3POOA

Human camp-dependent protein kinase in complex with an inhibitor
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
337
structure length
331
Chain Sequence
b'SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFDTSNFDDYEEEEIRVINEKCGKEFSEF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title fragment based drug design on PKA
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 109
structure length 331
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3pooA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pooA02
2OH4A 4YO4A 3Q2MA 4O38A 4XOYA 2V22A 4AACA 3P7AA 4ZSJA 3GU6A 1URWA 4CFUA 4XP2A 3ANQA 3OD6X 1WBVA 3JY0A 2PZ5A 1YWRA 3A2CA 3F7ZA 2JAVA 3FI4A 4AGUA 4AGWA 2RFSA 3V5JA 5ANKA 3IG7A 4QMMA 4DFBA 1E1VA 5A14A 2WTKC 3D15A 2YFXA 2WFYA 2GFCA 3KMWA 3ZRKA 4AUAA 3JYAA 3AC8A 4G5PA 4HZRA 4JQ8A 4TWCA 5EOBA 5FG8A 4F64A 4DEIA 5F4NA 1I09A 2RKUA 3QC4A 3VRZA 2IG7A 4NEUA 2GHLA 5FGKA 5I9WA 3UO6A 3GU7A 3V5PA 3W18A 2VX3A 4ITHA 4KWPA 1YI3A 3KK8A 2BR1A 4O96A 4UMUA 5IKWA 4FNYA 3G51A 3Q3BA 2C6TA 3PWDA 3F5UA 3ENMA 4G34A 3Q5IA 4NM7A 3HV6A 1Q5KA 2B52A 4TWNA 4YJQA 1O9UA 3R7OA 4AW5A 3Q52A 1MUOA 3WF9A 3KF7A 5CT0A 1TQIA 4KKEA 4L00A 4KINA 1Q8UA 5ETCA 4BYJA 4BIEA 5KZ0A 3VUIA 3M2WA 4K6ZA 3B2TA 3EWHA 3OBJA 4Y83A 4KIPA 3QUDA 1JVPP 3L8SA 4KS8A 4NIFB 4CXAA 1H07A 2YZLA 4KRCA 4FZ6A 4C3FA 4HVGA 4M68A 2A27A 5KMMA 3VUGA 5AP5A 3BYSA 2RG6A 5IA0A 5CSHA 4ZMEA 2Q0NA 4MCVA 3IO7A 3UIBA 2C69A 3VN9A 4CYJA 4ENXA 3D2IA 1H1SA 4PPBA 2I6LA 2Z2WA 2C6DA 1U54B 4RWIA 2V55A 4MWIA 1IA9A 5E4HA 4ANMA 5LARA 4YTFA 3C4CA 4QQCA 3MJ1A 4FEVA 4IM0A 3U9CA 4JT3A 3A7IA 4GFGA 1APME 1JPAA 5IH6A 5HBEA 5T6KA 4F1OA 3PIYA 3V8SA 1WBSA 4PQNA 4O0SA 3WOWA 4H05A 4D2VA 2W1ZA 4RC4A 3RCDA 3TCPA 4FA2A 1KUTA 4LOQA 5ETIA 4EH7A 3VW6A 4CRLA 2R9SA 1SM2A 3D94A 1GZNA 3GC9A 3O96A 3OC1A 4QO9A 1UWHA 1ZMWA 2WU7A 4MX9A 5EDQA 3VVHA 4XG4A 1M14A 4CZYB 3KMMA 3OOGA 5AR7A 2C5YA 3PLSA 1LR4A 1OKZA 2R3GA 2XH5A 4IX3A 4RFYA 5K0KA 3TG1A 4D2PA 4D5KA 1UV5A 4EBWA 5BNJA 5KO1A 5M56A 3EQBA 5AR8A 1KE5A 4JDKA 5HOAA 1F3MC 3HRFA 1MQBA 4EC8A 2YCRA 4FKJA 5CEMA 3FL4A 3GI3A 4CRSA 5DEWA 5J5SA 2WMXA 2R64A 2W9ZB 2NRUA 4G17A 3ORIA 5F94A 5AV1A 3LQ3A 3DZOA 3ZOSA 4L8MA 4EOLA 4BFMA 5DR6A 3FUPA 1F0QA 4BIDA 1Q24A 4FKPA 4A7CA 4AZFA 2GNLA 3MY1A 4CZTA 2GSFA 3I4BA 5CNNA 4IZ5A 4EONA 5HG7A 1J7IA 4FKIA 4UEUA 5E92A 3LMIA 2XIKA 1PJKA 3QWJA 4BN1A 4BDBA 5LVLA 4EK6A 3DK6A 4IFGA 4F7LA 3HRCA 4BDGA 2YIXA 3FY2A 2X2LA 3H10A 5HCZA 4BBEA 3KCFA 4IVDA 5JN2A 2BIYA 2ITTA 5IA2A 3FY0A 2XIRA 4W9XA 1ZMUA 2W1CA 5C03A 3ZSHA 4BDCA 1KSWA 4D5HA 3Q6WA 5DN3A 4PDYA 4BI0A 4QPMA 2R7BA 3LXLA 3LFBA 1PF8A 3BX5A 3KXMA 2EXEA 3FMDA 3KULB 2C5OA 5A6OA 3SW7A 4PP7A 2VGPA 2WZJA 3R30A 3VJOA 4FSUA 4RGJA 1WVXA 4DH3A 3FI8A 3AMYA 3FZTA 4OTRA 4L44A 3RK7A 3W55A 3F2RA 2Z02A 4GJ3A 3KY2A 4XP3A 4D4RA 4EH2A 5DMZA 5L6PA 1K3AA 3EZVA 2Z8CA 5HIBA 4MXOA 2P3GX 4B99A 4H36A 2XS0A 3QQGA 1OGUA 3RPOA 3CQUA 5K9IA 5HLWA 4C37A 1JKTA 1ZYJA 4PTCA 4GV1A 4ZSLA 4FTCA 4F0IA 3EQPA 4FYNA 2PE0A 4X2JA 4CSVA 5HO7A 5IUIA 4AGDA 1ND4A 3C51A 3DAJA 3ZSIA 4CMUA 2IO6A 2X2KA 3FSKA 3R73A 3CD8A 3E3PA 2I40A 3TV6A 3EKKA 3ACKA 4RWKA 4MKCA 4IWOA 4YJUA 2R3NA 3GUBA 2R0UA 3EQFA 1WBOA 3HGKA 4OT6A 4EK3A 2IVUA 2VN9A 2Y4IB 2ZB0A 2YM4A 2QOHA 3BE2A 4I6HA 3H9FA 3UP7A 4DN5A 5HICA 2OO8X 1UU7A 4GK4A 4NWMA 2W1GA 4PL3A 5KNJA 3HMOA 4L68A 1NVRA 3MY0A 2RGPA 3VHEA 4ZTQA 4FSTA 4U41A 4S31A 5BX0A 4MTAA 5K0XA 2YDJA 4FTJA 2X7FA 5EHLA 4FT0A 4LGDA 2X9FA 5AIRA 5IQEA 3D5XA 5EI2A 5C1QB 1YVJA 3ROCA 2P55A 5ANIA 4A07A 3TZ8A 5AJQA 3UOLA 2UW9A 4ALUA 2WTKB 4EZ5A 3VS7A 4GCJA 3K3IA 3WI6A 2VO3A 3H4JA 1H0VA 3DBFA 3CE3A 3LFNA 4PY1A 4L46A 4RVTA 1AGWA 1JKKA 4I5MA 4WRGA 3QU0A 3KL8A 4EL9A 2FH9A 4LRKA 2QKRA 4R5YA 5I9ZA 4ASEA 4IXPA 3AC4A 4D2RA 2OZAB 4B6LA 4DBXA 2GQSA 3RPYA 4E4NA 2JKQA 1SMHA 5FLFA 2A0CX 4ANBA 3M1SA 3A7FA 5CS6A 4GRBA 4B7TA 2Y4PA 5E8YA 1Q62A 5BYZA 3C1XA 3DB8A 3DJ7A 4RQKA 4U6RA 3DT1A 5LWNA 3UVRA 4J97A 5EK7A 4MXYA 4MBJA 1ZZLA 4AAAA 3IDCA 4ZIMA 4WKQA 2J0JA 3VBWA 3DJ5A 4J98A 3SLSA 3R2BA 4H1MA 4JR7A 4AZEA 4C33A 3VS0A 4GIHA 4I0RA 3CIKA 3R8PA 3E7OA 3FI2A 1ATPE 2QOFA 4MNEB 2JD5A 2JDSA 3M42A 4RZWA 2UZOA 3R1SA 3UO5A 3ORTA 4EH8A 3QTWA 4FV7A 3GCUA 4AZVA 5A4LA 5M44A 2OJ9A 4NM3A 4UXQA 2ZJWA 4CT1A 2YCFA 5C8NA 4BDHA 4LI5A 2GS7A 3RWPA 2WTJA 3OEFX 3D2KA 4FKWA 4HPUE 1Y6BA 3PJ8A 5CAVA 1JAMA 3HLLA 3EN6A 3L9NA 1YRPA 3ZO2A 4L7SA 4FKQA 2ITOA 5GINE 3W2CA 4GG7A 2OF2A 2I0VA 4MEDA 5IZFA 4GUEA 4X2GA 3NWWA 4YZDA 3QCYA 4OTGA 5AM7A 5C9CA 2RFDA 5HZNA 5C4KA 3NZ0A 2YDIA 3U9NA 4C61A 2C5VA 4DEDA 3ATTA 3TDVA 4DYMA 2PVHA 5E1EA 2B7AA 4I0TA 3RKBA 5JMSA 3ID6C 1OL2A 5GNKA 2C6EA 4C59A 3GQLA 2QOLA 5LMKA 2W1FA 3DFCB 2QOCA 3BRBA 4J95A 3CY2A 2F7EE 3KRLA 2GHGA 3ZUUA 4E5AX 3TN8A 1PYEA 3PYYA 3R2YA 1JLUE 4JXFA 4OT5A 4QTDA 5TR6A 4YZ9A 5D12A 4FC0A 4YZNA 2XNOA 3QZHA 4W4YA 5HORA 1DAYA 5AM6A 3SOCA 3R83A 3UVPA 5JKGA 1TQPA 2ITVA 3IDPA 3TKIA 5I3RA 3ANRA 2PL0A 3TL8A 3TDWA 1OIRA 3QWKA 1H28A 5DEYA 3UGCA 4IWQA 4CFFA 5KMIA 3BWJA 4XRJA 3OXIA 3NX8A 3ORNA 5JFVA 3D7ZA 5CU6A 4ZLZA 2VX0A 4J53A 3R9HA 3OCBA 3E92A 5J9YA 2YCQA 3TIYA 3NYNA 2PZYA 2W17A 3FQEA 2X4FA 4GSBA 4F70A 1DI9A 1OIUA 4G3EA 3C4XA 3FKOA 3KXGA 3QUEA 2R3PA 5CF4A 4P2KA 5DT3A 5BVWA 4OTQA 5B2LA 3TV7A 1YOJA 2VTSA 1SVHA 3DXNA 3ZFXA 4ASXA 3S0OA 4HYUA 2IVVA 2WIHA 4ZY6A 1WCCA 1OL6A 4JBOA 2WQEA 2YM5A 2WQOA 3GCQA 2VZ6A 4JDHA 5HESA 1H01A 1UKIA 4PPCA 4EHGA 5CF5A 2WTCA 3MY5A 5L4QA 2DYLA 5B2MA 5IA4A 5IU2A 3OXZA 3HKOA 2UZVA 4M3QA 2YISA 3E7VA 3NRMA 3DLSA 4LUDA 4NTSA 1XBAA 3FLZA 1ZOEA 5JZNA 4DFNA 1X8BA 4EUTA 3FC1X 5E8ZA 4EH6A 3DLZA 1URCA 1S9IA 3KK9A 4FKGA 4CMOA 4YPDA 2F7ZE 5EM6A 3QTXA 4X3JA 4DLJA 4F1MA 4I22A 3TKUA 1RJBA 3MDYA 4IEBA 2R3MA 1ZOGA 4MYGA 2HZIA 2UZTA 1XKKA 3CPCA 1GJOA 3L8PA 5AP3A 2BRHA 2CJMA 3OXTA 3RM6A 4OAVB 2YM7A 3FYKX 4BHNA 3U6IA 1BI7A 2J2IB 2F4JA 3P08A 4JLCA 5ANGA 4FKLA 5ANEA 5HTIA 5I0BA 3MVLA 4L9IA 4NJ3A 4YLKA 3MI9A 3ET7A 3TNHA 3U4UA 5M55A 4DFYA 4C36A 4FIHA 4XG6A 3NGAA 3G9NA 5EW3A 5KCVA 4K2RA 4RC3A 1K9AA 4QTAA 4YJNA 2XCHA 1J3HA 4IMYA 3R7EA 3ZLWA 2VTTA 3OP5A 4CEGA 3NDMA 4G3GA 4BWXA 3H30A 4BVUA 3R01A 4AN2A 5GZAA 3QA0A 4NL0A 4IJPA 3ORMA 3O8PA 2VGOA 4QMYA 5LCJA 3IQ7A 3Q9ZA 3TT0A 3F5GA 2FSOX 3O71A 3VQHA 3AT4A 4B9DA 3WZEA 4YHFA 4WUNA 4NU1A 4TYJA 4D9TA 4NM0A 1WBPA 5IH4A 3K54A 4IAYA 4O0WA 1KE6A 3QRJA 2CMWA 4S32A 2XK8A 1O6YA 5EW8A 4YC8A 5AEPA 3ZZEA 4KB8A 2YIWA 1JSUA 2V7OA 3W10A 4FZDB 4YGAA 5J95A 5HO8A 5KMNA 2HY0A 4I1ZA 4FSQA 2X0GA 2GFSA 4TWPA 4QT1A 3ATSA 5HLPA 3SX9A 3R7IA 4EH5A 4MXZA 2QHNA 4BY9E 2YAAA 1YHVA 4XG9A 4EJNA 4V04A 2QR7A 3ITZA 4NKSA 4FT3A 4RPVA 3FMJA 4UN0C 2YACA 3PXQA 3QZFA 5D7VA 2Y9QA 3QKKA 4FSZA 1E9HA 4FVQA 4CLJA 4QMTA 2PVKA 3N51A 2QOQA 3AQVA 3T3VA 4OTIA 4I5HA 4UBAA 2CKOA 3ZDIA 4NIFA 2BDFA 5M57A 1FVTA 2PVRA 4XLIA 4M69A 4PF4A 5B2KA 3C4ZA 5CEQA 3MESA 5DHJA 2VWIA 1U4DA 2W5HA 3QCQA 4ASDA 4DTKA 2UW5A 5J7BA 5BYLA 1QPJA 1YXXA 3Q4TA 2PMLX 4Z7GA 4EH3A 5CAPA 4BB4A 3IW8A 2JLDA 1PMVA 3TJDA 4YHTA 5BQ0A 4BI2A 4AE6A 3DU8A 3PVWA 4BHZA 1A48A 3VUDA 4FEXA 4QMLA 4FTRA 4UY9A 2WOUA 4Y5QA 4V0GA 2VTHA 3S4QA 5AA8A 3FAAA 1L3RE 4V05A 3LVPA 4FVPA 4J8MA 3RNIA 4A06A 2WOTA 1CM8A 2Y8OA 2WMVA 3RMFA 2VUWA 4DEGA 3LHJA 3PJ1A 2E9NA 2KTYA 4D2WA 4FR4A 4V01A 4IIRA 4C34A 3CGOA 4HGSA 1O6KA 5CQUA 3E63A 5CXHA 3ERKA 2QO2A 4E93A 4HCTA 1IG1A 4ZZMA 2VNYA 2J0KA 4WNKA 3SG9A 2J5EA 2A19B 4BICA 3KN5A 3RPVA 1GZKA 5TO8A 2GPHA 4Y95A 2C68A 2O5KA 3R7GA 5LXMA 4O81A 3MPMA 1YXVA 3NUPA 2HY81 5E8VA 5A54A 2UW7A 3CTQA 4GK2A 1KE8A 4CCBA 4FSNA 4ZTSA 4YJRA 5CQWA 2VAGA 2WMUA 3AD5A 3PJCA 2XYUA 4ARKA 4A9YA 3Q9WA 4QRCA 3ZBFA 4FMQA 4HYIA 5E8UA 5K4IA 1V0PA 2F57A 1FMKA 4HNFA 3VUHA 2QOIA 4U9AA 4IAKA 3ZHPC 1WZYA 1ZWSA 4LYNA 1T46A 3BBTB 3OY3A 4L3PA 3B8RA 5A4TA 3EMGA 2ZDTA 4MK0A 5EH0A 2BZIB 2OU7A 5T68A 5IQBA 4OR5A 2C3JA 5CX9A 2J9MA 3EFKA 5LVPA 1UU8A 3CPBA 5DFPA 4LMNA 3L9MA 3UIUA 4M84A 3FWQA 4A4LA 1J7UA 4GS6A 2WHBA 3FEGA 3BHTA 4ANSA 3C9WA 2WNTA 3QCSA 4UXLA 1OL1A 2W96B 3ORZA 4FT7A 4O27B 3ROYA 4E1ZA 4QYGA 3O7LD 4AA4A 2G1TA 3R02A 2P0CA 1QCFA 2RF9A 4LL0A 4KUJA 2ZB1A 5DIAA 3PIZA 4AZWA 2X8EA 5GIPE 2CLXA 4GIIA 2R3QA 2HW6A 2WMTA 3Q9XA 4PTEA 4IANA 4YJPA 1YXTA 2ESMA 2F2UA 4FBXA 5CVFA 4AT5A 3DS6A 3QD4A 2PPQA 1CKIA 3BHYA 4LRMA 3FXZA 3MFRA 3PZHA 3DTWA 4O83A 3KGAA 4GW8A 5DPVA 1OPLA 2QC6A 3MTLA 4KNBA 4D2TA 3PY0A 3FLWA 4GFOA 4P5ZA 1IR3A 5IQCA 4PNIA 4C38A 3TUCA 2XK3A 5FXRA 3KVWA 4IX4A 4X3FC 4EOKA 2W1IA 4QPSA 3C0GA 3HV4A 3U55A 4EOSA 1NA7A 4YTIA 4KSQA 5HCYA 4ZY5A 2W1EA 1G8AA 3E64A 1CKPA 1WBWA 2RFNA 5BVNA 3DJ6A 4F6SA 2R4BA 1P14A 4I24A 3ZUVA 3F69A 3QHRA 2EWAA 1ZYDA 4PTGA 4WG4A 2XNGA 3MFSA 3D5UA 2VWUA 3O2MA 3QQLA 4QMVA 5HE2A 4AU8A 3COKA 2X7GA 3GENA 5E8TA 4BF2A 5IQAA 3KFAA 2EU9A 4D0XA 4CT2A 2EB3A 5E9EA 2IWIA 4N70A 2WMRA 4ONAA 4XG7A 3KEXA 1H1RA 3IDBA 3FDNA 3R00A 3LQ5A 4GT5A 4IB0A 4LGHA 1U5QA 4FEUA 3E8DA 3SHEA 3MBLA 2OFUA 2JIUA 4BR3A 4J52A 4BGGA 3SA0A 4RX9A 2CPKE 3LFCA 1BUHA 2W5BA 2RG5A 3BKBA 3G5DA 2Y4IC 4XV1A 4AT3A 2FUMA 3D7TB 5EYCA 4HW7A 3UVQA 4IX5A 3FV8A 3CLYA 5DR9A 5KE0A 4A9TA 3DKGA 1PXKA 3O8UA 3P1AA 2OBJA 1R0PA 4FV0A 3EQDA 4RIOA 5AR5A 4O0RA 3FXXA 1FVVA 2J4ZA 3EN7A 2VTNA 2QKWB 4LG4A 4BCFA 5LMKC 2A2AA 5IDNA 4P90A 3I5NA 5DI1A 5L2TA 3GU4A 2J50A 4ZJVA 5DWRA 3VBYA 4QMQA 3UPZA 3IW6A 2GS6A 4YR8A 3EB0A 5ANJA 1H00A 4BCJA 2ZAZA 5D7AA 2W99B 1IASA 3CQEA 1OVEA 4QP4A 5FWKK 3FZRA 5EKOA 4R1VA 3FMMA 2R0IA 3QD0A 3LFDA 5LMAA 3B2WA 4FX3A 4GT3A 3PDTA 1EH4A 2XIYA 4X7QA 5ACKA 5HE1A 2G2IA 4YBJA 3GC8A 2IW8A 3BEGA 5AR3A 3W32A 5D11A 3WZKA 4YP8A 2YLFA 4TN6A 1BL6A 2YDKA 4F09A 3A7JA 4EKLA 3O51A 4MQ1A 2FYSA 4YJOA 5LOHA 3VW8A 4ZSEA 2XVDA 3PLAE 3KXNA 2BRGA 3VF9A 3NMUF 4EKKA 4EUUA 2BPMA 2PMNX 4Y46A 1VEBA 4FG8A 3DTCA 4ZTHA 3Q2JA 3JPVA 4IWDA 2WXVA 3NUXA 4L45A 1VYZA 2V0DA 1M2RA 4I5CA 5E8XA 1TKIA 3UNKA 2UVYA 3TKHA 3ZONA 3JS2A 2PUIA 4IACA 4K8AA 5EM5A 2J0MB 4EC9A 5CEPA 5M4CA 3NUNA 1OZ1A 4GT4A 5JFXA 3CS9A 3DBCA 2PUNA 3LFFA 3NYXA 2E9PA 3VS5A 4USFA 3MH2A 2HZ4A 4MNFA 5ICPA 3NIZA 3COHA 1XH6A 3MN3A 4BIBA 4O0TA 4FODA 1GNGA 3LAUA 3MW1A 4C4HA 2REIA 1KWPA 1OL7A 2FA2A 4HYHA 5H9BA 4F7SA 1VYWA 3I60A 4IQ6A 3NVMB 2YIYA 3AT2A 2OLCA 3DZQA 2CDZA 4PMMA 2WQBA 3ZEPA 2YJRA 4O1OA 4FZFB 3WF6A 4EK8A 3HP5A 4U43A 4F0FA 5IQDA 3UNJA 2XNPA 2GTNA 4ZS0A 4F0GA 5A46A 5IPJA 3V5LA 1WFCA 3ENHA 4CG8A 3LCTA 3MVJA 3KRXA 4YNOA 4EK4A 3ODYX 2B0QA 1M52A 5CEIA 4I92A 4UX9A 3BZ3A 3QLFA 3GU8A 1W0XC 1JNKA 4C58A 1VZOA 5AX9A 3ZLSA 4CV8A 2PVYA 2WU6A 2CNVA 2YAKA 2XM9A 2QLQA 3VQUA 3NNWA 3JXWA 3E62A 3V01A 3U6JA 4U80A 3LM5A 4PDSA 1ZARA 4IHPA 5FM2A 4FZ7A 4W4VA 1QPDA 3C5IA 1UU9A 5EQEA 1HCLA 4JBPA 2XK9A 3CXWA 2HWPA 3OF0A 3EZRA 1GIHA 5IMXA 1TVOA 5JSMA 2BZJA 5AAGA 2YWPA 2XP2A 2QO7A 2NPQA 5M4UA 2R5TA 4L01A 4MVFA 3CKWA 4Q2AA 1LPUA 4NK9A 5DGZA 5FP5A 4QMSA 3TJCA 3LPBA 4EHEA 3ZO4A 4EZ3A 4FV6A 3JVSA 4CCUA 1DM2A 3Q5ZA 4AP7A 5JQ5A 4YJVA 4X2NA 1G8SA 3PPZA 4R7IA 3VJNA 4RRVA 3P7BA 2R3HA 3MA6A 2J5FA 4O7SA 4I20A 4FL1A 4U7ZA 2C3IB 5FTQA 4GEOA 3MWUA 5ACBC 4O7LA 2OKRA 3E8EA 4O1PA 3FLYA 3RK5A 3W2OA 3R6XA 4I4EA 2OJFE 3LJ2A 5L6OA 4A4OA 1XBCA 2VTAA 5C01A 4CFXA 2XRUA 3O50A 4BC6A 4IJ9A 1G3NA 3F3VA 3VS4A 2VU3A 1OPJA 1YI6A 2PK9A 2UW8A 3GU5A 2ERKA 3I7CA 4RFMA 2W5AA 4FIJA 4FT9A 3FI3A 2BTRA 4QP2A 3FMKA 4X3FB 5BMMA 3OFMA 3I81A 5FQDC 4AE9A 5EOLA 2VWWA 3BV2A 3R8UA 4WG5A 4NJDA 3IGOA 3F9NA 4KBKA 4BL1A 4NUSA 4OTPA 2O64A 5HX6A 4U97A 3DBDA 4MD8E 5KMKA 2PULA 3R8VA 2HENA 2DS1A 1ZY5A 4TZRA 3MPAA 3OWJA 2UVZA 3DDPA 4W9WA 5AV4A 3FQSA 3IW4A 3BGQA 4QQJA 3SG8A 4DC2A 3KMUA 1Y6AA 4U81A 5IISA 1W98A 2CHLA 2BRBA 2IW6A 2J6MA 3EQGA 5HIEA 5AUUA 3NUAA 3TV4A 3KB7A 3NEWA 4IB1A 3RAWA 4AW1A 5C4LA 4KIKB 4FKUA 5LJJA 5DE2A 1LP4A 2PMIA 5CENA 4RJ7A 5ITAA 4IFCA 2UZDA 4R3PA 5CWZA 4IB3A 3EH9A 2PYWA 3D0EA 3ORKA 4K18A 2CLQA 4FV5A 5KBQA 4FVRA 5DBXA 3RNYA 5KX8A 3UG2A 2OWBA 1Z5MA 3AOXA 3PE2A 5IA5A 4E6CA 3PP0A 4AN9A 3R7UA 4EK5A 4F08A 3QKMA 4JDIA 3CCNA 4G1WA 4UWYA 4EHZA 3H0YA 4FKSA 4PMSA 4Y85A 4IVAA 3FBVA 3QZGA 4FZAB 5EI8A 3R8LA 2NO3A 1ZMVA 2JKMA 4JIKA 4BTKA 1CSNA 3ETAA 2OW3A 3NPCA 4M67A 2YITA 4HZSA 5AV0A 3COIA 4APCA 5AUVA 5AAFA 3S00A 3IOPA 5DT4A 4MBLA 3QQUA 3OWLA 2NP8A 3ZLYA 4UWBA 4JNWA 2OI4X 2V62A 5M09A 3F88A 3QXOA 1ZXEA 4LMUA 3I7BA 4BCHA 3AMAA 3D14A 3OVVA 4MXXA 4BCMA 3D4QA 3WILA 3ZM9A 4FV1A 5HNBA 2UV2A 5AUWA 4FL3A 4ZLYA 2Y6OA 3V5QA 4E5BA 4IBMA 2G2HA 3NCGA 4FIGA 1AD5A 4NH1A 1XO2B 2JKKA 4TWOA 4UMPA 4C4GA 5HG9A 3OOMA 4RIYB 1PXIA 3HDNA 5LWMA 3QLGA 3E5AA 4OTDA 4YC3A 4EYJA 4K9YA 3FPMA 5AIKA 2IJMA 3BWFA 3FLSA 4XBUA 3ZC6A 4H1JA 2BDWA 1DAWA 5I5ZA 5LVNA 4RIXA 2ETMA 3ALNA 3KRWA 3VS1A 4XG8A 3LCSA 2X39A 3O8TA 3BGZA 3FHRA 2O2UA 1YOLA 3PY1A 1GAGA 4FIFA 4PDPA 3FC2A 4RJ5A 4FTKA 2H8HA 3GVUA 3LE6A 5E8SA 1QMZA 2B9HA 2EVAA 2OICA 2V5QA 3HA8A 3JY9A 3LXPA 3Q4CA 3EL7A 4TTHB 1HCKA 3SV0A 2W0JA 2RSVA 5CSPA 1OI9A 5CU4A 3ZSGA 4M7IA 3NW6A 3LJ0A 4Y72A 2W06A 2HAKA 4R77A 3C0HA 4OUCA 1K2PA 5I3OA 3WZJA 4WA9A 3VNTA 1PHKA 4O84A 3LIJA 3WF5A 2ZV7A 5EQYA 3G0EA 2C6KA 2XB7A 4G6LA 4BCGA 3BLRA 4Q9SA 3KKVA 4U42A 3UC4A 3WYYA 4G6NA 2CKQA 3TIZA 3CSVA 4YSMA 2HELA 2FGIA 5D10A 3KRJA 1F5QA 5AWMA 1SZMA 1SNXA 4MF0A 2BAKA 4HYSA 1IRKA 4FOBA 5HTCA 2ITWA 1FMOE 3VO3A 4HGEA 2WB8A 3UZPA 3TACA 4RQVA 4NM5A 3HUCA 2H96A 3O23A 3UBDA 2GQRA 4ZS4A 3WBLA 1ZOHA 2UZLA 3UMWA 4DGOA 2RIOA 4Q5EA 3QQFA 1R0EA 3HNGA 4NTTA 4HJOA 4DAWA 2PMOX 4DGMA 2E9UA 3F66A 4RWJA 5GHVA 5L2QA 3T8OA 3E8CA 3P7CA 3UO4A 1W84A 2OFVA 1P2AA 4DH8A 4W8EA 2J7TA 2R3KA 1MRUA 3W2SA 4AW0A 4YMJA 4UB7A 3G15A 2PY3A 4Y8DA 2YCSA 4DGGA 2XNBA 5KHXA 1YXSA 2ZMCA 3RM7A 5AR4A 1H4LA 2BCJA 5FTGA 3PXZA 3DCVA 3QTIA 3UZRA 3BGPA 1UU3A 4GU9A 4DT8A 4L67A 4AQCA 2OGVA 4D4SA 3HMPA 3OEZA 4G2FA 4H3QA 4IAZA 2VTRA 4QMNA 4R1YA 4CD0A 5CEKA 4ORKA 2OIQA 4QP3A 1BL7A 1JQHA 3R1QA 4CMTA 2H34A 3KREA 4RLLA 4FIEA 1YXUA 4FK3A 4ZTRA 1KV1A 1ZYCA 4BKYA 5EHOA 2HCKA 4AX8A 1NW1A 4AF3A 5I9VA 3DB6A 4H58A 3O7LB 5BUEA 4I6BA 3TI1A 3FMEA 5EDRA 4EOMA 3QYZA 4PMTA 2ITPA 4BDEA 2C4GA 4PNKA 4FV3A 2ITUA 4Q5HA 1PY5A 5HBJA 4NZWB 1XWSA 1Y8YA 2XUUA 4FSMA 2GTMA 3THBA 1Q8TA 3IKAA 3R1YA 4C3PA 1UVRA 2X6EA 1BX6A 4DG3E 3QTUA 2HXLA 4LV8A 4F7NA 5HE3A 2J0IA 2BRNA 3ZUTA 3RBWA 1Y8GA 5M51A 4JIAA 3R1NA 3C4EA 3OCTA 3F2NA 3BHUA 2O0UA 2A4LA 4KS7A 4QP8A 3W2QA 3DK3A 4O0VA 5JFSA 5EKNA 3NVKI 3LM0A 3RTPA 1OUYA 3CJFA 2IVTA 4JR3A 4RT7A 4GK3A 3M11A 4AA0A 3P9JA 4RX7A 4WIHA 3U8WA 2QONA 3HX4A 2Y7JA 3P4KA 3DKOA 1H1PA 4BTJA 5HNIX 4BDKA 3MB7A 3PUPA 4UYAA 1WMKA 2WO6A 1H24A 4FI1A 2UZNA 4EEVA 2B1PA 3NYOA 4C0TA 3P86A 4WO5A 1NXKA 1JKLA 4RIWA 4M0YA 5CY3A 2BDJA 1XHAA 2XJ0A 3A60A 1SYKA 2OF4A 3PVUA 3I79A 3NSZA 3LCDA 4FTIA 4KSPA 2C0IA 4TYEA 2ETRA 4DCEA 3L9PA 4BCPA 3EFWA 5L8JA 2F49A 3SQQA 1V0BA 3S3IA 1PXOA 4ZXTA 3QC9A 4XS2A 3KXHA 4O22A 5JGBA 5L8KA 4L53A 4F7JA 3DK7A 4EQUA 3I0QA 2JDRA 2I7QA 4AZTA 3EN4A 3ODZX 2B55A 4BZNA 5I9YA 4MHAA 1NVSA 3UOHA 2QVSE 4I3ZA 2WQMA 4JBVA 4F1TA 4KBCA 2O63A 3QRIA 2XKDA 5IUHA 5B0XA 3GC7A 2HW7A 3PSBA 3MS9A 3KC3A 3P78A 3EYGA 4JAIA 4GKIA 4B4LA 1XH9A 1GIJA 3OCGA 4HVDA 2I0HA 3OTUA 3AGLA 2JGZA 4QTCA 4EWQA 4BDIA 5FUTA 5HU9A 3IW5A 3DV3A 3F82A 2GNFA 4WBBB 3BBWA 3OS3A 4X6RA 3SVVA 5DVRA 4GL9A 4H39A 4RX8A 4P7EA 4MWHA 4JBQA 5EG3A 1PXLA 3V6SA 4YJSA 4BCIA 3SRVB 4CTBA 3F5XA 5LVMA 2UZBA 3ZM4A 2QNJA 3LW0A 2FSTX 2OIDA 3BI6A 1R39A 3AT3A 3LFEA 2C6IA 3TWJA 2PUUA 2YHVA 3BLQA 4C35A 3HV3A 5CTPA 4EQCA 5F1ZA 1M2PA 5BVKA 3RPRA 5TOZA 4C4JA 4FEWA 2A1AB 3S95A 5C27A 3W33A 2G2FA 3EQRA 4R6VA 4KRDA 4E73A 1NY3A 4O0XA 4XLVA 5DA3A 3V04A 4A9RA 4HVIA 5IA1A 1V1KA 3GNIB 4JDJA 2FB8A 3C13A 5CALA 2XEZA 4X0MA 3ZMMA 4IWPA 5DNRA 2G15A 3GBZA 4FG9A 4D1SA 3R9OA 2IN6A 3CTJA 4ACHA 1I44A 2JIIA 1YDTE 3RALA 1BYGA 5ANDA 1ZZ2A 4OTHA 3ZRMA 4Z16A 2IZSA 5IDPA 4JRVA 3R22A 4XP0A 2B54A 4TNDA 2JBPA 3ORXA 3PWYA 2GNGA 4DFXE 5AA9A 3P79A 2Z7RA 1ZAOA 3A7HA 3DAEA 3UJGA 3R7VA 5GZ9A 3RPSA 3QTSA 4ANQA 3DOGA 2X6DA 5E91A 4DCAA 1U46A 4FKOA 4IZ7A 3V8TA 1A06A 4JL9A 1BI8A 3PIXA 4WSYA 3RK9A 1U54A 2QURA 5TF9A 4FIIA 5IUGA 2Q0BA 4M8TA 5F20A 4UALA 1YWNA 3A8WA 4BTMA 4ZAUA 4USEA 5KKRB 2CNUA 2GNIA 1JSVA 4YNEA 1G5SA 5HU3A 3ELJA 1B6CB 4XOZA 2QG7A 4D1ZA 1WVWA 3MJ2A 4DH5A 2CCHA 3ZO3A 2NRYA 3FYJX 4FTOA 1FQ1B 3BQRA 3F3WA 4NT4A 1ZRZA 4OW8A 4DLIA 2QHMA 1XH5A 2J0LA 4I4FA 5DOSA 4XYFA 2DWBA 4UZHA 3Q4UA 3VS3A 3KXZA 1PMNA 2OSCA 2R3JA 3GCPA 2CGUA 4RBLA 3ZLXA 3HYHA 3R9RA 1Y57A 3D5WA 3OT8A 4NFMA 5BVEA 4FK6A 2HZ0A 4AFJA 2PWLA 3E88A 4M15A 3SDJA 4DG0E 3IECA 3NNUA 4C7TA 4HGLA 2SRCA 3U51A 3LFAA 5DH3A 4DE4A 3ZFYA 4LGGA 4AT4A 5H8GA 4YU2A 4E4MA 2R3RA 4H3BA 5K5XA 2J51A 2IZRA 4BKZA 5HGIA 5E90A 3QQHA 3HMNA 2IVSA 3A62A 4JG8A 5FEQA 5GJGA 3PJ2A 2WMBA 3OMVA 4AGCA 4L42A 5HX8A 4RVMA 3PXRA 4CFVA 2XBAA 3H3CA 3QRUA 5F9EA 3VS2A 5J9ZA 3KF4A 4I6FA 4WNOA 4B8LA 1Q8YA 4CZUA 4M66A 3RAHA 1RQQA 2EB2A 2JFLA 4ACCA 3GOPA 3T9IA 4DEBA 4ACMA 2UW3A 2QODA 3TNPC 4QTBA 5HI2A 2ERZE 2PVNA 5KMJA 4FTLA 4X21A 4IM3A 5AMNA 2VD5A 3ZZWA 2CN5A 4AW2A 2Y0AA 4EH4A 4EH9A 2QLUA 1OKVA 4PV0A 3QL8A 3MVHA 4R3CA 3QAME 4LOPA 2JIVA 4WNMA 2Z7QA 3BYMA 3WIKA 2BILB 4E8AA 2XJ1A 5BUJA 1P4FA 4X2KA 4Z9LA 3DBQA 4CKRA 4Z55A 4RWLA 1Q4LA 4O91A 1OKYA 4TYIA 4I23A 3DNDA 4XV3A 5IF1A 4OBQA 4DH7A 1FBNA 4CGAA 3V5WA 4G3FA 5BPYA 2HK5A 4ZMFA 3UMXA 3VBVA 5HEZA 3KULA 2XM8A 5AUYA 5J79A 4TY1A 3NUYA 5EI6A 3QQJA 5I4NA 3CTHA 5A4CA 4R8QA 2CGXA 3QQKA 5DYJA 4E7WA 2XZSA 2WTWA 2X8IA 3PA4A 3SC1A 3D9VA 3W1FA 5JGAA 3CBLA 2JC6A 2YM8A 5G1XA 1MRVA 2UW4A 4H3PA 5GZ8A 4RVKA 2OXDA 2E9VA 4NSTA 4EOJA 4QNYA 4BCOA 3P23A 4DT9A 2ZV8A 3MH1A 3PRIA 3DKCA 2B9IA 3KQ7A 4IM2A 4F9YA 5KUPA 4BGHA 4JRNA 4K11A 4MBIA 3IK3A 3KVXA 3LFSA 4FOCA 3T3UA 2YJSA 3Q4ZA 4QNAA 3SGCA 4NCTC 5BUIA 1Z57A 1XJDA 4ACDA 4K33A 4MD7E 4ZP5A 3QRTA 2AC3A 4PUZA 3MTFA 2BAQA 3TZ7A 2XK4A 1PMEA 3RGFA 3ZC5A 2XK6A 2GU8A 5FRIA 1QPCA 2R2PA 2JAMA 4OBPA 4E6AA 4CG9A 2JKOA 4YSJA 4CLIA 3AMBA 2C47A 2UW0A 2YLEA 3GCSA 3ZRLA 2XYNA 4FV4A 4JAJA 5FEEA 3V51A 3W2PA 4EOOA 3N4TA 3FPQA 4YBKA 1Q97A 3NW5A 3MH0A 4BRXA 5JGDA 5IQIA 2ONLA 3BHVA 3EFJA 2VWBA 3QD2B 4PL5A 4XCUA 4D9UA 4EORA 4USDA 4QP6A 2C6OA 2HOGA 4BDDA 3CR0A 4J1RA 4R3RA 3SKCA 3CQWA 2QCSA 4PMPA 3V8WA 4PPAA 4DA5A 4JQ7A 2BMCA 4FKRA 5CSVA 4DTBA 4PRJA 4TKSA 4BBFA 3G33A 1OUKA 1R3CA 4IADA 5I9XA 1RW8A 2BAJA 3QBNA 4IX6A 4YZBA 2VTOA 2ZMDA 3E93A 3W2RA 5CANA 3HUBA 4BCKA 5ETFA 3NYVA 4ID7A 1GZ8A 3G0FA 4XH6A 4XRLA 3SXSA 3LJ1A 4R7BA 4M14A 5AP7A 3F61A 4PWNA 4K0YA 5FEDA 2OZAA 4TL0A 5BMSA 2OXYA 5BYYA 3GQIA 1H8FA 2DQ7X 4ZTNA 3C7QA 3QTRA 5L8LA 2VV9A 4IZAA 3PFQA 4DFUA 2HWOA 3VWAA 2LGCA 5CU0A 3EIDA 4ZY4A 3PXYA 3LXKA 4I5PA 4UMQA 4IH8A 3PA3A 3SD0A 5D9HA 1OIQA 2YN8A 3OW3A 2BZKB 1H0WA 1GZOA 4WD5A 4YZCA 4O7VA 4GUBA 3A4OX 1B38A 2P4IA 3FJQE 2I0EA 2XKFA 3QALE 1UWJA 4GMYA 3R9NA 3UIXA 2PE2A 2QOOA 1BLXA 3HP2A 4F9CA 2RL5A 3TZMA 1BKXA 4YUQA 3FLQA 4HNIA 2G9XA 1CDKA 4UWCA 4BDAA 4DEHA 1XBBA 3WARA 5FTOA 2CSNA 1WBNA 3DQWA 4MNEA 4TYGA 4YLLA 4D2SA 3BQCA 4GH2A 2ZM4A 5JFWA 3VIDA 3TUBA 3HEGA 1UNGA 2AC5A 3L1SA 2OJGA 5JQ8A 4HOKA 3Q53A 4DFLA 3R8MA 3LCOA 4WHZA 3FZSA 5AP0A 5HNGA 4YURA 5JEBA 2YWVA 1H1WA 3PE1A 3ZO1A 4QQTA 5AUTA 4KABA 2B4SB 5DR2A 2BIKB 3OWKA 2AYPA 4NW6A 3U4WA 2FVDA 3TTIA 3PXKA 3FL5A 1J91A 4F9WA 3MFUA 3IONA 4NYEA 5HO6A 2PVJA 3UC3A 5CNOA 4OBOA 4BKJA 2JFMA 3RCJA 3LMHA 3EOCA 4K1BA 4IAFA 4ANNA 3V3VA 2IW9A 4M0ZA 2WPAA 2VO0A 4U5JA 4BYIA 1VR2A 3PPJA 5AR2A 3S1HA 2AUHA 4ENYA 4F6UA 1JBPE 4EQMA 4WSQA 3NR9A 4C62A 1NT2A 3CY3A 2BZHB 2W9FB 2PZIA 5CLPA 4YZMA 2VO7A 4F9BA 4X6QC 2B9FA 4E5WA 2ZDUA 4M69B 1XH4A 2OG8A 5IG1A 4W4XA 4AA5A 1REKA 2OXXA 3F3UA 4BZDA 4XBRA 2GNJA 3CD3A 5AP2A 3QKLA 4LM5A 1KOAA 4LFIA 4ANOA 5IH5A 3POZA 2ITQA 3PXFA 3NNXA 4BGQA 2C6MA 2C0OA 4GU6A 4C02A 4QYYA 3V5TA 2PTKA 2PSQA 5CXZA 2WELA 3FXWA 3VULA 3F2AA 4JI9A 4V0GB 5H2UA 4I93A 3T9TA 3UQGA 3DAKA 3VUKA 2UZWE 5J5TA 4MQ2A 4E4XA 1RDQE 4O82A 3HZTA 3VUMA 4DF3A 1J1BA 2HIWA 3KCKA 4FTMA 3PJ3A 3UYSA 4N4SA 3D83A 4YJTA 1RE8A 3RI1A 2C3KA 5K4JA 4QOXA 2O8YA 2BKZA 2F7XE 4HVSA 4XUFA 4O6LA 5IEVA 3A99A 4ITJA 3N9XA 3NNVA 2EXMA 3TXOA 2YEXA 3SXFA 2VNWA 3SAYA 1YHWA 4RA5A 2WMWA 4J71A 3VRYA 3MYGA 4WNPA 1JOWB 3BYOA 3SXRA 4JX7A 3BYVA 2BVAA 2QR8A 3P0MA 4ZZNA 4S30A 2OIBA 4BCNA 2W05A 1Q3WA 1W7HA 1YQJA 3GB2A 3LXNA 4D4YA 4F4PA 4K77A 2BALA 4DITA 3FHIA 4J8NA 2OJIA 3QHWA 4XX9A 5CZIA 4BCQA 4D28A 4QYEA 4C4IA 2WMSA 1OL5A 4DBNA 1LEZA 5HKMA 4Z7HA 4IVCA 4LQMA 4M97A 2F2CB 3RHKA 4G3DA 4S34A 1H25A 4CYIA 3F7WA 5CSXA 5HIDA 3C4WA 2XK7A 4DEAA 4FKVA 1JKSA 2XF0A 4IAIA 3HMMA 3C0IA 2YM6A 5HVYA 2XJ2A 1CTPE 1M7QA 3TZ9A 2ZV9A 3A8XA 4RFZA 4F9AA 4WUAA 3TEIA 4N57A 4CKIA 2ITXA 4O7YA 2XRWA 3A4PA 3DA6A 2VTIA 3UODA 2CCIA 4JG6A 2HYYA 4EBVA 4Q9ZA 2UZUE 3A61A 2VWZA 1KOBA 1QL6A 5DT0A 2C5NA 3UIMA 2OJJA 4AZSA 5HD4A 3ZS5A 1IAHA 2BKKA 3VC4A 4AN3A 4AFEA 3ZCLA 5AV2A 3RZFA 3ACJA 3MGYA 3PP1A 4YHJA 5DLSA 1Q3DA 3G6HA 4FL2A 3R63A 2Z7SA 3C4FA 4BI1A 4UYNA 4FUYA 5IQHA 1PXJA 3R28A 1PXNA 4PP9A 5IQGA 4ZJIA 4IE9A 4J96A 2QOKA 4X2FA 2R3IA 3HDMA 4EHVA 3TUDA 2C1AA 3FE3A 4DG2E 4UMRA 3QX4A 3FZPA 3DKFA 3SRVA 5CSWA 4A9UA 1P5EA 1UNHA 2G01A 3Q96A 4TNBA 4ZEGA 1YOMA 3WE4A 3UOKA 3H9RA 3WF7A 4RA4A 4HPTE 5EM8A 3OG7A 5J9LA 3PA5A 4FUXA 5EYDA 2JEDA 1IEPA 5JZJA 4TPTA 3GP0A 3NW7A 3QX2A 4C4EA 4E6DA 4Z3VA 1Q8WA 3COMA 4AS0A 5A4QA 4PDOA 2FSLX 3OROA 3U87A 4L43A 3MPTA 4IDVA 2JDTA 2X4ZA 1XH8A 3W8QA 3ZXZA 2PVMA 3G90X 4XMOA 1Y91A 1GIIA 4MH7A 4TRLA 4QYFA 2WTDA 4TYHB 2R3OA 3RAIA 3GFEA 4IZYA 5AADA 3UNZA 2VTMA 4LL5A 4F63A 1HOWA 3LOKA 4DGNA 1ZY4A 3RHXA 4ITIA 5G6VA 5EQPA 2ZYBA 1MQ4A 2IZUA 4DEEA 4I94A 3LCKA 4IVBA 2ZVAA 3AD4A 4MD9E 3EN5A 5L6WL 1PKGA 2VWVA 4FV2A 5CEOA 3CP9A 3PZEA 5EM7A 5K3YA 3Q32A 4QPAA 2CGWA 3F6XA 5AV3A 3IS5A 1M2QA 3QD3A 3OZ6A 3CGFA 2YM3A 1YW2A 4YTCA 2IPXA 4EJ7A 3EJ1A 5HHWA 2W7XA 3OWPA 4GYIA 4E6QA 3O0GA 4W4WA 3NAXA 2E2BA 4E20A 3DGKA 1H08A 5KBRA 1PKDA 3DFAA 3E8NA 3JVRA 5C26A 4FSRA 4C3RA 3I6WA 3UTOA 2VX1A 3QRKA 4IAAA 3OUNB 4L6QA 3WZDA 1PXMA 1SVGA 3TNWA 4Y73A 4J7BA 4RVLA 2O65A 4L3JA 5EHYA 5FBNC 4BBMA 5M4IA 4B0GA 1R1WA 2PVFA 2PVLA 3AGMA 4O6EA 3S2PA 3NS9A 3GCVA 3FQHA 1WVYA 4G3CA 3MIAA 5DRDA 5AUZA 5HCXA 3ZDUA 2BROA 5KKRC 2ETKA 1FGKA 2WTVA 4GFMA 2HZNA 3VS6A 5AX3A 4FYOA 5M06A 4FTUA 4ZLOA 5JK3A 3G9LX 4YLJA 5FXSA 5J87A 4QP1A 2ZM3A 4U0IA 3R0TA 4UV0A 1YDRE 2YERA 1TQMA 3KRRA 3AXWA 5DRBA 5E1SA 4XG2A 5BVDA 4NKAA 4U45A 4HVHA 3FKNA 3BV3A 3NCZA 4L52A 5IEYA 4FE2A 3IPHA 4S33A 3R8ZA 5FBOA 4KA3A 5CF8A 5CI7A 4BDJA 2H6DA 4QMOA 4RZVA 3UE4A 3FMNA 3GGFA 3GFWA 5IEXA 1XH7A 3A7GA 3DY7A 4D1XA 3BPRA 4FSYA 2VTQA 3POOA 4RC2A 5J8IA 5GJDA 4BWKA 2R3FA 4O0YA 5KHWA 1XQZA 4FEQA 3FMHA 3AD6A 3KXXA 3HECA 2WIPA 3UQCA 4AOJA 5EDPA 1FGIA 5C8MA 5BVFA 3VHKA 4WT6A 2GHMA 2WEVA 2Z7LA 2X2MA 2BRMA 2P2HA 5BVOA 1OM1A 2QU5A 1YKRA 4YO6A 5IQFA 4JX3A 2W4KA 4FG7A 4J99A 4KKHA 4TT7A 1JWHA 3TNQB 1Q99A 3OW4A 4G5JA 3BLHA 3AC1A 4OTWA 4IB5A 4QQ5A 3II5A 4I41A 4ACGA 3HAMA 2J90A 4XEYA 5B7VA 3IGGA 4QMUA 3RP9A 4WG3A 4KIOA 3ALOA 2RFEA 2ZOQA 3PRFA 2X1NA 4HCVA 5J7HA 3PVBA 4U3YA 2XNNA 4KD1A 5FDXA 3VUTA 3WF8A 4F99A 4O2ZA 5CZHA 2C1BA 2NNWB 2XKEA 4MAOA 2VRXA 1PXPA 1WAKA 3BE9A 3PG1A 4ALWA 3QUPA 1Z9XA 4G9RA 2GNHA 4EOQA 4A4XA 3W8LA 4LUEA 3PSDA 4OTFA 3OY1A 4GJ2A 3I0OA 1PMUA 3OTVA 4FTNA 2I1MA 3MVMA 5L2IA 1MP8A 5LCKA 4CTCA 2VTPA 4ERKA 4BDFA 3NUSA 2OZOA 5I9UA 2P2IA 2W4JA 3PG3A 1W83A 2GS2A 2H9VA 5L2WA 4G31A 1A9UA 3REPA 4KBAA 2WEIA 2QU6A 3RAKA 3QGYA 3QFVA 3AG9A 5K5NA 5AP4A 3QF9A 3RZBA 3WZUA 2FO0A 4EOPA 1B39A 1PW2A 1VJYA 3EFLA 4UZDA 4O7TA 1Q8ZA 1DI8A 5ANOA 4FTAA 1S9JA 2WMAA 4JVGA 1OPKA 5TT7A 2OH0E 2XIZA 3WIGA 3N4VA 2WMQA 4N6YA 3EQIA 5LQFA 5FXQA 1ZYLA 3EQHA 3ULIA 4QP9A 3ZXTA 5CF6A 4O7RA 3OT3A 5CU3A 4C2WA 3LLTA 4QMPA 3R21A 1QPEA 3K5VA 1OBGA 3EL8A 4DGLC 1J1CA 1L8TA 5CVHA 4R78A 5HD7A 5CT7A 1M7NA 2YABA 4DH1A 2X8DA 3I5ZA 4PL4A 4RLKA 3D7TA 3EYHA 2BHHA 5TKDA 3RWQA 1OECA 2W4OA 4M13A 1OIYA 1YI4A 3LKMA 4KKGA 4BTFA 3C50A 1WBTA 3AC3A 4I6QA 1CKJA 2B53A 3OUKA 3ZTXA 5A6NA 4PX6A 3PVGA 2XBJA 1GY3A 2X81A 3DBEA 4ZSAA 4IC8A 5GIOE 3F3TA 5L3AA 2CKPA 4GG5A 5HBHA 3ULZA 3R71A 2VTLA 3EN9A 3MA3A 4G9CA 2WTIA 3DXPA 3ORLA 3HRBA 3K5UA 2ZM1A 4D58A 4E26A 4RX5A 3VF8A 2XNMA 2CN8A 1UKHA 2W1DA 4LOOA 2BTSA 4S2ZA 5AFVA 5AP1A 4YC6A 4MF1A 4O86A 3TTJA 4L7FA 3E87A 3G2FA 4O2PA 1M17A 4JJRA 4FGRA 2QI8A 2V7AA 5A9UA 3UQFA 3LQ8A 1OBDA 4RSSA 2JDOA 2BHEA 4U40A 2QD9A 4AWIA 5AAEA 4WOVA 3G6GA 4EI4A 3BHHA 1U5RA 4HGTA 1T45A 3HV7A 4FNZA 4APPA 4O7NA 3BU5A 2Y6MA 4JS8A 3Q9YA 3VAPA 2CGVA 1STCE 3F3ZA 3NUUA 4O0UA 3TM0A 2XEYA 2XIXA 3IW7A 3Q04A 3MFTA 4JQEA 2WKMA 5H8BA 4FTQA 5HG5A 3R7YA 3QCXA 4RJ8A 4CKJA 3BCEA 3F5PA 3PY3A 4XNEA 4RJ4A 2DUVA 1R78A 2LAVA 4KIQA 3BIZA 5IMEA 3R04A 5CI6A 5GJFA 5KZIA 4EZ7A 4CQEA 4XV2A 3W16A 4CFWA 4QMXA 2QOBA 1LUFA 3HVCA 4D4VA 2XMYA 3MH3A 4M12A 3ZFMA 3JR1A 3DNEA 1KV2A 1PYXA 5H8EA 4L3LA 4XG3A 2QG5A 1AQ1A 3R9DA 4O7WA 2WD1A 1OITA 4TW9A 5HVKA 4C8BA 4F65A 3NLBA 2PHKA 4QP7A 1H26A 2XKCA 3NAYA 3UP2A 5J1WA 3PSCA 5CVGA 3BU6A 3BEAA 2XNEA 4FF8A 5HTBA 5EFQA 2FSMX 4OGRA 2QO9A 2UZEA 3RVGA 2BFXA 3ZBXA 4U8ZA 2ITNA 3EKNA 1CMKE 4ASZA 1YWVA 2C30A 4FT5A 4N0SA 4R7HA 4KAOA 3OCSA 4IW0A 3ZU7A 3DPKA 2YIQA 4CFMA 1FVRA 3H0ZA 3OBGA 2I0YA 3HA6A 3SOAA 3QGWA 5E7RA 4ZTMA 4RIXB 5JH6A 2GCDA 5D41A 1FOTA 4QMWA 4U44A 3ORPA 4WRSA 4EOIA 3GXLA 3FZOA 3MB6A 2O3PA 4ZOGA 4QYHA 4AG8A 1GOLA 2GDOA 5JRSA 4C2VA 4OAUC 2JBOA 3BELA 1J7LA 4AOIA 4ZTLA 5J1VA 1JSTA 3FZ1A 5DG5A 3UZTA 3RJCA 3UYTA 4MXCA 4ZJJA 5M4FA 4CVAA 1YDSE 2JITA 3WYXA 2UW6A 1OB3A 1ZYSA 4GYGA 4R5SA 2YZAA 4Y5HA 5FDPA 2OK1A 2Z60A 3EQCA 3LMGA 3OHTA 2PZPA 3EHAA 4U79A 4O7ZA 3NIEA 4P5QA 4DTAA 4AXAA 1SVEA 3GT8A 4DFZE 3H9OA 1U59A 5TE0A 1KE7A 3L8VA 1O6LA 2YIRA 4FV8A 4I0SA 5LVOA 2QQ7A 1H27A 1W82A 4XJ0A 3LLAA 4FTTA 4F6WA 1SNUA 2P33A 4ANLA 2UUEA 3U54A 4IDTA 3ZEWA 1BMKA 3CC6A 2F9GA 4GKHA 5EYMA 3PPKA 1IA8A 1OMWA 3GEQA 4UMTA 4QTEA 5FM3A 4FGBA 4RJ6A 1W8CA 4NFNA 4XV9A 1LEWA 1YHSA 5EYKA 4N6ZA 3CEKA 2C5XA 4X3FA 4QMZA 3LFQA 4EYMA 2PZRA 3MIYA 1FINA 3K2LA 2X7OA 4CFNA 3DXQA 4DHFA 3MSSA 3ZYAA 3FLNC 4JOAA 1H1QA 2ACXA 3CKXA 1V0OA 2PE1A 2XA4A 3JUHA 4WBOA 1E1XA 2VO6A 4NCTA 4IC7A 2BUJA 3FKLA 5HQ0A 1OKWA 3P5KA 3HAVA 3QXPA 4LRJA 4CNHA 4XHKB 4E3CA 3GOKA 3ZH8A 5M08A 3GC0A 2WAJA 3FMLA 1KE9A 1ZLTA 3VBTA 3V6RA 4ALVA 1NVQA 5EW9A 3QTQA 4RMZA 4KIKA 4P4CA 4C4FA 5CYIA 3BYUA 4II5A 4G16A 4LV5A 2IZTA 2Q83A 2JDVA 2XCKA 2WQNA 3N4UA 3HL7A 2EXCX 3HV5A 4EWHA 4JG7A 2GQGA 2VWXA 4ZZOA 3D5VA 5KMOA 5CAUA 4BZOA 3BU3A 3MV5A 5LMBA 4FV9A 1XR1A 2WGJA 3CJGA 4G6OA 4B8MA 1UA2A 4CQGA 3L9LA 5E8WA 5M53A 5A3XA 3C5UA 2R3LA 2W1HA 3HMIA 5H3QA 5T3QA 3RINA 3QZIA 5JT2A 4ZK5A 2B9JA 4A9SA 1UNLA 3DDQA 1FPUA 4W8DA 2CKEA 2VTJA 5A4EA 3O17A 2KULA 3I6UA 1P4OA 3Q60A 4FSWA 4OLIA 4U3ZA 5HG8A 4YTHA 3AC2A 4YPSA 3SW4A 2HXQA 3VBQA 5KMLA 5JRQA 5ETAA 4GVJA 1Q41A 2C6LA 4E4LA 4GVAA 4TYHA 2C3LA 3QTZA 2UVXA 5CU2A 3KA0A 3FSFA 2X9EA 5AUXA 5F95A 4BWPA 5C8KA 5M07A 2ITYA 1REJA 4ZSGA 3Q6UA 1MRYA 4HCUA 4RG0A 4TXCA 5CASA 3TNIA 4RIWB 4D55A 2BFYA 2VWYA 4QD6A 2R7IA 2CNQA 2C0TA 4FKTA 2ITZA 5D1JA 5AP6A 4FNWA 3UDBA 4RIYA 3UG1A 5IA3A 3LZBA 3QA8A 3I1AA 4I21A 4MXAA 3K3JA 5L2SA 2PUPA 4FICA 4O21A 5HE0A 3QYWA 3KN6A 2E9OA 3AC5A 5FD2A 3E3BX 4ERWA 5HLNA 2YA9A 4NW5A 3KU2A 5HVJA 3VBXA 3WE8A 1PRYA 4D0WA 4FNXA 3UPXA 3U6HA 3L8XA 4CV9A 4AOTA 2EUFB 3B8QA 4DINA 2GMXA 4RJ3A 3UOJA 1ERKA 4C57A 3PTGA 5CAOA 5FP6A 1DS5A 5CAQA 2ONLC 2PU8A 3DQXA 1IAJA 2ZV2A 3IOKA 1Q61A
chains in the Genus database with same CATH superfamily
2OH4A 4YO4A 3Q2MA 4O38A 4XOYA 2V22A 4AACA 3P7AA 4ZSJA 3GU6A 1URWA 4CFUA 4XP2A 3ANQA 3OD6X 1WBVA 3JY0A 2PZ5A 1YWRA 3A2CA 3F7ZA 2JAVA 3FI4A 4AGUA 4AGWA 2RFSA 3V5JA 5ANKA 3IG7A 4QMMA 4DFBA 1E1VA 5A14A 2WTKC 3D15A 2YFXA 2WFYA 2GFCA 3KMWA 3ZRKA 4AUAA 3JYAA 3AC8A 4G5PA 4HZRA 4JQ8A 4TWCA 5EOBA 5FG8A 4F64A 4DEIA 5F4NA 1I09A 2RKUA 3QC4A 3VRZA 2IG7A 4NEUA 2GHLA 5FGKA 5I9WA 3UO6A 3GU7A 3V5PA 3W18A 2VX3A 4ITHA 4KWPA 1YI3A 3KK8A 2BR1A 4O96A 4UMUA 5IKWA 4FNYA 3G51A 3Q3BA 2C6TA 3PWDA 3F5UA 3ENMA 4G34A 3Q5IA 4NM7A 4AAYA 3HV6A 4FJVA 1Q5KA 2B52A 4TWNA 4YJQA 1O9UA 3R7OA 4AW5A 3Q52A 1MUOA 3WF9A 3KF7A 5CT0A 1TQIA 4KKEA 4L00A 4KINA 1Q8UA 5ETCA 4BYJA 4BIEA 5KZ0A 3VUIA 3M2WA 4K6ZA 3B2TA 3EWHA 3OBJA 4Y83A 4KIPA 3QUDA 1JVPP 3L8SA 4KS8A 4NIFB 4CXAA 1H07A 2YZLA 4DHIB 4KRCA 4FZ6A 4C3FA 4HVGA 4M68A 2A27A 5KMMA 3VUGA 5AP5A 3BYSA 2RG6A 5IA0A 5CSHA 4ZMEA 2Q0NA 4MCVA 3IO7A 3UIBA 2C69A 3VN9A 4CYJA 4ENXA 3D2IA 1H1SA 4PPBA 2I6LA 2Z2WA 2C6DA 3P5JC 1U54B 4RWIA 2V55A 4MWIA 1IA9A 5E4HA 4ANMA 5LARA 4YTFA 3C4CA 4QQCA 3MJ1A 4FEVA 4IM0A 3U9CA 4JT3A 3A7IA 4GFGA 1APME 1JPAA 5IH6A 5HBEA 5T6KA 4F1OA 3PIYA 3V8SA 1WBSA 4PQNA 4O0SA 3WOWA 4H05A 4D2VA 2W1ZA 4RC4A 3RCDA 3TCPA 4FA2A 1KUTA 4LOQA 5ETIA 4EH7A 3VW6A 4CRLA 2R9SA 1SM2A 3D94A 1GZNA 3GC9A 3O96A 3OC1A 4QO9A 1UWHA 1ZMWA 2WU7A 4MX9A 5EDQA 3VVHA 4XG4A 1M14A 4CZYB 4AQKA 3KMMA 3OOGA 5AR7A 2C5YA 3PLSA 1LR4A 1OKZA 2R3GA 2XH5A 4IX3A 4RFYA 5K0KA 3TG1A 4D2PA 4D5KA 1UV5A 4EBWA 5BNJA 5KO1A 5M56A 3EQBA 5AR8A 1KE5A 4JDKA 5HOAA 1F3MC 3HRFA 1MQBA 4EC8A 2YCRA 4FKJA 5CEMA 3FL4A 3GI3A 4CRSA 5DEWA 5J5SA 2WMXA 2R64A 2W9ZB 2NRUA 4G17A 3ORIA 5F94A 5AV1A 3LQ3A 3DZOA 3ZOSA 4L8MA 4EOLA 4BFMA 5DR6A 3FUPA 1F0QA 4BIDA 1Q24A 2XAOA 4FKPA 4A7CA 4AZFA 2GNLA 3MY1A 4CZTA 2GSFA 3I4BA 5CNNA 4IZ5A 4EONA 5HG7A 1J7IA 4FKIA 4UEUA 5E92A 3LMIA 2XIKA 1PJKA 3QWJA 4BN1A 3W0NA 4BDBA 5LVLA 4EK6A 3DK6A 4IFGA 4F7LA 3HRCA 4BDGA 2YIXA 3FY2A 2X2LA 3H10A 5HCZA 4BBEA 3KCFA 4IVDA 5JN2A 2BIYA 2ITTA 5IA2A 3FY0A 2XIRA 4W9XA 1ZMUA 2W1CA 5C03A 3ZSHA 4BDCA 1KSWA 4D5HA 3Q6WA 5DN3A 4PDYA 4BI0A 4QPMA 2R7BA 3LXLA 3LFBA 1PF8A 3BX5A 3KXMA 2EXEA 3FMDA 3KULB 2C5OA 5A6OA 3SW7A 4PP7A 2VGPA 2WZJA 3R30A 3VJOA 4FSUA 4RGJA 1WVXA 4DH3A 3FI8A 3AMYA 3FZTA 4OTRA 4L44A 3RK7A 3W55A 3F2RA 2Z02A 4GJ3A 3KY2A 4XP3A 4D4RA 4EH2A 5DMZA 5L6PA 1K3AA 3EZVA 2Z8CA 5HIBA 4MXOA 2P3GX 4B99A 4H36A 2XS0A 3W0SA 3QQGA 1OGUA 3RPOA 4BJJB 3CQUA 5K9IA 5HLWA 4C37A 1JKTA 1ZYJA 4PTCA 4GV1A 4ZSLA 4FTCA 4F0IA 3EQPA 4FYNA 3BL7A 2PE0A 4X2JA 4CSVA 5HO7A 5IUIA 4AGDA 1ND4A 3C51A 3DAJA 3ZSIA 4CMUA 2IO6A 2X2KA 3FSKA 3R73A 3CD8A 3E3PA 2I40A 3TV6A 3EKKA 3ACKA 4RWKA 4MKCA 4IWOA 4YJUA 2R3NA 3GUBA 2R0UA 3EQFA 1WBOA 3HGKA 4OT6A 4EK3A 1G8KA 2IVUA 2VN9A 2Y4IB 2ZB0A 3UDSA 2YM4A 2QOHA 3BE2A 4I6HA 3H9FA 3UP7A 4DN5A 5HICA 2OO8X 1UU7A 4GK4A 4NWMA 2W1GA 4PL3A 5KNJA 3HMOA 4L68A 1NVRA 3MY0A 2RGPA 3VHEA 4ZTQA 4FSTA 4U41A 4S31A 5BX0A 4MTAA 5K0XA 2YDJA 4FTJA 2X7FA 5EHLA 4FT0A 4LGDA 2X9FA 4O4CA 5AIRA 5IQEA 3D5XA 5EI2A 5C1QB 1YVJA 3ROCA 2P55A 5ANIA 4A07A 3TZ8A 5AJQA 3UOLA 2UW9A 4ALUA 2WTKB 4EZ5A 3VS7A 4GCJA 3K3IA 3WI6A 2VO3A 3H4JA 1H0VA 3DBFA 3CE3A 3LFNA 4PY1A 4L46A 4RVTA 1AGWA 1JKKA 4I5MA 4WRGA 3QU0A 3KL8A 4EL9A 2FH9A 4LRKA 2QKRA 4R5YA 5I9ZA 4ASEA 4IXPA 3AC4A 4D2RA 2OZAB 4B6LA 4DBXA 2GQSA 3RPYA 4E4NA 2JKQA 1SMHA 5FLFA 2A0CX 4ANBA 3M1SA 3A7FA 5CS6A 4GRBA 4B7TA 2Y4PA 5E8YA 1Q62A 5BYZA 3C1XA 3DB8A 3DJ7A 4RQKA 4U6RA 3DT1A 5LWNA 3UVRA 4J97A 5EK7A 4MXYA 4MBJA 1ZZLA 4AAAA 3IDCA 4ZIMA 4WKQA 2J0JA 3VBWA 3DJ5A 4J98A 3SLSA 3R2BA 4H1MA 4JR7A 4AZEA 4C33A 3VS0A 4GIHA 4I0RA 3CIKA 3R8PA 3E7OA 3FI2A 1ATPE 2QOFA 4MNEB 2JD5A 2JDSA 3M42A 4RZWA 2UZOA 3R1SA 3UO5A 3ORTA 4EH8A 3QTWA 4FV7A 3GCUA 4AZVA 5A4LA 5M44A 2OJ9A 4NM3A 4UXQA 2ZJWA 4CT1A 2YCFA 5C8NA 4BDHA 4LI5A 2GS7A 3RWPA 2WTJA 3OEFX 3D2KA 4FKWA 4HPUE 1Y6BA 3PJ8A 5CAVA 1JAMA 3HLLA 3EN6A 3L9NA 1YRPA 3ZO2A 4L7SA 4FKQA 2ITOA 5GINE 3W2CA 4GG7A 2OF2A 2I0VA 4MEDA 5IZFA 4GUEA 4X2GA 3NWWA 4YZDA 3QCYA 4OTGA 5AM7A 5C9CA 2RFDA 5HZNA 5C4KA 3NZ0A 2YDIA 3U9NA 4C61A 2C5VA 4DEDA 3ATTA 3TDVA 4DYMA 2PVHA 5BV3A 5E1EA 2B7AA 4I0TA 3RKBA 5JMSA 3ID6C 1OL2A 5GNKA 2C6EA 4C59A 3GQLA 2QOLA 5LMKA 2W1FA 3DFCB 2QOCA 3BRBA 4J95A 3CY2A 2F7EE 3KRLA 2GHGA 3ZUUA 4E5AX 3TN8A 1PYEA 3PYYA 3R2YA 1JLUE 4JXFA 4OT5A 4QTDA 5TR6A 4YZ9A 5D12A 4FC0A 4YZNA 2XNOA 3QZHA 4W4YA 5HORA 1DAYA 5AM6A 3SOCA 3R83A 3UVPA 5JKGA 4JMQA 1TQPA 2ITVA 3IDPA 3TKIA 5I3RA 3ANRA 2PL0A 3TL8A 3TDWA 1OIRA 3QWKA 1H28A 5DEYA 3UGCA 3W0PA 4IWQA 4CFFA 5KMIA 3BWJA 4XRJA 3OXIA 3NX8A 3ORNA 5JFVA 3D7ZA 5CU6A 4ZLZA 2VX0A 4J53A 3R9HA 3OCBA 3E92A 5J9YA 2YCQA 3TIYA 3NYNA 2PZYA 2W17A 3FQEA 2X4FA 4GSBA 4F70A 1DI9A 1OIUA 4G3EA 3C4XA 3FKOA 3KXGA 3QUEA 2R3PA 5CF4A 4P2KA 5DT3A 5BVWA 4OTQA 5B2LA 3TV7A 1YOJA 2VTSA 1SVHA 3DXNA 3ZFXA 4ASXA 3S0OA 4HYUA 2IVVA 2WIHA 4ZY6A 1WCCA 2X0OA 1OL6A 4JBOA 2WQEA 2YM5A 2WQOA 3GCQA 2VZ6A 4JDHA 5HESA 1H01A 1UKIA 4PPCA 4EHGA 5CF5A 2WTCA 3MY5A 5L4QA 2DYLA 5B2MA 5IA4A 5IU2A 3OXZA 3HKOA 2UZVA 4M3QA 2YISA 3E7VA 3NRMA 3DLSA 4LUDA 4NTSA 1XBAA 3FLZA 1ZOEA 5JZNA 4DFNA 1X8BA 4EUTA 3FC1X 5E8ZA 4EH6A 3DLZA 1URCA 1S9IA 3KK9A 4FKGA 4CMOA 4YPDA 2F7ZE 5EM6A 3QTXA 4X3JA 4DLJA 4F1MA 4I22A 3TKUA 3NFFB 1RJBA 3MDYA 4IEBA 2R3MA 1ZOGA 4MYGA 2HZIA 2UZTA 1XKKA 3CPCA 1GJOA 3L8PA 5AP3A 2BRHA 2CJMA 3OXTA 3RM6A 4OAVB 3NFGB 2YM7A 3FYKX 4BHNA 3U6IA 1BI7A 2J2IB 2F4JA 3P08A 4JLCA 5ANGA 4FKLA 5ANEA 5HTIA 5I0BA 3MVLA 4L9IA 4NJ3A 4YLKA 3MI9A 3ET7A 3TNHA 3U4UA 5M55A 4DFYA 4C36A 4FIHA 4XG6A 3NGAA 3G9NA 5EW3A 5KCVA 4K2RA 4RC3A 1K9AA 4QTAA 4YJNA 2XCHA 1J3HA 4IMYA 3R7EA 3ZLWA 2VTTA 3OP5A 4CEGA 3NDMA 4G3GA 4BWXA 3H30A 4BVUA 3R01A 4AN2A 5GZAA 3QA0A 4NL0A 4IJPA 3ORMA 3O8PA 2VGOA 4QMYA 5LCJA 3IQ7A 3Q9ZA 3TT0A 3F5GA 2FSOX 3O71A 3VQHA 3AT4A 4B9DA 3WZEA 4YHFA 4WUNA 4NU1A 4TYJA 4D9TA 4NM0A 1WBPA 5IH4A 3K54A 4IAYA 4O0WA 1KE6A 3QRJA 2CMWA 4S32A 2XK8A 1O6YA 5EW8A 4YC8A 5AEPA 3ZZEA 1W2DA 4KB8A 2YIWA 3ML1A 1JSUA 2V7OA 3W10A 4FZDB 4YGAA 3W0OA 5J95A 5HO8A 5KMNA 2HY0A 4I1ZA 4FSQA 2X0GA 2GFSA 4TWPA 4QT1A 3ATSA 5HLPA 3SX9A 3R7IA 4EH5A 4LDTA 4AXFA 4MXZA 2QHNA 4BY9E 2YAAA 1YHVA 4XG9A 4EJNA 4V04A 2QR7A 3ITZA 4NKSA 4FT3A 4RPVA 3FMJA 4UN0C 2YACA 3PXQA 3QZFA 5D7VA 2Y9QA 3QKKA 4FSZA 1E9HA 4FVQA 4CLJA 4QMTA 2PVKA 3N51A 2QOQA 3AQVA 3T3VA 4OTIA 4I5HA 4UBAA 2CKOA 3ZDIA 4NIFA 2BDFA 5M57A 1FVTA 2PVRA 4XLIA 4M69A 4PF4A 5B2KA 3C4ZA 5CEQA 3MESA 5DHJA 2VWIA 1U4DA 2W5HA 3QCQA 4ASDA 4DTKA 2UW5A 5J7BA 5BYLA 1QPJA 1YXXA 3Q4TA 2PMLX 4Z7GA 4EH3A 5CAPA 4BB4A 3IW8A 2JLDA 1PMVA 3TJDA 4YHTA 5BQ0A 4BI2A 4AE6A 3DU8A 3PVWA 4BHZA 1A48A 3VUDA 4FEXA 4QMLA 4FTRA 4UY9A 2WOUA 4Y5QA 4V0GA 2VTHA 3S4QA 5AA8A 3FAAA 1L3RE 4V05A 3LVPA 4FVPA 4J8MA 3RNIA 4A06A 2WOTA 1CM8A 2Y8OA 2WMVA 3RMFA 2VUWA 4DEGA 3LHJA 3PJ1A 2E9NA 2KTYA 4D2WA 4FR4A 4V01A 4IIRA 4C34A 3CGOA 4HGSA 1O6KA 5CQUA 3E63A 5CXHA 3ERKA 2QO2A 4E93A 4HCTA 1IG1A 4ZZMA 2VNYA 2J0KA 4WNKA 3SG9A 2J5EA 2A19B 4BICA 3KN5A 3RPVA 1GZKA 5TO8A 2GPHA 4Y95A 2C68A 2O5KA 3R7GA 5LXMA 4O81A 3MPMA 1YXVA 3NUPA 2HY81 5E8VA 5A54A 2UW7A 3CTQA 4GK2A 1KE8A 4CCBA 4FSNA 4ZTSA 4YJRA 5CQWA 2VAGA 2WMUA 3AD5A 3PJCA 2XYUA 4ARKA 4A9YA 3Q9WA 4QRCA 3ZBFA 4FMQA 4HYIA 5E8UA 5K4IA 1V0PA 2F57A 4F78A 1FMKA 4HNFA 3VUHA 2QOIA 4U9AA 2IF8A 4IAKA 3ZHPC 1WZYA 1ZWSA 4LYNA 1T46A 3BBTB 3OY3A 4L3PA 3B8RA 5A4TA 1W2FA 3EMGA 2ZDTA 4MK0A 5EH0A 2BZIB 2OU7A 5T68A 5IQBA 4OR5A 2C3JA 5CX9A 2J9MA 3EFKA 5LVPA 1UU8A 3CPBA 5DFPA 4LMNA 3L9MA 3UIUA 4M84A 3FWQA 4A4LA 1J7UA 2ZFYA 4GS6A 2WHBA 3FEGA 3BHTA 4ANSA 3C9WA 2WNTA 3QCSA 4UXLA 1OL1A 2W96B 3ORZA 4FT7A 4O27B 3ROYA 4E1ZA 4QYGA 3O7LD 4AA4A 2G1TA 3R02A 2P0CA 1QCFA 2RF9A 4LL0A 4KUJA 2ZB1A 5DIAA 3PIZA 4AZWA 2X8EA 5GIPE 2CLXA 4GIIA 2R3QA 2HW6A 2WMTA 3Q9XA 4PTEA 4IANA 4YJPA 1YXTA 2ESMA 2F2UA 4FBXA 5CVFA 4AT5A 3DS6A 3QD4A 2PPQA 1CKIA 3BHYA 4LRMA 3FXZA 3MFRA 3PZHA 3DTWA 4O83A 3KGAA 4GW8A 5DPVA 1OPLA 2QC6A 3MTLA 4KNBA 4D2TA 3PY0A 3FLWA 4GFOA 4P5ZA 1IR3A 5IQCA 4PNIA 4C38A 3TUCA 2XK3A 5FXRA 3KVWA 4IX4A 4X3FC 4EOKA 2W1IA 4QPSA 3C0GA 3HV4A 3U55A 4EOSA 1NA7A 4YTIA 4KSQA 5HCYA 4ZY5A 2W1EA 1G8AA 3E64A 1CKPA 1WBWA 2RFNA 5BVNA 3DJ6A 4F6SA 2R4BA 1P14A 4I24A 3ZUVA 3F69A 3QHRA 2EWAA 1ZYDA 4PTGA 4WG4A 2XNGA 3MFSA 3D5UA 2VWUA 3O2MA 3QQLA 4QMVA 5HE2A 4AU8A 3COKA 2X7GA 3GENA 5E8TA 4BF2A 5IQAA 3KFAA 2EU9A 4D0XA 4CT2A 2EB3A 5E9EA 2IWIA 4N70A 2WMRA 4ONAA 4XG7A 1VLRA 3KEXA 1H1RA 3IDBA 3FDNA 3R00A 3LQ5A 4GT5A 4IB0A 4LGHA 1U5QA 4FEUA 3E8DA 3SHEA 3MBLA 2OFUA 2JIUA 4BR3A 4J52A 4BGGA 3SA0A 4RX9A 2CPKE 3LFCA 1ST0A 1BUHA 2W5BA 2RG5A 3BKBA 3G5DA 2Y4IC 4XV1A 4AT3A 2FUMA 3D7TB 5EYCA 4HW7A 3UVQA 4IX5A 3FV8A 3CLYA 5DR9A 5KE0A 4A9TA 3DKGA 1PXKA 3O8UA 3P1AA 2OBJA 1R0PA 4FV0A 3EQDA 4RIOA 5AR5A 4O0RA 3FXXA 1FVVA 2J4ZA 3EN7A 2VTNA 2QKWB 4LG4A 4BCFA 5LMKC 2A2AA 5IDNA 4P90A 3I5NA 5DI1A 5L2TA 2NYAA 3GU4A 2J50A 4ZJVA 5DWRA 3VBYA 4QMQA 3UPZA 3IW6A 3AKJA 2XANA 2GS6A 4YR8A 3EB0A 5ANJA 1H00A 4BCJA 2ZAZA 5D7AA 2W99B 1IASA 3CQEA 1OVEA 4QP4A 5FWKK 3FZRA 5EKOA 4R1VA 3FMMA 2R0IA 3QD0A 3LFDA 5LMAA 3B2WA 4FX3A 4GT3A 3PDTA 1EH4A 2XIYA 4X7QA 5ACKA 5HE1A 2G2IA 4YBJA 3GC8A 2IW8A 3BEGA 5AR3A 3W32A 5D11A 3WZKA 4YP8A 2YLFA 4TN6A 1BL6A 2YDKA 4F09A 3A7JA 4EKLA 3O51A 4MQ1A 2FYSA 4YJOA 5LOHA 3VW8A 4ZSEA 2XVDA 3PLAE 3KXNA 2BRGA 3VF9A 3NMUF 4EKKA 4EUUA 2BPMA 2PMNX 4Y46A 1VEBA 4FG8A 3DTCA 4ZTHA 3Q2JA 3JPVA 4IWDA 2WXVA 3NUXA 4L45A 1VYZA 2V0DA 1M2RA 4I5CA 5E8XA 1TKIA 3UNKA 2UVYA 3TKHA 3ZONA 3JS2A 2PUIA 4IACA 4K8AA 5EM5A 2J0MB 4EC9A 5CEPA 5M4CA 3NUNA 1OZ1A 4GT4A 5JFXA 3CS9A 3DBCA 2PUNA 3LFFA 3NYXA 2E9PA 3VS5A 4USFA 3MH2A 2HZ4A 4MNFA 5ICPA 3NIZA 3COHA 1XH6A 3MN3A 4BIBA 4O0TA 4FODA 1GNGA 3LAUA 3MW1A 4C4HA 2REIA 1KWPA 1OL7A 2FA2A 4HYHA 5H9BA 4F7SA 1VYWA 3I60A 4IQ6A 3NVMB 2YIYA 3AT2A 2OLCA 3DZQA 2CDZA 4PMMA 2WQBA 3ZEPA 2YJRA 4O1OA 4FZFB 3WF6A 4EK8A 4QDVA 3HP5A 4U43A 4F0FA 5IQDA 3UNJA 2XNPA 2GTNA 4ZS0A 4F0GA 5A46A 5IPJA 3V5LA 1WFCA 3ENHA 4CG8A 4DDIA 3LCTA 3MVJA 3KRXA 4YNOA 4EK4A 3ODYX 2B0QA 1M52A 5CEIA 4I92A 4UX9A 3BZ3A 3QLFA 3GU8A 1W0XC 1JNKA 4C58A 1VZOA 5AX9A 3ZLSA 4CV8A 2PVYA 2WU6A 2CNVA 2YAKA 2XM9A 2QLQA 3VQUA 3NNWA 3JXWA 3E62A 3V01A 3U6JA 4U80A 3LM5A 4PDSA 1ZARA 4IHPA 5FM2A 4FZ7A 4W4VA 1QPDA 3C5IA 1UU9A 5EQEA 3TMOA 1HCLA 4JBPA 2XK9A 3CXWA 2HWPA 3OF0A 3EZRA 1GIHA 5IMXA 1TVOA 5JSMA 2BZJA 5AAGA 2YWPA 2XP2A 2QO7A 2NPQA 5M4UA 2R5TA 4L01A 4MVFA 3CKWA 4Q2AA 1LPUA 4NK9A 5DGZA 5FP5A 1ST4A 4QMSA 3TJCA 3LPBA 4EHEA 3ZO4A 4EZ3A 4FV6A 3JVSA 4CCUA 1DM2A 3Q5ZA 4AP7A 5JQ5A 4YJVA 4X2NA 1G8SA 3PPZA 4R7IA 3VJNA 4RRVA 3P7BA 2R3HA 3MA6A 2J5FA 4O7SA 4I20A 4FL1A 4U7ZA 2C3IB 5FTQA 4GEOA 3VONA 3MWUA 5ACBC 4O7LA 2OKRA 3E8EA 4O1PA 3FLYA 3RK5A 3W2OA 3R6XA 4I4EA 2OJFE 3LJ2A 5L6OA 4A4OA 1XBCA 2VTAA 5C01A 4CFXA 2XRUA 3O50A 4BC6A 4IJ9A 1G3NA 3F3VA 3VS4A 2VU3A 1OPJA 1YI6A 2PK9A 2UW8A 3GU5A 2ERKA 3I7CA 4RFMA 2W5AA 4FIJA 4FT9A 3FI3A 2BTRA 4QP2A 3FMKA 4X3FB 5BMMA 3OFMA 3I81A 5FQDC 4AE9A 5EOLA 2VWWA 3BV2A 3R8UA 4WG5A 4NJDA 3IGOA 3F9NA 4KBKA 4BL1A 4NUSA 4OTPA 2O64A 5HX6A 4U97A 3DBDA 4MD8E 5KMKA 2PULA 3R8VA 2HENA 2DS1A 1ZY5A 4TZRA 3MPAA 3OWJA 2UVZA 3DDPA 4W9WA 5AV4A 3FQSA 3IW4A 3BGQA 4QQJA 3SG8A 4DC2A 3KMUA 1Y6AA 4U81A 5IISA 1W98A 2CHLA 2BRBA 2IW6A 2J6MA 3EQGA 5HIEA 5AUUA 3NUAA 3TV4A 3KB7A 3NEWA 4IB1A 3RAWA 4AW1A 5C4LA 4KIKB 4FKUA 5LJJA 5DE2A 1LP4A 2PMIA 5CENA 4RJ7A 5ITAA 4IFCA 2UZDA 4R3PA 5CWZA 4IB3A 3EH9A 2PYWA 3D0EA 3ORKA 4K18A 2CLQA 4FV5A 5KBQA 4FVRA 5DBXA 3RNYA 5KX8A 3UG2A 2OWBA 1Z5MA 3AOXA 3PE2A 5IA5A 4E6CA 3PP0A 4AN9A 3R7UA 4EK5A 4F08A 3QKMA 4JDIA 3CCNA 4G1WA 4UWYA 4EHZA 3H0YA 4FKSA 4PMSA 4Y85A 4IVAA 3FBVA 3QZGA 4FZAB 5EI8A 3R8LA 2NO3A 1ZMVA 2JKMA 4JIKA 4BTKA 1CSNA 3ETAA 2OW3A 4QEBA 3NPCA 4M67A 3W0RA 2YITA 4HZSA 5AV0A 3COIA 4APCA 5AUVA 5AAFA 3S00A 3IOPA 5DT4A 4MBLA 3QQUA 3OWLA 2NP8A 3ZLYA 4UWBA 4JNWA 2OI4X 2V62A 5M09A 3F88A 3QXOA 1ZXEA 4LMUA 3I7BA 4BCHA 3AMAA 3D14A 3OVVA 4MXXA 4BCMA 3D4QA 3WILA 3ZM9A 4FV1A 5HNBA 3AKKA 2UV2A 5AUWA 4FL3A 4ZLYA 2Y6OA 3V5QA 4E5BA 4IBMA 2G2HA 3NCGA 4FIGA 1AD5A 4NH1A 1XO2B 2JKKA 4TWOA 4UMPA 4C4GA 5HG9A 3OOMA 4RIYB 1PXIA 3HDNA 5LWMA 3QLGA 3E5AA 4OTDA 4YC3A 4EYJA 4K9YA 3FPMA 5AIKA 2IJMA 3BWFA 3FLSA 4XBUA 3ZC6A 4H1JA 2BDWA 1DAWA 5I5ZA 5LVNA 4RIXA 2ETMA 3ALNA 3KRWA 3VS1A 4XG8A 3LCSA 2X39A 3O8TA 3BGZA 3FHRA 2O2UA 1YOLA 3PY1A 1GAGA 4FIFA 4PDPA 3FC2A 4RJ5A 3UDZA 4FTKA 2H8HA 3GVUA 3LE6A 5E8SA 1QMZA 2B9HA 2EVAA 2OICA 2V5QA 3HA8A 3JY9A 3LXPA 3Q4CA 3EL7A 4TTHB 1HCKA 3SV0A 2W0JA 2RSVA 5CSPA 1OI9A 3KIOC 5CU4A 3ZSGA 4M7IA 3NW6A 3LJ0A 4Y72A 2W06A 2HAKA 4R77A 3C0HA 4OUCA 1K2PA 5I3OA 3WZJA 4WA9A 3VNTA 1PHKA 4O84A 3LIJA 3WF5A 2ZV7A 5EQYA 3G0EA 2C6KA 2XB7A 4G6LA 4BCGA 3BLRA 4Q9SA 3KKVA 4U42A 3UC4A 3WYYA 4G6NA 2CKQA 3TIZA 3CSVA 4YSMA 2HELA 2FGIA 5D10A 3O5AA 3KRJA 1F5QA 5AWMA 1SZMA 1SNXA 4MF0A 2BAKA 4HYSA 1IRKA 4FOBA 5HTCA 2ITWA 1FMOE 3VO3A 4HGEA 2WB8A 3UZPA 3TACA 4RQVA 4NM5A 3HUCA 2H96A 3O23A 3UBDA 2GQRA 4ZS4A 3WBLA 1ZOHA 2UZLA 3UMWA 4DGOA 2RIOA 4Q5EA 1TZDA 1R0EA 3HNGA 3QQFA 4HJOA 4NTTA 2PMOX 4DAWA 4DGMA 2E9UA 3F66A 4RWJA 5GHVA 5L2QA 3T8OA 3E8CA 3P7CA 3UO4A 1W84A 2OFVA 1P2AA 4DH8A 4W8EA 2J7TA 2R3KA 1MRUA 3W2SA 4AW0A 4YMJA 4UB7A 3G15A 2PY3A 4Y8DA 2YCSA 4DGGA 2XNBA 5KHXA 1YXSA 2ZMCA 3RM7A 5AR4A 1H4LA 2BCJA 5FTGA 3PXZA 3DCVA 3QTIA 3UZRA 3BGPA 1UU3A 3PUFC 4GU9A 4DT8A 4L67A 4AQCA 2OGVA 4D4SA 3HMPA 3OEZA 4G2FA 4H3QA 4IAZA 2VTRA 4QMNA 4R1YA 4CD0A 5CEKA 4ORKA 2OIQA 4QP3A 1BL7A 1JQHA 3R1QA 4CMTA 2H34A 2AEGA 3KREA 4RLLA 4FIEA 1YXUA 4FK3A 4ZTRA 1KV1A 1ZYCA 4BKYA 5EHOA 2HCKA 4AX8A 1NW1A 4AF3A 5I9VA 3DB6A 4H58A 3O7LB 5BUEA 4I6BA 3TI1A 3FMEA 5EDRA 4EOMA 3QYZA 4PMTA 2ITPA 4BDEA 2C4GA 4PNKA 4FV3A 2ITUA 4Q5HA 1PY5A 5HBJA 4NZWB 1XWSA 1Y8YA 2XUUA 4FSMA 2GTMA 3THBA 1Q8TA 3IKAA 3R1YA 4C3PA 1UVRA 2X6EA 1BX6A 4DG3E 3QTUA 2HXLA 4LV8A 4F7NA 5HE3A 2J0IA 2BRNA 3ZUTA