4BKZA

Crystal structure of unphosphorylated maternal embryonic leucine zipper kinase (melk) in complex with a benzodipyrazole inhibitor
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
333
structure length
309
Chain Sequence
KDYDELLKYYELHETIGTGAKVKLACHILTGEMVAIKIMDKNTLLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCASLAYAAPELIQGGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MATERNAL EMBRYONIC LEUCINE ZIPPER KINASE
publication title Structural Insight Into Maternal Embryonic Leucine Zipper Kinase (Melk) Conformation and Inhibition Towards Structure- Based Drug Design.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 309
sequence length 333
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2013-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4bkzA00
2CCHA 4RA5A 2WPAA 4QP3A 4NTTA 1U5RA 3D5VA 1APME 2C69A 3MI9A 4D9UA 4D58A 4PMPA 2IW6A 3COKA 4OTRA 5F4NA 3SKCA 4A4LA 1GZOA 5IH4A 3CD3A 4FKUA 1ZOEA 3QC4A 4X2KA 3Q9ZA 1A06A 1Y8GA 2YN8A 4RZVA 4EKKA 4PTGA 4E4NA 4CYJA 1P4OA 3O0GA 4ACDA 2C47A 2A2AA 3CTQA 5LMKA 4WG5A 2X8EA 2R3MA 3QTRA 4J71A 2ETKA 3HUCA 3TEIA 4E73A 3I81A 3BGQA 3VJNA 2F7EE 5LCJA 2YCFA 4RLLA 3H0YA 3EZRA 3AC4A 4BYJA 5IPJA 4WSQA 1FMOE 3P7BA 4IX5A 4HCUA 5DT3A 3WILA 3EWHA 2OU7A 3HEGA 3UVQA 3VHEA 5IUHA 3LFEA 5ETFA 2VGOA 1U46A 1SMHA 2CN5A 3QRUA 4QTEA 1PMNA 1WBWA 4C36A 5HIEA 5A3XA 2QLUA 3TXOA 2XRUA 2W17A 3NIEA 5CF8A 1LP4A 2QOKA 3KRJA 5IG1A 2C0OA 4FL2A 4XHKB 3IDCA 5FBOA 5AAFA 4GYIA 4BCFA 1R0PA 2ETRA 1YI4A 4CNHA 2XRWA 3ZC6A 2F2CB 3D5XA 2WTKC 4A4XA 5AP1A 5IMEA 2C0IA 3I1AA 3QBNA 3BEAA 3VN9A 5A14A 2GNFA 3ORMA 4G6LA 4JR7A 4FT3A 3LFNA 3MVLA 3VF8A 5AUZA 4WT6A 5CNNA 3WE4A 2W0JA 2PMNX 5D10A 4ZZOA 2GNGA 3PA3A 4DBNA 3VUIA 3UVPA 5HEZA 1Y91A 2YM8A 3FKLA 4C62A 4YBKA 2O65A 2CPKE 3CR0A 3KULB 3IECA 1M7QA 3P7CA 4E5BA 4E26A 2X7GA 3KULA 4RG0A 2X2LA 4OAVB 3OCBA 3PSDA 1GIHA 1JLUE 4DGNA 3NYOA 3TZ7A 3PE2A 1YDSE 3FXWA 4YZMA 4IVCA 4CQEA 4F0IA 5ANOA 2WAJA 3G9LX 1E1VA 1YXTA 5EM6A 5C26A 4DEDA 4BCPA 4BDFA 3E63A 3QRTA 1W7HA 2WQOA 3GCUA 1MUOA 1OMWA 4I0TA 2UZVA 1JKSA 5DI1A 4K0YA 4ONAA 4EZ7A 4CKRA 5EHOA 4GK4A 3GGFA 2BZJA 3QD0A 3S4QA 3TJCA 3ZLWA 3ZLSA 2IWIA 2J5FA 3KXZA 3CS9A 3ET7A 3QHWA 3FMLA 4DGLC 3NS9A 3F5UA 4OTWA 5HOAA 4BZNA 1ZMUA 5ANDA 3ZS5A 1SYKA 2CLXA 3NNWA 3BLHA 3R7UA 4C38A 4C4EA 4PPBA 4M15A 3DFCB 4IWQA 5HU3A 1NVRA 2XK8A 2OJGA 3Q04A 4Q5EA 3W2SA 4IW0A 4X21A 2FVDA 4UYNA 5GZ9A 3WBLA 1UVRA 5FP5A 5LXMA 1FVRA 3VBWA 5HO6A 5HTBA 3MIAA 4LV5A 2OJFE 3OD6X 1UV5A 1ZRZA 3KXHA 3OMVA 3PUPA 2H96A 3DS6A 3QQGA 5I9XA 4FZDB 4YTHA 3R7YA 4KKGA 3GFEA 5JK3A 4F9BA 5FQDC 4U41A 4Y8DA 3VC4A 2OIQA 3LXKA 4IX6A 4C37A 3MTLA 4IVAA 2ZM4A 4BGQA 1J3HA 1QCFA 2OFVA 4FSWA 2YIYA 2Y4PA 4RC3A 4AS0A 4GFMA 2GHMA 2Y8OA 3SXSA 2BZHB 2PK9A 4FKQA 4IAFA 3ZYAA 4EH8A 3OHTA 3DJ7A 3PPZA 2I0HA 5JFXA 4RSSA 4RX7A 4PDSA 2P55A 3WYXA 5BVKA 4AAAA 3NUUA 2VAGA 5FRIA 3P23A 4G9CA 4JAIA 3LM0A 5JZNA 3NUSA 5AR5A 3O7LB 5LVLA 2HXLA 2R7BA 4RPVA 1TKIA 4AN3A 2AC3A 4KKEA 5HICA 4AZVA 1L3RE 2R3LA 4G17A 4I22A 2PVMA 2RFSA 2OBJA 4J96A 3A8XA 3FYKX 2JFMA 5HESA 2W1ZA 2C3KA 1UWHA 2C1AA 5J1VA 2OXXA 1XH7A 4E6CA 3D9VA 1DAWA 4NUSA 2RKUA 4GVJA 4BRXA 5FEEA 5HE1A 1RW8A 3MVMA 2WMUA 2OO8X 2VUWA 4TW9A 3AC3A 3ZXZA 4JVGA 2ZB1A 2GNJA 5E8WA 3R22A 3WZUA 4KIQA 1YQJA 5BUIA 4WOVA 4DG0E 4P90A 3KXGA 3FQSA 4UZDA 4QPAA 1R39A 3NNXA 4PP9A 4IANA 3FMHA 4QTBA 2DWBA 4F6UA 4NJ3A 3F5XA 3D0EA 2XEYA 4FIJA 4FT0A 3VW8A 1OIRA 4D4YA 3PA4A 2VNYA 4E93A 4RFZA 4WIHA 4DCEA 3KEXA 4L8MA 3UO6A 4F1TA 2Z7RA 3G33A 4NCTA 3II5A 4AZSA 3UDBA 2XH5A 2R0IA 4ACGA 1KE8A 4MK0A 4RIYB 2PE0A 3MVHA 1CMKE 5LMAA 4FODA 3KF7A 3CPBA 4S34A 4O22A 1DS5A 4EOMA 2XYNA 1PXIA 4RIYA 5BVWA 4RX5A 4UBAA 3ORLA 5AUUA 2AUHA 2XKFA 4CFVA 4EJNA 4IJ9A 4JG7A 3BIZA 1OUKA 2R3IA 1OKWA 3QX4A 2YERA 5HX8A 5TF9A 3LFCA 5AIKA 3ETAA 3HKOA 4QMXA 5DRDA 1QPCA 5ETAA 4APCA 3TV4A 4AT4A 2BAJA 4RJ7A 4CLIA 4CT1A 3NYVA 4USEA 2BTRA 4N4SA 4ZTNA 5A4TA 3GI3A 2R3NA 2BTSA 3E92A 5EM5A 2IZTA 5BPYA 4F99A 4KINA 2XIXA 5JRSA 3FLZA 2XA4A 3EL8A 3Q4CA 4H3QA 3GOPA 4HNFA 4DN5A 2H6DA 3ALNA 3OUNB 4IDTA 3UIBA 1VZOA 4L68A 3UG1A 5E8YA 5CU4A 4OW8A 5IISA 4RQKA 4G3EA 4QRCA 5DT0A 4FV5A 2OXYA 4H1MA 4I24A 3ZRLA 1WMKA 3K54A 5K3YA 4FC0A 2ITTA 2JD5A 4FZ7A 4IC7A 3FLSA 3I5ZA 2QI8A 5DG5A 1PHKA 5AM7A 3G90X 5AUVA 1CKPA 2XB7A 3E3PA 2R3KA 3PVGA 5FEQA 4RVKA 4ALUA 5DR2A 4GYGA 3BELA 4WA9A 4MEDA 4DGMA 1WFCA 5BVFA 3F82A 5IZFA 3R00A 2VWVA 3FL4A 3FMEA 4NKAA 2X6DA 3MA3A 4MWHA 3C0HA 5HCZA 4QQTA 4JX7A 5JT2A 2BZIB 4S30A 2F9GA 4QTAA 2XJ1A 5CI6A 3QXOA 3WI6A 2VWIA 4TTHB 2QR7A 4P4CA 1J91A 3QU0A 4GG5A 3A7GA 3OCTA 1PF8A 3BQRA 2XCHA 4D1ZA 4RC4A 4FR4A 4ITJA 4ZTSA 4ENYA 4YPSA 3R7EA 3SXRA 5J87A 4MKCA 3VS4A 4HGLA 5LARA 3ZZWA 3LW0A 3DOGA 5AV0A 2OG8A 5AA9A 5HE3A 5IEYA 1H01A 3HA6A 4BCMA 5LVNA 1Z5MA 1SNUA 2JBPA 1PXKA 2P4IA 3DLSA 4FSUA 4G1WA 3UNJA 5A9UA 4Y46A 4ZLYA 2RL5A 4G9RA 4KB8A 3H9FA 3EQDA 4DGGA 5BVOA 4WD5A 5HZNA 3CCNA 2QCSA 3IW5A 4ZLOA 4YURA 4LGHA 3ORXA 4G2FA 3MY5A 1Q8ZA 4BCOA 1G5SA 5D11A 4ZK5A 5BX0A 1ZARA 3UJGA 3ANQA 4MXCA 2VWBA 3OTUA 1S9IA 2W06A 3GU8A 3U6JA 4MBLA 3ZMMA 3F7ZA 4TWCA 4AG8A 5CEOA 4Z7HA 4F9AA 3MB7A 2UW7A 4MXZA 1UA2A 4IFGA 4Y83A 3C5UA 3F66A 4EZ5A 4CCBA 3HV5A 3LM5A 2WEIA 3V01A 4ZSAA 4I6HA 2DQ7X 3SOAA 2W05A 1YVJA 3VULA 4CZTA 4D2TA 4I0RA 2NRYA 3W2PA 3W8QA 2PVRA 5IA4A 2WTIA 3VBVA 2V0DA 3PY1A 3HRCA 1IASA 3H3CA 3G6GA 3OTVA 4L53A 4FIEA 5FP6A 4BCGA 3T3VA 3H10A 4YZCA 4YJUA 2C6TA 3RWPA 3DAJA 2XJ0A 2YDJA 4KA3A 1JWHA 3G0FA 3R71A 3VIDA 5G1XA 4C61A 5HBJA 4BI0A 3KXMA 2UW4A 2XNGA 2VX0A 4U0IA 2WD1A 1XHAA 3UOKA 5J9LA 4ZXTA 4R7HA 3QAME 5AMNA 2BDFA 2VTMA 3MH3A 3UPXA 5EW3A 4BB4A 2Y7JA 5HE0A 4O0XA 4AOIA 2DS1A 4UX9A 5I3OA 1ZAOA 5AP0A 2QR8A 4JRNA 1OM1A 2PTKA 3MVJA 3TV6A 2GNHA 4XG2A 3OOMA 3U9CA 5BVDA 2UVZA 4RJ5A 3WF7A 5KMJA 2C6MA 2UZEA 3PIYA 1XH5A 5HI2A 3GVUA 4QP4A 4GVAA 4PF4A 5KMIA 3GU5A 4KS8A 1P5EA 4CXAA 4ANNA 1YWRA 3CQWA 4RVTA 2XK9A 4G34A 4DEAA 5CAVA 1Q5KA 1YHVA 4XBUA 4HCTA 5DGZA 4GJ2A 5HHWA 3W1FA 4ARKA 2YHVA 4ANQA 4DH7A 4L44A 2WQMA 3KC3A 3QQLA 4R1VA 4EOKA 2ITUA 5KHXA 4FNZA 2QQ7A 3AG9A 4EHEA 2HELA 5GJGA 3KMWA 5T3QA 5HVKA 4M69A 2JKMA 2J90A 4NFNA 4ZTRA 3AT3A 2CGUA 4M97A 4O2PA 1FGIA 4GK3A 4MD9E 4CT2A 5KE0A 3NCGA 1YHWA 2ZYBA 4D4SA 5KO1A 3KQ7A 3QQFA 2QC6A 3QUEA 2E9PA 4FUYA 4YHJA 2VWXA 1IRKA 3QF9A 3AC1A 3ZZEA 2VTOA 1SVGA 2HW7A 3OY3A 5M56A 3QCSA 4B9DA 4BTMA 1VJYA 3M42A 1BYGA 4Q9ZA 4FZAB 3TZMA 2XNMA 2IZUA 4BGHA 2BUJA 1A9UA 3EMGA 3MPAA 5C03A 4YZBA 2PVLA 4YTCA 1KE5A 2O8YA 3OEZA 1XJDA 4LRMA 3RPSA 1PMUA 4FTRA 2WTDA 1FOTA 5L2SA 2JITA 5JKGA 4BBMA 4CFNA 5AP4A 2Z7LA 1V0BA 3IOPA 4O38A 3BQCA 3FSFA 4LFIA 3CTJA 4J8NA 5EHLA 4BCJA 5AADA 2J51A 4GU9A 3O2MA 1OITA 4GV1A 3TTIA 4BICA 2F57A 1MRYA 4TWOA 3R7VA 1JOWB 3WZEA 2QOOA 3TZ8A 3DT1A 4W9XA 3HMOA 5IF1A 2X2KA 1URWA 2XK7A 4L7SA 1MQ4A 3BYSA 4MCVA 4G3DA 1M2RA 1M17A 2XVDA 1VYZA 4PDPA 2XK6A 4YBJA 3VS0A 4C8BA 3FMJA 3Q53A 4X3FB 4O0YA 1TVOA 1LR4A 4JDKA 3FPMA 3MPMA 4R7IA 4FL3A 2ITWA 3TNWA 4X3FA 5I3RA 4UMUA 4ZTHA 4D4VA 2FO0A 2GPHA 2EVAA 2GMXA 4EUUA 4GFGA 4CRLA 2ERZE 4DEHA 3QRJA 1W83A 2QONA 1M2QA 5CT0A 3Q9YA 4XG4A 5AV4A 3MYGA 4LQMA 4HVHA 3I5NA 4BKZA 4E6AA 3VRYA 5IEVA 3TUCA 4FV0A 4IE9A 4H3BA 4BTFA 4M14A 4YUQA 1H4LA 4Y5QA 5C9CA 1CM8A 3KMMA 5HD4A 4D2PA 2XYUA 5DVRA 5TE0A 5IH6A 2WMQA 3EQPA 3C4FA 5J8IA 4FMQA 2IZRA 4C2WA 2PZPA 2BRBA 3BYUA 4JS8A 4Q9SA 4QMUA 4BZDA 4EH6A 1CDKA 3LJ2A 4S33A 5K5NA 2R3QA 3SA0A 2YDKA 5H8BA 4RFYA 5DN3A 4H3PA 2WB8A 5JGDA 3CTHA 3R73A 2BDWA 3PIZA 5CTPA 5CT7A 3RWQA 2A1AB 3MPTA 4IAIA 3UODA 3F3UA 1KE7A 3Q6WA 1H0VA 3TNHA 1BUHA 1URCA 3I0QA 3OW3A 2QOIA 4O6EA 4AACA 4KRDA 3NX8A 3PXZA 3W16A 3A7FA 3G2FA 4FOBA 3EQBA 3VAPA 3D94A 4HZRA 2G2HA 4L43A 4NKSA 3ZONA 5D7VA 5IA0A 4TT7A 2PL0A 4E1ZA 2OJJA 3VBXA 1V1KA 4LV8A 4AZWA 1ZZLA 2JDVA 3C51A 3NAYA 2PE1A 4FVPA 3UYTA 2XK3A 4I5HA 3U6IA 3UC4A 2XMYA 4U40A 4N0SA 5CSVA 5HG7A 1VYWA 2Z8CA 3B2TA 3WOWA 3F5PA 5L2WA 3GC9A 4CMOA 4MF0A 4DYMA 4TY1A 3ZLYA 4XJ0A 4EQMA 4QMYA 3DFAA 3Q4UA 5AX9A 5IEXA 3DBCA 1ZWSA 4C4FA 2GS6A 3Q9XA 1PYEA 3V5LA 2E9OA 2J0LA 3NUPA 1XH8A 3PWDA 2IW8A 2UZNA 2JKOA 4BCHA 3PJ2A 4YO6A 4CEGA 3R9DA 4TYEA 2ETMA 3ZFXA 2W4KA 2FYSA 4NM0A 4WO5A 2WMTA 4NU1A 4BCIA 4I20A 3F2AA 3PP1A 4EONA 4FT9A 4UV0A 4CV8A 4FZFB 4TZRA 3MSSA 2YLEA 3NYNA 1DAYA 2W9ZB 3G6HA 4LL0A 2OWBA 4FZ6A 3K3JA 4QQCA 5CI7A 4BF2A 1KOAA 4QT1A 4E3CA 3BHUA 3UIXA 2C5NA 3TL8A 3AT4A 4ZY4A 3DK7A 4XP0A 3FJQE 4UALA 3CE3A 5CZHA 3RINA 4JIAA 3R83A 4AA5A 5BVNA 4K11A 4XS2A 5E90A 4ZOGA 3O8PA 3C4XA 3LFSA 4FX3A 3VS6A 4E6DA 4UXQA 3P1AA 5L3AA 2GTMA 4IZYA 3UIUA 3DA6A 3FAAA 2QOLA 2VO3A 3FHRA 2VTAA 3OT3A 4OLIA 5KZ0A 3TZ9A 4LRKA 2UUEA 5M44A 3KK8A 2ITPA 3A7HA 4U79A 3OEFX 4AF3A 4DTKA 4B99A 4QMVA 5IUIA 4FNYA 4M66A 5DOSA 3KXXA 3R2BA 5AA8A 4IM0A 3F7WA 1OPJA 2WIHA 3GC0A 3MTFA 5FTQA 4BIDA 5LQFA 1ZMWA 4QPMA 1S9JA 3LXNA 1PW2A 2WTCA 3OWKA 4NW5A 4C3FA 5L2QA 3S2PA 3R6XA 4MHAA 4ERWA 4J52A 4YJQA 4CFMA 2QURA 2B7AA 3LCTA 3QTUA 4AP7A 2QOQA 3F3ZA 1WBTA 4V01A 2JIVA 2RSVA 3FMDA 4FUXA 4EOQA 5IA5A 5FLFA 4Y73A 4AA0A 4EHZA 3ZCLA 4ASEA 4B8LA 2FH9A 4UEUA 5DT4A 1Q8TA 2Y6MA 1UU9A 3KXNA 2VTRA 4XH6A 5GNKA 5I4NA 3ZM4A 4I4FA 1GZ8A 4RVMA 3SD0A 1JKKA 1OKZA 1QPDA 2WMVA 1Y57A 4QTDA 5FD2A 5K0KA 3ACKA 4KNBA 4AGUA 2JGZA 5L8KA 5DHJA 3TWJA 2HXQA 1H1RA 2R3JA 3P08A 3DKFA 3C0GA 1Q62A 4MNEB 4QTCA 3BYVA 1GIIA 2HY0A 3HDMA 4NZWB 5HBEA 3PZHA 2W99B 3QZGA 4FV4A 4NWMA 5CU3A 3P79A 3WZKA 4ANOA 4ENXA 5I9VA 4OGRA 2HYYA 4MNEA 4I4EA 3IDPA 3F5GA 2PVNA 4OTIA 4AOTA 3C4CA 3JY0A 3E7VA 2NRUA 2YCQA 4FV9A 4O0WA 3K5VA 4ZSLA 2RG5A 5CXHA 4TNBA 4PL4A 4FKRA 4MAOA 3NPCA 3D5UA 3RK5A 1XWSA 5CU2A 4QYGA 5HNBA 5E1SA 5KZIA 4YP8A 2YLFA 3QA0A 4I6BA 4XLIA 4YJSA 3ELJA 4HVDA 2UVXA 2FSTX 1YOMA 2C30A 1K2PA 2BCJA 2BRNA 2PMLX 5B2MA 5JQ5A 3L9PA 4DEGA 5LMKC 3DB8A 3I7BA 5A6NA 1JSUA 4JQ7A 5L8JA 3CEKA 3DKGA 2Z2WA 4AGWA 5HG8A 2H9VA 2W7XA 4WG4A 5CENA 3UO4A 2EXMA 4L3LA 5ETIA 2VX1A 4ZP5A 4RBLA 1XBBA 3I7CA 4PL5A 1BX6A 4AW1A 5A4CA 4CFFA 1Q8WA 4GUBA 5HIDA 4S2ZA 3ODYX 4JXFA 4NM3A 4I6QA 4LGGA 4A9TA 3MFSA 3ERKA 4B6LA 4F9YA 5HTCA 3UOJA 2JAMA 3IDBA 5IMXA 1T46A 4B8MA 3DBQA 2XNBA 3AGMA 2PHKA 4BTKA 5DH3A 3E3BX 1CTPE 1YI6A 3CKXA 2PMIA 2C5YA 4O96A 4IWOA 2QO9A 2X6EA 4KIPA 4IDVA 4GSBA 3ALOA 2R3HA 5HG9A 3KK9A 3AC2A 4Z3VA 4ZJVA 4L46A 5J95A 3LCKA 3R9HA 4U8ZA 3GCSA 3W2CA 4IAAA 4YJRA 3TKHA 4F0GA 1XO2B 2I1MA 3AD4A 3CIKA 1M2PA 2HY81 2ERKA 2WZJA 4BDCA 4FV8A 5C1QB 4QMQA 4ZSGA 3AQVA 3SVVA 4J99A 4LOPA 4TKSA 3V5QA 5AR8A 3WIGA 4R3CA 3FMNA 3UOLA 2I0EA 4R5YA 4BIBA 5AV2A 4AGCA 3Q96A 5LWNA 3R28A 1OVEA 3FPQA 4J8MA 3BU6A 3MH1A 3AT2A 3OXIA 2WU7A 2PVYA 2YIWA 3NLBA 3ORKA 4J53A 4R8QA 3QWKA 3ZRKA 3LQ5A 1MQBA 4FV2A 3RK9A 3UGCA 3P78A 4PPAA 4YMJA 2A4LA 2C6KA 2P0CA 4N70A 2CMWA 5CEMA 5KBRA 4FTIA 2O0UA 2EXCX 3C9WA 4AW2A 1SNXA 4IAZA 5DNRA 4I41A 2UW6A 4LUDA 4CMUA 5EKOA 3DK3A 1GOLA 3LMGA 2BRGA 2R3OA 4AN2A 5IKWA 4U3ZA 5D9HA 4CFXA 1ATPE 3AD6A 1QL6A 4BTJA 4IVDA 4EC9A 4WNPA 1SVHA 2QVSE 4FKIA 3S00A 3NSZA 3PXQA 5AR7A 3OP5A 3L8SA 1Y6AA 5CSXA 1T45A 3L9MA 3FY2A 2XBAA 1O9UA 4UMRA 3H0ZA 3IG7A 3V8TA 4C4IA 2UW8A 5LCKA 2XJ2A 3SW7A 1KWPA 2GSFA 3IOKA 4MXYA 5BNJA 4AGDA 1GZKA 3EQCA 5I9YA 5IDPA 5AR4A 5I9UA 2BHEA 5HLWA 4O0TA 2BR1A 3QYZA 3ZUVA 5EYCA 5AUTA 4O0VA 2O3PA 3TJDA 5G6VA 1IR3A 4C4HA 2WKMA 5BMSA 2X2MA 4E5WA 4USDA 1UNGA 2YITA 3Q52A 1RJBA 5CSWA 3DQWA 3KA0A 4D9TA 4LOOA 4C58A 2X9EA 3PVBA 3QZIA 4KIKB 2OIDA 1WBPA 3MDYA 5TT7A 4EH9A 4FOCA 5HX6A 1REJA 3LXPA 4XNEA 3G9NA 4HYUA 2B53A 4KIKA 4R6VA 3CJFA 4QYEA 5T6KA 2WFYA 3IQ7A 3QKKA 5AUWA 4EK4A 2RIOA 4H58A 3Q2MA 4YLKA 2RF9A 3Q4TA 4O27B 5D1JA 4B0GA 5LVMA 4YC6A 3A99A 3AD5A 4XG9A 3ORNA 3RM6A 5AR3A 3ROCA 3VS1A 4BBFA 4EK8A 3GC7A 2O64A 3BU3A 4B7TA 3GQLA 4DAWA 1H28A 3OY1A 4QMWA 4XOZA 5EI2A 5FXQA 3EHAA 3VBTA 4L00A 2XK4A 4YR8A 5CEIA 1WBVA 4JBVA 4FV3A 1R3CA 3TV7A 4DH3A 5B0XA 4EZ3A 5A4EA 2UZLA 3EQHA 3R1YA 5HG5A 3QZFA 3OZ6A 4WSYA 2BRMA 3ODZX 2QO7A 3DGKA 4W4XA 4YSJA 3UNZA 4EBVA 3QQJA 4ZTMA 4JDIA 2QHNA 5J5TA 5CNOA 3I6UA 2BZKB 1M14A 5FG8A 4GIIA 4D28A 1P2AA 3C4ZA 2QOBA 4FTNA 4BFMA 4BN1A 2X8DA 4QP6A 3W55A 2ZJWA 2W4JA 3QRKA 3V04A 4FSTA 4YPDA 3VS3A 5JSMA 4JLCA 2VD5A 4P5QA 2GS2A 2P2IA 1QPEA 4U6RA 5B7VA 3B2WA 2R3PA 3PA5A 1JNKA 1OPLA 4O0SA 1AD5A 4R3PA 3PJ8A 2PVJA 4HGTA 5IH5A 3CY3A 3E8EA 1O6LA 4AN9A 4U7ZA 4C4JA 1X8BA 4FTLA 2OKRA 2RFDA 4GU6A 4JL9A 2JFLA 3R7OA 1DI9A 4NCTC 4YHFA 2HWPA 3NW5A 2G9XA 3FQHA 4U43A 4X6RA 4FTJA 3SV0A 5J9YA 4IXPA 5FXSA 3FZ1A 3RPYA 5CF6A 4D2WA 2C3IB 4JDHA 3RVGA 3VBQA 4J95A 3ZRMA 2OZAB 3PPJA 2ZMCA 4YNEA 4TYGA 4QP8A 2YAAA 4BBEA 4OR5A 3DY7A 2Y9QA 2HW6A 2OZAA 3RTPA 5EOLA 4BDGA 4DFYA 2C5XA 3WARA 3FLYA 3QGYA 2WQEA 5JGBA 3IW7A 2PZRA 4AX8A 2BHHA 2VZ6A 3VS7A 3TCPA 1ZMVA 1K3AA 5C8NA 4GL9A 4M3QA 5A4LA 3PG1A 3LFFA 1KE6A 2BDJA 3JS2A 4FKPA 5ANJA 3UVRA 3C4WA 3FDNA 5KMMA 4UWCA 4L3JA 3DJ6A 4RIXB 1DM2A 2QHMA 4FSNA 3O8UA 3NCZA 5EHYA 3TKUA 4EKLA 4CZUA 2B55A 4EOLA 1WAKA 4EYMA 3FHIA 4RIXA 4YLLA 3V51A 4RWJA 4BHNA 3MH2A 2BPMA 3PXYA 2PUUA 2EB3A 2GCDA 4ALVA 3DZQA 4XYFA 1PXLA 4PRJA 3PFQA 3QLFA 3AXWA 4M68A 5AP5A 1SZMA 3GCVA 4W4WA 2X7OA 1OPKA 4FNXA 5DRBA 1Z57A 3SAYA 4L42A 5F9EA 3JXWA 4PTCA 1RE8A 4RT7A 4AZFA 1Q61A 5ACBC 4FBXA 4C34A 5IA2A 5ANEA 4F1MA 3MW1A 4D5KA 3FZTA 4JDJA 5DIAA 1Y8YA 4TYJA 4L6QA 3FXZA 4PNKA 3LJ0A 1NXKA 5BYYA 3HV3A 2ZV7A 4OBQA 4QP9A 3GU7A 2ZVAA 3CD8A 3VUDA 4HPTE 4P5ZA 3UE4A 4GFOA 1ZOGA 3R63A 4G3FA 3LCOA 4OBOA 5K9IA 5DWRA 2B1PA 3ZEPA 2FSOX 1FMKA 5CQUA 1JPAA 3IW8A 2QKRA 5JGAA 4YLJA 5DEYA 2VU3A 2WEVA 4Y5HA 4FV1A 4C0TA 1LUFA 3N51A 3F3WA 4QP7A 3NRMA 4FG9A 3FC2A 5CAQA 2BAQA 3AC8A 4F08A 1H25A 3KMUA 2ZM3A 4RLKA 2B9HA 4EK5A 3TKIA 3S3IA 4HW7A 5CAPA 3PY3A 2XNNA 1NVSA 2GU8A 4HYIA 2ITQA 4DFNA 4U80A 5H8GA 3NNVA 1Q41A 4NEUA 4DITA 5DFPA 2SRCA 2ITOA 2XKDA 4FL1A 3W32A 3F3TA 4ZZNA 2XF0A 3EQRA 2J0IA 2QOHA 3L8XA 5H2UA 3G51A 4MVFA 5J5SA 2GDOA 2WO6A 3OBGA 4V04A 4C4GA 4DHFA 4AU8A 5EDRA 2A27A 3IPHA 4IB5A 3RPOA 2EUFB 3EZVA 3NW6A 2E2BA 4JT3A 3HP5A 2XCKA 5LMBA 3D7TB 4AUAA 3MJ2A 3U4UA 1XBCA 4FTUA 3L8VA 2W1FA 3QRIA 3DZOA 3BBWA 3RK7A 3D7TA 5CF4A 3FI2A 3ZFYA 5F94A 1PKDA 1OL1A 4EH5A 3R1SA 3ROYA 4CRSA 4O1OA 3EFKA 4GIHA 3BRBA 2V55A 3DDQA 4QOXA 2OW3A 2VWYA 1CSNA 4FTKA 2G2FA 3GU4A 2YIRA 1PYXA 2ONLA 3BGZA 3VUGA 3PG3A 4XX9A 4N6ZA 3W33A 2BAKA 2ITYA 3A7IA 1JSVA 4A9YA 3WF9A 2IJMA 1U54B 1K9AA 1O6KA 1ZYSA 2J0JA 4U3YA 4DEIA 4C57A 2W5AA 3DCVA 3GC8A 2W1CA 3M11A 1U54A 3HX4A 2H34A 4P2KA 2AYPA 4PTEA 3LZBA 4QYFA 2QLQA 3HV7A 3K3IA 4M8TA 5HVJA 5HE2A 1XBAA 5JFVA 2R2PA 3NZ0A 4EORA 4IFCA 4BI2A 2C68A 4EOSA 2BRHA 5JFWA 1PMVA 4XBRA 5JRQA 5KMNA 4GT3A 2OF4A 1GAGA 2CKEA 2X8IA 3EKKA 3A8WA 4YZNA 2R0UA 1QMZA 4EOJA 4FYOA 3VWAA 2OFUA 5L2IA 1FVTA 2PVFA 3VW6A 1BL6A 4IACA 3TACA 2JLDA 3ZFMA 2Y6OA 3OG7A 1ZZ2A 4M69B 4F6WA 3TN8A 3UC3A 2J4ZA 2RG6A 3AMBA 4FTTA 5AV1A 3GUBA 3KKVA 2F49A 2GFSA 3BEGA 5EOBA 4H36A 2C3JA 4K9YA 3O51A 1Q3DA 2QG5A 3E5AA 2YAKA 3IGGA 4U81A 3R7GA 3HRBA 1U4DA 3CKWA 1P4FA 3ZBFA 3NEWA 3F61A 1PMEA 2FGIA 2VO7A 3HECA 4ID7A 4EH4A 3FKOA 5CY3A 4BDKA 4CCUA 4F4PA 3A2CA 1YDTE 3R8LA 4I5CA 3O8TA 4C3RA 5EKNA 3C13A 4RJ3A 3ENHA 2UZOA 3NNUA 4AZEA 2DUVA 3CLYA 3U4WA 3JPVA 5CS6A 3R8ZA 4RWKA 3LVPA 1FVVA 3IKAA 4QMSA 3R8MA 3R8VA 3RP9A 4FG8A 4UB7A 3OWLA 2C6DA 3I79A 4FTMA 2AC5A 3QXPA 5TKDA 3UBDA 3EN6A 2XNOA 4GCJA 2V7OA 5E92A 5FDXA 4IEBA 4JI9A 4MQ2A 3NW7A 2VTIA 2E9UA 2PMOX 3CGFA 4CQGA 2X4ZA 2J2IB 3FYJX 3NWWA 4NM7A 1OECA 3BI6A 4ZSJA 5J79A 3QLGA 4BCQA 4FIHA 4U45A 4F6SA 5JEBA 2IW9A 3THBA 2W1EA 3PVWA 4EQCA 3FZSA 2R4BA 3ZU7A 5E8SA 4EHVA 4FA2A 1OUYA 4HNIA 3BHYA 4XLVA 3KRWA 3BHHA 1W84A 3Q32A 4DEEA 1PXJA 1ERKA 2ZV2A 3DXNA 3FBVA 2CCIA 3ORIA 3FZRA 4J7BA 4ANLA 4EK3A 3E93A 4LGDA 4M84A 4RGJA 1PKGA 4AFEA 4E6QA 4ERKA 3GU6A 4KABA 4CD0A 3QTQA 2UZDA 3SX9A 3OXTA 1Q8YA 4ASXA 3HA8A 1B39A 3DV3A 4UWYA 2OGVA 1AQ1A 3QKMA 4XUFA 3MFRA 4GW8A 1F3MC 1H1SA 1MP8A 2NPQA 3JYAA 4OTFA 4X3FC 4EI4A 1BI8A 4FF8A 4HJOA 3ZSHA 3M2WA 4IB0A 3RHKA 1ZXEA 2WNTA 2YM6A 1E1XA 2X0GA 4W4VA 4OAUC 3HUBA 3ZDUA 1CKJA 1KE9A 5GHVA 2JEDA 3PXKA 4F7NA 3F88A 2R3RA 2ZDUA 2OJIA 2YDIA 4JQ8A 3KVWA 5K5XA 2QD9A 3OOGA 5FWKK 3TTJA 3VQUA 4AW5A 1M7NA 3NUYA 5FM2A 3C0IA 3PWYA 3VBYA 4BYIA 2YABA 5GZAA 4GG7A 3OVVA 3SQQA 4KIOA 4A07A 1H07A 4I21A 2W9FB 4A7CA 3OT8A 5CANA 5EYDA 4YC8A 3RPVA 3V6RA 4PDOA 4WBBB 5ANKA 4RJ4A 4L7FA 2X39A 5IA1A 3O96A 1OKYA 5AJQA 1Q24A 3EN7A 2GS7A 2XM9A 4BIEA 4RJ6A 3O50A 3TUBA 1R0EA 4RRVA 4QMMA 5DEWA 4KSPA 1YDRE 3GOKA 2BFYA 1E9HA 1ZYDA 3GFWA 4PL3A 1OKVA 5AV3A 4QNYA 5CEPA 3P7AA 4WNKA 5TOZA 5K0XA 2X7FA 3O17A 3VUHA 4DFZE 4AE6A 5JMSA 3UQFA 2YWPA 4L01A 5FM3A 3UMXA 3KRLA 5CAOA 2W1HA 2ZOQA 5JQ8A 2C6OA 2WTJA 4EOPA 4Z16A 4IM2A 2JDSA 2XNPA 1YWNA 5BUEA 2PE2A 3G5DA 2UV2A 3REPA 2WMXA 2R9SA 3BE9A 3I4BA 1YHSA 3T8OA 3W8LA 5L4QA 3FZPA 2LAVA 5JH6A 4FT5A 3BX5A 3DTCA 2G15A 2C6LA 4TWNA 3BU5A 3RAWA 3QCYA 3LXLA 3RCJA 2X9FA 3C4EA 3E7OA 5M4FA 4MF1A 5ICPA 3R2YA 5CU6A 2R5TA 3ZO3A 2FSMX 3GP0A 4FYNA 4PMTA 3HRFA 3T9TA 3KVXA 3V8WA 1J1BA 2BFXA 3GT8A 4F0FA 5AEPA 1WVXA 4BDIA 4EC8A 3F69A 3U6HA 5DR9A 4W9WA 3QTXA 2Y4IB 4MH7A 5EYMA 1F5QA 3OCGA 5EW9A 2C4GA 1ZY4A 5E8XA 2KULA 5M57A 4I5PA 2PZ5A 1GY3A 4QQ5A 3W2QA 2HZ0A 2Y4IC 1I44A 2UW9A 4GT5A 3BGPA 4IZ5A 4AFJA 2OH4A 2BVAA 4HCVA 3R9NA 4CKIA 1BLXA 4J97A 2YZAA 2YEXA 4S31A 5EM8A 1CKIA 1YXVA 5ANIA 3GB2A 5AUXA 5GZ8A 4ALWA 2J5EA 4CKJA 3EN9A 2HZNA 3KN6A 4RX8A 4RWLA 2UZTA 4IC8A 3ORTA 4NTSA 4AE9A 3R8PA 4AT5A 5IDNA 1KOBA 3O23A 3BWJA 3E8CA 4FTQA 5H3QA 5DA3A 4BDAA 2WTVA 1BL7A 2B9FA 3D2KA 3FY0A 3LCDA 4JJRA 5HGIA 3LIJA 4BDEA 5HLNA 2IN6A 2JIUA 3QQKA 1H27A 2HENA 4TRLA 5ETCA 3IS5A 3VQHA 1R1WA 3AC5A 4EH2A 4X7QA 4FKOA 4P7EA 3WIKA 1LPUA 2IVTA 4FTOA 4LM5A 5M4CA 3U87A 2WXVA 5CEKA 4OTDA 2G01A 5CSPA 3GCPA 4PWNA 2Z7QA 2PZYA 4C02A 3DNDA 3SC1A 4IVBA 4MNFA 4IB3A 1JQHA 3HNGA 4U97A 3GBZA 5EM7A 5HLPA 2VO0A 1Z9XA 3HMNA 2XS0A 4RA4A 4BCKA 4MWIA 3QTSA 4FNWA 5C8MA 4NIFB 2RFNA 5B2KA 2OJ9A 3QGWA 2PSQA 5DPVA 4QMPA 3BV3A 3PP0A 3EL7A 3F2NA 4IM3A 4NIFA 5CF5A 3C1XA 3T9IA 3LCSA 4KAOA 3RGFA 4O0UA 4FK3A 4I6FA 3MA6A 3OCSA 4LMNA 4C33A 4ZEGA 1AGWA 2CHLA 2BIYA 1YXXA 2PZIA 4QQJA 2UW0A 3RALA 3SLSA 3BZ3A 3UNKA 2YM5A 4ZZMA 3L8PA 3P9JA 4PQNA 2GFCA 3TIYA 2V7AA 3B8QA 4I23A 2WMSA 4J1RA 3H30A 5CQWA 2EB2A 2LGCA 4GH2A 1UU7A 1H00A 2ITNA 3C7QA 2NP8A 3ZUTA 2QOCA 3RCDA 2YM4A 2EXEA 3L9NA 2J9MA 5HU9A 4AZTA 3MFTA 4N6YA 4OT5A 2VRXA 3NUNA 1H26A 3HLLA 3OF0A 1HCKA 3ACJA 4EYJA 2GHLA 3ZO1A 2JIIA 2CGVA 3QD3A 4ASZA 3LHJA 3BLQA 3DTWA 5EK7A 1GZNA 3DKCA 1EH4A 4O6LA 4X0MA 2I6LA 2Y0AA 1YRPA 2BILB 4KKHA 2ITZA 5J7HA 5KX8A 4XRJA 4FTAA 3DBFA 4ASDA 4TL0A 1ZYCA 4C35A 4FKLA 5BQ0A 5FXRA 3R9OA 3W18A 4BHZA 3R02A 4D2RA 4TN6A 2XIRA 4MTAA 1H0WA 4HVIA 4E8AA 2XIKA 3AOXA 5EI8A 4OTHA 4TYIA 3KL8A 2C5OA 5AX3A 4F1OA 4ZJIA 3L1SA 2WTKB 3F3VA 3I60A 3TNIA 4M0YA 2V62A 1HOWA 3KF4A 2W96B 3E87A 4IAKA 4DLJA 4JOAA 5C01A 5BUJA 3HDNA 4BKYA 2UZWE 2IVUA 2YCSA 4WUAA 2WQBA 3I6WA 4DG2E 2YIQA 4E4XA 2ZDTA 5AM6A 4BWXA 4XP2A 4ITIA 3PE1A 4S32A 3PTGA 3DQXA 2J7TA 4FIFA 4UZHA 3P86A 5CZIA 5FBNC 4ZTLA 4YZ9A 3GCQA 3ZSIA 1J1CA 4KS7A 4YGAA 4DG3E 4FKTA 3IW6A 2PVHA 3T3UA 1QPJA 1V0OA 2X81A 3H4JA 3EJ1A 3DNEA 3VUTA 2R3FA 3FC1X 2VWUA 3EIDA 3POZA 3QTZA 1GNGA 3MWUA 3AMAA 3MB6A 4ZSEA 4QP1A 5H8EA 5HKMA 4G3CA 4R1YA 3ZXTA 3D5WA 5EW8A 4BWKA 1NY3A 4JAJA 4K6ZA 5TR6A 4GS6A 4OBPA 5K4JA 1PXMA 3ENMA 3KY2A 3RM7A 4BI1A 4G3GA 5L6WL 4IX4A 3LJ1A 3UIMA 3W10A 2QKWB 3UZTA 4L52A 4H39A 4F7SA 2P33A 3BYMA 1B38A 3MFUA 2QU6A 4D0WA 4XG3A 4F64A 1XH6A 3ZO2A 2ZV8A 3QUDA 1H1WA 4V0GB 2CSNA 4UMQA 3NYXA 4GJ3A 2OIBA 2B52A 1Q4LA 3KU2A 4WBOA 2V22A 1YWVA 4V0GA 4F65A 2XZSA 3UG2A 5F95A 3UQCA 3VJOA 3U51A 1BI7A 3FSKA 1JBPE 3NUXA 4KBKA 3DAKA 4X2JA 4CTCA 3MY0A 4RJ8A 3G0EA 4MD7E 4C2VA 3U8WA 3UOHA 3V3VA 1O6YA 1OI9A 4WUNA 5EH0A 3DDPA 2C0TA 4RMZA 5E8TA 2Q0NA 5KMKA 4XV3A 4M67A 4U42A 3JUHA 3WZDA 2JDOA 4FEQA 4LI5A 3OFMA 4IWDA 1WBSA 3ZDIA 2I0VA 3BLRA 3MV5A 2FUMA 2UW3A 3E8NA 3F6XA 2HIWA 3OW4A 4OT6A 2JKKA 1MRVA 2VO6A 4EOOA 3E62A 2VTNA 3L9LA 3ZEWA 1LEZA 1Q97A 4G6NA 3UO5A 3WZJA 2EWAA 5KUPA 4KD1A 3UP7A 3LFQA 5I0BA 4FICA 2OH0E 4H1JA 5KCVA 3PXRA 4OTPA 4WNOA 3ZUUA 4XV9A 2C3LA 4B4LA 4X6QC 3FL5A 4USFA 2J0MB 1Q99A 2PVKA 4EOIA 4CVAA 4OTQA 4GUEA 2BROA 4MX9A 4BGGA 3HP2A 3QCXA 5L2TA 1OL2A 1UNHA 3IGOA 3DKOA 5EG3A 3Q5ZA 3GQIA 5HNGA 4I3ZA 1YW2A 3R0TA 5CAUA 1JKTA 4HVGA 1I09A 3V5PA 4FKJA 4EL9A 1YOLA 3HMPA 2XUUA 2C1BA 1FGKA 2YA9A 3O7LD 2XM8A 2ACXA 1UKIA 3EFLA 5A54A 4UY9A 5E8VA 3RKBA 4YSMA 3RPRA 4CLJA 3Q5IA 3Q9WA 2WTWA 3EFWA 5BMMA 2C5VA 3HVCA 4L67A 4FSRA 3VO3A 4F63A 2O5KA 5JN2A 5CEQA 3SDJA 3OS3A 3EOCA 2P2HA 5E8ZA 4JQEA 1VR2A 4X3JA 4FV7A 3CGOA 3R1NA 1Q8UA 2CLQA 1KSWA 2XIZA 5JFSA 1DI8A 3UP2A 3V5TA 2ESMA 1RQQA 3RAHA 4DINA 4PMSA 4R3RA 5AP3A 3FUPA 2F7ZE 2ZAZA 1UU3A 4FKVA 3NGAA 1GIJA 4A06A 4AT3A 5AR2A 4NFMA 1JAMA 1IG1A 4G31A 4Z9LA 4RVLA 2YCRA 3ULIA 5IUGA 2CGWA 3ORZA 4GK2A 3W2OA 4JX3A 2HZ4A 3UMWA 3WF8A 3WF6A 4KWPA 5HBHA 4X2FA 4D0XA 4FIGA 3MS9A 3OC1A 2JBOA 3BHTA 3WYYA 5D41A 3VS2A 4EH3A 5DR6A 3EQIA 2B4SB 3PXFA 1NA7A 2VTTA 3P4KA 3OUKA 5F1ZA 2XNEA 5IU2A 5HORA 1UU8A 3IW4A 1OIQA 3EFJA 2CGXA 3KRXA 5CVHA 3VRZA 2R7IA 4O91A 4QYYA 2YISA 3LAUA 3FLQA 3PRIA 2HWOA 2VTHA 2ZMDA 2GTNA 2DYLA 3Q3BA 3OWPA 4Y95A 4BDDA 3COIA 4X2NA 3RBWA 3PJCA 3OROA 1R78A 3EYGA 3P5KA 4C7TA 3UPZA 1ZY5A 3R1QA 3MBLA 4YC3A 1WVYA 4PY1A 5CVFA 3LE6A 5AP2A 2WMWA 3KCKA 3VNTA 4DLIA 3E88A 3C50A 3QWJA 4YTIA 5LVOA 5H9BA 4WNMA 3DLZA 3MIYA 3B8RA 4FV6A 5GJDA 4DH1A 4Y85A 4KRCA 4C59A 4FSQA 3FMKA 2BMCA 5EDPA 3NDMA 3QA8A 5HCYA 3UZPA 3TT0A 4YJOA 4YHTA 3ZSGA 5JZJA 2YJRA 3JVRA 4K1BA 4QYHA 4A9UA 2GQGA 4E5AX 1V0PA 2R64A 3EH9A 4AOJA 4NK9A 4RIWB 5LOHA 3HL7A 1IA8A 4LYNA 2UZUE 3HV6A 3ZLXA 4HOKA 1YXSA 3R8UA 2YIXA 4RIWA 4ACHA 4IHPA 4UYAA 5HIBA 5HVYA 5AP6A 4RZWA 1WZYA 4KBAA 4U9AA 4YZDA 3SOCA 5EDQA 5HTIA 4QNAA 4O2ZA 3EQGA 3A62A 2W1IA 3QQUA 1TQIA 4IQ6A 4Y72A 4QD6A 2I0YA 2JKQA 3CP9A 2A0CX 4X2GA 4TYHB 4RQVA 1WCCA 4E4LA 5HO7A 3TI1A 3PIXA 4IADA 3NAXA 3RAIA 1UWJA 1H24A 2RGPA 3EN4A 4G6OA 4TNDA 2VTPA 4TYHA 4DEBA 5I5ZA 4U44A 3ZHPC 4YU2A 3KB7A 5D7AA 4MD8E 4OTGA 4CYIA 4RFMA 4ANSA 5CALA 2W5HA 3TNPC 4G5PA 3PZEA 4EQUA 5IA3A 2W1DA 4UN0C 1PJKA 2YM7A 5AP7A 5CASA 3HZTA 4D1SA 3LPBA 4YJPA 4TWPA 3FE3A 4IJPA 4FKGA 5E7RA 2WHBA 4EHGA 1UNLA 5C27A 3CC6A 4XMOA 2W4OA 3VVHA 2QU5A 5AAGA 3VUKA 4XV2A 1OL6A 1TQPA 5EYKA 1FINA 3KFAA 3TG1A 4A9SA 4IH8A 2CN8A 4YNOA 4ZJJA 4DH5A 5CWZA 4XG6A 3PVUA 1W8CA 3FI4A 3QHRA 4E4MA 2WMBA 5FGKA 2P3GX 4WHZA 4EEVA 5A4QA 2B54A 3KGAA 4MQ1A 4BWPA 3MH0A 4FSZA 2ONLC 5CX9A 2VTLA 5ITAA 4JIKA 2QNJA 4JR3A 2X1NA 4QMTA 4I1ZA 2I40A 3S0OA 1MRUA 2YACA 3D2IA 4NM5A 4IZ7A 2HK5A 5M55A 4EBWA 2IVVA 3PLSA 4XP3A 3W2RA 4G5JA 2E9NA 4EWHA 3DJ5A 2QODA 2HZIA 3PSCA 4CV9A 4WRGA 4F9WA 4BZOA 3MJ1A 5I9WA 4D55A 4GRBA 3POOA 3RZBA 4EK6A 4BCNA 3I0OA 4WKQA 3LFAA 3ZOSA 4OUCA 4C3PA 1YOJA 4IIRA 4HYSA 4PUZA 4PP7A 5AWMA 4ZS0A 1REKA 2RFEA 3M1SA 1XH9A 2BALA 2VV9A 2BIKB 4BDJA 4JBOA 4D1XA 1BMKA 3K5UA 2KTYA 1XKKA 4GT4A 4M13A 3BV2A 4AWIA 1F0QA 4FG7A 4II5A 4APPA 4ITHA 5CU0A 1YKRA 2HOGA 3OXZA 4ACMA 3FLWA 2J0KA 1W0XC 4GEOA 4DFXE 4YO4A 1OZ1A 2IO6A 4BL1A 2VWZA 1OIUA 4W4YA 1Y6BA 2QO2A 4M12A 2B9IA 2J6MA 3QALE 4BVUA 5F20A 4FKWA 4FVRA 2J50A 5FTOA 3OBJA 4LL5A 4PX6A 1YI3A 4O21A 5E8UA 1SM2A 1ZYLA 3EN5A 2BKZA 3QUPA 4F7LA 2WU6A 4M7IA 5CVGA 4JG6A 3GXLA 1OGUA 3FLNC 3A60A 3JY9A 4YJNA 5A46A 2VN9A 3BHVA 5HNIX 3R30A 3SRVB 2F2UA 2VTJA 2W5BA 4BDBA 1M52A 3HYHA 2WIPA 5L6OA 3HMMA 4IWPA 3SRVA 4BKJA 4PNIA 2VX3A 4DH8A 2EU9A 1PY5A 4JG8A 4O1PA 1W82A 5FEDA 5DBXA 2ZV9A 3ZH8A 2OK1A 4QMOA 4CFWA 5KHWA 3DBEA 4QP2A 2GHGA 3LFBA 3DB6A 4K8AA 4HZSA 4PMMA 3OWJA 1IEPA 4K77A 3QC9A 1U59A 2R3GA 2GNLA 3COHA 3UYSA 3MGYA 5BVEA 3TNQB 4ACCA 5K4IA 3U9NA 4UWBA 3CQEA 1XR1A 2VNWA 1PXPA 3CJGA 4MBJA 3COMA 4G16A 4IZAA 4I5MA 4Z55A 3CXWA 3LOKA 3CY2A 5KMLA 2HAKA 5LWMA 3LLTA 4I0SA 4FSYA 3PJ3A 3SW4A 3ULZA 2XEZA 3BKBA 1B6CB 3D83A 3TUDA 2YJSA 4RC2A 2WGJA 4QMZA 5E91A 2FA2A 3A61A 4NT4A 2HCKA 2OXDA 5HD7A 2WMAA 4LG4A 2XP2A 1UKHA 4MBIA 2OSCA 4ZY6A 4CZYB 4W8EA 4KSQA 5HO8A 2YFXA 2A19B 4A9RA 3PY0A 3RAKA 3LFDA 5C8KA 3DK6A 3FMMA 2VTSA 5E1EA 4F7JA 4NW6A 5CSHA 3MY1A 4DFLA 4TPTA 2NO3A 2OICA 3DBDA 4FIIA 3ZBXA 3HMIA 1FQ1B 2ZB0A 1Q3WA 4YJTA 1ZLTA 4XOYA 5AUYA 3DU8A 3QCQA 3IONA 1H1QA 2JDTA 3JVSA 2C6IA 2GNIA 3A4OX 3DAEA 4GMYA 4F9CA 3RMFA 3R04A 3V5JA 2C6EA 2W1GA 5EFQA 4XRLA 2IVSA 5LJJA 3PJ1A 3CQUA 3KCFA 5DLSA 3QD4A 3FQEA 2QOFA 4JNWA 1OB3A 1WBOA 2YM3A 4PV0A 3FI3A 3P0MA 3MN3A 4I94A 3RHXA 5J7BA 1ZYJA 3Q60A 3LQ8A 4L3PA 4BC6A 4WRSA 4I93A 5I9ZA 4XG8A 1FPUA 4MYGA 5CLPA 3FV8A 1KV1A 3NIZA 4JRVA 4CTBA 2H8HA 3QQHA 3CBLA 4FKSA 3BYOA 5M53A 3D4QA 1H1PA 5LVPA 1BKXA 5KMOA 4ANBA 2O2UA 2VGPA 5AAEA 3GENA 3IK3A 4AXAA 4DC2A 2CDZA 4Z7GA 3ITZA 2G2IA 1TQMA 4AA4A 4UMPA 4L45A 4IBMA 2G1TA 2ITVA 3PSBA 4JBQA 4K18A 4KBCA 4NJDA 4R5SA 3ZC5A 4WG3A 2WMRA 5KKRB 2Q0BA 4MXXA 5GJFA 2UW5A 5TO8A 3QFVA 2XBJA 4QMNA 4E20A 5CXZA 1H08A 2OZOA 4UXLA 4HYHA 4FVQA 1OIYA 4EUTA 4V05A 5ANGA 3A7JA 5KKRC 3GNIB 3R01A 3S95A 3O71A 1KV2A 5EI6A 5DMZA 4CSVA 3VS5A 3E64A 4A4OA 3CPCA 5KNJA 3BBTB 4F09A 2Z60A 2PWLA 4QMLA 3Q6UA 4DGOA 5HQ0A 4D4RA 4HGSA 3Q4ZA 3FKNA 4CMTA 5FDPA 4NH1A 3QTIA 3BPRA 1LEWA 3H9RA 5KBQA 3E8DA 4RX9A 4D2VA 1P14A 3EKNA 2FSLX 4QPSA 3FZOA 2IZSA 3WF5A 4D5HA 5M4UA 3ZTXA 3QZHA 3RNYA 4FGBA 3BE2A 3R21A 3F9NA 3AMYA 3KRRA 1RDQE 1VEBA 3A4PA 4MXAA 4XEYA 1WBNA 2OI4X 3IO7A 4XV1A 2REIA 3N9XA 5ACKA 4IX3A 1H8FA 4IMYA 3GEQA 2B9JA 2ZM1A 3WE8A 4AW0A 3VHKA 2WELA 3HGKA 4FT7A 4FSMA 4LOQA 1PXNA 3QL8A 2WQNA 3BWFA 3EB0A 3RI1A 3KN5A 4F70A 5L8LA 3NR9A 1YXUA 2Z7SA 4YJVA 4LRJA 4FI1A 4ZY5A 4HVSA 2VTQA 3EYHA 5J9ZA 3D7ZA 3FXXA 5DE2A 3BCEA 4FTCA 5AIRA 4TXCA 4HGEA 3ANRA 4L9IA 5CYIA 3ZO4A 4K2RA 2PY3A 1PXOA 4E7WA 3SXFA 3QYWA 3DPKA 2V5QA 3PYYA 4ZTQA 1GJOA 1XH4A 4BDHA 2F7XE 4I92A 3S1HA 3PRFA 4PPCA 2XKCA 1STCE 3QD2B 2O63A 4M0ZA 4LUEA 4YTFA 2X4FA 1NVQA 3FWQA 4Q5HA 4FK6A 4RWIA 5M4IA 3D14A 2XIYA 4LMUA 3QTWA 5M51A 5T68A 5HCXA 3RNIA 4XCUA 1JSTA 2JDRA 3ORPA 3V6SA 3V5WA 4ZLZA 5BYZA 3UTOA 4J98A 3QX2A 3UQGA 3VF9A 5B2LA 3HV4A 2JAVA 4ZAUA 1SVEA 3K2LA 3AGLA 1HCLA 4ZIMA 5D12A 2UVYA 3H9OA 4IB1A 1XQZA 2JC6A 2E9VA 3TIZA 2OF2A 4AQCA 4ANMA 1W98A 1WVWA 2CJMA 3QKLA 4JBPA 2ITXA 1G3NA 2WOTA 4O0RA 1OL7A 4W8DA 3VUMA 3EQFA 2UZBA 3R7IA 1U5QA 4UMTA 3PPKA 3D15A 4HPUE 4IAYA 4K33A 4U5JA 4EH7A 1JVPP 2VWWA 4NSTA 3RJCA 4CFUA 3V8SA 4MXOA 4EWQA 5L6PA 5A6OA 5J1WA 2FB8A 4RIOA 4Q2AA 1ZOHA 1JKLA 2XKEA 2F4JA 3SHEA 4D2SA 3RZFA 2WOUA 4XG7A 4QO9A 1OL5A
chains in the Genus database with same CATH superfamily
2CCHA 4RA5A 2WPAA 2X0QA 4NTTA 1U5RA 4QP3A 3D5VA 1APME 2C69A 3MI9A 4D9UA 4D58A 4PMPA 2IW6A 3COKA 4OTRA 5F4NA 3SKCA 4A4LA 1GZOA 5IH4A 3CD3A 4FKUA 1ZOEA 3QC4A 4X2KA 3Q9ZA 1A06A 1Y8GA 2YN8A 4RZVA 4EKKA 4PTGA 4E4NA 4CYJA 1P4OA 3O0GA 4ACDA 2C47A 2A2AA 3CTQA 5LMKA 4WG5A 2X8EA 2R3MA 3QTRA 4J71A 2ETKA 3HUCA 3TEIA 4E73A 3I81A 3BGQA 3VJNA 2F7EE 5LCJA 2YCFA 4RLLA 3H0YA 3EZRA 3AC4A 4BYJA 5IPJA 4WSQA 1FMOE 3P7BA 4IX5A 4HCUA 5DT3A 3WILA 3EWHA 2OU7A 3HEGA 3UVQA 3VHEA 5IUHA 3LFEA 5ETFA 2VGOA 1U46A 1SMHA 2CN5A 3QRUA 4QTEA 1PMNA 1WBWA 4C36A 5HIEA 5A3XA 2QLUA 3TXOA 2XRUA 2W17A 3NIEA 5CF8A 1LP4A 2QOKA 3KRJA 5IG1A 2C0OA 4FL2A 4XHKB 3IDCA 5FBOA 5AAFA 4GYIA 4BCFA 1R0PA 2ETRA 1YI4A 4CNHA 2XRWA 3ZC6A 2F2CB 3D5XA 2WTKC 4A4XA 5AP1A 5IMEA 2C0IA 3I1AA 3QBNA 3BEAA 3VN9A 5A14A 2GNFA 3ORMA 4G6LA 4JR7A 4FT3A 3LFNA 3MVLA 3VF8A 5AUZA 4WT6A 5CNNA 3WE4A 2W0JA 2PMNX 5D10A 4ZZOA 2GNGA 3PA3A 4DBNA 3VUIA 3UVPA 5HEZA 1Y91A 2YM8A 3FKLA 4C62A 4YBKA 2O65A 2CPKE 3CR0A 3KULB 3IECA 1M7QA 3P7CA 4E5BA 4E26A 2X7GA 3KULA 4RG0A 2X2LA 4OAVB 3OCBA 3PSDA 1GIHA 1JLUE 4DGNA 3NYOA 3TZ7A 3PE2A 1YDSE 3FXWA 4YZMA 4IVCA 4CQEA 4F0IA 5ANOA 2WAJA 3G9LX 1E1VA 1YXTA 5EM6A 5C26A 4DEDA 4BCPA 4BDFA 3E63A 3QRTA 1W7HA 2WQOA 3GCUA 1MUOA 1OMWA 4I0TA 2UZVA 1JKSA 5DI1A 4K0YA 4ONAA 4EZ7A 4CKRA 5EHOA 4GK4A 3GGFA 2BZJA 3QD0A 3S4QA 3TJCA 3ZLWA 3ZLSA 2IWIA 2J5FA 3KXZA 3CS9A 3ET7A 3QHWA 3FMLA 4DGLC 3NS9A 3F5UA 4OTWA 5HOAA 4BZNA 1ZMUA 5ANDA 3ZS5A 1SYKA 2CLXA 3NNWA 3BLHA 3R7UA 4C38A 4C4EA 4PPBA 4M15A 3DFCB 4IWQA 5HU3A 1NVRA 2XK8A 2OJGA 3Q04A 4Q5EA 3W2SA 4IW0A 4X21A 2FVDA 4UYNA 5GZ9A 3WBLA 1UVRA 5FP5A 5LXMA 1FVRA 3VBWA 5HO6A 5HTBA 3MIAA 4O4FA 4LV5A 2OJFE 3OD6X 1UV5A 1ZRZA 3KXHA 3OMVA 3PUPA 2H96A 3DS6A 3QQGA 5I9XA 4FZDB 4YTHA 3R7YA 4KKGA 3GFEA 5JK3A 4F9BA 5FQDC 4U41A 4Y8DA 3VC4A 2OIQA 3LXKA 4IX6A 4C37A 3MTLA 4IVAA 2ZM4A 4BGQA 1J3HA 1QCFA 2OFVA 4FSWA 2YIYA 2Y4PA 4RC3A 4AS0A 4GFMA 2GHMA 2Y8OA 3SXSA 2BZHB 2PK9A 4FKQA 4IAFA 3ZYAA 4EH8A 3OHTA 3DJ7A 3PPZA 2I0HA 5JFXA 4RSSA 4RX7A 4PDSA 2P55A 3WYXA 5BVKA 4AAAA 3NUUA 2VAGA 5FRIA 3P23A 4G9CA 4JAIA 3LM0A 5JZNA 3NUSA 5AR5A 3O7LB 5LVLA 2HXLA 2R7BA 4RPVA 1TKIA 4AN3A 2AC3A 4KKEA 5HICA 4AZVA 1L3RE 2R3LA 4G17A 4I22A 2PVMA 2RFSA 2OBJA 4J96A 3A8XA 3FYKX 2JFMA 5HESA 2W1ZA 2C3KA 1UWHA 2C1AA 5J1VA 2OXXA 1XH7A 4E6CA 3D9VA 1DAWA 4NUSA 2RKUA 4GVJA 4BRXA 5FEEA 5HE1A 1RW8A 3MVMA 2WMUA 2OO8X 2VUWA 4TW9A 3AC3A 3ZXZA 4JVGA 2ZB1A 2GNJA 5E8WA 3R22A 3WZUA 4KIQA 1YQJA 5BUIA 4WOVA 4DG0E 4P90A 3KXGA 3FQSA 4UZDA 4QPAA 1R39A 3NNXA 4PP9A 4IANA 3FMHA 4QTBA 2DWBA 4F6UA 4NJ3A 3F5XA 3D0EA 2XEYA 4FIJA 4FT0A 3VW8A 1OIRA 4D4YA 3PA4A 2VNYA 4E93A 4RFZA 4WIHA 4DCEA 3KEXA 4L8MA 3UO6A 4F1TA 2Z7RA 3G33A 4NCTA 3II5A 4AZSA 3UDBA 2XH5A 2R0IA 4ACGA 1KE8A 4MK0A 4RIYB 2PE0A 3MVHA 1CMKE 5LMAA 4FODA 3KF7A 3CPBA 4S34A 4O22A 1DS5A 4EOMA 2XYNA 1PXIA 4RIYA 5BVWA 4RX5A 4UBAA 3ORLA 5AUUA 2AUHA 2XKFA 4CFVA 4EJNA 4IJ9A 4JG7A 3BIZA 1OUKA 2R3IA 1OKWA 3QX4A 2YERA 5HX8A 5TF9A 3LFCA 5AIKA 3ETAA 3HKOA 4QMXA 5DRDA 1QPCA 5ETAA 4APCA 3TV4A 4AT4A 2BAJA 4RJ7A 4CLIA 4CT1A 3NYVA 4USEA 2BTRA 4N4SA 4ZTNA 5A4TA 3GI3A 2R3NA 2BTSA 3E92A 5EM5A 4O4BB 2IZTA 5BPYA 4F99A 4KINA 2XIXA 5JRSA 3FLZA 2XA4A 3EL8A 3Q4CA 4H3QA 3GOPA 4HNFA 4DN5A 2H6DA 3ALNA 3OUNB 4IDTA 3UIBA 1VZOA 4L68A 3UG1A 5E8YA 5CU4A 4OW8A 5IISA 4RQKA 4G3EA 4QRCA 5DT0A 4FV5A 2OXYA 4H1MA 4I24A 3ZRLA 1WMKA 3K54A 5K3YA 4FC0A 2ITTA 2JD5A 4FZ7A 4IC7A 3FLSA 3I5ZA 2QI8A 5DG5A 1PHKA 5AM7A 3G90X 5AUVA 1CKPA 2XB7A 3E3PA 2R3KA 3PVGA 5FEQA 4RVKA 4ALUA 5DR2A 4GYGA 3BELA 4WA9A 4MEDA 4DGMA 1WFCA 5BVFA 3F82A 5IZFA 3R00A 2VWVA 3FL4A 3FMEA 4NKAA 2X6DA 3MA3A 4MWHA 3C0HA 5HCZA 4QQTA 4JX7A 5JT2A 2BZIB 4S30A 2F9GA 4QTAA 2XJ1A 5CI6A 3QXOA 3WI6A 2VWIA 4TTHB 2QR7A 4P4CA 1J91A 3QU0A 4GG5A 3A7GA 3OCTA 1PF8A 3BQRA 2XCHA 4D1ZA 4RC4A 4FR4A 4ITJA 4ZTSA 4ENYA 4YPSA 3R7EA 3SXRA 5J87A 4MKCA 3VS4A 4HGLA 5LARA 3ZZWA 3LW0A 3DOGA 5AV0A 2OG8A 5AA9A 5HE3A 5IEYA 1H01A 3HA6A 4BCMA 5LVNA 1Z5MA 1SNUA 2JBPA 1PXKA 2P4IA 3DLSA 4FSUA 4G1WA 3UNJA 5A9UA 4Y46A 4ZLYA 2RL5A 4G9RA 4KB8A 3H9FA 3EQDA 4DGGA 5BVOA 4WD5A 5HZNA 3CCNA 2QCSA 3IW5A 4ZLOA 4YURA 4LGHA 3ORXA 4G2FA 3MY5A 1Q8ZA 4BCOA 1G5SA 5D11A 4ZK5A 5BX0A 1ZARA 3UJGA 3ANQA 4MXCA 2VWBA 3OTUA 1S9IA 2W06A 3GU8A 3U6JA 4MBLA 3ZMMA 3F7ZA 4TWCA 4AG8A 5CEOA 4Z7HA 4F9AA 3MB7A 2UW7A 4MXZA 1UA2A 4IFGA 4Y83A 3C5UA 3F66A 4EZ5A 4CCBA 3HV5A 3LM5A 2WEIA 3V01A 4ZSAA 4I6HA 2DQ7X 3SOAA 2W05A 1YVJA 3VULA 4CZTA 4D2TA 4I0RA 2NRYA 3W2PA 3W8QA 2PVRA 5IA4A 2WTIA 3VBVA 2V0DA 3PY1A 3HRCA 1IASA 3H3CA 3G6GA 3OTVA 4L53A 4FIEA 5FP6A 4BCGA 3T3VA 3H10A 4YZCA 4YJUA 2C6TA 3RWPA 3DAJA 2XJ0A 2YDJA 4KA3A 1JWHA 3G0FA 3R71A 3VIDA 5G1XA 4C61A 5HBJA 4BI0A 3KXMA 2UW4A 2XNGA 2VX0A 4U0IA 2WD1A 1XHAA 3UOKA 5J9LA 4ZXTA 4R7HA 3QAME 5AMNA 2BDFA 2VTMA 3MH3A 3UPXA 5EW3A 4BB4A 2Y7JA 5HE0A 4O0XA 4AOIA 2DS1A 4UX9A 5I3OA 1ZAOA 5AP0A 2QR8A 4JRNA 1OM1A 2PTKA 3MVJA 3TV6A 2GNHA 4XG2A 3OOMA 3U9CA 5BVDA 2UVZA 4RJ5A 3WF7A 5KMJA 2C6MA 2UZEA 3PIYA 1XH5A 5HI2A 3GVUA 4QP4A 4GVAA 4PF4A 5KMIA 3GU5A 4KS8A 1P5EA 4CXAA 4ANNA 1YWRA 3CQWA 4RVTA 2XK9A 4G34A 4DEAA 5CAVA 1Q5KA 1YHVA 4XBUA 4HCTA 5DGZA 4GJ2A 5HHWA 3W1FA 4ARKA 2YHVA 4ANQA 4DH7A 4L44A 2WQMA 3KC3A 3QQLA 4R1VA 4EOKA 2ITUA 5KHXA 4FNZA 2QQ7A 3AG9A 4EHEA 2HELA 5GJGA 3KMWA 5T3QA 5HVKA 4M69A 2JKMA 2J90A 4NFNA 4ZTRA 3AT3A 2CGUA 4M97A 4O2PA 1FGIA 4GK3A 4MD9E 4CT2A 5KE0A 3NCGA 1YHWA 2ZYBA 4D4SA 5KO1A 3KQ7A 3QQFA 2QC6A 3QUEA 2E9PA 4FUYA 4YHJA 2VWXA 1IRKA 3QF9A 3AC1A 3ZZEA 2VTOA 1SVGA 2HW7A 3OY3A 5M56A 3QCSA 4B9DA 4BTMA 1VJYA 3M42A 1BYGA 4Q9ZA 4FZAB 3TZMA 2XNMA 2IZUA 4BGHA 2BUJA 1A9UA 3EMGA 3MPAA 5C03A 4YZBA 2PVLA 4YTCA 1KE5A 2O8YA 3OEZA 1XJDA 4LRMA 3RPSA 1PMUA 4FTRA 2WTDA 1FOTA 5L2SA 2JITA 5JKGA 4BBMA 4CFNA 5AP4A 2Z7LA 1V0BA 3IOPA 4O38A 3BQCA 3FSFA 4LFIA 3CTJA 4J8NA 5EHLA 4BCJA 5AADA 2J51A 4GU9A 3O2MA 1OITA 4GV1A 3TTIA 4BICA 2F57A 1MRYA 4TWOA 3R7VA 1JOWB 3WZEA 2QOOA 3TZ8A 3DT1A 4W9XA 3HMOA 5IF1A 2X2KA 1URWA 2XK7A 4L7SA 1MQ4A 3BYSA 4MCVA 4G3DA 1M2RA 1M17A 2XVDA 1VYZA 4PDPA 2XK6A 4YBJA 3VS0A 4C8BA 3FMJA 3Q53A 4X3FB 4O0YA 1TVOA 1LR4A 4JDKA 3FPMA 3MPMA 4R7IA 4FL3A 2ITWA 3TNWA 4X3FA 5I3RA 4UMUA 4ZTHA 4D4VA 2FO0A 2GPHA 2EVAA 2GMXA 4EUUA 4GFGA 4CRLA 2ERZE 4DEHA 3QRJA 1W83A 2QONA 1M2QA 5CT0A 2A98A 3Q9YA 4XG4A 5AV4A 3MYGA 4LQMA 4HVHA 3I5NA 4BKZA 4E6AA 3VRYA 5IEVA 3TUCA 4FV0A 4IE9A 4H3BA 4BTFA 4M14A 4YUQA 1H4LA 4Y5QA 5C9CA 1CM8A 3KMMA 5HD4A 4D2PA 2XYUA 5DVRA 5TE0A 5IH6A 2WMQA 3EQPA 3C4FA 5J8IA 4FMQA 2IZRA 4C2WA 2PZPA 2BRBA 3BYUA 4JS8A 4Q9SA 4QMUA 4BZDA 4EH6A 1CDKA 3LJ2A 4S33A 5K5NA 2R3QA 3SA0A 2YDKA 5H8BA 4RFYA 5DN3A 4H3PA 2WB8A 5JGDA 3CTHA 3R73A 2BDWA 3PIZA 5CTPA 5CT7A 3RWQA 2A1AB 3MPTA 4IAIA 3UODA 3F3UA 1KE7A 3Q6WA 1H0VA 3TNHA 1BUHA 1URCA 3I0QA 3OW3A 2QOIA 4O6EA 4AACA 4KRDA 3NX8A 3PXZA 3W16A 3A7FA 3G2FA 4FOBA 3EQBA 3VAPA 3D94A 4HZRA 2G2HA 4L43A 4NKSA 3ZONA 5D7VA 5IA0A 4TT7A 2PL0A 4E1ZA 2OJJA 3VBXA 1V1KA 4LV8A 4AZWA 1ZZLA 2JDVA 3C51A 3NAYA 2PE1A 4FVPA 3UYTA 2XK3A 4I5HA 3U6IA 3UC4A 2XMYA 4U40A 4N0SA 5CSVA 5HG7A 1VYWA 2Z8CA 3B2TA 3WOWA 3F5PA 5L2WA 3GC9A 4CMOA 4MF0A 4DYMA 4TY1A 3ZLYA 4XJ0A 4EQMA 4QMYA 3DFAA 3Q4UA 5AX9A 5IEXA 3DBCA 1ZWSA 4C4FA 2GS6A 3Q9XA 1PYEA 3V5LA 2E9OA 2J0LA 3NUPA 1XH8A 3PWDA 2IW8A 2UZNA 2JKOA 4BCHA 3PJ2A 4YO6A 4CEGA 3R9DA 4TYEA 2ETMA 3ZFXA 2W4KA 2FYSA 4NM0A 4WO5A 2WMTA 4NU1A 4BCIA 4I20A 3F2AA 3PP1A 4EONA 4FT9A 4UV0A 4CV8A 4FZFB 4TZRA 3MSSA 2YLEA 3NYNA 1DAYA 2W9ZB 3G6HA 4LL0A 2OWBA 4FZ6A 3K3JA 4QQCA 5CI7A 4BF2A 1KOAA 4QT1A 4E3CA 3BHUA 3UIXA 2C5NA 3TL8A 3AT4A 4ZY4A 3DK7A 4XP0A 3FJQE 4UALA 3CE3A 5CZHA 3RINA 4JIAA 3R83A 4AA5A 5BVNA 4K11A 4XS2A 5E90A 4ZOGA 3O8PA 3C4XA 3LFSA 4FX3A 3VS6A 4E6DA 4UXQA 3P1AA 5L3AA 2GTMA 4IZYA 3UIUA 3DA6A 3FAAA 2QOLA 2VO3A 3FHRA 2VTAA 3OT3A 4OLIA 5KZ0A 3TZ9A 4LRKA 2UUEA 5M44A 3KK8A 2ITPA 3A7HA 4U79A 3OEFX 4AF3A 4DTKA 4B99A 4QMVA 5IUIA 4FNYA 4M66A 5DOSA 3KXXA 3R2BA 5AA8A 4IM0A 3F7WA 1OPJA 2WIHA 3GC0A 3MTFA 5FTQA 4BIDA 5LQFA 1ZMWA 4QPMA 1S9JA 3LXNA 1PW2A 2WTCA 3OWKA 4NW5A 4C3FA 5L2QA 3S2PA 3R6XA 4MHAA 4ERWA 4J52A 4YJQA 4CFMA 2QURA 2B7AA 3LCTA 3QTUA 4AP7A 2QOQA 3F3ZA 1WBTA 4V01A 2JIVA 2RSVA 3FMDA 4FUXA 4EOQA 5IA5A 5FLFA 4Y73A 4AA0A 4EHZA 3ZCLA 4ASEA 4B8LA 2FH9A 4UEUA 5DT4A 1Q8TA 2Y6MA 1UU9A 3KXNA 2VTRA 4XH6A 5GNKA 5I4NA 3ZM4A 4I4FA 1GZ8A 4RVMA 3SD0A 1JKKA 1OKZA 1QPDA 2WMVA 1Y57A 4QTDA 5FD2A 5K0KA 3ACKA 4KNBA 4AGUA 2JGZA 5L8KA 5DHJA 3TWJA 2HXQA 1H1RA 2R3JA 3P08A 3DKFA 3C0GA 1Q62A 4MNEB 4QTCA 3BYVA 1GIIA 2HY0A 3HDMA 4NZWB 5HBEA 3PZHA 2W99B 3QZGA 4FV4A 4NWMA 5CU3A 3P79A 3WZKA 4ANOA 4ENXA 5I9VA 4OGRA 2HYYA 4MNEA 4I4EA 3IDPA 3F5GA 2PVNA 4OTIA 4AOTA 3C4CA 3JY0A 3E7VA 2NRUA 2YCQA 4FV9A 4O0WA 3K5VA 4ZSLA 2RG5A 5CXHA 4TNBA 4PL4A 4FKRA 4MAOA 3NPCA 3D5UA 3RK5A 1XWSA 5CU2A 4QYGA 5HNBA 5E1SA 5KZIA 4YP8A 2YLFA 3QA0A 4I6BA 4XLIA 4YJSA 3ELJA 4HVDA 2UVXA 2FSTX 1YOMA 2C30A 1K2PA 2BCJA 2BRNA 2PMLX 5B2MA 5JQ5A 3L9PA 4DEGA 5LMKC 3DB8A 3I7BA 5A6NA 1JSUA 4JQ7A 5L8JA 3CEKA 3DKGA 2Z2WA 4AGWA 5HG8A 2H9VA 2W7XA 4WG4A 5CENA 3UO4A 2EXMA 4L3LA 5ETIA 2VX1A 4ZP5A 1W2CA 1XBBA 3I7CA 4PL5A 1BX6A 4RBLA 4AW1A 4CFFA 5A4CA 1Q8WA 4GUBA 5HIDA 4O4DA 3ODYX 4JXFA 4NM3A 4S2ZA 4I6QA 4LGGA 4A9TA 3MFSA 3ERKA 4B6LA 4F9YA 5HTCA 3UOJA 2JAMA 3IDBA 5IMXA 1T46A 4B8MA 3DBQA 2XNBA 3AGMA 2PHKA 4BTKA 5DH3A 3E3BX 1CTPE 1YI6A 3CKXA 2PMIA 2C5YA 4O96A 4IWOA 2QO9A 2X6EA 4KIPA 4IDVA 4GSBA 3ALOA 2R3HA 5HG9A 3KK9A 3AC2A 4Z3VA 4ZJVA 4L46A 5J95A 3LCKA 3R9HA 4U8ZA 3GCSA 3W2CA 4IAAA 4YJRA 3TKHA 4F0GA 1XO2B 2I1MA 3AD4A 3CIKA 1M2PA 2HY81 2ERKA 2WZJA 4BDCA 4FV8A 5C1QB 4QMQA 4ZSGA 3AQVA 3SVVA 4J99A 4LOPA 4TKSA 3V5QA 5AR8A 3WIGA 4R3CA 3FMNA 3UOLA 2I0EA 4R5YA 4BIBA 5AV2A 4AGCA 3Q96A 5LWNA 3R28A 1OVEA 3FPQA 4J8MA 3BU6A 3MH1A 3AT2A 3OXIA 2WU7A 2PVYA 2YIWA 3NLBA 3ORKA 4J53A 4R8QA 3QWKA 3ZRKA 3LQ5A 1MQBA 4FV2A 3RK9A 3UGCA 3P78A 4PPAA 4YMJA 2A4LA 2C6KA 2P0CA 4N70A 2CMWA 5CEMA 5KBRA 4FTIA 2O0UA 2EXCX 3C9WA 4AW2A 1SNXA 4IAZA 5DNRA 4I41A 2UW6A 4LUDA 4CMUA 5EKOA 3DK3A 1GOLA 3LMGA 2BRGA 2R3OA 4AN2A 5IKWA 4U3ZA 5D9HA 4CFXA 1ATPE 3AD6A 1QL6A 4BTJA 4IVDA 4EC9A 4WNPA 1SVHA 2QVSE 4FKIA 3S00A 3NSZA 3PXQA 5AR7A 3OP5A 3L8SA 1Y6AA 5CSXA 1T45A 3L9MA 3FY2A 2XBAA 1O9UA 4UMRA 3H0ZA 3IG7A 3V8TA 4C4IA 2UW8A 5LCKA 2XJ2A 3SW7A 1KWPA 2GSFA 3IOKA 4MXYA 5BNJA 4AGDA 1GZKA 3EQCA 5I9YA 5IDPA 5AR4A 5I9UA 2BHEA 5HLWA 4O0TA 2BR1A 3QYZA 3ZUVA 5EYCA 5AUTA 4O0VA 2O3PA 3TJDA 5G6VA 1IR3A 4C4HA 2WKMA 5BMSA 2X2MA 4E5WA 4USDA 1UNGA 2YITA 3Q52A 1RJBA 5CSWA 3DQWA 3KA0A 4D9TA 4LOOA 4C58A 2X9EA 3PVBA 3QZIA 4KIKB 2OIDA 1WBPA 3MDYA 5TT7A 4EH9A 4FOCA 5HX6A 1REJA 3LXPA 4XNEA 3G9NA 4HYUA 2B53A 4KIKA 4R6VA 3CJFA 4QYEA 5T6KA 2WFYA 3IQ7A 3QKKA 5AUWA 4EK4A 2RIOA 4H58A 3Q2MA 4YLKA 2RF9A 3Q4TA 4O27B 5D1JA 4B0GA 5LVMA 4YC6A 3A99A 3AD5A 4XG9A 3ORNA 3RM6A 5AR3A 3ROCA 3VS1A 4BBFA 4EK8A 3GC7A 2O64A 3BU3A 4B7TA 3GQLA 4DAWA 1H28A 3OY1A 4QMWA 4XOZA 5EI2A 5FXQA 3EHAA 3VBTA 4L00A 2XK4A 4YR8A 5CEIA 1WBVA 4JBVA 4FV3A 1R3CA 3TV7A 4DH3A 5B0XA 4EZ3A 5A4EA 2UZLA 3EQHA 3R1YA 5HG5A 3QZFA 3OZ6A 4WSYA 2BRMA 3ODZX 2QO7A 3DGKA 4W4XA 4YSJA 3UNZA 4EBVA 3QQJA 4ZTMA 4JDIA 2QHNA 5J5TA 5CNOA 3I6UA 2BZKB 1M14A 5FG8A 4GIIA 4D28A 1P2AA 3C4ZA 2QOBA 4FTNA 4BFMA 4BN1A 2X8DA 4QP6A 3W55A 2ZJWA 2W4JA 3QRKA 3V04A 4FSTA 4YPDA 3VS3A 5JSMA 4JLCA 2VD5A 4P5QA 2GS2A 2P2IA 1QPEA 4U6RA 5B7VA 3B2WA 2R3PA 3PA5A 1JNKA 1OPLA 4O0SA 1AD5A 4R3PA 3PJ8A 2PVJA 4HGTA 5IH5A 3CY3A 3E8EA 1O6LA 4AN9A 4U7ZA 4C4JA 1X8BA 4FTLA 2OKRA 2RFDA 4GU6A 4JL9A 2JFLA 3R7OA 1DI9A 4NCTC 4YHFA 2HWPA 3NW5A 2G9XA 3FQHA 4U43A 4X6RA 4FTJA 3SV0A 5J9YA 4IXPA 5FXSA 3FZ1A 3RPYA 5CF6A 4D2WA 2C3IB 4JDHA 3RVGA 3VBQA 4J95A 3ZRMA 2OZAB 3PPJA 2ZMCA 4YNEA 4TYGA 4QP8A 2YAAA 4BBEA 4OR5A 3DY7A 2Y9QA 2HW6A 2OZAA 3RTPA 5EOLA 4BDGA 4DFYA 2C5XA 3WARA 3FLYA 3QGYA 2WQEA 5JGBA 3IW7A 2PZRA 2X0OA 4AX8A 2BHHA 2VZ6A 3VS7A 3TCPA 1ZMVA 1K3AA 5C8NA 4GL9A 4M3QA 5A4LA 3PG1A 3LFFA 1KE6A 2BDJA 3JS2A 4FKPA 5ANJA 3UVRA 3C4WA 3FDNA 5KMMA 4UWCA 4L3JA 3DJ6A 4RIXB 1DM2A 2QHMA 4FSNA 3O8UA 3NCZA 5EHYA 3TKUA 4EKLA 4CZUA 2B55A 4EOLA 1WAKA 4EYMA 3FHIA 4RIXA 4YLLA 3V51A 4RWJA 4BHNA 3MH2A 2BPMA 3PXYA 2PUUA 2EB3A 2GCDA 4ALVA 3DZQA 4XYFA 1PXLA 4PRJA 3PFQA 3QLFA 3AXWA 4M68A 5AP5A 1SZMA 3GCVA 4W4WA 2X7OA 1OPKA 4FNXA 5DRBA 1Z57A 3SAYA 4L42A 5F9EA 3JXWA 4PTCA 1RE8A 4RT7A 4AZFA 1Q61A 1TZDA 5ACBC 4FBXA 4C34A 5IA2A 5ANEA 4F1MA 3MW1A 4D5KA 3FZTA 4JDJA 5DIAA 1Y8YA 4TYJA 4L6QA 3FXZA 4PNKA 3LJ0A 1NXKA 5BYYA 3HV3A 2ZV7A 4OBQA 4QP9A 3GU7A 2ZVAA 3CD8A 3VUDA 4HPTE 4P5ZA 3UE4A 4GFOA 1ZOGA 3R63A 4G3FA 3LCOA 4OBOA 5K9IA 5DWRA 1W2FA 2B1PA 3ZEPA 2FSOX 1FMKA 5CQUA 1JPAA 3IW8A 2QKRA 5JGAA 4YLJA 5DEYA 2VU3A 2WEVA 4Y5HA 4FV1A 4C0TA 1LUFA 3N51A 3F3WA 4QP7A 3NRMA 4FG9A 3FC2A 5CAQA 2BAQA 3AC8A 4F08A 1H25A 3KMUA 2ZM3A 4RLKA 2B9HA 4EK5A 3TKIA 3S3IA 4HW7A 5CAPA 3PY3A 2XNNA 1NVSA 2GU8A 4HYIA 2ITQA 4DFNA 4U80A 5H8GA 3NNVA 1Q41A 4NEUA 4DITA 5DFPA 2SRCA 2ITOA 2XKDA 4FL1A 3W32A 3F3TA 4ZZNA 2XF0A 3EQRA 2J0IA 2QOHA 3L8XA 5H2UA 3G51A 4MVFA 5J5SA 2GDOA 2WO6A 3OBGA 4V04A 4C4GA 4DHFA 4AU8A 5EDRA 2A27A 3IPHA 4IB5A 3RPOA 2EUFB 3EZVA 3NW6A 2E2BA 4JT3A 3HP5A 2XCKA 5LMBA 3D7TB 4AUAA 3MJ2A 3U4UA 1XBCA 4FTUA 3L8VA 2W1FA 3QRIA 3DZOA 3BBWA 3RK7A 3D7TA 5CF4A 3FI2A 3ZFYA 5F94A 1PKDA 1OL1A 4EH5A 3R1SA 3ROYA 4CRSA 4O1OA 3EFKA 4GIHA 3BRBA 2V55A 3DDQA 4QOXA 2OW3A 2VWYA 1CSNA 4FTKA 2G2FA 3GU4A 2YIRA 1PYXA 2ONLA 3BGZA 3VUGA 3PG3A 4XX9A 4N6ZA 3W33A 2BAKA 2ITYA 3A7IA 1JSVA 4A9YA 3WF9A 2IJMA 1U54B 1K9AA 1O6KA 1ZYSA 2J0JA 4U3YA 4DEIA 4C57A 2W5AA 3DCVA 3GC8A 2W1CA 3M11A 1U54A 3HX4A 2H34A 4P2KA 2AYPA 4PTEA 3LZBA 4QYFA 2QLQA 3HV7A 3K3IA 4M8TA 5HVJA 5HE2A 1XBAA 5JFVA 2R2PA 3NZ0A 4EORA 4IFCA 4BI2A 2C68A 4EOSA 2BRHA 5JFWA 1PMVA 4XBRA 5JRQA 5KMNA 4GT3A 2OF4A 1GAGA 2CKEA 2X8IA 3EKKA 3A8WA 4YZNA 2R0UA 1QMZA 4EOJA 4FYOA 3VWAA 2OFUA 5L2IA 1FVTA 2PVFA 3VW6A 1BL6A 4IACA 3TACA 2JLDA 3ZFMA 2Y6OA 3OG7A 1ZZ2A 4M69B 4F6WA 3TN8A 3UC3A 2J4ZA 2RG6A 3AMBA 4FTTA 5AV1A 3GUBA 3KKVA 2F49A 2GFSA 3BEGA 5EOBA 4H36A 2C3JA 4K9YA 3O51A 1Q3DA 2QG5A 3E5AA 2YAKA 3IGGA 4U81A 3R7GA 3HRBA 1U4DA 3CKWA 1P4FA 3ZBFA 3NEWA 3F61A 1PMEA 2FGIA 2VO7A 3HECA 4ID7A 4EH4A 3FKOA 5CY3A 4BDKA 4CCUA 4F4PA 3A2CA 1YDTE 3R8LA 4I5CA 3O8TA 4C3RA 5EKNA 3C13A 4RJ3A 3ENHA 2UZOA 3NNUA 4AZEA 2DUVA 3CLYA 3U4WA 3JPVA 5CS6A 3R8ZA 4RWKA 3LVPA 1FVVA 3IKAA 4QMSA 3R8MA 3R8VA 3RP9A 4FG8A 4UB7A 3OWLA 2C6DA 3I79A 4FTMA 2AC5A 3QXPA 5TKDA 3UBDA 3EN6A 2XNOA 4GCJA 2V7OA 5E92A 5FDXA 4IEBA 4JI9A 4MQ2A 3NW7A 2VTIA 2E9UA 2PMOX 3CGFA 4CQGA 2X4ZA 2J2IB 3FYJX 3NWWA 4NM7A 1OECA 3BI6A 4ZSJA 5J79A 3QLGA 4BCQA 4FIHA 4U45A 4F6SA 5JEBA 2IW9A 3THBA 2W1EA 3PVWA 4EQCA 3FZSA 2R4BA 3ZU7A 5E8SA 4EHVA 4FA2A 1OUYA 4HNIA 3BHYA 4XLVA 3KRWA 3BHHA 1W84A 3Q32A 4DEEA 1PXJA 1ERKA 2ZV2A 3DXNA 3FBVA 2CCIA 3ORIA 3FZRA 4J7BA 4ANLA 4EK3A 3E93A 4LGDA 4M84A 4RGJA 1PKGA 4AFEA 4E6QA 4ERKA 3GU6A