3POOA

Human camp-dependent protein kinase in complex with an inhibitor
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
337
structure length
331
Chain Sequence
SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title fragment based drug design on PKA
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 109
structure length 331
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3pooA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pooA02
4IVCA 1KWPA 3KRWA 4R1YA 5K4IA 3H30A 4EOOA 4IDTA 3HUBA 4H3QA 5J5SA 2YACA 1BKXA 4IXPA 3VS7A 5EM8A 3A7GA 4F64A 1BX6A 3SQQA 4F1OA 4F7SA 4IB5A 3HV4A 1UNLA 5HQ0A 2XCHA 5DN3A 4KAOA 5IA3A 3ETAA 4HZSA 4NM0A 2YM3A 3AC4A 3ACKA 3FC1X 4G31A 5CALA 4CQGA 2WQOA 4YHTA 2BRNA 3EKKA 1OIYA 5J79A 3FQEA 1MUOA 3E5AA 4IC7A 3OXZA 2OH4A 4XV2A 2C3KA 4MWIA 4PDOA 1U5RA 2PE0A 4PUZA 1BI7A 2BVAA 4WKQA 4YGAA 4C38A 5E1EA 3FZSA 2OLCA 4FV1A 2YM7A 5JGAA 4NCTC 1M2PA 2WMAA 4LYNA 2W9ZB 2BZHB 3R83A 3DLSA 3L8XA 4M13A 2YEXA 3CLYA 3LFNA 3R04A 2V22A 4RVMA 2FYSA 4YHJA 4U41A 3RI1A 5CEQA 5CF5A 4L3PA 4J52A 3R1NA 2WZJA 3BYMA 3E8DA 3ZSHA 3FPQA 2Z7LA 4TKSA 3O0GA 5HVYA 1NXKA 2YCFA 5A4CA 5EH0A 3HKOA 2OW3A 1TQIA 2WTWA 3O71A 4I92A 1ZOHA 2DWBA 4IFGA 4YJSA 3DNEA 3A4OX 4YC8A 4YJUA 4BL1A 4DH8A 3E92A 4F0GA 2A2AA 4WNPA 3LFSA 2QKWB 4XMOA 3UG1A 4XEYA 1MQ4A 3NRMA 3DZOA 5CF8A 5FBOA 3G9NA 4BI0A 1MQBA 5LXMA 1KE7A 2WD1A 3GCUA 4UY9A 1ND4A 1REKA 3RCDA 4GKHA 3KULA 4TYIA 5HICA 3TIZA 4RIYB 3ZTXA 2PE1A 3QRJA 4B4LA 4XRJA 4LV8A 4YP8A 4RFZA 2W1ZA 4FKOA 5LARA 1WZYA 3IK3A 1YWRA 2VWYA 5EM5A 4C3PA 2HCKA 4PWNA 3Q60A 1TQMA 2C6OA 3MYGA 5HIDA 5ANEA 2J51A 5AR5A 5C8NA 4L53A 4WNMA 3TKHA 4IAAA 4KABA 2B54A 4UWCA 1KV1A 3FLQA 5EW8A 4EH8A 4FIJA 2WELA 3TACA 5FTOA 3O50A 5IH4A 2X7OA 2VWZA 4RRVA 4M7IA 4G34A 2GS2A 4OTPA 2WEVA 4RBLA 4YMJA 3D0EA 2I1MA 2WOTA 1BUHA 4FUYA 2B52A 3G0FA 2Q0NA 4XLVA 4EHEA 4GU6A 1YDRE 3DA6A 3F9NA 2FB8A 3FQSA 1U46A 3MVLA 4KIQA 3UVRA 4BGHA 2XIKA 2XIZA 4FTIA 4RA4A 4X3FA 5AV2A 5C27A 2RFSA 2G01A 2OGVA 3PA5A 4U81A 4JOAA 3FXZA 4NFNA 5H8GA 4YO6A 3EQGA 4USEA 1QPCA 2IW8A 2Z8CA 5K0XA 4EI4A 4EHZA 3DU8A 2WAJA 2GSFA 2QOFA 3N4TA 3SC1A 1ZWSA 2B9JA 3P78A 3K2LA 5K5NA 4IE9A 2EXCX 4K1BA 3CPBA 3EB0A 4C0TA 4V0GA 3AG9A 4MXYA 1HCKA 4I1ZA 4RIWA 3UJGA 3R8LA 3ALOA 4AE6A 4EK3A 1G8SA 4XP2A 4ASZA 4EWQA 3DFCB 2UZDA 4DYMA 4O7TA 4PMPA 2RIOA 4NM5A 3V04A 3FI3A 3MY0A 4D9UA 5TF9A 2X8IA 5J7HA 5L2WA 2CNUA 5CF6A 5KE0A 4IH8A 4FV0A 3R7GA 1W83A 3R8ZA 4M84A 2YJSA 2YFXA 3MDYA 2XNNA 5HBHA 3F69A 4O7RA 2ZMDA 4FKJA 3L1SA 3OY3A 5FD2A 3HEGA 4C33A 1Y6BA 2JKOA 4ACGA 4F7JA 3EQBA 4MVFA 5HEZA 3GUBA 2WTCA 4XBRA 4F1MA 2V62A 4AZSA 3MIAA 3F6XA 3PIZA 2BZJA 3PY0A 3P9JA 3DDPA 4U97A 4D0WA 3G15A 3SGCA 3CTHA 3PYYA 4B6LA 4EH9A 3R71A 3RM6A 2QKRA 3A8XA 1ZY4A 4OTHA 4RT7A 4X2KA 3ULZA 1W82A 2OI4X 5HCXA 3UTOA 5CEMA 2HWPA 3QQKA 3R28A 3RVGA 4GV1A 2VWVA 4FBXA 2X4ZA 2XK3A 2UZUE 4NFMA 2EWAA 4RIYA 4U0IA 4FV9A 3BE2A 1PXJA 4TZRA 3OUKA 1SVGA 4L45A 4AS0A 3WF7A 4QMQA 5GZAA 4DINA 3IW4A 3D5WA 4UMPA 3QWKA 1Y8GA 5HBJA 4D0XA 2Z02A 4ZIMA 3ZC6A 2NRYA 3W2QA 2VTOA 2VWBA 2WMRA 3EQFA 3KVXA 3LJ2A 1J7LA 3D83A 4NKSA 2BRMA 5AP4A 3CIKA 1LEWA 4PRJA 2IJMA 5CU2A 4Q9ZA 2CN5A 4WUNA 3R7IA 5AAEA 3A8WA 2JFMA 3POZA 4AWIA 3A99A 3W10A 4TW9A 4D5HA 5AEPA 3G2FA 5CNNA 1NVQA 2F9GA 3FLNC 4X0MA 3QD4A 5IF1A 1JQHA 2IO6A 4ZJVA 2JDVA 3FSKA 4RC3A 4Z9LA 3C50A 3EMGA 2GNIA 2I0VA 2PK9A 3H0YA 1VEBA 5DPVA 4F99A 1UU9A 1VJYA 2H96A 2Y6MA 3D7ZA 3LOKA 4H05A 4IM0A 4BWXA 5DG5A 4C2VA 4ACCA 5A6OA 3LFEA 1PMNA 3NX8A 2X9EA 4FSYA 2BKKA 3HLLA 2HK5A 4XV1A 3DKFA 4AT4A 2VUWA 3NYNA 3U4UA 2YCSA 3VUDA 3UC4A 2QLUA 3V5QA 4UMRA 3A62A 5AA8A 1HOWA 3O96A 2C69A 3AD4A 3M42A 4F6WA 3NWWA 2R3IA 2Z7SA 3EN6A 4Q5HA 4B0GA 4B99A 4YJOA 5HO6A 4AGWA 5L2IA 2Z7QA 4TWPA 3KXHA 1FQ1B 3POOA 4IM2A 3QZHA 3PVUA 4HPTE 4AGDA 2XK9A 4NT4A 4YLJA 3OW3A 5AP6A 4AOIA 5C26A 4Z7GA 4ONAA 2HZNA 2OZOA 4LGGA 4OLIA 4DF3A 2C3LA 1IA8A 4MBLA 1P14A 2WMQA 5J1WA 4IMYA 3MJ1A 4FKQA 4CMUA 3OP5A 4R5SA 1DI8A 3IOPA 3KVWA 3PLSA 3QQLA 3ZBFA 1PXNA 1IAJA 4FTAA 5CI6A 2F7EE 4LRJA 3DXPA 5CEOA 3C4FA 2XF0A 3LFBA 2ERKA 4BB4A 4JG6A 3BV2A 4MF0A 4PMSA 3ZOSA 4RC2A 1OKYA 4DFNA 2CKQA 3P7BA 1JVPP 4GG7A 4M12A 3FYJX 4O22A 5HIBA 4BIBA 4X21A 5A6NA 5KMNA 1Y8YA 2VTNA 1UKHA 3KA0A 3ZSGA 5BUEA 5LVLA 5EDRA 4O38A 5BVOA 4L7SA 2YJRA 5AP7A 2BCJA 4Z16A 3TDVA 3E93A 2AUHA 2JD5A 4UWYA 2X2MA 4Y85A 3SVVA 5E9EA 2QNJA 4J99A 4K2RA 4TWOA 1J7IA 5ICPA 2FSMX 4XOYA 3ODZX 5AP3A 4BCNA 2DYLA 3EKNA 4RJ6A 3F7ZA 5CX9A 5DI1A 5E90A 4QYEA 4QMZA 3ZFXA 2W1GA 5KHWA 4H36A 3BYUA 4WIHA 1H01A 5CLPA 4IX6A 5EFQA 3VULA 5J9ZA 1UVRA 4JLCA 2VTTA 2UW7A 4I22A 2WOUA 4QMUA 2UUEA 3ZRKA 3OFMA 3TIYA 2R0IA 3CTJA 4GYGA 2OF2A 2QI8A 4E7WA 4NW5A 5CSPA 1L8TA 5GIPE 4KB8A 3K5VA 2GTMA 3R9NA 2XK8A 1Q8TA 2HWOA 2UW3A 3ORNA 3P5KA 3TN8A 1X8BA 3PP0A 2WQEA 5C01A 4O7NA 5IQGA 5BVKA 3SG8A 3ZLWA 5IQDA 4ZZOA 3LW0A 4KRCA 2OU7A 2WMXA 2PZIA 1AD5A 5BMMA 2PTKA 5HE2A 5JGBA 2EVAA 3BE9A 5HTBA 3RHXA 4DH1A 1PRYA 5AM6A 3CY2A 1ZYJA 4PY1A 5DMZA 3MFSA 3KCKA 5H8EA 4QD6A 3PVWA 2ONLC 3DJ7A 4JG7A 4MWHA 5FEQA 1YXVA 2P3GX 4AP7A 2CPKE 5CSXA 3FMEA 3R21A 3LHJA 4EOKA 1IG1A 4F70A 1R39A 5F20A 2ZMCA 4LGDA 4YJVA 3ORMA 3BYSA 5IUGA 3EQHA 3NYOA 3ULIA 4ZXTA 4HVIA 5FP5A 1MRYA 5HOAA 3P23A 4GT3A 4AZWA 3TUCA 4YJRA 3NPCA 3S2PA 4M8TA 5IEXA 5D9HA 4CFWA 3O7LB 3QD2B 5TR6A 2W1EA 3R63A 4F7NA 3QYZA 4XP3A 3V6SA 3ANRA 1J1CA 2G2HA 3HV3A 2XNMA 2OK1A 5KO1A 4YZCA 4YPDA 3D5XA 4AA0A 5AR4A 4D58A 3FE3A 1VYWA 2CGXA 4GH2A 1UNGA 4PNKA 4QMTA 3RMFA 1JPAA 4GW8A 4F7LA 3QD3A 3P4KA 5FEEA 2PVMA 2OZAB 2QO9A 3D7TB 3F7WA 4GVJA 3CGOA 4UYAA 4I20A 1ZOGA 2R5TA 4G3CA 4FYNA 4H3PA 1Q61A 4BDGA 4C62A 1Y57A 4AN2A 5E1SA 4MXZA 5AJQA 4FOBA 2GNGA 4FKTA 4U45A 4AOJA 4MD8E 3UO6A 3VN9A 4UYNA 2IPXA 2IZRA 4GVAA 4O0WA 5F1ZA 1Z9XA 2XNEA 3I81A 5KBQA 3DBQA 1GZKA 3Q53A 3HZTA 4J8NA 4AZTA 3FI8A 4AUAA 3HVCA 4QPMA 4CTBA 5DT3A 3TV7A 4LM5A 2ZDUA 2CN8A 4L00A 3CS9A 3ALNA 2G15A 4CTCA 1WVYA 4WG5A 3PIYA 4PNIA 1H07A 4H58A 5E8SA 2XKCA 3PSCA 2P2HA 3HDNA 4R8QA 3DAKA 2F7ZE 3EZVA 4A9SA 2OIDA 1TKIA 4C4GA 3AC3A 4ZLYA 2ITYA 3IONA 2PMOX 4B7TA 4FV3A 3V5JA 4KRDA 5TOZA 1IAHA 4MYGA 3MPTA 2RSVA 3U87A 4FA2A 2GCDA 3IECA 4EOLA 4M69B 3UO4A 5ANIA 4NYEA 2WMBA 3E64A 3ERKA 3LPBA 3ZUVA 3ZH8A 4KKGA 3QQGA 4J95A 3UP2A 1ZYCA 2WIHA 4QYGA 2R3MA 3W2PA 3PLAE 2GNJA 2DUVA 3PZEA 3W55A 4DEHA 1G8AA 3KMMA 4ZZNA 2E9OA 3NNXA 4FV6A 3VIDA 3F2AA 5JN2A 4PDYA 1Q41A 5KZIA 4HVSA 5FTGA 3R2BA 4BKJA 4E6CA 2UW5A 2BRGA 3SXRA 5L6WL 3T9TA 3AGMA 2CCHA 4OAVB 4A4OA 4FEWA 3VUGA 4C4JA 4XX9A 3QA8A 4BI1A 4EUUA 4HNIA 5CZIA 5AUXA 4Z3VA 2ITXA 3QBNA 3QCSA 3R2YA 3PXFA 3DB8A 4FZFB 4JAJA 4QNAA 5FEDA 4EH2A 2GQSA 5AIRA 4BBEA 4IZ7A 3CSVA 3RK5A 3C51A 2ETKA 1KSWA 3GU7A 3KKVA 3AOXA 4UEUA 4I5HA 3SLSA 3TJDA 4GU9A 4A06A 4FSQA 5B2MA 4L43A 3VS5A 3FI4A 1R0EA 1KV2A 2V0DA 3KXMA 2XYUA 4FKGA 2R0UA 4O21A 3WF5A 4JBPA 4Y83A 2W4OA 5EQPA 2CSNA 3FZ1A 3OY1A 2YDIA 4ZAUA 2QU5A 2JIVA 2ITTA 4S30A 3HYHA 2WTKB 5IA0A 2BHHA 1OL2A 2VZ6A 1BYGA 5JZJA 3D7TA 4RIOA 2UV2A 1XH5A 4FKIA 3WF6A 4AN9A 1SNUA 3OOMA 4W8DA 4ZS4A 4JX7A 3N51A 4GYIA 4ACMA 3GC8A 2J0MB 3GI3A 5H2UA 1H1SA 4I3ZA 2J9MA 1Q97A 3IO7A 5ACBC 3NIEA 1R3CA 4X2JA 3OCGA 2XZSA 4FG8A 3AC1A 2ZM1A 3K5UA 4TRLA 4WA9A 4D2WA 3NZ0A 5JRSA 1P2AA 1VR2A 2C5YA 3D14A 4II5A 4QO9A 4C02A 3GEQA 1OITA 2YZAA 4PDPA 3F82A 4QYYA 4F9CA 3QU0A 2C4GA 1IA9A 4X6RA 4IZYA 3GNIB 5AP0A 1XR1A 3MN3A 4QQJA 2J4ZA 3OEZA 4FZ7A 3FWQA 3QUEA 4RWIA 1Q8UA 3NUNA 1SNXA 4BCKA 4TYHB 3Q2MA 4BDJA 1YI6A 3MVMA 4DFLA 4FTLA 2HXQA 3KGAA 1STCE 3OUNB 2X6EA 2B55A 4D2TA 1WAKA 4FSNA 3CC6A 4C34A 2VX0A 3PIXA 2R3LA 4M69A 4QP1A 4WSYA 3Q9XA 5IMEA 1H8FA 4YUQA 5ACKA 1KOBA 1MP8A 2G2IA 3PVGA 4TN6A 3TNPC 2YDKA 4AZEA 2YHVA 4EOPA 3WE4A 2WMVA 3FPMA 3MTFA 4I5CA 3RWQA 2V7OA 3AGLA 2J50A 3C4EA 4G1WA 3VUTA 4AW2A 5M56A 3ID6C 1LR4A 2AYPA 3MVHA 3LFCA 4YJPA 3TJCA 3LCOA 4FVQA 4C3FA 1OUYA 4FZ6A 3TNWA 3UOKA 2GS7A 4IWPA 1JAMA 4R5YA 4QP6A 5DBXA 3WE8A 4L67A 3DQXA 3EIDA 2I0HA 3G33A 3UOJA 4KIPA 5BQ0A 1M2QA 2WMUA 3VWAA 4ZTQA 3F88A 4ZSJA 3AC2A 4K9YA 4DH7A 4FMQA 4PQNA 3NLBA 4E6DA 3TXOA 4KBAA 4E6QA 4ZSAA 4ORKA 2PMNX 2WMTA 1R0PA 4DHFA 4FT0A 4RFMA 3C5IA 3AMBA 4HYIA 4FTMA 4N4SA 4LQMA 4DG0E 5D10A 3EJ1A 2GDOA 4QP2A 4I0RA 4OT5A 5IA1A 2Y4PA 4E1ZA 5BYYA 4FKPA 2ITZA 4D2RA 2B7AA 4M68A 4BKZA 4BCMA 2ZAZA 2XJ2A 5ANDA 5IKWA 3UC3A 2X1NA 3KXGA 3U55A 1OL6A 3WI6A 3LQ3A 1QCFA 3TTJA 3ZU7A 3R7YA 4O81A 3COKA 3LAUA 2B9IA 2QOKA 4GK3A 2GPHA 4M3QA 4DN5A 2HZ4A 3PJ1A 3LKMA 4G3DA 4DT8A 3C0IA 4DGOA 5EDPA 2LGCA 4DGGA 1UU8A 4R3CA 4FE2A 1O6LA 1PW2A 4GUEA 3HNGA 3L9LA 4EUTA 4FNZA 5L6PA 3R30A 4I93A 1Q3DA 4IVAA 4JQ7A 4AF3A 3QL8A 2FSTX 5KUPA 1OBDA 1GY3A 2JEDA 4HYUA 2OJFE 2XIRA 3C7QA 1KE9A 3V8SA 3OTVA 5D7AA 5DE2A 4DFZE 4DG3E 2ZV8A 2GFCA 3FMJA 4UXQA 1YI4A 3FMMA 4ASEA 2XRWA 2C6LA 3D15A 3KF4A 3LCKA 3HMNA 4JNWA 4JIKA 5IDPA 4TYHA 3PA3A 4QRCA 4BDCA 2UW9A 4R7IA 2WQBA 3PG3A 5A46A 4G3GA 4BIEA 3DZQA 4DE4A 4TYJA 5DRDA 3Q4ZA 1T45A 3RALA 2X9FA 5I5ZA 3FV8A 5HG8A 1GIJA 1OECA 5A4LA 3KFAA 4MCVA 5CAQA 3NAXA 4BDFA 3QKMA 1M17A 4O6LA 3KRLA 3ZO3A 4EZ5A 1REJA 4HCVA 3MESA 4O84A 2YITA 4EOJA 5GJFA 4O2PA 3CPCA 1H27A 3R0TA 4FV4A 3FQHA 1QPJA 3UMXA 2UW0A 3Q96A 2QCSA 4OTQA 3S3IA 3ZFMA 3QXOA 4ZTLA 4RFYA 4D5KA 2VO0A 3GC9A 4FIHA 2VO6A 2GS6A 2QOBA 1YDTE 3KXZA 3M1SA 4OTRA 4FV7A 4P4CA 4XG8A 4YBJA 2UZEA 1Y6AA 3ZCLA 4GFOA 2FSOX 4A9TA 2XRUA 3DAJA 1OVEA 2JLDA 5JFSA 2BRBA 2ERZE 4ZY4A 4KNBA 3IW8A 5A14A 4YJQA 4UXLA 4EH4A 3EQIA 5LVPA 5TE0A 5B7VA 4FGBA 3AT3A 3SX9A 2PUUA 5J5TA 4EOQA 4IAFA 3OBGA 3VF9A 3VRZA 4MKCA 1FVRA 3F5UA 5DNRA 5FQDC 2OJGA 3KMUA 2QOQA 3QTZA 3K54A 4EZ7A 2QOIA 5IQCA 3KRXA 2YERA 3K3IA 4JG8A 4WBOA 2P0CA 4BCJA 4W8EA 1PKDA 4GT4A 3C4ZA 4CKIA 4IAZA 3PPZA 2C5VA 3DK6A 5I9UA 4ZZMA 4IADA 2PZYA 1L3RE 2VU3A 3IW7A 3SDJA 3VQHA 1YHWA 2B9HA 3GCPA 4G3EA 4WG3A 3W18A 4A9RA 3QX2A 3D9VA 4FEXA 4X3FB 4CT1A 3DK7A 2UZVA 3I4BA 4MK0A 4YSMA 4BCOA 4XHKB 4O7ZA 4RVKA 1H1RA 3Q9WA 3WIGA 4ANLA 2YDJA 1J3HA 2OSCA 4KIKB 3DBCA 1F0QA 3CD3A 3PTGA 4G2FA 3C4WA 5CAOA 1OUKA 2BTSA 5LMKC 1GJOA 4O82A 3VS2A 5KHXA 4V0GB 2PUIA 4MXAA 5TT7A 3EYHA 3DJ6A 3I1AA 4RIWB 4FTOA 4BGGA 4V01A 1W98A 2CLXA 1F5QA 4CT2A 5M4IA 3C0HA 4Y95A 4DGMA 3U9NA 3FLWA 2WMSA 4ALUA 5FWKK 4CXAA 5C8MA 1Z57A 4OAUC 4PF4A 2UVXA 3P7AA 4PPBA 3DKOA 2WU7A 4DFBA 3QLFA 1UV5A 3LCTA 4NK9A 3DNDA 5JFWA 2QR7A 4O1PA 1YHVA 2BALA 1PXMA 4I0TA 5EYCA 4R3PA 3ORIA 3QUDA 1YXXA 4FK3A 2W1DA 3MJ2A 1DM2A 1ZMWA 3ZZEA 2ZB1A 5EDQA 4ANNA 3DFAA 3UBDA 4NU1A 1E9HA 4YURA 3UVPA 1PMUA 3VQUA 3TEIA 3ZZWA 4RVTA 3AQVA 4J71A 4C8BA 3AC8A 5IZFA 4EEVA 5HX6A 4EBWA 4BDEA 4QTDA 3F5XA 4FTCA 5JEBA 1PXIA 1YW2A 5IQAA 1H1QA 4BCHA 3BX5A 2ITNA 2C30A 4I0SA 3FYKX 5E8TA 5J9LA 4FZAB 1URCA 4O7LA 4EK4A 4PP9A 1G5SA 4FR4A 2UZWE 3Q9ZA 4O86A 2GNLA 2OH0E 3F3UA 4FF8A 3GQIA 4PDSA 3AC5A 4ZJIA 1FMOE 3UPZA 3HAVA 4BWKA 5DT4A 4EORA 2Y0AA 2W1CA 2ETMA 4AU8A 5BPYA 4IWQA 3TUBA 2GTNA 2JIIA 3W2CA 4OGRA 5ANGA 3MH3A 5DFPA 3U6HA 3S4QA 2YM8A 2OIBA 5L3AA 1ZLTA 5JK3A 4F1TA 4XUFA 5CF4A 1NVSA 4I6HA 4Y5QA 4YZMA 5CXHA 3ATSA 4I41A 5LMAA 5C4KA 1YHSA 3HDMA 2B0QA 5GZ8A 4KIKA 3DAEA 3NNWA 4K0YA 4RGJA 4AAAA 3LIJA 5A4QA 1OGUA 4JIAA 2C5NA 3RZFA 4BI2A 2A27A 4RWLA 3ENHA 2R3HA 4GUBA 2RFNA 3CJFA 5AUZA 4AGCA 1H24A 3C9WA 3O2MA 4QP7A 3SXSA 3DB6A 2J0KA 3A7HA 1T46A 5M06A 1W7HA 3ZYAA 5LOHA 2A4LA 4KINA 3WILA 4DBXA 1UU3A 5A54A 3UYTA 4GIIA 5L8LA 3R8VA 2WU6A 4F08A 3ANQA 3OVVA 2YCRA 3UOHA 2NP8A 4ZEGA 4EYMA 3ZM9A 4FSTA 5J8IA 3CY3A 2OXDA 5IISA 2FVDA 4IVDA 3NR9A 1JKTA 2X8EA 4QTBA 5I9ZA 5L4QA 5EW9A 5HGIA 4BCPA 4DA5A 4R3RA 3UP7A 1FGKA 2ITOA 4GSBA 3VS4A 4A7CA 4D4VA 1I09A 4FNWA 5DIAA 5E8ZA 2JFLA 2IWIA 2Q0BA 4E4XA 5FLFA 2CGUA 4JR3A 3RTPA 1B38A 4JL9A 3ZDIA 4BDKA 2OJJA 1NW1A 4KUJA 2WTVA 4IZAA 3RAHA 3QRUA 4WNOA 1LP4A 4APCA 1W84A 4EOIA 3IS5A 4E26A 2JDOA 2H9VA 4ZTMA 5M44A 3SW7A 5EI8A 4JDHA 2EB3A 2VTJA 2PUPA 4O96A 3R9HA 3I7BA 4E4LA 5JFXA 4HVHA 4YTHA 4EH7A 4F0IA 1KE5A 3PG1A 2PWLA 4PMMA 4FSWA 3D5VA 4IC8A 4U42A 4CYJA 1XJDA 3A60A 2ITUA 4PPAA 3PJ2A 3RINA 4BICA 3BYOA 4QMNA 2HY0A 2W4KA 2PVJA 1XH4A 2BPMA 3Q9YA 4R6VA 4L44A 2X0GA 4U44A 5E8XA 2XK6A 4KSPA 5TO8A 4G9RA 1WBNA 5DR2A 1JNKA 4PL4A 3B2WA 3GU8A 4OTFA 4XCUA 1YOLA 1FBNA 4Y5HA 5HCYA 3CBLA 3DPKA 5LVOA 4ZS0A 4DLJA 5L6OA 4I5PA 3Q2JA 4A9UA 2KTYA 2YIYA 5L2QA 2HZ0A 2JC6A 2PHKA 3IQ7A 4DEDA 2XM8A 3R6XA 4HW7A 4QYFA 3RCJA 5ETFA 2CGVA 4ZJJA 4EK5A 3QQJA 2VX1A 5CAUA 2ZDTA 4BC6A 4LOQA 2E9PA 4BCGA 2J0IA 4EHVA 3VS0A 3FHIA 3Q3BA 3FL5A 3LCSA 4U3YA 1YOJA 4S33A 3CQUA 3VHKA 4UN0C 4APPA 3BHYA 3OCSA 1ZZ2A 2C47A 4ZSLA 5M4CA 5FBNC 3TNHA 3DS6A 4FK6A 3NAYA 4LV5A 5T68A 3U51A 4YZ9A 4M67A 4K8AA 4HGSA 4QMYA 4RWJA 4TYGA 5HG5A 4NWMA 2PMIA 4GCJA 4NM7A 4U3ZA 4MAOA 1O9UA 3KRRA 4BCIA 5HI2A 3ZSIA 3D5UA 4O83A 1XBCA 5JT2A 2ITQA 2B1PA 3Q32A 2CLQA 3GU6A 3BHHA 3O8UA 2VO7A 4MQ2A 4FOCA 1GZNA 4M15A 4RJ5A 3MGYA 4EJNA 3GOPA 4ERWA 4QTEA 2GHGA 5HLNA 5HU9A 4NTSA 4MX9A 3KK8A 5EKOA 2FUMA 5IQHA 3FY0A 3W32A 4YLLA 5DHJA 3W2RA 3L9NA 5AAFA 3CE3A 4E4MA 2HOGA 5EKNA 3VAPA 4XYFA 4L01A 3H3CA 4FSUA 4MNFA 3ZXTA 2CNQA 3DDQA 1WBWA 2WKMA 3MA3A 5HTIA 4EJ7A 1XH7A 4WG4A 2C0IA 2QURA 3DQWA 2QOCA 3GT8A 2XUUA 4C36A 1WVWA 4D2VA 4TL0A 4YZDA 4E4NA 4FKUA 4YNEA 4CLJA 4HVDA 2CDZA 4BCFA 1Q8WA 2ZM4A 4WBBB 1O6YA 4KWPA 4OTIA 3MH1A 3ZLSA 4HCTA 3ORLA 2CHLA 4IIRA 5HIEA 3PUPA 3M2WA 4ANQA 4L7FA 4DTKA 2O63A 2PZPA 4JDJA 3Q4TA 2AC5A 4RIXB 3W2OA 4NW6A 4AA4A 3MWUA 3LMIA 4YC6A 4JI9A 1PHKA 3GCQA 3LFFA 4YU2A 1NT2A 5HESA 3MB6A 1GZOA 4NJ3A 2XEYA 3FZOA 3FZPA 3NYXA 4MXOA 4CG8A 5EOBA 5J95A 2VTIA 3PJ3A 2UZLA 3OWJA 4MD9E 1R1WA 2XKEA 4LGHA 3FI2A 2QOOA 4NIFB 3NEWA 4DTBA 5IMXA 4FL2A 4W9WA 5KBRA 4FEUA 1LEZA 1U5QA 4FV5A 2C1AA 4OR5A 3VBWA 2E2BA 4UMQA 3RM7A 3C5UA 2ZOQA 5D7VA 1JKSA 4J1RA 3MH2A 5HBEA 4D4SA 2ONLA 3QQHA 3EN9A 2FH9A 3IDPA 3TKIA 4AW1A 4ZMEA 4EHGA 3DBDA 4ITHA 2OICA 4ZSGA 5DVRA 4XG4A 1H4LA 4FIGA 2UZBA 2GHMA 3A4PA 2PZRA 3ORZA 3ENMA 1Q5KA 3VW8A 2R3RA 3WF9A 4CV8A 1QL6A 5ITAA 3T3VA 2OFVA 4W4YA 3QHWA 3GFWA 1GNGA 4YZNA 3RJCA 3ZDUA 1E1VA 3OCBA 5EI6A 4BYJA 2QODA 3EL8A 4G3FA 4G5JA 5CASA 5J7BA 3D4QA 1M2RA 3WZDA 5M08A 1YXSA 3LE6A 5IH5A 3MI9A 4GKIA 2IG7A 3KRJA 4CQEA 4KD1A 5HO8A 4AW5A 4LRMA 3H9FA 2XEZA 5HHWA 4F9AA 3E3PA 4TPTA 3G6GA 4O7SA 3Q5ZA 4IX5A 3W1FA 3WIKA 3BGQA 4QMXA 5HNIX 4DCEA 2HXLA 2O5KA 4MXCA 5HG9A 2H6DA 3E8EA 4QPAA 3ZC5A 3OCTA 4JDKA 3HMIA 5M07A 3VJNA 1S9IA 2O65A 2XK4A 3HX4A 4YBKA 3LCDA 2UZTA 3ORKA 3VUHA 2WTIA 3QKKA 4YPSA 4BBMA 1SVEA 4DFUA 2QVSE 2OJIA 3I6UA 3R73A 4E6AA 2F49A 3OBJA 4R7HA 4ACDA 1OL1A 1Q24A 2XNPA 2BDFA 3DOGA 4H1MA 4UWBA 4RX9A 1RE8A 3QQUA 3UNJA 4AW0A 5JQ5A 2WB8A 3OHTA 2EU9A 3G9LX 1A9UA 4NEUA 3REPA 4AOTA 5EQEA 3G90X 4IHPA 3VBVA 5IA5A 3ZEPA 4IW0A 4DEEA 2PUNA 4L8MA 3AD6A 2FSLX 2YAAA 4FSZA 4C37A 4HGEA 4O7WA 3C4CA 3TTIA 4RIXA 4NJDA 5CS6A 3TNQB 4C4FA 4E93A 5CU4A 5AV1A 3GU4A 5FP6A 3HA8A 3BLQA 2Y4IB 5AR2A 1FVVA 2VWXA 5D1JA 3VHEA 4W9XA 4QMVA 3QD0A 3JPVA 4NIFA 1I44A 3ZM4A 3ZRLA 4X2FA 1SYKA 5C03A 3SW4A 3U8WA 4EOMA 3UIXA 4DFYA 4FEQA 3RPSA 4CVAA 2XNBA 3MFUA 3S00A 2E9UA 3RNIA 3HV7A 4YZBA 1JWHA 2XP2A 4DLIA 2R64A 4QP8A 2IN6A 2Z60A 4ARKA 3W8QA 2IZUA 4G6LA 1YOMA 5C9CA 2VWUA 3FMNA 4P2KA 2BFXA 3CQEA 2VAGA 3LFAA 3GVUA 5T6KA 2JBOA 3HMMA 4AT3A 3QCYA 4R1VA 3BRBA 3FXWA 3R7UA 4JDIA 2PVLA 3VNTA 4KBCA 5CT0A 3TNIA 2YAKA 2QONA 2YWPA 3BWFA 5ANOA 5BYLA 2F57A 4IACA 5F95A 5DLSA 2V7AA 4IJ9A 4CSVA 2KULA 1J1BA 3WARA 3BU3A 4FTTA 5K3YA 4FEVA 2H34A 2QO7A 4Q5EA 3E7OA 5E92A 3VBXA 3F5PA 3VUIA 2PVYA 4C57A 1CDKA 2ACXA 2W5HA 1YVJA 2QR8A 4LFIA 3MY1A 5JZNA 4Y73A 2P4IA 2SRCA 4DEIA 3FSFA 2Y7JA 5AM7A 2W1IA 3FJQE 3FMLA 1WBSA 2PVRA 3OT3A 4ZSEA 3F5GA 5HORA 5HG7A 4IEBA 2QOHA 3G5DA 3KQ7A 2H8HA 3HMPA 3MY5A 4ZLZA 4FYOA 4USFA 2YIQA 5GINE 2WIPA 4WUAA 3UO5A 2ZJWA 5AIKA 4E20A 4QPSA 5KMIA 1IRKA 2XBAA 3CP9A 3NGAA 3BQCA 4BF2A 3DXNA 5F9EA 4C35A 2C5OA 1M7QA 4QP9A 5EM6A 5E8UA 3BZ3A 4F9BA 5ANJA 4BCQA 3ODYX 1UU7A 3QRIA 3VRYA 1U54B 3I5NA 1WBTA 5ETIA 3ORXA 1F3MC 2ZYBA 3BIZA 4I5MA 5HO7A 4TNDA 3RPYA 2BROA 3TCPA 3PZHA 5KKRB 4ZMFA 2VTQA 2O0UA 4F0FA 1ZYDA 1DI9A 3LJ0A 5AV3A 3DBEA 2QG5A 4JR7A 4C2WA 1HCLA 2VTLA 2YIXA 3I7CA 3QA0A 4BDAA 1FOTA 4FICA 2HELA 1ZZLA 2XM9A 5CWZA 1OPKA 4I4EA 4XH6A 4A07A 2J0LA 3EQCA 1CM8A 2C1BA 3LMGA 4O27B 4PL5A 3C1XA 1K3AA 5HLPA 4FODA 2O8YA 1CKIA 4CFFA 5CY3A 3FLZA 1BMKA 5LQFA 4G17A 5M4FA 2ESMA 3BWJA 4RJ8A 5CSVA 3VC4A 3B8QA 5I9YA 4X3JA 4RLKA 5E8YA 5GZ9A 3SXFA 3QTRA 4XRLA 1Q8YA 3R8MA 4UMTA 3HP5A 2Y6OA 3NW5A 4C59A 4U79A 4BN1A 4KSQA 5I3OA 3F3WA 4OUCA 4BWPA 3BELA 1IEPA 1FGIA 4EOSA 3LXKA 4GK4A 2I0YA 3OWLA 1OPLA 3BLHA 3NUAA 2OO8X 2VWIA 4Q9SA 4XG9A 5AMNA 3CR0A 5AR8A 1A06A 5AA9A 3NUUA 3OC1A 2GFSA 4JS8A 1J91A 4CMTA 3PPJA 2PPQA 4IB3A 4QMPA 3QALE 5H9BA 2RL5A 4FKSA 4PTEA 5E8VA 2VTRA 1PXLA 4AFEA 1SM2A 3RP9A 3QQFA 4G9CA 4D2SA 1TQPA 3E3BX 2EXEA 2Z2WA 3GGFA 4BZDA 5HLWA 2BAKA 1JKLA 3RPRA 3OOGA 1FMKA 3GXLA 4IX3A 4LMUA 4O0VA 1ERKA 5BVNA 1OL7A 1PXPA 4FTQA 3KY2A 5IDNA 4I23A 2BMCA 3MTLA 4B8MA 2VO3A 2C5XA 1H08A 1ZRZA 1P5EA 3FLSA 3L8PA 3R01A 4DEBA 3HV5A 3FMHA 3P0MA 4LG4A 3ATTA 2ZB0A 1NVRA 5C8KA 4O0TA 4YR8A 4TWCA 4LRKA 1V0BA 3HP2A 1G3NA 3WZJA 4PTCA 3Q52A 3QFVA 5B2LA 4TWNA 4HOKA 5LCJA 5CEIA 1OIQA 2W96B 3I6WA 2IZSA 2NPQA 4BHZA 1JBPE 5IA4A 4RVLA 2ZVAA 5K5XA 1PMEA 4H3BA 3R22A 4KS8A 3OXIA 3DGKA 3NYVA 5LCKA 3NVMB 3F2NA 3FKNA 3HV6A 1MRVA 2EB2A 3EWHA 3RAKA 4BVUA 3B2TA 4HYSA 2WTKC 3QZGA 4U43A 4XS2A 1U54A 5KMMA 4U6RA 1PMVA 5GJDA 3O17A 5HVKA 3G6HA 3GENA 3CEKA 3PRFA 4QMWA 3VUKA 5LJJA 4FG7A 2Z7RA 1WFCA 3UIUA 2I0EA 2WFYA 3F61A 4FTJA 5EM7A 4MF1A 2WNTA 3ROCA 4GS6A 3EYGA 5AP5A 4D1ZA 3Q04A 3PXQA 3EZRA 4OBOA 2BFYA 3FXXA 1QMZA 5CU0A 2WGJA 3DLZA 3EFKA 3KMWA 4F09A 5CT7A 5H3QA 3L8SA 4ENYA 1CKPA 5IH6A 2JAVA 2HW6A 4XG2A 4CYIA 2J90A 3NUXA 4D4RA 3OTUA 5IG1A 3ZEWA 2XH5A 3LJ1A 5DGZA 4FZDB 3PA4A 5BNJA 2JIUA 1A48A 3CKXA 1YWNA 4U8ZA 1K2PA 3ROYA 4DFXE 3KXNA 1PY5A 1XH9A 4ITIA 2YIRA 2XNGA 3R7OA 4CZUA 2QHMA 3R1YA 4WNKA 4DITA 4Q2AA 2OIQA 2BAJA 4RZVA 5CENA 4D2PA 2E9VA 2PZ5A 3A7JA 2R9SA 4TTHB 5CQUA 2GQRA 4FVPA 3F66A 2XYNA 4JXFA 3DBFA 3HRFA 1Q8ZA 3W16A 3IPHA 3QRKA 3OW4A 2G9XA 3PWDA 4RLLA 3UIMA 4BZNA 3C0GA 2PVFA 3TG1A 3UQGA 4BR3A 2J2IB 1XHAA 3FZRA 4MBIA 2BILB 3UMWA 4D9TA 4LUEA 5I4NA 3LXLA 5I9XA 5DRBA 4EQCA 1RJBA 2PVKA 3IDBA 4ZOGA 3RPOA 3ZO4A 4FSRA 3QGYA 1FINA 3I5ZA 4U7ZA 4QT1A 5AV0A 2JKKA 4P90A 2ZV7A 3KC3A 3TKUA 4IFCA 3ACJA 3KB7A 4IZ5A 3MVJA 4QMOA 3BU6A 4IB1A 3E88A 4PMTA 2VWWA 4RPVA 1WCCA 3EQRA 4L9IA 4QMLA 4CG9A 5C4LA 3DT1A 2ITVA 4DH5A 3PFQA 5M57A 5EHYA 3DKGA 3GCVA 3AMAA 3NS9A 2WTDA 3HUCA 2XS0A 1PXOA 4PX6A 4QMMA 2DS1A 3S0OA 5JGDA 5FDPA 5AV4A 4TYEA 4QTAA 2P2IA 5KMKA 2R3PA 4ERKA 4NCTA 4CV9A 3E8NA 1DS5A 5CZHA 4MD7E 3DJ5A 2A0CX 4QQCA 3KU2A 4G6OA 1LPUA 4F6SA 2PY3A 3WZUA 4OTWA 4EKKA 3PY3A 4WSQA 4BDIA 5CVHA 4EQUA 3MBLA 3R9RA 4DEAA 2CKPA 4BGQA 3QHRA 3R9DA 4KS7A 4A4LA 5GIOE 4N6YA 3TV4A 5DA3A 3VW6A 5I9VA 2VGOA 4RZWA 4RG0A 4XG7A 4GJ3A 2IZTA 2QQ7A 2YN8A 3DTWA 4FI1A 2UW4A 5KCVA 1M14A 4CCUA 4AT5A 3KCFA 3T3UA 5IUHA 5TKDA 4L3LA 2OXXA 4QNYA 5A3XA 5LMBA 3BI6A 1DAYA 4UMUA 4MH7A 4FT3A 3O7LD 5ANKA 4BTJA 1IASA 3OZ6A 3Q4UA 1SVHA 3LMHA 1FPUA 5CVFA 4CMOA 3JVSA 4IQ6A 4C4IA 3O8TA 2CNVA 3I79A 4U40A 1GIHA 2J6MA 5CAPA 5IQIA 2WQNA 3BU5A 5EYDA 2R7BA 3KN6A 2I7QA 4CZYB 4CCBA 1ZAOA 4MXXA 1OMWA 2W0JA 5G6VA 5ETCA 3TWJA 2JKQA 5L2SA 3UOLA 4ANOA 4D4YA 4FIFA 5LVMA 3FMKA 3KK9A 4WOVA 4FTKA 5J9YA 2I6LA 3EHAA 3LVPA 3VJOA 4BHNA 4FKWA 1V1KA 1JSVA 4OW8A 5H8BA 2JDRA 4KIOA 4IM3A 3TI1A 1OKZA 4GG5A 3AT4A 2CCIA 4O0RA 3T9IA 4B8LA 4LL0A 5CAVA 2OJ9A 5EK7A 5M51A 4DBNA 4W4VA 4YNOA 3N4UA 2C0TA 3FKLA 2A1AB 3NDMA 5AR7A 3ELJA 3OS3A 1R78A 3UNKA 3LXNA 5I0BA 3VBTA 2B9FA 3RK9A 3ZLXA 2FGIA 5ETAA 2CKOA 4EBVA 1OI9A 4S2ZA 4EK8A 3F3TA 3OMVA 2HZIA 2YM5A 3IOKA 5BVWA 1BI8A 4U5JA 5AUWA 5EYKA 2QLQA 3P7CA 1XWSA 1FVTA 4O0SA 3UGCA 3LLAA 2R4BA 4I21A 2OG8A 3AMYA 4P5ZA 1YI3A 5AX3A 1XKKA 3Q5IA 4KKHA 5LVNA 2YM6A 3CJGA 2C6EA 3A7FA 4ID7A 4NTTA 2OF4A 4DGNA 3S1HA 4EWHA 4J8MA 4PP7A 3IW6A 3DK3A 2QC6A 3NW6A 3QTIA 4RX8A 1H28A 5C1QB 3BHUA 4FX3A 3TUDA 2B53A 3G0EA 1Q62A 3IKAA 3MFTA 4X3FC 2HYYA 2BZKB 1GOLA 1KE6A 2VNWA 3HECA 3MB7A 4FSMA 4TY1A 4F65A 4CKJA 5CNOA 5CU6A 3FDNA 1H1PA 4CRSA 3AT2A 4WRGA 2VTPA 4IWDA 4H1JA 1WMKA 3UQFA 1B39A 2ITWA 3EFLA 3I0QA 5M53A 4WHZA 3SOCA 2XJ0A 1BLXA 1PJKA 3QYWA 2C6MA 1XH8A 3RPVA 3EH9A 1H25A 5BYZA 3JUHA 2IVSA 2BIKB 2XB7A 3GOKA 4BRXA 2RG5A 4AE9A 4BTFA 3QC9A 2Q83A 3JXWA 4J53A 3LFDA 5M09A 5K9IA 1LUFA 4M14A 4P7EA 2X81A 3QUPA 5DWRA 4IB0A 4CD0A 4TXCA 4JVGA 4C4EA 4ZTNA 1XBAA 4NZWB 2BAQA 3KF7A 4M0ZA 3LZBA 4E3CA 4FTRA 1Q3WA 2VX3A 1P4OA 4AG8A 1K9AA 1NY3A 1XBBA 3WOWA 5CANA 5FUTA 3SHEA 1OPJA 4C3RA 5CU3A 1OL5A 4ZY5A 1H00A 4FT5A 3ZUTA 4CEGA 3AD5A 3LM5A 3A7IA 4GL9A 4JAIA 4O91A 5FXQA 1CMKE 3V3VA 2GQGA 4D55A 4DCAA 1CKJA 3PE2A 4P5QA 3EN5A 3RKBA 2YLEA 3EQDA 3NSZA 1OIRA 3PSDA 4G6NA 5D11A 5GJGA 5BVFA 3I60A 2F2CB 4OTDA 2VTHA 2W17A 3OWPA 4R77A 1OB3A 4MTAA 3HGKA 4ZP5A 3RAIA 5IU2A 1UWJA 4MHAA 3LXPA 3QGWA 5J87A 4IAIA 4XG6A 5HD7A 1BL7A 3D94A 2OFUA 3IW5A 4I94A 2YZLA 4OT6A 1ZYLA 3HRBA 3UZTA 4AACA 2BRHA 3H10A 4BDHA 4FT7A 3GBZA 3R1QA 3BLRA 1Q99A 3CKWA 3P1AA 2VGPA 5FTQA 4CKRA 3RK7A 4DT9A 2W1FA 4RC4A 4AZVA 2PU8A 4MQ1A 3L8VA 4JBOA 4QP3A 2J7TA 3NUYA 4ANMA 5A9UA 4M66A 5IQBA 2W4JA 3QCXA 3TZ7A 4YTFA 2BHEA 1PYEA 3PP1A 3UZPA 5FRIA 2NO3A 4EH6A 2RFDA 4KKEA 2VRXA 3OXTA 2OWBA 3VS1A 5HTCA 4EYJA 4ZK5A 4Y46A 2O64A 3FZTA 1GZ8A 4FGRA 4BTKA 5EQYA 3ORTA 3KN5A 4GK2A 3TZMA 4EC8A 3FL4A 3EN7A 5CYIA 5JH6A 4NL0A 2DQ7X 3LQ5A 4CFVA 4HNFA 1OM1A 5CXZA 5AP2A 4ANSA 4WD5A 4FNXA 3N4VA 4CFUA 2XCKA 3SD0A 2G1TA 3K3JA 5CEPA 1PXKA 4HJOA 4L3JA 5HE3A 3MFRA 3UZRA 2GNFA 2X8DA 4ZTRA 4NUSA 1RDQE 5HE1A 5L2TA 4RWKA 5KX8A 2UVZA 2O3PA 3R8PA 5EOLA 3QRTA 3F2RA 4G16A 3UE4A 2V5QA 2X4FA 1ZYSA 5B2KA 3UODA 2B4SB 3BBWA 3GQLA 5FM2A 4FL3A 1UNHA 2WO6A 5AX9A 1EH4A 4CNHA 2JKMA 4UBAA 1BL6A 1XQZA 4J97A 4HVGA 4JT3A 1GAGA 2BDJA 2QOLA 2PMLX 3BHVA 2R7IA 2GU8A 3R1SA 3NUSA 2WMWA 2XNOA 4IJPA 5E4HA 5IQFA 3U54A 4CFNA 4PTGA 4CLIA 5HD4A 3WZEA 3OD6X 3H9RA 4I24A 3OWKA 4XJ0A 4NSTA 4TNBA 3E7VA 3R9OA 4ITJA 4UALA 2ETRA 4HGLA 3QTWA 4ACHA 3NVKI 2YISA 5HE0A 4AN3A 2XMYA 2O2UA 3CQWA 3ORPA 3PE1A 4CZTA 3BEGA 1UKIA 3OT8A 4FKLA 1KE8A 2Y8OA 5EYMA 4OBQA 4ZTSA 3O8PA 1V0PA 4XP0A 3COMA 4C7TA 3U6IA 5BVDA 2F2UA 4G5PA 4EC9A 3QCQA 5E7RA 3RZBA 1B6CB 5DEWA 2C6TA 3FC2A 4W4WA 5A4TA 2BZIB 2OKRA 3EFWA 3BGPA 2I40A 3R02A 5JQ8A 4J7BA 2HENA 3U9CA 3V5WA 2E9NA 2YLFA 4I4FA 4E5BA 2NNWB 1KUTA 4D28A 3COHA 3Q4CA 4EH3A 4V04A 3PXZA 4DTAA 4JBQA 2W9FB 3UNZA 4ANBA 2IW9A 4E8AA 4BY9E 4XV3A 4FC0A 2F4JA 4FIEA 3PXKA 3QZFA 4IWOA 5EI2A 4AQCA 2YCQA 3U6JA 2PSQA 4XLIA 3UVQA 2REIA 3JS2A 4WO5A 4AX8A 4K33A 4E73A 3ZBXA 2BIYA 1YQJA 4S34A 4C4HA 4C58A 5HZNA 4EH5A 2BTRA 5M55A 4IX4A 4USDA 1QPDA 3QTUA 2F7XE 3LQ8A 3PXRA 2WTJA 4AFJA 4Z55A 1YXUA 2RKUA 1OBGA 1OKWA 2J5FA 4GT5A 2QO2A 4JX3A 5CTPA 4YO4A 5L8KA 4ZLOA 4EZ3A 2J0JA 3PXYA 4AGUA 1PYXA 4O7YA 3QZIA 4JQ8A 4V05A 3VUMA 2JITA 2VD5A 4MNEB 2ZV2A 4RJ3A 4MEDA 4Y8DA 2HW7A 3FUPA 5EHOA 4EL9A 2X39A 4OBPA 3BHTA 5B0XA 2WHBA 5D12A 3R00A 3ZO2A 2JDSA 2X7FA 3VS3A 3QF9A 4FTUA 3BKBA 4O0XA 5F94A 3LM0A 3ZMMA 1JLUE 4PL3A 3V8WA 4EQMA 2JBPA 2JGZA 2GNHA 2JDTA 3C4XA 3BYVA 3NIZA 4L52A 3UPXA 5GNKA 3PRIA 3M11A 3GB2A 4L6QA 4KA3A 3A61A 5LWMA 3CXWA 3OEFX 4QYHA 2HIWA 4YTCA 1SZMA 5F4NA 4GIHA 5DYJA 3AXWA 4XV9A 5E91A 2IW6A 5CQWA 3GU5A 4BTMA 2X2KA 3EL7A 2ZM3A 3U4WA 1UWHA 3GC0A 3JY0A 2VTAA 3CTQA 1Z5MA 4J98A 3ZUUA 4BZOA 4I6BA 4K6ZA 2W06A 2ZV9A 2EUFB 3DV3A 2W5AA 3GP0A 4IBMA 3NCZA 3TL8A 3DCVA 3FBVA 5I3RA 3II5A 3BPRA 3ZFYA 2WEIA 1GIIA 4O1OA 4XNEA 3NW7A 3BV3A 3ZS5A 2OXYA 2P33A 4YSJA 4M0YA 4MBJA 1W8CA 5DR6A 5AADA 3A2CA 2RG6A 3W2SA 2CKEA 3F3VA 3TDWA 3QTXA 4FV8A 3SOAA 1AGWA 4E5AX 4UV0A 3C13A 3VO3A 5IA2A 4CFMA 1H0WA 5K4JA 3IGGA 3Q6UA 5AUUA 3RBWA 2YWVA 1CTPE 3V5LA 2C68A 3H9OA 3QTSA 1PF8A 4AZFA 4XG3A 3P86A 3FKOA 3DKCA 3EN4A 2VTSA 5AWMA 5HU3A 3PJCA 3UG2A 4DGLC 4EKLA 1PKGA 3QX4A 3NCGA 3O23A 1P4FA 3GC7A 2BUJA 3IG7A 4WT6A 2V55A 2C6DA 1H1WA 4BDDA 4JRVA 3FEGA 1M7NA 2HAKA 3KEXA 4N6ZA 5IEYA 4GMYA 1OKVA 2YIWA 4IAYA 2IVVA 1NA7A 2W5BA 4BFMA 2YM4A 5EG3A 5KMLA 4LUDA 3WF8A 1XO2B 4ASDA 2R2PA 5AUTA 4BDBA 2WPAA 1RW8A 3S95A 3VF8A 5I9WA 2PULA 3VS6A 2X7GA 2W7XA 4O0UA 4CGAA 1MRUA 3SRVB 5KMJA 5BUJA 2NRUA 4RA5A 3Q6WA 4O6EA 4TT7A 4MNEA 2PE2A 2UW8A 3L9MA 4XOZA 3WBLA 3ZLYA 2R3KA 3L9PA 5JSMA 3QLGA 5IEVA 4R7BA 5FXSA 3KREA 4QP4A 3MA6A 4ENXA 3MPMA 5FM3A 3FMDA 4O2ZA 4YLKA 2XVDA 3BQRA 4PV0A 4DC2A 3NUPA 2OZAA 4JQEA 1XH6A 2R3QA 4K18A 2W1HA 5CSWA 4E5WA 5HX8A 3P08A 5A4EA 2JAMA 1JSTA 2C3JA 3ZONA 4CFXA 5BX0A 5HNGA 4YJTA 5AFVA 4I6FA 4Z7HA 4ALVA 4ZTHA 3E87A 2C0OA 2ITPA 3FY2A 4GFGA 5HKMA 4DAWA 3OF0A 3BEAA 5LWNA 4JBVA 2WXVA 4K77A 3TV6A 3V01A 4LL5A 4N70A 3ZHPC 5GHVA 4L46A 3F3ZA 3HAMA 1YDSE 4I6QA 3SA0A 1J7UA 3NMUF 4EONA 1OIUA 4GJ2A 3O51A 4S32A 4X2NA 3CD8A 4GRBA 3E8CA 2FO0A 2P55A 3JYAA 5AUYA 5IPJA 3FHRA 4O0YA 2UVYA 4CRLA 3PJ8A 3HMOA 4FT9A 4X6QC 1OZ1A 3V51A 3MSSA 4OTGA 5AP1A 5BVEA 5EHLA 2W05A 2UZNA 1CSNA 2C6IA 4BKYA 4C61A 3ITZA 3RAWA 4QOXA 4X7QA 1V0OA 2QHNA 3ZO1A 4HYHA 2BKZA 3PVBA 5DEYA 3H4JA 2Y4IC 3LLTA 3EQPA 3PY1A 3E62A 2VTMA 1ZXEA 2OBJA 4FG9A 2XIXA 2XKDA 1ZARA 4RSSA 1YXTA 4IAKA 3TT0A 5J1VA 4FIIA 1U59A 3W8LA 4X2GA 5HCZA 3WZKA 4UZDA 2CJMA 3SAYA 4AXAA 2XJ1A 5DOSA 4H39A 4Y72A 3H0ZA 4HPUE 3PDTA 4KBKA 3P79A 5DH3A 1YWVA 4BYIA 3SV0A 4B9DA 2RGPA 3CCNA 4RQVA 5L8JA 4NH1A 3QAME 3E63A 4LMNA 5CI7A 3R8UA 3UDBA 4YHFA 4AA5A 4QMSA 3RNYA 3NNVA 4IVBA 3MV5A 2W99B 2R3FA 3TZ8A 3VBYA 3EFJA 4RJ4A 4LOPA 1DAWA 3SRVA 2CMWA 2R3OA 2XIYA 1E1XA 1JOWB 5KZ0A 2BDWA 1JKKA 3RHKA 4L42A 4F6UA 5CEKA 5JRQA 2XKFA 3RWPA 3V8TA 2R3JA 4UB7A 2PVHA 2R3GA 3OROA 4QQ5A 3V5TA 2Y9QA 1ZY5A 4LI5A 3MIYA 1TVOA 1ZMVA 3QC4A 2BR1A 5KNJA 1ATPE 4FNYA 4FUXA 3DXQA 3VBQA 5JKGA 3KXXA 3CGFA 3IGOA 3ZXZA 2WQMA 4FVRA 5T3QA 1VZOA 3IDCA 5AUVA 4DG2E 1YRPA 4S31A 4ZY6A 3BBTB 5FXRA 5BMSA 3BCEA 1URWA 2XA4A 5JMSA 1JSUA 2FA2A 3FAAA 3HL7A 1RQQA 3DY7A 3RGFA 4N57A 5D41A 2XBJA 3MPAA 1WBOA 3UYSA 4M97A 2LAVA 5AAGA 2HY81 1UA2A 1WBVA 1Y91A 3SKCA 4LOOA 3QTQA 3QWJA 2QG7A 3EOCA 5AR3A 3B8RA 1VYZA 3PPKA 1S9JA 4D1SA 2GMXA 4D1XA 2UW6A 4U80A 3MH0A 3NNUA 4FKVA 4QTCA 5HNBA 5M4UA 1O6KA 3ET7A 5E8WA 4FKRA 3FLYA 2J5EA 4NM3A 2G2FA 5K0KA 4F9YA 4YC3A 4HGTA 2QU6A 4RJ7A 2YA9A 4JJRA 3HA6A 3G51A 1H0VA 4IANA 4FTNA 3R7EA 3JVRA 4BIDA 4RX5A 4A4XA 5KKRC 3OG7A 5FDXA 3THBA 3V6RA 4PPCA 3V5PA 4HZRA 4BBFA 4HCUA 3MS9A 3UIBA 2IVTA 4XBUA 1W0XC 2RFEA 4WRSA 2CGWA 2VNYA 3KL8A 5CVGA 3ZRMA 5CSHA 4F4PA 1H26A 5IQEA 3DTCA 3HRCA 1AQ1A 2AC3A 1M52A 4RMZA 3WYYA 3GCSA 1KOAA 1ZMUA 3WYXA 2PVNA 4N0SA 4NKAA 4UX9A 2C6KA 3QKLA 4F9WA 1IR3A 2XK7A 2VN9A 2VV9A 2YABA 5KMOA 4ALWA 3UQCA 3JR1A 4O7VA 3N9XA 1QPEA 5DR9A 4QQTA 2UZOA 4L68A 4R78A 3LFQA 4FV2A 4EK6A 4YJNA 4F63A 4UZHA 2EXMA 4J96A 2C3IB 3SG9A 3KULB 4DH3A 4JRNA 3QXPA 1WBPA 3R7VA 4DEGA 5G1XA 3BGZA 3PSBA 4U9AA 1Q4LA 3D2IA 5FGKA 3MW1A 3VVHA 4YTIA 2RF9A 4A9YA 5BUIA 3PWYA 5DT0A 2R3NA 4RX7A 1WVXA 3JY9A 4K11A 3W33A 5FG8A 5IUIA 1YKRA 4GFMA 5EW3A 2PL0A 5HVJA 5JFVA 3GFEA 3D2KA 3TM0A 3COIA 3T8OA 2X2LA 4W4XA 1APME 4IDVA 3I0OA 2X6DA 4ASXA 2PYWA 4GEOA 2A19B 1U4DA 2IVUA 1ZOEA 5LMKA 4FL1A 3TZ9A 4RQKA 1SMHA 2GHLA 2QD9A
chains in the Genus database with same CATH superfamily
4IVCA 1KWPA 3KRWA 4R1YA 5K4IA 3H30A 4EOOA 4IDTA 3HUBA 4H3QA 5J5SA 2YACA 1BKXA 4IXPA 3VS7A 5EM8A 3A7GA 4F64A 1BX6A 3SQQA 4F1OA 4F7SA 4IB5A 3HV4A 1UNLA 5HQ0A 2XCHA 5DN3A 4KAOA 5IA3A 3ETAA 4HZSA 4NM0A 2YM3A 3AC4A 3ACKA 3FC1X 4G31A 5CALA 4CQGA 2WQOA 4YHTA 2BRNA 3EKKA 1OIYA 5J79A 3FQEA 1MUOA 3E5AA 4IC7A 3OXZA 2OH4A 4XV2A 2C3KA 4MWIA 4PDOA 1U5RA 2PE0A 4PUZA 1BI7A 2BVAA 4WKQA 4YGAA 4C38A 5E1EA 3FZSA 2OLCA 4FV1A 2YM7A 5JGAA 4NCTC 1M2PA 2WMAA 4LYNA 2W9ZB 2BZHB 3R83A 3DLSA 3L8XA 4M13A 4DDGA 2YEXA 3CLYA 3LFNA 3R04A 2V22A 4RVMA 2FYSA 4YHJA 4U41A 3BL9A 3RI1A 5CEQA 5CF5A 4L3PA 4J52A 3R1NA 2WZJA 3BYMA 3E8DA 3ZSHA 3FPQA 2Z7LA 4TKSA 3O0GA 5HVYA 1NXKA 2YCFA 5A4CA 5EH0A 3HKOA 2OW3A 1TQIA 2WTWA 3O71A 4I92A 1ZOHA 2DWBA 4IFGA 4YJSA 3DNEA 3A4OX 4YC8A 4YJUA 4BL1A 4DH8A 3E92A 4F0GA 2A2AA 4WNPA 3LFSA 2QKWB 4XMOA 3UG1A 4XEYA 1MQ4A 3NRMA 3DZOA 5CF8A 5FBOA 3G9NA 4BI0A 1MQBA 5LXMA 1KE7A 2WD1A 3GCUA 4UY9A 1ND4A 1REKA 3RCDA 4GKHA 3KULA 4TYIA 5HICA 3TIZA 4RIYB 3ZTXA 2PE1A 3QRJA 4B4LA 4XRJA 4LV8A 4YP8A 4RFZA 1VLRA 2W1ZA 4FKOA 5LARA 1WZYA 3IK3A 1YWRA 2VWYA 5EM5A 4C3PA 2HCKA 4PWNA 3Q60A 1TQMA 2C6OA 3MYGA 5HIDA 5ANEA 2J51A 5AR5A 5C8NA 4L53A 4WNMA 3TKHA 4IAAA 4KABA 2B54A 4UWCA 1KV1A 3FLQA 5EW8A 4EH8A 4FIJA 2WELA 3TACA 5FTOA 3O50A 5IH4A 2X7OA 2VWZA 4RRVA 4M7IA 4G34A 2GS2A 4OTPA 2WEVA 4RBLA 4YMJA 3D0EA 2I1MA 2WOTA 1BUHA 4FUYA 2B52A 3G0FA 2Q0NA 4XLVA 4EHEA 4GU6A 1YDRE 3DA6A 3F9NA 2FB8A 3FQSA 1U46A 3MVLA 4KIQA 3UVRA 4BGHA 2XIKA 2XIZA 4FTIA 4RA4A 4X3FA 5AV2A 4AXDA 5C27A 2RFSA 2G01A 2OGVA 3PA5A 4U81A 4JOAA 3UDSA 3FXZA 4NFNA 5H8GA 4YO6A 3EQGA 4USEA 1QPCA 2IW8A 2Z8CA 5K0XA 4EI4A 4EHZA 3DU8A 2WAJA 2GSFA 2QOFA 3N4TA 3SC1A 1ZWSA 2B9JA 3P78A 3K2LA 5K5NA 4IE9A 2EXCX 4K1BA 3CPBA 3EB0A 4C0TA 4V0GA 3AG9A 4MXYA 1HCKA 4I1ZA 4RIWA 3UJGA 3R8LA 3ALOA 4AE6A 4EK3A 1G8SA 4XP2A 4ASZA 4EWQA 3DFCB 2UZDA 4DYMA 4O7TA 4PMPA 2RIOA 4NM5A 3V04A 3FI3A 3MY0A 4D9UA 5TF9A 2X8IA 5J7HA 5L2WA 2CNUA 5CF6A 5KE0A 4IH8A 4FV0A 3R7GA 1W83A 3R8ZA 4M84A 2YJSA 2YFXA 3MDYA 2XNNA 5HBHA 3F69A 4O7RA 2ZMDA 4FKJA 3L1SA 3OY3A 5FD2A 3HEGA 4C33A 1Y6BA 2JKOA 4ACGA 4F7JA 3EQBA 4MVFA 5HEZA 3GUBA 2WTCA 4XBRA 4F1MA 2V62A 4AZSA 3MIAA 3F6XA 3PIZA 2BZJA 3PY0A 3P9JA 3DDPA 4U97A 4D0WA 3G15A 3SGCA 3CTHA 3PYYA 4B6LA 4EH9A 3R71A 3RM6A 2QKRA 3A8XA 1ZY4A 4OTHA 4RT7A 4X2KA 3ULZA 1W82A 2OI4X 5HCXA 3UTOA 5CEMA 2HWPA 3QQKA 3R28A 3RVGA 4GV1A 2VWVA 4FBXA 2X4ZA 2XK3A 2UZUE 4NFMA 2EWAA 4RIYA 4U0IA 4FV9A 3BE2A 1PXJA 4TZRA 3OUKA 1SVGA 4L45A 4AS0A 3WF7A 4QMQA 5GZAA 4DINA 3IW4A 3D5WA 4UMPA 3QWKA 1Y8GA 5HBJA 4D0XA 2Z02A 4ZIMA 3ZC6A 2NRYA 3W2QA 2VTOA 2VWBA 2WMRA 3EQFA 3KVXA 3LJ2A 1J7LA 3D83A 4NKSA 2BRMA 5AP4A 3CIKA 1LEWA 2X0OA 4PRJA 2IJMA 5CU2A 4Q9ZA 2CN5A 4WUNA 3R7IA 5AAEA 3A8WA 2JFMA 3POZA 4AWIA 3A99A 3W10A 4TW9A 4D5HA 5AEPA 3G2FA 5CNNA 1NVQA 2F9GA 3FLNC 4X0MA 3QD4A 5IF1A 1JQHA 2IO6A 4ZJVA 2JDVA 3FSKA 4RC3A 4Z9LA 3C50A 3EMGA 2GNIA 2I0VA 2PK9A 3H0YA 1VEBA 5DPVA 4F99A 1UU9A 1VJYA 2H96A 2Y6MA 3D7ZA 3LOKA 4H05A 4IM0A 4BWXA 5DG5A 4C2VA 4ACCA 5A6OA 3LFEA 1PMNA 3NX8A 2X9EA 4FSYA 2BKKA 3HLLA 2HK5A 4XV1A 3DKFA 4AT4A 2VUWA 3NYNA 3U4UA 3BLAA 2YCSA 3VUDA 3UC4A 2QLUA 3V5QA 4UMRA 3A62A 5AA8A 1HOWA 3O96A 1OGYA 2C69A 3AD4A 3M42A 4F6WA 3NWWA 2R3IA 2Z7SA 3EN6A 4Q5HA 4B0GA 4B99A 4YJOA 5HO6A 4AGWA 5L2IA 2Z7QA 4TWPA 3KXHA 1FQ1B 3POOA 3W0SA 4IM2A 3QZHA 3PVUA 4HPTE 4AGDA 2XK9A 4NT4A 4YLJA 3OW3A 5AP6A 4AOIA 5C26A 4Z7GA 4ONAA 2HZNA 2OZOA 4LGGA 4OLIA 4DF3A 2C3LA 1IA8A 4MBLA 1P14A 2WMQA 5J1WA 4O4BB 4IMYA 3MJ1A 4FKQA 4CMUA 3OP5A 4R5SA 1DI8A 3IOPA 3KVWA 3PLSA 4QEBA 3QQLA 3ZBFA 1PXNA 1IAJA 4FTAA 5CI6A 2F7EE 4LRJA 3DXPA 5CEOA 3C4FA 2XF0A 3LFBA 2ERKA 4BB4A 4JG6A 3BV2A 4MF0A 4PMSA 3ZOSA 4RC2A 1OKYA 4DFNA 2CKQA 3P7BA 1JVPP 4GG7A 4FRFA 4M12A 3FYJX 4O22A 5HIBA 4BIBA 4X21A 5A6NA 5KMNA 1Y8YA 2VTNA 1UKHA 3KA0A 3ZSGA 5BUEA 5LVLA 5EDRA 4O38A 5BVOA 4L7SA 2YJRA 5AP7A 2BCJA 4Z16A 3TDVA 3E93A 2AUHA 2JD5A 4UWYA 2X2MA 4Y85A 3SVVA 5E9EA 2QNJA 4J99A 4K2RA 4TWOA 1J7IA 5ICPA 2FSMX 4XOYA 3ODZX 5AP3A 4BCNA 2DYLA 3EKNA 4RJ6A 3F7ZA 5CX9A 5DI1A 5E90A 4QYEA 4QMZA 3ZFXA 2W1GA 5KHWA 4H36A 3BYUA 4WIHA 1H01A 5CLPA 4IX6A 5EFQA 3VULA 5J9ZA 1UVRA 4JLCA 2VTTA 2UW7A 4I22A 2WOUA 4QMUA 2UUEA 3ZRKA 3OFMA 3TIYA 2R0IA 3CTJA 4GYGA 2OF2A 2QI8A 4E7WA 4NW5A 5CSPA 1L8TA 5GIPE 4KB8A 3K5VA 2GTMA 3R9NA 2XK8A 1Q8TA 2HWOA 2UW3A 3ORNA 3P5KA 3TN8A 1X8BA 3PP0A 2WQEA 5C01A 4O7NA 5IQGA 5BVKA 3SG8A 3ZLWA 5IQDA 4ZZOA 3LW0A 4KRCA 2OU7A 2WMXA 2PZIA 1AD5A 5BMMA 2PTKA 5HE2A 5JGBA 2EVAA 3BE9A 5HTBA 3RHXA 4DH1A 1PRYA 5AM6A 3CY2A 1ZYJA 4PY1A 5DMZA 3MFSA 3KCKA 5H8EA 4QD6A 3PVWA 2ONLC 3DJ7A 4JG7A 4MWHA 5FEQA 1YXVA 2P3GX 4AP7A 2CPKE 5CSXA 3FMEA 3R21A 3LHJA 4EOKA 1IG1A 4F70A 1R39A 5F20A 2ZMCA 4LGDA 4YJVA 3ORMA 3BYSA 5IUGA 3EQHA 3NYOA 3ULIA 4ZXTA 4HVIA 5FP5A 1MRYA 5HOAA 3P23A 4GT3A 4AZWA 3TUCA 4YJRA 3NPCA 3S2PA 4M8TA 5IEXA 5D9HA 4CFWA 3O7LB 3QD2B 5TR6A 2W1EA 3R63A 4F7NA 3QYZA 4XP3A 3V6SA 3ANRA 1J1CA 2G2HA 3HV3A 2XNMA 2OK1A 5KO1A 4YZCA 4YPDA 4QDVA 3D5XA 4AA0A 5AR4A 4D58A 3FE3A 1VYWA 2CGXA 4GH2A 1UNGA 4PNKA 4QMTA 3RMFA 1JPAA 4GW8A 4F7LA 3QD3A 3P4KA 5FEEA 2PVMA 2OZAB 2QO9A 3D7TB 3F7WA 4GVJA 3CGOA 4UYAA 4I20A 1ZOGA 2R5TA 4G3CA 4FYNA 4H3PA 1Q61A 4BDGA 4C62A 1Y57A 4AN2A 5E1SA 4MXZA 5AJQA 4FOBA 2GNGA 4FKTA 4U45A 4AOJA 4MD8E 3UO6A 3VN9A 4UYNA 2IPXA 2IZRA 4GVAA 4O0WA 5F1ZA 1Z9XA 2XNEA 3I81A 5KBQA 3DBQA 1GZKA 3Q53A 3HZTA 4J8NA 4AZTA 3FI8A 4AUAA 3HVCA 4QPMA 4CTBA 5DT3A 3TV7A 4LM5A 2ZDUA 2CN8A 4L00A 3CS9A 2NYAA 3ALNA 2G15A 4O4DA 4CTCA 1WVYA 4WG5A 3PIYA 4PNIA 1H07A 4H58A 5E8SA 2XKCA 3PSCA 2P2HA 3HDNA 4R8QA 3DAKA 2F7ZE 3EZVA 2A98A 4A9SA 2OIDA 1TKIA 4C4GA 3AC3A 4ZLYA 2ITYA 3IONA 2PMOX 4B7TA 4FV3A 3V5JA 4KRDA 5TOZA 1IAHA 4MYGA 3MPTA 2RSVA 3U87A 4FA2A 2GCDA 3IECA 4EOLA 4M69B 3UO4A 5ANIA 4NYEA 2WMBA 3E64A 3ERKA 3LPBA 3ZUVA 3ZH8A 4KKGA 3QQGA 4J95A 3UP2A 1ZYCA 2WIHA 4QYGA 2R3MA 3W2PA 3PLAE 2GNJA 2DUVA 3PZEA 3W55A 4DEHA 1G8AA 3KMMA 4ZZNA 2E9OA 3NNXA 4FV6A 3VIDA 3F2AA 5JN2A 4PDYA 1Q41A 5KZIA 4HVSA 5FTGA 1W2CA 3R2BA 4BKJA 4E6CA 2UW5A 2BRGA 3SXRA 5L6WL 3T9TA 3AGMA 2CCHA 4OAVB 4A4OA 4FEWA 3VUGA 4C4JA 4XX9A 3QA8A 4BI1A 4EUUA 4HNIA 5CZIA 5AUXA 4Z3VA 2ITXA 3QBNA 3QCSA 3R2YA 3PXFA 3DB8A 4FZFB 4JAJA 4QNAA 5FEDA 4EH2A 2GQSA 5AIRA 4BBEA 4IZ7A 3CSVA 3RK5A 3C51A 2ETKA 1KSWA 3GU7A 3KKVA 3AOXA 4UEUA 4I5HA 3SLSA 3TJDA 4GU9A 4A06A 4FSQA 5B2MA 4L43A 3VS5A 3FI4A 1R0EA 1KV2A 2V0DA 3KXMA 2XYUA 4FKGA 2R0UA 4O21A 3WF5A 4JBPA 4Y83A 2W4OA 5EQPA 2CSNA 3FZ1A 3OY1A 2YDIA 4ZAUA 2QU5A 2JIVA 1G8JA 2ITTA 4S30A 3HYHA 2WTKB 5IA0A 2BHHA 1OL2A 2VZ6A 1BYGA 5JZJA 3D7TA 4RIOA 2UV2A 1XH5A 4FKIA 3WF6A 4AN9A 1SNUA 3OOMA 4W8DA 4ZS4A 4JX7A 3N51A 4GYIA 4ACMA 3GC8A 2J0MB 3GI3A 5H2UA 1H1SA 4I3ZA 2J9MA 1Q97A 3IO7A 5ACBC 3NIEA 1R3CA 4X2JA 3OCGA 2XZSA 4FG8A 3AC1A 2ZM1A 3K5UA 4TRLA 4WA9A 4D2WA 3NZ0A 5JRSA 1P2AA 1VR2A 3BL7A 2C5YA 3D14A 4II5A 4QO9A 4C02A 4AXCA 3GEQA 1OITA 2YZAA 4PDPA 3F82A 1W2FA 4QYYA 4F9CA 3QU0A 3O5AA 2C4GA 1IA9A 4X6RA 4IZYA 3GNIB 5AP0A 1XR1A 3MN3A 4QQJA 2J4ZA 3OEZA 4FZ7A 3FWQA 3QUEA 4RWIA 1Q8UA 3NUNA 1SNXA 4BCKA 4TYHB 3Q2MA 4BDJA 1YI6A 3MVMA 4DFLA 4FTLA 2HXQA 3KGAA 1STCE 3OUNB 2X6EA 2B55A 4D2TA 1WAKA 4FSNA 3CC6A 4C34A 2VX0A 3PIXA 2R3LA 4M69A 4QP1A 4WSYA 3Q9XA 5IMEA 1H8FA 4YUQA 5ACKA 1KOBA 1MP8A 2G2IA 3PVGA 4TN6A 3TNPC 2YDKA 4AZEA 2YHVA 4EOPA 3WE4A 2WMVA 3FPMA 3MTFA 4I5CA 3RWQA 2V7OA 3AGLA 2J50A 3C4EA 4G1WA 3VUTA 4AW2A 5M56A 3ID6C 1LR4A 2AYPA 3MVHA 3LFCA 4YJPA 3TJCA 3LCOA 4FVQA 4C3FA 1OUYA 4FZ6A 3TNWA 3UOKA 2GS7A 4IWPA 1JAMA 4R5YA 3W0MA 4QP6A 5DBXA 3WE8A 1ST4A 4L67A 3DQXA 3EIDA 2I0HA 3G33A 3UOJA 4KIPA 5BQ0A 1M2QA 2WMUA 3VWAA 4ZTQA 3F88A 4ZSJA 3AC2A 4K9YA 4DH7A 4FMQA 4PQNA 3NLBA 4E6DA 3TXOA 4KBAA 4E6QA 4ZSAA 2AQXA 2PMNX 4ORKA 2WMTA 1R0PA 4DHFA 4FT0A 4RFMA 3C5IA 3AMBA 4HYIA 4FTMA 4N4SA 4LQMA 4DG0E 5D10A 3EJ1A 2GDOA 4QP2A 4I0RA 4OT5A 5IA1A 4JMQA 2Y4PA 4E1ZA 5BYYA 4FKPA 2ITZA 4D2RA 2B7AA 4M68A 4BKZA 4BCMA 2ZAZA 2XJ2A 5ANDA 5IKWA 3UC3A 2X1NA 3KXGA 3U55A 1OL6A 3WI6A 3LQ3A 1QCFA 3TTJA 3ZU7A 3R7YA 4O81A 3COKA 3LAUA 2B9IA 2QOKA 4GK3A 2GPHA 4M3QA 4DN5A 2HZ4A 3PJ1A 3LKMA 4G3DA 4DT8A 3C0IA 4DGOA 5EDPA 2LGCA 4DGGA 1UU8A 4R3CA 4FE2A 1O6LA 1PW2A 4GUEA 3HNGA 3L9LA 4EUTA 4FNZA 5L6PA 3R30A 4I93A 1Q3DA 4IVAA 4JQ7A 4AF3A 3QL8A 2FSTX 5KUPA 1OBDA 1GY3A 2JEDA 4HYUA 2OJFE 2XIRA 3C7QA 1KE9A 3V8SA 3OTVA 5D7AA 5DE2A 4DFZE 4DG3E 2ZV8A 2GFCA 3FMJA 4UXQA 1YI4A 3FMMA 4ASEA 2XRWA 2C6LA 3D15A 3KF4A 3LCKA 3HMNA 4JNWA 4JIKA 5IDPA 4TYHA 3PA3A 4QRCA 4BDCA 2UW9A 4R7IA 2WQBA 3PG3A 5A46A 4G3GA 4BIEA 3DZQA 4DE4A 4TYJA 5DRDA 3Q4ZA 1T45A 3RALA 2X9FA 5I5ZA 3FV8A 5HG8A 4AAYA 1GIJA 1OECA 5A4LA 3KFAA 4MCVA 5CAQA 3NAXA 4BDFA 2XALA 3QKMA 1M17A 4O6LA 3KRLA 3ZO3A 4EZ5A 1REJA 4HCVA 3MESA 4O84A 2YITA 4EOJA 5GJFA 4O2PA 3CPCA 1H27A 3R0TA 4FV4A 3FQHA 1QPJA 3UMXA 2UW0A 3Q96A 2QCSA 4OTQA 3S3IA 3ZFMA 3QXOA 4ZTLA 4RFYA 4D5KA 2VO0A 3GC9A 4FIHA 2VO6A 2GS6A 2QOBA 1YDTE 3KXZA 3M1SA 4OTRA 4FV7A 4P4CA 4XG8A 4YBJA 2UZEA 1Y6AA 3ZCLA 4GFOA 2FSOX 4A9TA 2XRUA 3DAJA 1OVEA 2JLDA 4AQKA 5JFSA 2BRBA 2ERZE 4ZY4A 4KNBA 3IW8A 5A14A 3AKKA 4YJQA 4UXLA 4EH4A 3EQIA 5LVPA 5TE0A 5B7VA 4FGBA 3AT3A 3SX9A 2PUUA 5J5TA 4EOQA 4IAFA 3OBGA 3VF9A 3VRZA 4MKCA 1FVRA 3F5UA 5DNRA 5FQDC 2OJGA 3KMUA 2QOQA 3QTZA 3K54A 4EZ7A 2QOIA 5IQCA 3KRXA 2YERA 3K3IA 4JG8A 4WBOA 2P0CA 4BCJA 4W8EA 1PKDA 4GT4A 3C4ZA 4CKIA 4LV7A 2XAMA 4IAZA 3PPZA 2C5VA 3DK6A 5I9UA 4ZZMA 4IADA 2PZYA 1L3RE 2VU3A 3IW7A 3SDJA 3VQHA 1YHWA 2B9HA 3GCPA 4G3EA 4WG3A 3W18A 4A9RA 3QX2A 3D9VA 4FEXA 4X3FB 4CT1A 3DK7A 2UZVA 3I4BA 4MK0A 4YSMA 4BCOA 4XHKB 4O7ZA 4RVKA 1H1RA 3Q9WA 3WIGA 4ANLA 2YDJA 1J3HA 2OSCA 4KIKB 3DBCA 3ML1A 1F0QA 3CD3A 3UDZA 3PTGA 4G2FA 3C4WA 5CAOA 1OUKA 2BTSA 5LMKC 4BJJB 1GJOA 4O82A 3VS2A 5KHXA 4V0GB 2PUIA 4MXAA 5TT7A 3EYHA 3DJ6A 3I1AA 4RIWB 4FTOA 4BGGA 4V01A 1W98A 2CLXA 1F5QA 4CT2A 5M4IA 3C0HA 4Y95A 4DGMA 3U9NA 3FLWA 2WMSA 4ALUA 5FWKK 4CXAA 5C8MA 1Z57A 4OAUC 4PF4A 2UVXA 3P7AA 4PPBA 3DKOA 2WU7A 4DFBA 3QLFA 1UV5A 3LCTA 4NK9A 3DNDA 5JFWA 2QR7A 4O1PA 1YHVA 2BALA 1PXMA 4I0TA 5EYCA 4R3PA 3ORIA 3QUDA 1YXXA 4FK3A 2W1DA 3MJ2A 1DM2A 1ZMWA 3ZZEA 2ZB1A 5EDQA 4ANNA 3DFAA 3UBDA 4NU1A 1E9HA 4YURA 3UVPA 1PMUA 3VQUA 3TEIA 3ZZWA 4RVTA 3AQVA 4J71A 4C8BA 3AC8A 4O4FA 5IZFA 4EEVA 5HX6A 4EBWA 4BDEA 4QTDA 3F5XA 4FTCA 5JEBA 1PXIA 1YW2A 5IQAA 1H1QA 4BCHA 3BX5A 2ITNA 2C30A 4I0SA 3FYKX 5E8TA 5J9LA 4FZAB 1URCA 4O7LA 4EK4A 4PP9A 1G5SA 4FR4A 2UZWE 3Q9ZA 4O86A 2GNLA 2OH0E 3F3UA 4FF8A 3GQIA 4PDSA 3AC5A 4ZJIA 1FMOE 3UPZA 3HAVA 4BWKA 5DT4A 4EORA 2Y0AA 2W1CA 2ETMA 4AU8A 5BPYA 4IWQA 3TUBA 2GTNA 2JIIA 3W2CA 4OGRA 5ANGA 3MH3A 5DFPA 3U6HA 3S4QA 2YM8A 2OIBA 5L3AA 1ZLTA 5JK3A 4F1TA 4XUFA 5CF4A 1NVSA 4I6HA 4Y5QA 4YZMA 5CXHA 3ATSA 4I41A 5LMAA 5C4KA 1YHSA 3HDMA 2B0QA 5GZ8A 4KIKA 3DAEA 3NNWA 4K0YA 4RGJA 4AAAA 3LIJA 5A4QA 1OGUA 4JIAA 2C5NA 3RZFA 4BI2A 2A27A 4RWLA 3ENHA 2R3HA 4GUBA 2RFNA 3CJFA 5AUZA 4AGCA 1H24A 3C9WA 3O2MA 4QP7A 3SXSA 3DB6A 2J0KA 3A7HA 1T46A 5M06A 1W7HA 3ZYAA 5LOHA 2A4LA 4KINA 3WILA 4DBXA 1UU3A 3P5JC 5A54A 3UYTA 4GIIA 5L8LA 3R8VA 2WU6A 4F08A 3ANQA 3OVVA 2YCRA 3UOHA 2NP8A 4ZEGA 4EYMA 3ZM9A 4FSTA 5J8IA 3CY3A 2OXDA 5IISA 2FVDA 4IVDA 3NR9A 1JKTA 2X8EA 4QTBA 5I9ZA 5L4QA 5EW9A 5HGIA 4BCPA 4DA5A 4R3RA 3UP7A 1FGKA 2ITOA 4GSBA 3VS4A 4A7CA 4D4VA 1I09A 4FNWA 5DIAA 5E8ZA 2JFLA 2IWIA 2Q0BA 4E4XA 5FLFA 2CGUA 4JR3A 3RTPA 1B38A 4JL9A 3ZDIA 4BDKA 2OJJA 1NW1A 4KUJA 2WTVA 4IZAA 3RAHA 3QRUA 4WNOA 1LP4A 4APCA 1W84A 4EOIA 3IS5A 4E26A 2JDOA 2H9VA 4ZTMA 5M44A 3SW7A 5EI8A 4JDHA 2EB3A 2VTJA 2PUPA 4O96A 3R9HA 3I7BA 4E4LA 5JFXA 4HVHA 4YTHA 3KIOC 4EH7A 4F0IA 1KE5A 3PG1A 2PWLA 4PMMA 4FSWA 3D5VA 4IC8A 4U42A 4CYJA 1XJDA 3A60A 2ITUA 4PPAA 3PJ2A 3RINA 4BICA 3BYOA 4QMNA 2HY0A 2W4KA 2PVJA 1XH4A 2BPMA 3Q9YA 4R6VA 4L44A 2X0GA 4U44A 5E8XA 2XK6A 4KSPA 5TO8A 4G9RA 1WBNA 5DR2A 1JNKA 4PL4A 3B2WA 3GU8A 4OTFA 4XCUA 1YOLA 1FBNA 4Y5HA 5HCYA 3CBLA 3DPKA 5LVOA 4ZS0A 4DLJA 5L6OA 4I5PA 3Q2JA 4A9UA 2KTYA 2YIYA 5L2QA 2HZ0A 2JC6A 2PHKA 3IQ7A 4DEDA 2XM8A 3R6XA 4HW7A 4QYFA 3RCJA 5BV3A 5ETFA 2CGVA 4ZJJA 4EK5A 3QQJA 2VX1A 5CAUA 2ZDTA 4BC6A 4LOQA 2E9PA 4BCGA 2J0IA 4EHVA 3VS0A 3FHIA 3Q3BA 3FL5A 3LCSA 4U3YA 1YOJA 4S33A 3CQUA 3VHKA 4UN0C 4APPA 3BHYA 3OCSA 1ZZ2A 2C47A 4ZSLA 5M4CA 5FBNC 3TNHA 3DS6A 4FK6A 3NAYA 4LV5A 5T68A 3U51A 4YZ9A 4M67A 4K8AA 4HGSA 4QMYA 4RWJA 4TYGA 5HG5A 4NWMA 2PMIA 4GCJA 4NM7A 4U3ZA 4MAOA 1O9UA 3KRRA 4BCIA 5HI2A 3ZSIA 3D5UA 4O83A 1XBCA 5JT2A 2ITQA 2B1PA 3Q32A 2CLQA 3GU6A 3BHHA 3O8UA 2VO7A 4MQ2A 4FOCA 1GZNA 4M15A 4RJ5A 3MGYA 4EJNA 3GOPA 4ERWA 4QTEA 2GHGA 5HLNA 5HU9A 4NTSA 4MX9A 3KK8A 5EKOA 2FUMA 5IQHA 3FY0A 3W32A 4YLLA 5DHJA 3W2RA 3L9NA 5AAFA 3CE3A 4E4MA 2HOGA 5EKNA 3VAPA 4XYFA 4L01A 3H3CA 4FSUA 4MNFA 3ZXTA 2CNQA 3DDQA 1WBWA 2WKMA 3MA3A 5HTIA 4EJ7A 1XH7A 4WG4A 4F78A 2C0IA 2QURA 3DQWA 2QOCA 3GT8A 2XUUA 4C36A 1WVWA 4D2VA 4TL0A 4YZDA 4E4NA 4FKUA 4YNEA 4CLJA 4HVDA 2CDZA 4BCFA 1Q8WA 2ZM4A 4WBBB 1O6YA 4KWPA 4OTIA 3MH1A 3ZLSA 4HCTA 3ORLA 2CHLA 4IIRA 5HIEA 3PUPA 3M2WA 4ANQA 4L7FA 4DTKA 2O63A 2PZPA 4JDJA 3Q4TA 2AC5A 4RIXB 3W2OA 4NW6A 4AA4A 3MWUA 3LMIA 4YC6A 4JI9A 1PHKA 3GCQA 3LFFA 4YU2A 1NT2A 5HESA 3MB6A 1GZOA 4NJ3A 2XEYA 3FZOA 3FZPA 3NYXA 4MXOA 4CG8A 5EOBA 3PUFC 5J95A 2VTIA 3PJ3A 2UZLA 3OWJA 4MD9E 1R1WA 2XKEA 4LGHA 3FI2A 2QOOA 4NIFB 3NEWA 4DTBA 5IMXA 4FL2A 4W9WA 5KBRA 4FEUA 1LEZA 1U5QA 4FV5A 2C1AA 4OR5A 3VBWA 2E2BA 4UMQA 3RM7A 3C5UA 2ZOQA 5D7VA 1JKSA 4J1RA 3MH2A 5HBEA 4D4SA 2ONLA 3QQHA 3EN9A 2FH9A 3IDPA 3TKIA 4AW1A 4ZMEA 4EHGA 3DBDA 4ITHA 2OICA 4ZSGA 5DVRA 1XMLA 4XG4A 1H4LA 4FIGA 2UZBA 2GHMA 3A4PA 2PZRA 3ORZA 3ENMA 1Q5KA 3VW8A 2R3RA 3WF9A 4CV8A 1QL6A 5ITAA 3T3VA 2OFVA 4W4YA 3QHWA 3GFWA 1GNGA 4YZNA 3RJCA 3ZDUA 1E1VA 3OCBA 5EI6A 4BYJA 1XMMA 2QODA 3EL8A 4G3FA 4G5JA 5CASA 5J7BA 3D4QA 1M2RA 3WZDA 5M08A 1YXSA