6A 3PXZA 2F2UA 5EYMA 4DH1A 3GCPA 3PJ2A 4GUEA 3G6GA 2V7OA 3UO6A 4JX7A 2BMCA 3R02A 4AG8A 3O71A 3QHRA 2C47A 1OUYA 2R3GA 4KABA 5CF8A 3CJFA 2OBJA 3OEFX 2PE1A 2ZV7A 2HYYA 2V62A 3LFQA 2ZYBA 4KAOA 5A54A 5KKRC 3MVHA 4YZ9A 3ZLSA 3DLSA 3FE3A 2VTLA 3UOHA 3C5UA 1PXIA 3GEQA 3D0EA 4UMQA 3BBWA 1XWSA 2R64A 1QPJA 4Y46A 4FZFB 5HOAA 2GMXA 3QUEA 3WZEA 1JAMA 2WTIA 4RA4A 4LGHA 4RFYA 1XH9A 1R0PA 4RJ6A 1ZAOA 2GNHA 3NWWA 4I5HA 4MAOA 4C61A 3Q5IA 3VIDA 4HYHA 1JWHA 4UZHA 2QONA 4NU1A 3MS9A 2B52A 5EOLA 4XG8A 3BQCA 3R0TA 4JRVA 4QTCA 2A2AA 5HICA 2UV2A 4PTCA 4EOOA 1ZWSA 2A4LA 1YXUA 5BQ0A 4QP4A 2UW3A 5B2LA 3FLWA 2BZIB 4L7FA 3MVJA 4AE9A 2Y6OA 4AOTA 3NGAA 5EW9A 4BHNA 2DS1A 3AC4A 3ORTA 4EKKA 5CY3A 3JYAA 5CVGA 4IANA 5IA1A 4XBRA 2Y6MA 3GU6A 2OGVA 3KXHA 4IBMA 3QKKA 4QP7A 4GT4A 4M67A 3I0OA 3DBDA 4LG4A 5DEWA 4R3RA 4IACA 1RDQE 4FTOA 1GY3A 3NIZA 4L7SA 4LOOA 4XG3A 5AIRA 1FVVA 4FKRA 2XS0A 3WZUA 4HPTE 3ACJA 1M2RA 5E1EA 3OCSA 2BAJA 4HOKA 2JAMA 4RIWB 1P4OA 5HO8A 5LXMA 3DK6A 2GNGA 5CEQA 4GU9A 4RJ4A 4WRGA 3QLGA 2OK1A 2BRMA 3EH9A 4FIGA 3SKCA 4E8AA 4IVBA 2PVHA 3AC5A 3I60A 1UVRA 3R1QA 5JH6A 4PPBA 4C38A 4ANNA 4OAUC 3ZEWA 2HXQA 2R3IA 5E8ZA 3LJ1A 4FYNA 3RK5A 3UTOA 2YJRA 4FKVA 5BVNA 4BBEA 2VX1A 5L2IA 3FXXA 3GFWA 4RPVA 3P4KA 4AW5A 5K4JA 3VRYA 2XK7A 4K77A 4I5PA 4BTJA 4DTKA 2ZB1A 5IUHA 3R01A 1QPDA 1QL6A 2RG6A 2WU7A 4HYIA 2F4JA 3ROYA 4G2FA 4W8DA 4UBAA 5FXSA 3F5PA 5EFQA 4YPSA 2WMTA 3EQGA 1WZYA 5DHJA 4WD5A 4WBBB 2QOBA 3AD4A 1FPUA 4AZWA 4YO4A 3A8WA 4ZIMA 4BDCA 4QYFA 4C7TA 2YM5A 2WB8A 3P7BA 4QMVA 2IZUA 4RFZA 3GC9A 5FBNC 3PVGA 5FM2A 5F95A 4L9IA 4FKGA 5AUVA 3V8TA 4MF0A 4TYEA 4BDDA 1WBSA 1W98A 3D5VA 3EN5A 5M4FA 4BB4A 3FXZA 5EHYA 4OTRA 3P86A 3Q9ZA 2IVVA 4J98A 3ZHPC 4FSRA 5JZJA 1GOLA 4OTDA 4L43A 2PWLA 3S2PA 3BHVA 4FIFA 1Q8ZA 1OL6A 4IWOA 3RM6A 4HZRA 4ZTLA 5CEPA 3BZ3A 3UPXA 2R3PA 5BYYA 5JFVA 3ZM4A 3FSKA 4I6HA 5CU4A 3GU4A 4QP9A 3FKLA 1MQBA 2W1EA 2BRGA 3Q6UA 4TNBA 3WF8A 2W4JA 5CTPA 5KE0A 3PTGA 3E8DA 4FIIA 3IDBA 4QT1A 1ZYJA 4BIEA 3EQFA 5FDPA 4RX5A 5HNBA 4EOIA 5JEBA 5FWKK 2B4SB 2BZJA 3QC4A 4WBOA 3FY2A 3Q4UA 4F9YA 3VS4A 4MKCA 3GCVA 3ZOSA 4BKYA 3VUGA 4QP6A 4TPTA 5KMMA 3F7ZA 4QTEA 5EDPA 4AT3A 3IGOA 1FMKA 4D28A 3FDNA 1H1QA 4MXYA 5CS6A 4RG0A 5KO1A 4IZ5A 5ACBC 2YM7A 2ZMCA 1F0QA 2HWPA 3VF9A 1Q97A 4DEHA 3V3VA 5GJGA 2ITXA 3F2AA 3ET7A 1FVTA 3P0MA 2CCIA 4L46A 4BGGA 3M42A 4YMJA 1TQPA 5I0BA 5HORA 3QTUA 1H1SA 3QZGA 4AN2A 4NTSA 4OBQA 3NAYA 5IH4A 5CQWA 4MD8E 3MFUA 1UU7A 4IC7A 2XUUA 3KFAA 3G6HA 1T45A 5EH0A 2UW8A 4R7IA 4ZY6A 3VW8A 3HKOA 4OGRA 2OO8X 3GOPA 2VTPA 4TT7A 3ORNA 5LCKA 3OF0A 2BILB 2YIQA 3IOPA 4Y83A 3D5UA 2VTOA 2XJ0A 5GJDA 3LFSA 2OIQA 4A4OA 4A06A 4ALVA 3O50A 1NVSA 3LJ2A 3NUYA 5KKRB 5LJJA 5CAVA 5BVKA 4X3FB 3WIKA 1OVEA 2UW6A 4WHZA 3DZOA 4JBPA 3QC9A 4CKIA 4AF3A 2R3MA 1MUOA 3DPKA 3CD3A 3NDMA 3EQRA 2LAVA 3LCSA 3KVWA 3A7JA 4Q9SA 4LUEA 3BV2A 3DJ5A 3QTXA 3LCDA 3LOKA 3PFQA 5AM6A 3OMVA 1J91A 5D7VA 5EDQA 3ORMA 3PA4A 3PVBA 4DHFA 4FUYA 5IUIA 4JOAA 4CFFA 1XH6A 5D7AA 2Z7QA 4ZSAA 5JT2A 1XBCA 2I0VA 4H36A 3TKIA 1JOWB 4V01A 5DLSA 5FQDC 5CAUA 2VZ6A 2ITWA 3QRIA 4HYSA 3BE2A 2QVSE 3DT1A 3NZ0A 3QXOA 4C3RA 1MRUA 1ZRZA 3MPTA 4CXAA 1H24A 4X3FC 3KEXA 4CTBA 4FV8A 2J0IA 3OXIA 4RX8A 3SV0A 1AGWA 3FXWA 3W55A 3QTWA 4JAIA 4QD6A 5JQ5A 1U59A 3C1XA 2XIKA 3CBLA 3R73A 5J5SA 4NJDA 3UOKA 4ZAUA 4Q9ZA 3TN8A 5K9IA 2V0DA 5J7HA 3SXRA 3VQHA 4WG4A 4M0YA 3FMHA 4O21A 4D58A 4DFZE 1KV2A 2CDZA 2VAGA 3R8ZA 4FTLA 5E92A 2J4ZA 2WMAA 2YAKA 3GNIB 4O2PA 3GU8A 3VNTA 4M12A 3OCGA 4MXAA 5E8WA 1H1PA 4EOKA 2Y4IC 3RBWA 3EZRA 3VHKA 4BYJA 2J7TA 3UYTA 5HG7A 4YZNA 3BYSA 1ZY4A 5AP2A 3KVXA 4JG8A 5E8UA 4GK4A 1U5RA 5HG5A 2W1CA 4IWDA 4ANBA 4X2KA 4HVGA 2W5BA 3UOLA 2R3OA 1O6YA 3CXWA 3MB7A 3UJGA 2X8IA 3IONA 2CLXA 4QQ5A 3MA6A 2IW9A 1R3CA 3CTQA 4AU8A 1YWRA 2IVSA 1LPUA 3SA0A 2HELA 3E8CA 4FSWA 4ZTRA 3PJCA 5ITAA 3F3VA 4RLLA 2PZPA 2ZM1A 3R8LA 3JPVA 2JKQA 2IO6A 3NYVA 1TVOA 3LQ5A 5EYCA 3UQGA 2ITTA 3KK9A 5KMIA 4FKOA 1CSNA 3RCDA 2J50A 4GS6A 3UOJA 4NWMA 3IOKA 3NUXA 4BDFA 1H1RA 3E64A 3ZLWA 1J1BA 3S3IA 2W1IA 4IAAA 3SX9A 4AWIA 2E9NA 4FEQA 2B9JA 1OB3A 3R30A 4GL9A 3ZRKA 3HP2A 2HWOA 5DNRA 2WTVA 4O96A 2CSNA 5FEEA 2XNGA 2WEIA 4FT7A 5T68A 2HW7A 2XIYA 3DBCA 1RW8A 2PK9A 3C51A 4FTIA 3FQHA 3IK3A 3AMYA 5DA3A 1G5SA 2HZIA 2FH9A 2NRYA 4B4LA 1GZKA 4YBJA 1KE5A 2PZRA 3L9LA 1YI4A 2V7AA 4G9RA 3Q96A 2GNFA 3DQXA 3AMAA 5HCZA 5CZHA 4EHEA 4XP3A 4O1OA 4P2KA 4JDJA 2Q0BA 4LRKA 4NCTA 5AUYA 3BGQA 3BYUA 4ZTSA 4J53A 4DEBA 3GI3A 5LMAA 3QYWA 4RIXA 5L8JA 3IGGA 3AOXA 3KC3A 3SVVA 3K3JA 4FG9A 2R7IA 5FEQA 4PMPA 1MQ4A 2BFXA 3QQJA 4LV5A 3RAHA 2HENA 3ORLA 5KZ0A 3ROCA 4C34A 3UZTA 4YZMA 1NA7A 5A4TA 3CPBA 3KU2A 3HP5A 2PE2A 4J99A 3LXNA 4MBLA 5EHLA 3ENMA 4NZWB 4QMYA 3D94A 1F5QA 5HE1A 1WVYA 1BLXA 1OL2A 4J52A 4K11A 3NNVA 4F6SA 2Z7SA 5AWMA 3C0IA 3P23A 3PSCA 3UMXA 4D0WA 3FPMA 2W06A 2UZBA 3ZUTA 3ZTXA 3S4QA 2XK8A 5CSHA 1HCKA 4L68A 5EOBA 4EL9A 4YC6A 1Z5MA 4KKEA 2W1GA 4PL4A 5EHOA 5ETCA 2OZAB 3CKXA 1U5QA 2Y9QA 2XKFA 3ZH8A 4X6QC 2PZ5A 4L01A 3PPZA 2EU9A 2XCKA 5DT3A 2QOKA 3MB6A 3DFCB 3C0HA 2FVDA 3HZTA 3UIMA 2HAKA 3V01A 3S0OA 3DKCA 3PUPA 4U9AA 3PZHA 4MBJA 2GDOA 3ZO3A 3TIYA 4RJ7A 2VX3A 2HK5A 2XCHA 4FKQA 3KN6A 3DNEA 3B8RA 2W5HA 5CSWA 3UBDA 4IVDA 5J7BA 3EB0A 4AA5A 1XKKA 3E88A 1JLUE 3BX5A 2PVLA 4BDIA 4QP3A 4HYUA 1K9AA 3POOA 4NIFA 3PXFA 2WQMA 3BLHA 5HG9A 1BI8A 1WAKA 1NXKA 2H96A 2JIVA 2WKMA 3R8MA 1SVEA 4OLIA 5CYIA 3TZ7A 5KMKA 5D41A 2C5VA 5AAEA 4QMPA 3VJNA 1MP8A 2WTCA 1W82A 3BKBA 4OT5A 4F08A 2W99B 1FVRA 3HMOA 1ZOEA 5HD7A 4FKSA 4J7BA 5J87A 2WXVA 4MNEA 3AT4A 5A6NA 2QI8A 4W4WA 3VS2A 3IW4A 2VWZA 4GEOA 2BTSA 2C5XA 2QCSA 4RQVA 3RP9A 3EWHA 4EH5A 4EH2A 4DFYA 3COHA 2XYNA 1UU3A 3K54A 2X6EA 4K8AA 5HBEA 4GVAA 2GHMA 4E73A 2C3IB 4JIAA 3SRVA 3PPJA 2OWBA 2C3KA 2KTYA 3HRFA 4ITHA 3TTIA 5BVOA 5M4IA 5HLPA 3C4CA 4FUXA 4DBNA 3NRMA 5M56A 4NM3A 1A9UA 3C9WA 3EZVA 4IAFA 5C03A 3DS6A 4XLVA 3QQUA 3UVRA 2GS2A 5DE2A 4DINA 4EOMA 3CPCA 3R2YA 4CZYB 3RK7A 2LGCA 5J1WA 3D7TB 3BLRA 4FODA 2C30A 3NCGA 2OZAA 3EN6A 3Q53A 3KF4A 3WF5A 1H27A 4G6OA 5CNOA 4GK2A 5IMXA 5C8KA 5IPJA 5IZFA 5LVOA 2JDVA 5L6OA 5HNGA 3CR0A 4F0IA 5HTCA 3R6XA 3ACKA 4MXCA 4D5KA 5FLFA 3KMMA 3AC3A 5AJQA 1KE6A 3W2SA 3RJCA 5EK7A 5L2TA 3DKFA 4RIYA 4B8MA 4CTCA 3BU5A 3JUHA 3BPRA 2P2IA 4S2ZA 4FTJA 4U81A 5IA4A 1Q99A 5AP0A 2JC6A 3ORZA 2OSCA 4G5JA 4C33A 4ERWA 3BEGA 3TI1A 3W2RA 4MTAA 4QMMA 3L9NA 1YDSE 1E1VA 2BAQA 4AW2A 4NTTA 3OOGA 4FTCA 1YRPA 4BDBA 4TW9A 3LM0A 5T6KA 2V22A 2UUEA 3ORPA 3QQLA 4AAAA 2XKDA 1TQMA 4I0SA 5EM8A 5CENA 5IMEA 2OH4A 4IX6A 4QRCA 3RPOA 4I21A 3REPA 3CY3A 4E20A 3NYOA 2PVYA 3OHTA 1PF8A 4PPAA 3GOKA 3WZKA 1YQJA 2QC6A 4W4VA 2UZTA 4CFMA 5HD4A 3CD8A 4ANLA 4FOCA 3V5WA 1KV1A 4ZTQA 3KQ7A 2ZM4A 2WNTA 3VBQA 4JL9A 4QMOA 1Y57A 2WOUA 3BI6A 5DR2A 3VS6A 2IJMA 3BQRA 4CT2A 3GU5A 4J96A 3VN9A 4YSJA 2G2FA 2QOHA 4YJRA 1PHKA 5BMMA 3EQHA 4IZAA 4O0WA 3CIKA 2CCHA 4GK3A 4UY9A 3RGFA 4ACMA 5L6PA 1URCA 2C1AA 3KXMA 2SRCA 4W8EA 4TYJA 4JS8A 2FB8A 1VJYA 3PYYA 2CGXA 2X81A 2BDFA 4OTQA 4FTKA 3QCXA 5AR5A 5HIDA 4YLKA 3QZFA 4GJ2A 4OTHA 4EC9A 4ZK5A 4IADA 1JKSA 4M69A 3BWFA 3KCKA 1DAWA 4GUBA 3KXGA 3ZRLA 4FTQA 3EQCA 4P90A 5BVEA 5M57A 2EVAA 3BELA 3ZO4A 4YNEA 3MA3A 5HE0A 1PXMA 1IA8A 3AXWA 5HO6A 1IEPA 3HNGA 5K3YA 5K4IA 2PMOX 5E8YA 4DYMA 3UP2A 1OIUA 3EFKA 4E93A 2VWYA 3Q4CA 4Z55A 4JDIA 4U43A 3K3IA 2YERA 5AR2A 4ONAA 3S1HA 5T3QA 4A9TA 4DEAA 4LQMA 4QYEA 4U6RA 3COKA 3ANQA 4FVRA 2YA9A 4PX6A 3VUTA 4D2WA 4NH1A 1WBPA 2BCJA 3D83A 4RZVA 1BL7A 4M13A 3WOWA 4PDOA 4QNAA 4CLIA 2C6LA 4YTFA 2VWUA 3R9OA 2F57A 3HMNA 3F3UA 4JDKA 2YJSA 2IVTA 4MH7A 5JRQA 4XG9A 3OROA 3SQQA 3OS3A 1Y8YA 5J79A 4LUDA 2Z7RA 3OCBA 1IASA 4APPA 4F09A 2XM9A 2RFNA 1U46A 1P2AA 5FEDA 4FV7A 4Y5QA 5HE2A 2QNJA 1PXOA 4EC8A 4EOSA 5JFSA 1PXPA 3ULZA 1OZ1A 2WIHA 4I0TA 2P3GX 3OY1A 5CAOA 3UO4A 3HUBA 4BWKA 2YCFA 3NR9A 3VW6A 3QTSA 5DR6A 2PY3A 4QP1A 5K0KA 2ZM3A 4S34A 4O1PA 4OTFA 4U3ZA 2W0JA 3R1SA 4WOVA 3WF6A 4BICA 3NNWA 4LV8A 3BRBA 3ZBFA 3QRJA 3NS9A 4K1BA 3WF7A 4AUAA 5I9VA 3FC2A 4AA4A 2UVXA 3L8SA 4MCVA 4O6LA 1XH4A 2EXMA 2JBOA 4I5MA 3KB7A 4BDKA 4EHZA 3V51A 4PL3A 4H3BA 4R1VA 3HLLA 5D10A 4YJPA 2HY81 3MH2A 4XRJA 2OG8A 1H1WA 4FL1A 4J8MA 3ZC5A 4RIYB 2X8EA 4DH5A 4E5AX 4AFEA 4UYNA 4QPMA 5ANJA 1QPEA 2VWIA 3FI4A 1APME 4BFMA 2BRBA 2WIPA 4PV0A 2E2BA 2E9VA 5HTIA 1YVJA 4CFUA 5EM5A 2BVAA 2QO7A 5AMNA 5EG3A 4D9UA 3SDJA 3VULA 4L67A 4XJ0A 4IZ7A 3EFLA 3FZTA 3NUUA 3QCSA 3KULB 4G5PA 4QQJA 3KL8A 5HTBA 4FV4A 3QGYA 3RAKA 4Y85A 4GRBA 5CASA 4KIQA 5DEYA 5DPVA 3V04A 3GC0A 4U8ZA 3DBFA 1YXVA 4BGHA 4G1WA 5J9YA 5G6VA 4BVUA 4Y72A 4D4VA 3PP1A 2PVFA 2R3NA 2XNEA 2WO6A 3QTRA 3Q6WA 3LM5A 5BYZA 3ETAA 4BCOA 4NFNA 3PXYA 4RIOA 4DITA 2BKZA 3BV3A 4EOLA 4KIOA 2OKRA 3A60A 2A27A 4MWHA 4UALA 4MYGA 4ZSGA 3ZSHA 2UVZA 2ITNA 2G2HA 2CPKE 2YCSA 1UNHA 4IWPA 4RX9A 4EK3A 1JSTA 3PIZA 3K5UA 4JT3A 5HIEA 4USFA 3QRKA 4LFIA 4BCNA 5LMKC 5EYKA 2GNLA 2YZAA 2GCDA 5CXHA 3WILA 2A0CX 2UZVA 1YWVA 3HYHA 4U3YA 5JQ8A 3QGWA 3N9XA 4USEA 5HVYA 3HMIA 3BYOA 3NUNA 2VWBA 3ZUUA 5FTOA 2Y4IB 3Q04A 2BRNA 5CEMA 4KS7A 2YIYA 3UO5A 5DOSA 2YDKA 4FZ6A 5C27A 1SM2A 3R00A 4ANOA 4G9CA 2GFCA 4I5CA 1P4FA 3ZUVA 1JNKA 1YXTA 1SYKA 1Q41A 2R3LA 2V5QA 4Y5HA 4YPDA 3R04A 4F9BA 3FI3A 3ALNA 3VUIA 3DTWA 2A19B 3PY1A 3EN7A 5E8TA 1O6KA 4L3PA 3AQVA 2VTSA 4AGDA 4EK5A 3U6JA 1UU9A 4YJQA 3R7IA 4KB8A 4DG0E 4IW0A 2CMWA 3EKKA 4U79A 1H00A 2VX0A 4IEBA 3ZFXA 4KS8A 5HZNA 2PZIA 5CT0A 3W16A 4CKRA 4TYHB 2C6TA 3PA3A 4PMMA 5HI2A 4AZTA 2UW0A 4UMRA 1WBNA 1PMEA 3QTIA 4DAWA 1YXXA 1WBTA 3C0GA 2FYSA 4NW6A 3VQUA 3P1AA 3RCJA 3VBYA 3W18A 1V0OA 2H9VA 3FMNA 4RFMA 4BCQA 2QO2A 3MDYA 5DRBA 1JSVA 4OTIA 3SLSA 5F9EA 4CCBA 3MVLA 4Z3VA 3QF9A 5AV0A 3EQBA 4TWPA 2X4ZA 5AIKA 5IH5A 4O0XA 3LFBA 3QQFA 4MEDA 3TCPA 3UNJA 4HW7A 4O38A 5FP5A 4I1ZA 2JDOA 3P7CA 3CP9A 3R9HA 4DFXE 2YCRA 2YM6A 4O0SA 3PA5A 2VO7A 5L6WL 3TNPC 4IJPA 1H07A 3WZJA 4BWPA 4J8NA 5C8MA 3FBVA 3M2WA 3QD3A 4YC3A 5F4NA 4WSYA 3FZSA 1YKRA 5H2UA 1SNXA 2GPHA 5IU2A 3R7EA 2P2HA 3R7OA 4FKIA 2VO6A 1OKWA 2ITZA 5I9ZA 4BZOA 3ZZWA 5BVWA 4CMTA 2Y7JA 4AZVA 3TUDA 4K9YA 2J6MA 2OJJA 3FYJX 5CX9A 4DEDA 4W9XA 4GFMA 4IH8A 3EFWA 5F20A 2JIIA 3DB8A 5KNJA 5AV4A 4FSMA 3OBJA 5I3RA 3GXLA 4LL0A 3BLQA 4E6QA 3KMUA 3RAWA 5I9WA 1R0EA 1YOJA 3BHUA 3EFJA 4KKHA 4F1OA 4E5WA 3LFNA 4FV9A 2E9UA 1B39A 5KZIA 5L2SA 3AGLA 2OW3A 3FHRA 3I0QA 4WG5A 2VTIA 1YHVA 4KKGA 3VS5A 4PMTA 4V0GB 5HHWA 3HVCA 3ZMMA 4N6YA 2WFYA 4M3QA 3VS3A 2YAAA 3FLZA 3NX8A 3C7QA 4A9RA 1EH4A 1U54A 2YIWA 3GT8A 3MPAA 1VYWA 4GYGA 3IECA 3ZFMA 2ERZE 2H8HA 2QKWB 3A7GA 3FL5A 3JS2A 2WOTA 3PRIA 5M55A 5AAGA 4FYOA 3R8PA 2J5FA 3E7VA 3FLNC 4FIHA 5HVJA 2J51A 4S33A 3UC3A 2VN9A 4IM2A 3HL7A 2BIKB 3ALOA 3LXKA 5M53A 1V0BA 1BI7A 1K3AA 4QP8A 1PJKA 4MNEB 3PJ3A 4M97A 1Q8TA 4ERKA 3NPCA 5AP6A 3QUPA 2P55A 4EK4A 2QU5A 1PMNA 3FUPA 2EB2A 3QX4A 2ONLC 4JJRA 1OL5A 2XNPA 4IXPA 3ZFYA 2YIRA 3VBXA 2WMBA 1KE9A 5HEZA 5ACKA 4ZLOA 5KHWA 3BIZA 3HDMA 1IR3A 3R83A 4A4LA 2OIBA 1H0WA 4UZDA 1G3NA 5BUJA 3R63A 5HCXA 3BBTB 4O6EA 4PP7A 4XBUA 1Y91A 3KCFA 4RLKA 2XH5A 4M7IA 4RA5A 4TYIA 4BTMA 3ZEPA 3D4QA 4TRLA 2C5NA 4KIPA 2XM8A 3BYVA 4GCJA 2F7EE 2UZLA 1ZZLA 5L2WA 4W4YA 5A4CA 2P0CA 4NCTC 1V0PA 3EQDA 3H9RA 4AN3A 3HRCA 3HUCA 1V1KA 3KA0A 3PVWA 4ZY4A 3VS7A 5IDPA 1XH8A 3FV8A 4F64A 4E3CA 4ACDA 3FHIA 4BBMA 3UIUA 3OC1A 2B54A 3QYZA 5D1JA 4EOPA 3ZYAA 3HA6A 3VUHA 3LZBA 2OF2A 2BPMA 3KULA 3KXZA 5I9UA 5AR3A 4FK3A 1YDTE 4YJUA 2E9PA 5FRIA 4FNZA 5CF4A 2FUMA 1U4DA 4V0GA 4TL0A 2P4IA 5D11A 3MY1A 4FNYA 2VWWA 1U54B 3Q5ZA 5IEXA 4XG4A 2VTTA 4FZAB 4WNPA 3Q4TA
chains in the Genus database with same CATH superfamily
2R0UA 2UW4A 1FGIA 3FSFA 4C2WA 2YEXA 4LL5A 4X0MA 4MQ2A 4D4RA 2R7BA 3DNDA 5DGZA 1LEZA 2RSVA 4AOIA 5LMBA 5HGIA 3FMEA 3H30A 2CKEA 5IEYA 2JEDA 3CC6A 1OIQA 1ZMUA 5C1QB 3WBLA 3OVVA 3TKHA 3DK3A 5FM3A 1B38A 2NO3A 4IDTA 4O4BB 4DC2A 4LI5A 4CLJA 3O7LB 3GENA 1NVQA 1WBVA 2B9FA 3IW6A 4U0IA 4CMOA 4UWCA 2R4BA 5AEPA 5KHXA 4FT9A 3LW0A 1QCFA 5FGKA 1YOMA 2VNWA 1Q3DA 3MBLA 3D7TA 4IX5A 4QPSA 4X2FA 4E26A 2IZTA 1STCE 4ZTNA 2B53A 3VHEA 5HQ0A 5B0XA 1REJA 4YNOA 4DH7A 3MH1A 3TUCA 4G6NA 1KOAA 2WMXA 3A2CA 3HGKA 2R3HA 1PY5A 2G15A 2Z2WA 3EN4A 2G2IA 1PXJA 3PWYA 3QRTA 5IA5A 3QD0A 4BDHA 2X1NA 3MW1A 5EI8A 2OXXA 3VBWA 4MXXA 1GZOA 4F65A 5EKNA 3DKOA 4S31A 4YHFA 3H9FA 5HX8A 5FBOA 2QU6A 4KNBA 3AC1A 3PG3A 4FSTA 4BCIA 2X6DA 4KD1A 3MN3A 3P7AA 4O0VA 4FR4A 3ULIA 4YC8A 3QZHA 4RVTA 1CKJA 4Y8DA 3M1SA 4EK6A 3F3WA 1YOLA 2JKKA 4FL3A 3WYXA 4C2VA 4D2PA 3D2KA 2UZUE 3DBEA 2Y0AA 3L8VA 5LOHA 3KXNA 3H0ZA 3TNIA 4HVSA 4FI1A 3ERKA 2HOGA 5AV2A 4BRXA 4CFWA 2W1FA 1WBWA 4EWHA 1JPAA 4IWQA 3HA8A 4I94A 3ORXA 5CZIA 4R6VA 2C0OA 4DN5A 5KBQA 4QMXA 3W10A 3N51A 3PXQA 4O22A 2YM4A 5HKMA 1Q5KA 1LP4A 3ORIA 3A8XA 3FJQE 3LCKA 3D5XA 3LVPA 4ZXTA 3VUDA 4E1ZA 3M11A 4GSBA 2J0MB 2J5EA 3TWJA 4BDAA 3IDCA 4EWQA 5IA3A 4MQ1A 4LMNA 3RPYA 4X3JA 3ODZX 3ZLXA 4JAJA 4XX9A 3DGKA 2CGUA 4EH9A 3E8NA 2B9HA 3TJCA 5M4CA 4FNWA 4XOYA 3UPZA 3GQLA 3NUPA 4F70A 4B99A 3DAKA 4OT6A 2CJMA 3VS0A 3QWJA 5DVRA 3GU7A 3DFAA 4RWIA 4F9WA 4NKAA 2VTHA 2WZJA 4IVAA 5DH3A 3DQWA 4WUAA 2I6LA 2W1HA 3MI9A 4O91A 3UE4A 3W1FA 3RMFA 5JFWA 4K33A 4FVQA 2X0QA 3QAME 3L9MA 2BR1A 4IVCA 4FK6A 3Q60A 3PSDA 4D4YA 3R9NA 4M84A 5HU9A 2XVDA 3MH3A 4MD9E 4WO5A 4BCPA 3MYGA 4I4FA 3UDBA 3OP5A 5A6OA 1VYZA 3DBQA 3CQWA 3QHWA 4XV9A 4IB1A 4N70A 4XNEA 4JNWA 4RC2A 2WMSA 1REKA 3AGMA 4C62A 4DCEA 2OFVA 1M2QA 3D5WA 4EH8A 5A4LA 3VBTA 3F5UA 4MXOA 1Q3WA 4PY1A 3OXZA 3ZLYA 4JX3A 2GHGA 3AC8A 3U6IA 2Y8OA 3I81A 4EQCA 3TG1A 3IS5A 4OTWA 4DGOA 1YXSA 4TYHA 3QCQA 2I1MA 4D2VA 4FTTA 3RTPA 3FWQA 1OI9A 2VTRA 4H1MA 4LMUA 2X2LA 4YLLA 5HIBA 3RNIA 4OTGA 2ITPA 1WVXA 4FIJA 4L44A 4BI2A 3LFFA 3AC2A 2F9GA 1M17A 3TEIA 3JY0A 4FTUA 2HCKA 2GHLA 4R1YA 3W2OA 3ZSGA 4X21A 2ZDUA 5GHVA 2PTKA 4XV1A 5CU6A 2X7FA 3MSSA 5ETFA 3C4WA 3KY2A 4BCKA 4DG3E 4CQGA 2GQGA 3IDPA 4EK8A 2W7XA 3H10A 2BZKB 4ZSEA 4JRNA 5A3XA 3RPRA 3CQUA 3I6WA 2GFSA 1Z9XA 3LE6A 4G3CA 4PQNA 4WKQA 4AW0A 4F6UA 2X2KA 1YWNA 3QWKA 4YBKA 3A99A 5AUZA 4BZNA 5AUXA 3EL7A 3RALA 3TXOA 2XBJA 4CRSA 4BCFA 1MRYA 2RG5A 4ZTHA 2ETMA 4CZUA 1UKHA 3FZOA 3OTVA 2QOLA 2H6DA 3QU0A 5DI1A 3FMDA 1MRVA 3W8QA 4UMUA 4PP9A 4ITIA 4GT3A 2J9MA 4G3EA 3EJ1A 4I93A 5CVFA 2QHMA 4EUUA 4II5A 5ICPA 4E5BA 5H9BA 5J1VA 2F7XE 2ESMA 4ZLYA 4BIBA 4I6BA 4JXFA 5HO7A 3UMWA 4D1XA 4CMUA 3DZQA 3E92A 3EOCA 3RPSA 1SMHA 2ZMDA 2R3QA 5KCVA 3OY3A 2AC3A 4IJ9A 4QYGA 4ACGA 2C0IA 4C36A 5KUPA 1TZDA 2ITQA 3FYKX 4AZEA 4CD0A 3H3CA 3NW5A 4OR5A 5AA8A 3EYHA 5BUIA 1RJBA 2H34A 4B6LA 4BCHA 4HCTA 2JD5A 3Q52A 4L00A 4RIXB 2YABA 4UXLA 2WMQA 1BX6A 4O4DA 3I4BA 5I5ZA 4BCMA 3QUDA 2EB3A 2JAVA 2QO9A 1WVWA 3LCTA 4LRJA 2RF9A 4U5JA 1DI8A 1ZZ2A 1UA2A 5DIAA 1VEBA 4YURA 3G0FA 3K2LA 2J0LA 3DJ6A 4RIWA 1W83A 4V04A 5AM7A 4L52A 2ZV2A 3AD5A 4FT0A 2C6EA 4FKJA 5DR9A 3RWQA 5G1XA 4MWIA 1ATPE 2C6OA 4YJVA 5DT0A 3EN9A 5HU3A 3E7OA 4B9DA 5TE0A 3KN5A 4NUSA 5AAFA 3GB2A 3E8EA 3QZIA 1Z57A 3CEKA 4RJ5A 5CU3A 3ZXTA 3UVPA 4K18A 4QMSA 5D12A 4FIEA 2PUUA 4XS2A 4AT5A 4J71A 4ITJA 4K2RA 3MTFA 4U80A 4AE6A 4FGBA 2NPQA 4E6DA 3PIYA 4NEUA 4CFVA 3FY0A 1T46A 4ZZNA 4ZEGA 5CXZA 1GIJA 4HVIA 2QOCA 1BUHA 2YACA 5HLWA 4UMTA 2XRUA 4KBAA 2W9FB 2BHEA 3CGOA 3OT3A 4G17A 4F99A 4AP7A 4B8LA 2XRWA 3MJ1A 3LJ0A 4EH6A 3BYMA 4KWPA 4O0RA 4H3QA 5EM6A 1QMZA 4WA9A 4XG2A 1M7QA 4KIKA 1W8CA 4DEEA 3W8LA 1B6CB 3ANRA 3CS9A 3C4FA 2XP2A 4FTMA 2JIUA 4HJOA 4LGDA 2YITA 2FSMX 4NIFB 3UP7A 3MFTA 4GYIA 3ELJA 3OCTA 4RVLA 4TWOA 1OECA 5IF1A 3MIAA 2XNMA 4M68A 4AGWA 2DQ7X 1YI3A 3MFRA 2ITUA 5A14A 3DKGA 4MVFA 5CAQA 2R3FA 4ZSLA 3AG9A 3I5ZA 2JFLA 2OF4A 3W2QA 4YU2A 5A46A 1Q62A 1RE8A 2WTWA 3KRRA 5DG5A 3F9NA 3ZZEA 5EW3A 1L3RE 1OL7A 1S9IA 1URWA 1DM2A 3A62A 4ZJVA 3RPVA 3A7HA 2Z60A 1S9JA 4U45A 1BKXA 3UYSA 3NYXA 3POZA 3ZDUA 4BDJA 3C13A 5KX8A 4FKWA 3R9DA 2W5AA 4UYAA 4OW8A 2VUWA 4ZS0A 2GNIA 2PSQA 3OWPA 3RI1A 4CYIA 2BAKA 3DU8A 3FQSA 2C3JA 5K5NA 5AV1A 5DMZA 3U6HA 3HMMA 4PTGA 1ZLTA 2UW9A 3DDPA 3IPHA 3B2TA 4TWCA 3UGCA 4BTKA 5B7VA 5BVFA 4HVDA 4Z7HA 2UZNA 3GCSA 2WQOA 3QBNA 1A06A 2W4OA 1FOTA 5C8NA 4UWYA 4Z7GA 3HV5A 3UIBA 3IG7A 3EKNA 4FZ7A 4AN9A 1WMKA 2G1TA 3G0EA 3CCNA 2JKMA 2PVMA 3GC7A 3L8PA 4I4EA 4FA2A 4JQ7A 4KBCA 2QQ7A 3BE9A 4XHKB 3TT0A 4E6AA 2WPAA 4C4HA 1SNUA 4EONA 4QMTA 3OEZA 3HV4A 3MY5A 4JDHA 1AD5A 4JVGA 4APCA 2IW6A 4OBPA 2PMLX 3T3UA 3UZPA 2J0KA 4M66A 3PWDA 4MX9A 4LOQA 5DRDA 3SAYA 4OBOA 3UQFA 1WFCA 3TZ9A 4UV0A 4LRMA 4M8TA 3KRXA 4QTBA 4C58A 2HXLA 2XA4A 4NM7A 5ANEA 3TNWA 2XIRA 4FV2A 4A9YA 3GP0A 4BCJA 2WTJA 5DN3A 5A9UA 2VTQA 3QD4A 3U8WA 4IB5A 2OFUA 2JDTA 2R0IA 2HZ4A 2VWXA 3PY0A 5DBXA 3F88A 2XK6A 4RVMA 4PDSA 1XR1A 3MY0A 3ORKA 5C9CA 4BCGA 4UN0C 1JKKA 3DAEA 5D9HA 5AP4A 2UZEA 4I20A 4EHGA 4QMQA 5KMOA 4ASZA 4C3PA 4YUQA 3PXRA 2QG5A 2QLUA 4R5SA 5L8KA 3BEAA 3F61A 4FSUA 4D2RA 4XG6A 1OIYA 4IX4A 2VV9A 2UZWE 1O6LA 4CFNA 4JBQA 3NAXA 1F3MC 3LAUA 3EQIA 3G33A 1GJOA 3FAAA 2O5KA 3QA0A 5ANGA 5HE3A 1Q4LA 3A7FA 2C5YA 3D2IA 4EOJA 4RBLA 3ODYX 1O9UA 3U9NA 3NW7A 4D1SA 1H01A 2P33A 3D9VA 3V5LA 5E1SA 4Z9LA 4C4GA 3U9CA 4NK9A 3PRFA 3QTZA 2WEVA 4ZZMA 2Z7LA 1KSWA 3UVQA 4M15A 3PIXA 3F6XA 4MNFA 5CEIA 4P4CA 5E8VA 1PW2A 2Q0NA 4BDEA 4C37A 4BI1A 1R1WA 4DGNA 2RFDA 4ANSA 1ZOGA 4FF8A 1DI9A 5IG1A 1SVHA 2BUJA 1XHAA 2PVRA 4KSPA 4F0GA 3FL4A 3A7IA 2JDSA 1KOBA 2RIOA 4C4EA 3V5TA 5A4QA 2J2IB 4IAYA 2WQNA 3BCEA 3FMKA 4ACCA 2WAJA 2C1BA 2CGWA 2DUVA 5EDRA 2KULA 3OW3A 1H26A 2XIZA 5K5XA 5LMKA 1OKVA 4QO9A 4FX3A 4D1ZA 2PZYA 2X4FA 1XH5A 2YLEA 5E90A 1IG1A 4TXCA 2ZAZA 3IW5A 4EKLA 4JG7A 4C59A 4M14A 2ONLA 4FV0A 4AGCA 4FSZA 3PXKA 1DS5A 3SOCA 4IC8A 4EHVA 4BWXA 2IN6A 3A4PA 3EQPA 4I41A 4DGMA 3SOAA 1J3HA 2PVJA 5DT4A 4D55A 2ZB0A 4YTCA 3R28A 4YTHA 4C0TA 5E7RA 2OJGA 4RSSA 4E7WA 4NJ3A 1BMKA 1OL1A 5DWRA 4I6FA 4Z16A 3PE2A 1FQ1B 4NSTA 2OI4X 4MHAA 2YDIA 3IW7A 5CAPA 4YHJA 2YLFA 3E62A 3T9IA 1PKGA 4IAIA 1PKDA 2ITYA 4IQ6A 3VBVA 2F49A 5TO8A 2YISA 1KE7A 2X0OA 3D7ZA 4EZ5A 4HGEA 1I44A 3QALE 2DYLA 3QQKA 5KBRA 3C4EA 1ERKA 3CKWA 5H8GA 3PG1A 3QD2B 2FSOX 4FSQA 2GS7A 3UNKA 4FG7A 2HY0A 3Q9YA 4BKZA 4ASEA 4IAZA 1H08A 1OKZA 2BZHB 4L42A 3GCUA 2B9IA 3UG1A 5M4UA 4NW5A 4DLIA 4N4SA 3I7BA 3NUSA 3TUBA 1Q8UA 3TACA 3L8XA 2GS6A 2R3KA 3PY3A 4FT3A 4MF1A 4XOZA 4CEGA 4C35A 2XYUA 2PMIA 1UWHA 5CU2A 4EH3A 5AR4A 2W1DA 3FZ1A 2HZNA 4GH2A 4G6LA 4FSNA 4H58A 5EI2A 3B8QA 3EHAA 3ZU7A 3HV6A 4MBIA 3FMJA 1PXNA 4PMSA 5LARA 3V8WA 2OZOA 3E63A 3V6RA 1CMKE 3I1AA 5CSPA 4X7QA 1ZOHA 4FT5A 2WTKC 2VGOA 4TN6A 3VF8A 2C68A 3QA8A 4G31A 5HX6A 4PNIA 3O51A 1WBOA 3OD6X 2I40A 2QR7A 3C50A 3ZC6A 3DK7A 3DA6A 4TY1A 2VRXA 3IKAA 4KBKA 5FDXA 5B2KA 2BIYA 5J9ZA 4X6RA 4AOJA 2O8YA 4O4CA 1OM1A 3GCQA 4ZSJA 3V8SA 2XKCA 3FZRA 4GIHA 3ZO2A 5ANKA 3FLYA 3G9NA 3UODA 3G2FA 4FKTA 3MPMA 4QTDA 4FKLA 1UU8A 3R1NA 4FVPA 2IVUA 3I79A 4A07A 4A7CA 5AUTA 1FGKA 4IB0A 2O0UA 4EUTA 1OKYA 4MXZA 5BNJA 2YM8A 3OWJA 5HBJA 1FINA 1I09A 2C5OA 1XJDA 4EZ7A 3KRLA 1PYEA 2VO3A 4PWNA 4ANMA 3HEGA 2YIXA 5GJFA 3CLYA 3LIJA 2R2PA 4F7SA 3FKOA 2BHHA 1ZYLA 4TYGA 5J9LA 4JQ8A 5M51A 2OXDA 2XNNA 1OIRA 4EZ3A 3VJOA 3G5DA 4BHZA 3DLZA 3A4OX 2WTKB 4YHTA 3FMMA 2EUFB 1GIIA 3CJGA 2O63A 4PRJA 2C4GA 1XBBA 2X9EA 2UZOA 1OPLA 3OG7A 4IX3A 5LVNA 2WMVA 5TKDA 4EI4A 5CF5A 2RFSA 4B0GA 5J5TA 4NM5A 4YZBA 5JK3A 4K6ZA 3U87A 2QOFA 4UB7A 2FGIA 4W9WA 5CLPA 4I22A 3P08A 4XV2A 5FXRA 4O2ZA 4RQKA 5B2MA 4P7EA 4BZDA 2OU7A 4YGAA 3BGZA 1RQQA 2X9FA 4IM3A 1QPCA 3LQ8A 3HV7A 1Q8WA 2UW5A 2XEZA 2EXCX 3EYGA 3H0YA 3SC1A 3WIGA 2A1AB 2Z8CA 4FICA 2AC5A 4RWKA 2I0HA 5BX0A 4F0FA 3DDQA 4QPAA 2XF0A 3TIZA 5I4NA 3P79A 3RINA 3PLSA 3MFSA 3QXPA 3G51A 3THBA 4XEYA 4XYFA 4QMUA 4S30A 4A9SA 2WELA 2AUHA 2W9ZB 3KGAA 4XG7A 4F4PA 2C69A 3I7CA 3RHXA 1M7NA 3PE1A 2WHBA 3G90X 4PL5A 3RKBA 3UG2A 5CANA 4X3FA 4ZJIA 4HGLA 4UMPA 3E87A 4EJNA 4CVAA 2VTMA 4NFMA 5F94A 3UIXA 4C4JA 5FXQA 5LVPA 4HGSA 3S00A 4YTIA 1Q8YA 3GBZA 3KRJA 3OUNB 1UWJA 3LCOA 3W33A 1DAYA 3BHTA 2C6DA 2YDJA 2REIA 3LPBA 3ZBXA 4QQCA 4F9CA 4F7JA 2O64A 3DB6A 3DTCA 5F1ZA 5JGDA 4U97A 4KRDA 1X8BA 3BWJA 4C4FA 4ZOGA 4PNKA 3TZ8A 1OPKA 4M0ZA 2XK3A 4CV8A 2WMUA 1XQZA 3U51A 4BL1A 3MGYA 3NEWA 4LYNA 3QCYA 3O8PA 4P5ZA 4N6ZA 1JQHA 4YJOA 5H8BA 3R7UA 2QOQA 4WNOA 2VTAA 3AD6A 1CTPE 3R2BA 3VO3A 3ZSIA 4F7NA 2ZJWA 2X2MA 4R3CA 4L3JA 3VUMA 3MIYA 3R8VA 4D2TA 3DOGA 5AV3A 4YR8A 4G16A 1ZMWA 2X0GA 4C02A 3CGFA 4WNKA 3HDNA 5HVKA 4X2GA 1VR2A 4M69B 1NY3A 2YHVA 2W4KA 1E1XA 5I3OA 4AX8A 3QLFA 4CV9A 4GFGA 5H3QA 1LR4A 4ANQA 2YFXA 4ZP5A 5FG8A 1J1CA 2QLQA 3O8UA 3O7LD 5HLNA 3MVMA 2G01A 3OXTA 1OGUA 2F7ZE 2WGJA 3MH0A 1KE8A 3PZEA 1GIHA 5JKGA 2R3RA 3SXFA 3VWAA 4I92A 3R1YA 4FV1A 4I0RA 4XH6A 3VUKA 5AX9A 4EQUA 4DEGA 1ZMVA 1BYGA 3BU3A 4EEVA 4AW1A 3LFCA 3BHHA 5CWZA 3QQHA 4FG8A 4S32A 2RL5A 3F69A 2R9SA 3QX2A 3WZDA 2PVKA 2PVNA 4KRCA 2RGPA 2YWPA 4IFGA 4RGJA 4BGQA 3V5JA 4I23A 5CSXA 2O3PA 2ETKA 4CFXA 3GVUA 1CKIA 1AQ1A 2RFEA 5EKOA 3TL8A 5HNIX 3WF9A 4TWNA 2JLDA 2W17A 4GU6A 4Q2AA 5JMSA 4EH7A 1W0XC 4RVKA 4ALUA 2IWIA 3CQEA 2X8DA 3QQGA 1GZNA 1PYXA 2CHLA 3PP0A 4H1JA 4XCUA 3W2CA 4JQEA 4BYIA 2AQXA 3T8OA 4BDGA 1YI6A 4AGUA 3MV5A 3MWUA 4AQCA 4F1TA 3SW4A 4HGTA 4C4IA 5JSMA 4ZJJA 4U42A 2PMNX 4L45A 4DFNA 4RT7A 2WD1A 3G9LX 4QYYA 5GZ8A 4L8MA 5CSVA 4O0UA 4IM0A 3T9TA 1H0VA 2NRUA 5K0XA 4FL2A 2BALA 2CN5A 4O0TA 3BGPA 5LQFA 4YJSA 3CTJA 4BTFA 4DEIA 3O0GA 2FSTX 4FKPA 3FI2A 4J95A 2PHKA 4F63A 4IDVA 4ZY5A 1Y6AA 5BUEA 4USDA 4LM5A 4G34A 3FC1X 1K2PA 4RX7A 3DY7A 4H39A 2ZV8A 4UWBA 3RM7A 4BBFA 2O2UA 4QYHA 3V6SA 4GMYA 4Y73A 2BDJA 3RK9A 4B7TA 1XH7A 4FKUA 5IISA 5LWMA 4F7LA 2FO0A 1FMOE 2C6KA 2XZSA 4LGGA 4FZDB 4QMLA 3E3BX 3O2MA 4EOQA 4L6QA 3PJ8A 4IZYA 4R5YA 4CYJA 4E4NA 3R22A 3JY9A 4E6CA 5JGBA 3T3VA 2EWAA 3LXLA 4PDPA 5HG8A 4K0YA 3DCVA 2GSFA 2XNOA 4R3PA 5LVMA 2HW6A 2XIXA 2BDWA 4V05A 5AP7A 4YP8A 4UX9A 5BVDA 3F3TA 2FSLX 2WQEA 4ENXA 4QNYA 3OFMA 1OPJA 3MTLA 3PSBA 4IB3A 4QMNA 4GVJA 1SVGA 4RWLA 3IW8A 5LVLA 4AZSA 2PL0A 3IO7A 3Q4ZA 5DFPA 3ZDIA 3A61A 3NCZA 1HOWA 2AYPA 1NVRA 4W4XA 2W05A 4XP2A 2I0YA 4FTRA 2NP8A 2QHNA 3Q9XA 4G3DA 3SRVB 4ZLZA 5CU0A 4RZWA 3JVSA 2OH0E 3ZRMA 3FLSA 4AZFA 3LLTA 3Q9WA 3VC4A 1P14A 3WYYA 1XBAA 3HRBA 4QP2A 3NLBA 3O8TA 4DFLA 4FV3A 3CE3A 2G9XA 4GG7A 4BIDA 2CGVA 4DGLC 2XK4A 3NSZA 4CKJA 4OAVB 2E9OA 3KXXA 4DH8A 3F5XA 3F3ZA 2WU6A 4YJTA 4ALWA 5JN2A 4E4LA 5CT7A 2JKOA 3TJDA 5L4QA 4QMWA 3ZONA 2B55A 4WUNA 1TQIA 2IZRA 3MJ2A 4JIKA 2IW8A 4FC0A 3RWPA 1ZXEA 3C4XA 5A4EA 3CY2A 2YN8A 3II5A 4FNXA 3COMA 3RHKA 2GU8A 4DG2E 5CEKA 4TNDA 3R8UA 5LCJA 4EBWA 2X7OA 4PUZA 2VTJA 1ZARA 3E93A 4C57A 4GFOA 4FV6A 1UV5A 4WG3A 3LHJA 1CM8A 4RWJA 5IA0A 1E9HA 1UKIA 4GW8A 4JI9A 3NW6A 5KMLA 5CQUA 4KSQA 4EQMA 1UNLA 4MK0A 4IIRA 2A98A 3ENHA 5I9XA 2XEYA 2WMWA 3PVUA 4RJ8A 3KMWA 2XJ2A 3R71A 5AP3A 2ZV9A 3QKMA 3P9JA 3R21A 3KF7A 3O17A 5JZNA 3W32A 3E3PA 3L9PA 4OUCA 5I9YA 4WIHA 5IA2A 3DXNA 4NKSA 3WARA 5AR8A 4GG5A 4JBVA 1SZMA 3LXPA 4O27B 5KMJA 5EM7A 3RZBA 3HMPA 3GFEA 2WMRA 4FV5A 4XUFA 3VVHA 4ASXA 2YCQA 3D15A 2J0JA 3NYNA 2OXYA 4D4SA 4BF2A 5J8IA 3H4JA 1JBPE 3LFAA 3UQCA 5TT7A 4C8BA 4H3PA 3QFVA 3OOMA 4GIIA 3U4WA 3ZS5A 3Q2MA 1H28A 4G3FA 1M52A 3VS1A 3ITZA 1UNGA 3R7VA 5AP1A 1OUKA 1OMWA 2FA2A 4O4EA 4PPCA 3SXSA 5AA9A 1W84A 1OITA 2XMYA 3DV3A 3TV4A 1PXKA 2XK9A 2O65A 2OJFE 4JG6A 5EYDA 2OICA 5HCYA 3F66A 3D14A 4YZCA 4BI0A 4JR7A 4IHPA 3O23A 4U41A 4F6WA 2EXEA 4PTEA 4F9AA 4HNIA 4CRLA 3RZFA 2BFYA 5C01A 4D5HA 4DLJA 2ETRA 3BU6A 5IUGA 2V55A 3WE4A 3TV6A 2Y4PA 2WQBA 5JRSA 4PF4A 2UVYA 2J90A 4Q5HA 3RNYA 4D9TA 4FTNA 5FTQA 3WI6A 4XLIA 4CNHA 1VZOA 1GNGA 4OTPA 5TR6A 3V5QA 4AA0A 3TKUA 3TZMA 5ANOA 3WE8A 1JSUA 2JFMA 5IH6A 2X0PA 4Y95A 1H8FA 5CNNA 2IEWA 2VU3A 3JXWA 1M14A 3DJ7A 2OJIA 4BKJA 4I6QA 1H4LA 2VWVA 5IKWA 3P5KA 4G3GA 5L8LA 5AADA 1PMVA 4QOXA 3QKLA 5CEOA 3O96A 3FQEA 4A9UA 3LMGA 4RMZA 4MD7E 3EL8A 2QOIA 3U4UA 1BL6A 5E8SA 4KINA 1CDKA 4ZTMA 4ID7A 5C26A 4YSMA 4HNFA 4HZSA 4FTAA 2GNJA 4P5QA 2C0TA 3F5GA 4QMZA 4XRLA 5ANIA 4EORA 3BHYA 2X39A 3LFEA 3ZCLA 4JLCA 5FD2A 1WCCA 5CF6A 2QKRA 4ACHA 2VNYA 3NNXA 4AXAA 3Q32A 3OW4A 3CTHA 3S95A 2VD5A 4IE9A 2OIDA 5JFXA 2VTNA 4WSQA 3FKNA 3JVRA 2UW7A 5HESA 2QURA 1HCLA 4RRVA 1P5EA 3QTQA 4FBXA 4R7HA 4AT4A 2F2CB 5JGAA 2ZDTA 3P78A 3NNUA 4KIKB 5GZ9A 2XNBA 4QTAA 3AT2A 2OJ9A 3GQIA 3L1SA 4WRSA 5EI6A 3VAPA 2C6MA 2ERKA 5IDNA 2DWBA 2VO0A 2WTDA 3AMBA 3E5AA 4YLJA 3TTJA 2JGZA 4XP0A 5TOZA 3RVGA 3QL8A 2C6IA 3ZXZA 1Y6BA 2VGPA 4CT1A 2X7GA 4HCVA 4RC3A 3HV3A 4X2JA 5CVHA 1ZYSA 4TKSA 4IAKA 4TZRA 5FP6A 4O0YA 5ANDA 2GTNA 3FLQA 5CI7A 4YO6A 4IFCA 4AACA 2W1ZA 2ZVAA 1JKTA 4RC4A 4ASDA 5L2QA 3IQ7A 2ITVA 3H9OA 4I3ZA 4XMOA 2ZOQA 4NT4A 3SHEA 4HVHA 3V5PA 4J97A 4U44A 2CLQA 3ZO1A 3KK8A 1YDRE 1IRKA 3OTUA 5E91A 4I24A 4HPUE 4U7ZA 3DAJA 4WNMA 2HZ0A 2JBPA 3F2NA 4GV1A 2XB7A 4EBVA 3AT3A 2HIWA 3UNZA 4BN1A 5TF9A 2QR8A 4UEUA 3UC4A 2BRHA 2BTRA 2XKEA 3OUKA 1LUFA 2YM3A 4DH3A 4EYJA 4ZZOA 3OT8A 5AR7A 3KRWA 4X2NA 2XBAA 4L53A 3K5VA 3R7GA 2PE0A 1ZYCA 3OWLA 3OWKA 2B7AA 1W7HA 4ENYA 4ARKA 4EYMA 3EIDA 5AX3A 2IZSA 1H25A 5CALA 5KMNA 4AS0A 1Q61A 2QD9A 2QODA 3B2WA 4GJ3A 4A4XA 3OBGA 4LOPA 5GZAA 5IEVA 1GZ8A 5BMSA 3Q3BA 4GT5A 3TNHA 3KKVA 3NIEA 4CSVA 1GAGA 3F82A 3TV7A 5ETAA 2JDRA 2RKUA 4J1RA 5ETIA 1CKPA 3OZ6A 1M2PA 4FOBA 4N0SA 4R8QA 5L3AA 3TNQB 1R39A 2R5TA 5H8EA 2W96B 3GC8A 4TTHB 3I5NA 4YZDA 1TKIA 2BROA 3GGFA 3QRUA 5GNKA 3PPKA 3FPQA 1XO2B 3FMLA 4KA3A 3RAIA 3W2PA 1Y8GA 3EMGA 4D0XA 1ZYDA 2XJ1A 2B1PA 4D2SA 4DGGA 4YJNA 1Q24A 5J95A 5BPYA 5EW8A 1LEWA 4UXQA 4JR3A 2I0EA 4L3LA 4JBOA 2ACXA 4C3FA 4F1MA 4AFJA 4CCUA 4HCUA 1PMUA 2ITOA 4RJ3A 2UZDA 1R78A 4FMQA 4WT6A 3SW7A 5AUWA 4FSYA 4IMYA 4E4MA 4CZTA 3HECA 4Q5EA 5E8XA 1PXLA 4O4FA 5LWNA 5M44A 1JKLA 3VRZA 1ZY5A 4XV3A 3SD0A 3I6UA 2QOOA 3C4ZA 1YHSA 3COIA 4CQEA 3GUBA 3PJ1A 2C3LA 2R3JA 2JITA 3F7WA 4QQTA 3R7YA 4EH4A 5AP5A 1JVPP 1YHWA 4E4XA 1KWPA 4U40A 3HX4A 3FZPA 2CN8A 1YW2A 4BC6A 4NM0A 5HBHA 5AUUA 2GTMA 3LFDA 5CI6A 3PXZA 2F2UA 5EYMA 4DH1A 3GCPA 3PJ2A 4GUEA 3G6GA 2V7OA 3UO6A 4JX7A 2BMCA 3R02A 4AG8A 3O71A 3QHRA 2C47A 1OUYA 2R3GA 4KABA 5CF8A 3CJFA 2OBJA 3OEFX 2PE1A 2ZV7A 2HYYA 2V62A 3LFQA 2ZYBA 4KAOA 5A54A 5KKRC 3MVHA 4YZ9A 3ZLSA 3DLSA 3FE3A 2VTLA 3UOHA 3C5UA 1PXIA 3GEQA 3D0EA 4UMQA 3BBWA 1XWSA 2R64A 1QPJA 4Y46A 4FZFB 5HOAA 2GMXA 3QUEA 3WZEA 1JAMA 2WTIA 4RA4A 4LGHA 4RFYA 1XH9A 1R0PA 4RJ6A 1ZAOA 2GNHA 3NWWA 4I5HA 4MAOA 4C61A 3Q5IA 3VIDA 4HYHA 1JWHA 4UZHA 2QONA 4NU1A 3MS9A 2B52A 5EOLA 4XG8A 3BQCA 3R0TA 4JRVA 4QTCA 2A2AA 5HICA 2UV2A 4PTCA 4EOOA 1ZWSA 2A4LA 1YXUA 5BQ0A 4QP4A 2UW3A 5B2LA 3FLWA 2BZIB 4L7FA 3MVJA 4AE9A 2Y6OA 4AOTA 3NGAA 5EW9A 4BHNA 2DS1A 3AC4A 3ORTA 4EKKA 5CY3A 3JYAA 5CVGA 4IANA 5IA1A 4XBRA 2Y6MA 3GU6A 2OGVA 3KXHA 4IBMA 3QKKA