3POOA

Human camp-dependent protein kinase in complex with an inhibitor
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
337
structure length
331
Chain Sequence
SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title fragment based drug design on PKA
rcsb
source organism Homo sapiens
total genus 109
structure length 331
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3pooA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pooA02
3KB7A 4FZFB 4TN6A 4QMUA 5HG5A 4ANLA 3F82A 3O0GA 4PWNA 5E8YA 5EOBA 3V5JA 3F3TA 3R7IA 3BLRA 3FXWA 3IECA 4UMRA 5AA9A 3CY2A 3F3WA 4KIQA 4U9AA 4ITIA 3KRRA 4HCUA 2R3FA 1CKJA 3R2YA 4FTNA 4LUEA 2CNVA 4ALWA 1FMOE 2KULA 2QOOA 3II5A 4O83A 4QO9A 5FTGA 4RJ3A 4Y5QA 4PP7A 5IKWA 3D0EA 4UN0C 4AGCA 4C7TA 3D2IA 4AN3A 1NXKA 3EWHA 4MKCA 4MTAA 1XBBA 1Q99A 2YZLA 4BYJA 4CFMA 5M44A 4QMVA 2CPKE 3O8PA 4I21A 4EOKA 3ORLA 5K5XA 1HCKA 2I1MA 3DOGA 4IWQA 3LFFA 4E5BA 5IDPA 5L2IA 2JDVA 2BRGA 4H39A 2V22A 2B4SB 4EORA 2YM6A 3BKBA 3LXLA 4FEUA 2OFVA 3OOGA 3ZFMA 5HIBA 4EZ7A 2V7AA 3V04A 4JDHA 4BGGA 5KKRC 3DAKA 3KKVA 4HPTE 3DLSA 4U5JA 4UEUA 1RE8A 4FODA 4PDPA 4MWHA 4IHPA 5EKNA 3N51A 2OIBA 4RG0A 3G51A 3TEIA 2R3OA 3THBA 4OBPA 1V0PA 4YBKA 3O51A 2RKUA 4FEXA 5FG8A 3Q4ZA 4G3FA 3QQJA 3SD0A 3DJ7A 4FG9A 3NUYA 2XKDA 4QYYA 4WKQA 4FNWA 2HY0A 4EOQA 4RGJA 4CFXA 4KUJA 3RP9A 1ZXEA 3RTPA 4IX4A 3PXKA 4BTJA 3HMOA 3QRKA 4IFGA 4WO5A 4F63A 5CSXA 2VO7A 2B9HA 4NTTA 3DQXA 4U6RA 4CKIA 3KRJA 4TYIA 1M2QA 1PXJA 1U5QA 2BDJA 1Z9XA 2EXMA 4O0VA 4X2JA 4FA2A 1XBCA 3RK5A 5KX8A 3ID6C 1P4OA 3U9CA 4DG2E 4BICA 5DH3A 4GK3A 4RIYA 4D4YA 5CANA 2HZIA 4BKJA 5AADA 3FXXA 4ITJA 3UNJA 4CFFA 2R0IA 4ZSGA 4BI2A 2VTAA 4FMQA 3QRJA 3CTJA 2YDJA 2WMTA 5LMKA 5BVEA 5F4NA 1H08A 1Y8GA 2XJ1A 3PY1A 3CPCA 5DN3A 5FP5A 3OMVA 3POZA 3DU8A 4ANQA 2R9SA 3OFMA 3L8SA 4TY1A 2QU5A 4XV3A 4AT4A 4EBVA 1XH5A 2WMUA 2YJSA 5K4IA 3MTFA 4M3QA 4J1RA 1PXKA 2Y0AA 4FKRA 1GAGA 4FKUA 4X3JA 5D10A 2GQGA 3BHUA 4ID7A 4FVPA 2UZVA 4H3PA 3P79A 2OF2A 2XK7A 5E1EA 4HYIA 2QLQA 4LV8A 4EYJA 5GZ8A 5IA1A 5CU4A 2WTKB 3ZLXA 4AF3A 3RK7A 4G1WA 3KF4A 2FSMX 1QCFA 3DBEA 3LIJA 5GJFA 4AWIA 3RJCA 5CXZA 1JKSA 2YACA 3ZS5A 2WTWA 3BRBA 5I9WA 4EHZA 4DEHA 2PVRA 5IUIA 4PTCA 4BIBA 5LOHA 3GC9A 3VS1A 4UYAA 4J7BA 4L68A 3WYYA 4JG8A 2YLEA 2UZTA 3UMXA 4DG0E 3W2OA 3F5UA 5EH0A 3GBZA 4L7FA 3WYXA 1H25A 3EQIA 1FGKA 3QZIA 3PVBA 3PJ3A 1YXXA 4O0TA 3MB6A 3F5XA 3ZO1A 2ZB1A 4EH6A 3QQGA 1YDRE 2FO0A 4NIFB 3VS5A 3VVHA 4ZAUA 2IJMA 3A8XA 4BZDA 4G2FA 2WMRA 4LGDA 4RFZA 3D9VA 4C4HA 1YI3A 2A1AB 3PE2A 4FV5A 1O6YA 3GVUA 5HVKA 2IW6A 1RW8A 2X0GA 2XNBA 5M4UA 4NM7A 5AP6A 5EOLA 3R73A 1W8CA 5IA5A 3BLQA 3TUCA 2VTLA 5D41A 2YERA 3DLZA 4K1BA 2WTIA 3FL5A 4BDDA 4OTDA 2W17A 4QMMA 5H9BA 3FQHA 4OAUC 4JBOA 3KXGA 4QP4A 2OI4X 4Z16A 3UNKA 3TM0A 1IASA 3PXYA 1PKDA 3LJ2A 4GH2A 3W18A 4G34A 4XYFA 3EN6A 3NUSA 4D0WA 2XKCA 5H8GA 2PVKA 3TN8A 2Q83A 4K9YA 3GOPA 4MXYA 1BYGA 4AA5A 1BKXA 3NW6A 4EZ3A 2XB7A 5LVNA 3GU8A 3MY1A 2GHGA 3QUDA 3HMPA 4O0SA 3MH0A 2UW7A 4FL3A 4WA9A 1IAJA 2ERZE 4D5KA 5EQYA 2VGOA 3UVRA 5L8JA 2FGIA 3MBLA 3ZYAA 4NL0A 1BL6A 4YTFA 3AOXA 1Q3WA 1OIRA 2WTVA 4UZHA 3Q4UA 1VEBA 3V51A 2X7OA 4NZWB 4RPVA 3ZBXA 4GKHA 4QMSA 4TTHB 4CSVA 3AC5A 3LXPA 3RZFA 2AYPA 3UODA 4DFNA 5HX6A 3ZSHA 3EFJA 3OXZA 2H9VA 1DM2A 2R2PA 4YZCA 3UQGA 3ZC5A 2PZIA 2WIPA 4CLJA 4DT9A 4LMNA 1OL2A 4C8BA 4DGNA 5CTPA 4U81A 1LR4A 2B52A 2XCHA 4HCTA 3TV6A 2VN9A 3GU5A 4O0RA 3FSKA 3MH3A 3ZUTA 5JFWA 2AC3A 4O7SA 4CNHA 4IB1A 3QTZA 3MVMA 4FNXA 2W1DA 3KXHA 3MA6A 4KSQA 5CLPA 4GKIA 4FT0A 1I09A 1KE6A 3HGKA 5CVGA 3SA0A 5CF4A 3FMMA 2GNLA 4WG3A 5L2QA 2JBPA 3SXSA 3EMGA 3P1AA 1UU7A 4S32A 3W10A 2IVUA 4CVAA 2YN8A 3GU4A 3KCFA 4EC9A 4Z55A 2PE2A 3R00A 2HZNA 2WHBA 3ZZWA 2BMCA 2QOKA 5IISA 4ZLYA 2VWUA 2QOCA 4RJ4A 5E9EA 3BYSA 3PXRA 5IH5A 2BALA 2WTKC 3CKWA 1V0OA 3Q4CA 2BVAA 1Q41A 4F70A 2XIZA 5BVNA 5J5SA 1YOJA 4BCGA 2UZWE 4FIIA 5BVFA 4MD9E 4YMJA 1T45A 3MGYA 3HDMA 4L46A 5AUUA 3P23A 5FXRA 3WIGA 2EUFB 3AC8A 3UOHA 1KOBA 3L8VA 5F95A 3GT8A 3ZUVA 4EH3A 4YTCA 2EB3A 2YA9A 3VJNA 4FIFA 2R3MA 5CAVA 2J0JA 2ZDUA 4GU9A 3JY0A 3UPXA 4O6LA 2ITOA 3E7VA 4G9RA 4JIKA 4ZXTA 4YJTA 3ZC6A 4CZTA 2WO6A 4YU2A 3G0FA 5DE2A 3WIKA 3KN5A 3OY3A 1PMVA 4R7HA 4MAOA 4A06A 4HVHA 4D5HA 1IG1A 2UW3A 4IM3A 5AIKA 5J95A 2YAKA 3SKCA 3HLLA 4DHFA 3BEAA 3QBNA 4EUUA 1U59A 3TIYA 2WAJA 3SDJA 4WBOA 3GFWA 4TKSA 3SOAA 4IZ5A 4PDSA 3TV4A 4D2TA 4U44A 3U6IA 4RFMA 4X2KA 5IH6A 4ZZOA 3F3ZA 3O23A 2HWPA 3QKMA 1V0BA 3R8ZA 5CEIA 5AX3A 3T9TA 2JDTA 4PP9A 3S0OA 4UMUA 5CAQA 5KMOA 1SZMA 4F6UA 3ZRKA 5FXQA 4EH7A 2GFSA 1H07A 3NNUA 1UNGA 1LEWA 1JSUA 3WZJA 1SNXA 3FWQA 4YHTA 3QQHA 4FTJA 4FUYA 3OS3A 2R3LA 1R78A 5J8IA 3C4EA 1YVJA 4AGWA 2WNTA 5AAFA 4RX8A 3UVPA 4I93A 4C59A 3QD0A 5JH6A 3FSFA 2CKEA 5DNRA 2Y9QA 4EHGA 5BX0A 4EWQA 3OWLA 5LARA 3F6XA 3S1HA 3NGAA 1YXVA 4OT6A 4LOQA 5BMMA 4FKTA 3FKNA 4LMUA 5JZNA 4KBCA 5CS6A 4QMPA 4WT6A 4ANSA 4F7SA 5EM5A 3BCEA 3E8DA 5FRIA 4MBLA 4TWOA 4E8AA 5DIAA 4CLIA 2VWVA 4RIYB 5FQDC 3LQ5A 4CCUA 1SM2A 2G2FA 1K2PA 5BMSA 2IVVA 2GHLA 3F5GA 4F6SA 4O0XA 5CI6A 1J1BA 1OGUA 5AUYA 5A3XA 3TNQB 3MV5A 3PSDA 3BYOA 4RRVA 4B4LA 4CGAA 2B1PA 2R3GA 4RIWB 4Y95A 1PJKA 3R1QA 4BFMA 4RT7A 4PF4A 5H8BA 4D2RA 5LVOA 4XOYA 4KKEA 1J91A 4V05A 3OC1A 4FTMA 2Y4PA 5L8KA 3NIEA 3QC4A 4O81A 1OITA 2OIDA 2XNMA 4FICA 2V62A 3LFCA 3B2WA 4BKYA 3FMHA 4M68A 1WBSA 2UZOA 2C1BA 2Z8CA 5EM8A 5M55A 5KUPA 2NRUA 5M4FA 3VULA 3MFTA 2OWBA 3O2MA 4BWPA 1M2PA 3I4BA 2P4IA 5JQ8A 4QNYA 2UVZA 4X2NA 4O1PA 1Y57A 4ZJJA 4O7LA 4FV4A 3HAMA 4CEGA 1BL7A 3QTQA 3Q9ZA 4NM0A 3OVVA 2NPQA 3FKLA 3ZLSA 2OKRA 1WVYA 2X9FA 4H58A 5BYZA 4PRJA 3ZM9A 2YISA 4M69B 4U7ZA 4WNPA 3UC3A 4IX6A 2YCQA 4BIDA 4DH1A 3OCSA 4UALA 4APPA 4IZYA 4AGDA 2BZIB 4GFGA 2HAKA 2FA2A 2XNPA 3QXPA 3FL4A 1YW2A 4KKHA 2CHLA 3D4QA 1W98A 3PA3A 1BI7A 4CMOA 3EKKA 3ROCA 4CMTA 5AR5A 3BBWA 2W05A 2ITYA 2GNJA 3EQHA 1F5QA 1OL6A 3AD6A 3D7TA 4YPSA 4AW1A 5IQDA 4FIHA 3UYSA 5AV4A 4G3GA 4DEGA 3M42A 2REIA 5M56A 1LP4A 4OTRA 5E1SA 4I6FA 1H00A 3KMWA 5EDQA 4ZSEA 3PG3A 5TKDA 3G9NA 5FGKA 4GW8A 2GFCA 2WMXA 4M7IA 5HD7A 3R02A 4EK4A 1TVOA 1VZOA 2XNNA 4I0SA 1F3MC 4X3FA 5E90A 2F49A 3HDNA 5HO6A 3I7BA 5C4KA 4P5QA 2FB8A 3TV7A 3ZDIA 5KMIA 4H3BA 3RPOA 3UQFA 1O9UA 4LRJA 4TW9A 4YZ9A 5CZIA 5EHYA 3S00A 2AUHA 3PDTA 5B2KA 5KMKA 2B7AA 2V0DA 4D0XA 3GU7A 2EXCX 3Q2JA 4QP7A 3BU6A 3T3VA 4HZSA 3E64A 4O27B 3A4PA 3DJ6A 1SYKA 5CT0A 5G6VA 3DBDA 4XV9A 2HCKA 4AZSA 2CJMA 4D4RA 4RLKA 4DH5A 4Q9ZA 2C3KA 2ITXA 3MIYA 4XCUA 5EI8A 3REPA 5HE3A 3R7EA 2XYNA 1KE7A 2H96A 5D9HA 4EQMA 4F09A 2VO3A 3HUBA 3IW4A 1ZOGA 1B39A 3H30A 3EYGA 4PMSA 4XMOA 5BVKA 4ZY4A 1WBPA 3I6WA 4A7CA 4BRXA 4N4SA 4IC8A 4QTBA 1UU9A 4BDCA 2PU8A 4H1JA 2QG7A 4IEBA 4JG6A 4EWHA 2H34A 4IIRA 3C0GA 4MF0A 2WMWA 3EFWA 2QR8A 4PDOA 1ZOHA 2C6MA 5BUJA 4L67A 5A6NA 4A9RA 4D9TA 4MX9A 2OXXA 4EK6A 2WELA 4D4VA 4PTEA 4YNOA 2B55A 5GHVA 4XG6A 5DI1A 4XG2A 4YNEA 4JBVA 2OJFE 4KIKA 5EW8A 5HLPA 2HOGA 4QPSA 4I20A 4A07A 2Z02A 4HCVA 2WTDA 5HOAA 4O7RA 5J7BA 2BZKB 3A4OX 4FSZA 1DAWA 4I5PA 4WNKA 3CC6A 4DFYA 3DXPA 3L9LA 5AR7A 1R1WA 3ORIA 2P0CA 3JY9A 3TJCA 4QP2A 4XLIA 2Y7JA 5DEYA 3VQHA 3AGMA 1YXTA 3OBGA 3OXTA 5B0XA 3FE3A 4AZTA 3VBWA 3FUPA 2QONA 3QLGA 5ANEA 5JGBA 1X8BA 4WD5A 2QOQA 4BDAA 2OGVA 2C5YA 2XKEA 3EKNA 4NW5A 1BX6A 4MNEB 2OH4A 5T3QA 3ZBFA 3UOKA 4L53A 5JMSA 1IA8A 4QNAA 2QLUA 4FV8A 5CSHA 1RJBA 4FV3A 1ZYSA 3B8QA 3PY3A 4GJ3A 3DKGA 5CVFA 5G1XA 1UV5A 4DTBA 3F9NA 2BHEA 1Q8TA 3ORPA 4CTCA 4F9YA 2VWWA 4YHJA 4KA3A 3A7JA 5FBOA 5T6KA 4Z7GA 3KA0A 2R3PA 3NCGA 5CVHA 3TZ9A 3VWAA 3W2CA 5I0BA 3NVKI 4U42A 4LRKA 5IQBA 4BWKA 2P2IA 3LXKA 4QPMA 1OECA 3PP0A 2FSOX 4C4GA 3IW7A 3OCGA 3TNPC 3HVCA 3LM5A 1XWSA 2F7XE 2ESMA 1CDKA 3E3BX 3RK9A 1GJOA 2J0IA 2Y6OA 5IG1A 3EQRA 5EYMA 3LOKA 5GZ9A 2QNJA 1J7UA 5DRDA 2UW9A 1ZYLA 4EK3A 4I24A 2R3QA 2PVJA 5FTOA 2VTQA 4I4EA 4II5A 4W4WA 3UOJA 3C4WA 4O7NA 3WZUA 4E4MA 4N6YA 3AT4A 5H3QA 3MVLA 1ZY4A 3C5IA 4XNEA 3QQLA 5LCJA 4GCJA 4FEQA 3F3VA 3VS4A 4M12A 1TQMA 5CALA 3QKKA 4R3RA 5E91A 2QHNA 2XP2A 2XEYA 4GSBA 4F9AA 2GDOA 5HNBA 3S4QA 4D2VA 3BLHA 4QQTA 3U55A 4XBRA 3ZO4A 2E9UA 5BUEA 2YIRA 1PXLA 4XG7A 3ANQA 4DEAA 1PXNA 5JFSA 5ANGA 4AS0A 4R1VA 3DKOA 4RC4A 3BYMA 5JGAA 1PXPA 4ONAA 4YR8A 3VS6A 3VUTA 3P86A 3Q53A 1AQ1A 3NS9A 3TTIA 2UVXA 4J53A 2X8EA 4GVJA 5JKGA 4AZEA 4BDJA 1PW2A 3H9RA 5CF8A 1YWVA 3QYZA 1DS5A 3PJ8A 3R8LA 1WBOA 4C4IA 2B53A 3KK8A 3QTIA 5FEQA 4UXQA 2XBJA 2JDSA 4PUZA 4QOXA 4CMUA 4PNKA 3DNEA 4XP3A 5ETIA 5LMAA 3EN7A 1NT2A 4ACCA 3I7CA 2W1EA 3HNGA 1VJYA 1CKIA 2JIVA 3F61A 4GG5A 4JOAA 5DGZA 1PMNA 3UIMA 3UO4A 4IBMA 1PMUA 2XYUA 4IAKA 4CQGA 3BV2A 5ACBC 4PTGA 3EOCA 5DR6A 4AQCA 2C5NA 4DTAA 1RDQE 2VGPA 2ZMCA 3R83A 5CNOA 3SOCA 1JSTA 1Y8YA 3R8VA 4MXAA 3FMDA 4QPAA 4IB5A 5E92A 2BFXA 5EDRA 4RVMA 5CASA 3A99A 4JL9A 4J8NA 3UNZA 4AW2A 3TL8A 1JAMA 4MBIA 4XEYA 5HNGA 3RINA 4TWNA 3V8WA 4DGGA 3N4VA 4EH8A 5B7VA 4U79A 5KMLA 1CSNA 3Q2MA 2C5OA 2OZAA 4B0GA 2R3IA 5CY3A 3CJGA 5CEMA 2BDWA 3RPVA 3P7BA 3PSCA 3ULIA 2HIWA 3NVMB 4TL0A 3D5VA 2ITUA 1BLXA 2PVFA 4U45A 5ANDA 3VS3A 4EBWA 1FOTA 1Q62A 3A7IA 5E8ZA 4FKJA 1FVRA 4DGMA 4E6QA 2I0YA 4FSYA 4NJ3A 3OT3A 4KINA 2BAKA 4ZZNA 2WMVA 4S34A 3BYUA 3AQVA 4AOIA 3QFVA 4H05A 4I23A 2CKOA 1UWJA 2P2HA 2VNYA 2W96B 3D83A 3CXWA 4M84A 4X3FB 3NRMA 3ZO2A 3R71A 3P9JA 4FV9A 3C0IA 2XKFA 4C0TA 5K9IA 4JXFA 1TQIA 2BHHA 1UKHA 2V7OA 4B8MA 2FVDA 4YZBA 4DTKA 5CSPA 5IH4A 4E4LA 2BCJA 2YM7A 1VR2A 2GMXA 3D15A 4U8ZA 2A19B 4W8EA 4C57A 2PWLA 2YLFA 4OLIA 3ZONA 1J3HA 2O2UA 4NYEA 2BZHB 3WBLA 4UMTA 3FMLA 4E3CA 4JR3A 2WZJA 2XF0A 5HI2A 5AUWA 4R77A 4Q5HA 3PXZA 4DBNA 4OTHA 5DG5A 4DLJA 3F5PA 1FVVA 3R7OA 3HUCA 4BWXA 3AD4A 4HYUA 3VUKA 4BCMA 2C30A 3QHRA 2CCHA 3GXLA 2OJJA 2F7EE 2IW9A 4RJ5A 4KAOA 3HV3A 3TZ8A 3EFKA 3U6JA 4O38A 2V55A 2IZSA 1JSVA 4FG8A 3DKFA 2I7QA 3BI6A 4RWKA 3IK3A 2Q0BA 3ZMMA 4TNBA 4F65A 3KRWA 2IVSA 1WBWA 1W83A 2CN5A 4F99A 1XO2B 2ZDTA 4YZNA 1I44A 3OEFX 1JOWB 2CGVA 3QGWA 4L00A 5A9UA 2BKKA 4EK8A 4ZMFA 4DBXA 3QX2A 4NKSA 2YM8A 4WUAA 2PE1A 4XBUA 4L42A 4JQ8A 5A4QA 3KQ7A 3UP7A 2QOIA 4KIKB 4OUCA 5D11A 4EZ5A 2YIYA 4HGSA 3G2FA 5IMXA 1JKKA 3RHXA 3GENA 3NX8A 3QD2B 5K0KA 3QUPA 5DR2A 2OH0E 5AWMA 3NW5A 2H8HA 1V1KA 4PL3A 5CWZA 4QP6A 3R8UA 4QQJA 4ZTQA 4ZS4A 4HVIA 4K18A 4QMYA 2JIUA 4O0YA 3RPRA 1KE8A 2VWZA 4JJRA 5D7VA 3VC4A 3C4CA 3FZSA 3IW6A 3PA4A 4UMQA 4FGBA 1OPKA 3IKAA 3DZQA 4FT3A 3DAEA 4FX3A 2WMSA 5AUVA 4BGHA 4RIXA 3MJ2A 3VBVA 4FBXA 4UWBA 5TOZA 3R2BA 3I5NA 1WVXA 4MNFA 2RSVA 4EKKA 5BVDA 3NYNA 4TYEA 1J7IA 4WNOA 3UMWA 5CEKA 3UIXA 3IONA 3ENMA 3VJOA 5I3OA 3R21A 3FI8A 5FM2A 4W4YA 3BHHA 4WOVA 2O65A 3DK6A 3Q9WA 4ZTHA 4F08A 4CCBA 2OIQA 3QCYA 5HU3A 3VQUA 4BI1A 5BQ0A 4HJOA 2WKMA 4ACGA 5IQGA 2QOBA 3HYHA 4F7LA 2QODA 2VTOA 5AMNA 4BDHA 3LFAA 4W4XA 3P78A 5M07A 4FTKA 2PULA 3HX4A 4CFUA 3E92A 4E7WA 3K54A 2YCRA 2X7GA 2E9PA 1XBAA 2W1CA 4OTQA 5FUTA 2X1NA 1A9UA 3R28A 2ZJWA 4X3FC 4AN9A 4EOPA 2C5VA 3BEGA 1S9JA 2G2IA 3H9OA 4IB3A 5EI6A 1OL1A 5F1ZA 4C61A 3CPBA 2A2AA 4ZJIA 1P5EA 2X2MA 4QTDA 3LFSA 2CNQA 1WAKA 5IPJA 4MK0A 4F1MA 1R0EA 1LUFA 5CENA 4BN1A 3QL8A 4KS7A 5BYYA 2XS0A 2C6IA 3GFEA 4BTFA 4IAIA 1NY3A 4IVAA 2XK4A 3DZOA 1P4FA 3OBJA 2ONLA 3BELA 5K3YA 3AC1A 4LGHA 2QOLA 1WBVA 4AN2A 1REKA 2YJRA 4BCIA 3FZTA 3O96A 1YWNA 3DT1A 3NYXA 5AAGA 2GS6A 5KCVA 5DT0A 2X9EA 1ZYCA 3JR1A 3OW4A 4YJPA 4FVQA 4AA0A 4J52A 4YURA 3RCDA 2B54A 5HVJA 5LVMA 5ETFA 2UV2A 5K0XA 4JIAA 2XNGA 4UBAA 4BR3A 2R0UA 1H1PA 3AT3A 3F2NA 1IA9A 3EB0A 4C38A 4HYHA 1IRKA 3OOMA 4GYGA 3OXIA 2EWAA 5GNKA 2CDZA 5HESA 3NAYA 2ZV9A 3ZLWA 4O7VA 4TYHB 3QF9A 3IG7A 4G16A 4MCVA 3LCSA 3ERKA 5E8SA 4NUSA 2JAMA 4G3CA 4CFNA 3OWKA 3W8LA 4FSMA 1OBGA 4L6QA 1PXMA 4IDTA 4Y85A 1ZOEA 3UP2A 4APCA 3UJGA 2XH5A 4BHZA 4ACHA 3RPYA 4C35A 1LPUA 4GT5A 2W5BA 4TPTA 5HG8A 4C4EA 1P2AA 2C6TA 1JNKA 4ACDA 5CF5A 3I79A 1NVRA 5CF6A 1KWPA 3BWJA 5HHWA 4O86A 3NNWA 4G3DA 4J96A 1QMZA 3OT8A 4L52A 4U41A 4NU1A 4C4JA 5I9XA 2GS2A 2GSFA 3LMGA 1OL7A 5E4HA 1MUOA 1QL6A 4GUBA 4KSPA 4BZNA 5E7RA 4F7JA 5KNJA 2R7BA 2EB2A 3CQWA 1FQ1B 4DFBA 4E1ZA 4FK6A 3R9HA 4QMWA 3R9DA 3V8SA 4FSUA 3ZEWA 2ZAZA 3OHTA 4A4LA 4O2PA 2JKMA 3OROA 1UA2A 3E3PA 4FKOA 2PSQA 3UBDA 3FMEA 3LKMA 3KXZA 2OZAB 4DT8A 4W9WA 1SVEA 5JT2A 5J7HA 4FTCA 2IWIA 3CJFA 2XRWA 3EQBA 4D1XA 5B2LA 1H26A 3LAUA 2RFDA 4FGRA 4RSSA 3RHKA 4B6LA 5BNJA 3H9FA 2WXVA 4GFMA 4IADA 2OJ9A 3LFDA 4CG9A 3RNYA 1WVWA 4CRSA 4B7TA 5I3RA 4RLLA 3R0TA 4DH3A 1OMWA 4WSQA 4WRSA 2YAAA 4GFOA 3NUNA 3QTSA 1WMKA 4C58A 5KMMA 2X4ZA 4ERKA 3EIDA 5IQEA 3R6XA 4IM0A 4XHKB 2W1ZA 5AV0A 4E26A 4AZFA 3R1SA 2PUPA 4C3RA 1OPLA 2PVHA 3DAJA 4G6LA 4RZWA 2B9JA 4K0YA 2H6DA 3PVWA 5FXSA 4ZY5A 4I0TA 2YDIA 5LVLA 5HG9A 1NW1A 4TYGA 2BRHA 3MH1A 3NYOA 4D2WA 2UW4A 2A0CX 2ITPA 5HU9A 5IZFA 4LYNA 4HGEA 5J87A 5HTBA 2GQSA 4P90A 2C3IB 4GK4A 2W1GA 3SAYA 5HORA 4LQMA 2OW3A 1P14A 3OUKA 5M51A 3A7GA 2G1TA 4JVGA 2ETMA 4AFEA 3PUPA 4JDIA 2PMOX 2UZLA 1IEPA 1XHAA 5GJDA 3RBWA 3UQCA 4ZTLA 3QZHA 1BMKA 4NT4A 1ZARA 3L9MA 4QP3A 4CQEA 2OLCA 4NH1A 3VS0A 2BTSA 1MRVA 4IVCA 4GVAA 5AA8A 3RKBA 2QO2A 5I9VA 3GGFA 5J79A 3N4UA 5A4LA 5EKOA 2VWIA 3ZO3A 2WEVA 4ALUA 5ETAA 5E8UA 3ZEPA 3P7CA 3Q52A 3EQPA 2PMNX 2BIKB 3DTCA 3WOWA 3PJCA 1YXUA 4H3QA 4N6ZA 2YABA 3RVGA 4FZDB 4IXPA 4XP2A 4BVUA 5M4IA 4DA5A 3TCPA 2WTCA 2J9MA 1KOAA 2W5AA 1FPUA 5FM3A 3PZEA 3VF8A 3AD5A 2XM8A 3CE3A 2JBOA 3HMNA 4JI9A 4EEVA 3R9RA 3A60A 3VRZA 5J9YA 1R0PA 1ZWSA 3P5KA 4LL5A 3RZBA 5JFVA 4PMMA 4DFUA 4F6WA 2OBJA 4IAYA 4GYIA 3V5QA 2E9VA 3BHYA 3GCQA 3W1FA 4PPAA 4MWIA 3WE8A 3CS9A 3UIBA 4QMNA 2PZ5A 3Q5ZA 4FKWA 3PIZA 5AP5A 3ZFXA 3R1YA 5JZJA 5HBEA 3ATTA 4D1ZA 3BQRA 1OUKA 4RWLA 3ORXA 4J95A 2I6LA 2G2HA 2PVNA 3WILA 1J7LA 3DXQA 5IQFA 2GPHA 2YIQA 3MW1A 3VBXA 4C34A 3PJ1A 2C6DA 4FZ6A 3ORTA 3EZVA 4RIXB 5DT3A 5I9UA 4BCHA 5CAPA 3FPQA 5IQCA 4GK2A 4ZJVA 4R78A 2XJ0A 3K3JA 3MA3A 3CLYA 4KB8A 4N70A 3TACA 3IDBA 5DWRA 4EOJA 1H0VA 1FMKA 2HW7A 4DFXE 5HNIX 3MDYA 2X2KA 2ETRA 3D94A 4LRMA 3RMFA 3SG8A 5HICA 1OM1A 3HRCA 3QA8A 4H36A 5KZIA 5JQ5A 4TWPA 5TR6A 3LZBA 3UTOA 4CV9A 3EQDA 3NPCA 4IW0A 4QP8A 2SRCA 3MB7A 2IW8A 2JDRA 2PMLX 3FY0A 2V5QA 4UYNA 3W2RA 1U4DA 2C6LA 3C9WA 1KV2A 5IMEA 3QZGA 4YBJA 4C62A 4IVDA 4NKAA 3KVXA 1GNGA 3ZSIA 4IZ7A 5AFVA 2QOHA 2W9FB 1L3RE 3CR0A 3PVUA 4RVKA 4YO6A 3LFEA 3K5VA 1Y6BA 3OEZA 3DPKA 2ITNA 2O64A 5KO1A 4JS8A 2C6EA 2X4FA 4I5HA 5CX9A 3R7UA 4PNIA 4ASDA 4QMQA 5AP1A 1QPJA 4OBOA 3VNTA 2F9GA 3MFRA 3U6HA 5M06A 3CTQA 4ASEA 4WRGA 3FKOA 3IDCA 5AR4A 2PE0A 4HNFA 4NJDA 3DNDA 3FYKX 3D2KA 3HV5A 4Y8DA 4I5MA 5FEEA 4YUQA 2X2LA 4XLVA 3DTWA 5BVOA 5IA0A 3LW0A 3Q32A 3RPSA 5C01A 4CKJA 3BHTA 4JAIA 3VF9A 4AW0A 4F1OA 5HGIA 3ULZA 4RC3A 2VX3A 3EQFA 4IANA 4LV5A 3A61A 3ZHPC 5CXHA 2QHMA 4JR7A 4YSJA 4DE4A 2XBAA 5ACKA 5F20A 4UX9A 3U54A 5DT4A 1A06A 5T68A 1W82A 1OIYA 2WGJA 4WUNA 3VBTA 3MJ1A 3MI9A 5AV1A 3AG9A 3KXXA 2YDKA 1YDSE 2VD5A 3EN5A 4C33A 2YWPA 5CU2A 4IMYA 3ETAA 4TZRA 4CT2A 5L2WA 3QLFA 2E9NA 3MY0A 3NCZA 1H1SA 3ENHA 5GINE 4EUTA 4XV1A 1CM8A 2J0LA 4JBPA 3RALA 4YJRA 2R3RA 3LCOA 4HYSA 3NNVA 2W99B 1ZZ2A 3ZTXA 4E6DA 5F9EA 3QALE 3IPHA 1YXSA 4BBFA 2VTMA 4JRVA 4R7IA 2JDOA 3UC4A 5LCKA 1VYZA 3MESA 3V5WA 1PHKA 3EJ1A 1A48A 3JS2A 3TZMA 2YZAA 5DFPA 3V5LA 3CD8A 3QQUA 3KF7A 2VV9A 3Q96A 4YLJA 2QKRA 1U5RA 1PRYA 2PK9A 1Z5MA 2X6DA 4M0ZA 5E8TA 3LMHA 4AA4A 4R6VA 1UNLA 2PY3A 4IAZA 2BAQA 4DFZE 5C8NA 4P2KA 1O6LA 3CQUA 1STCE 3E93A 1Q61A 1XH6A 2VTTA 3MY5A 5JN2A 5LQFA 1DAYA 5HD4A 2X6EA 2WQNA 3JPVA 3QX4A 4Q9SA 3LQ3A 3L8PA 3MVHA 3FI2A 3V8TA 4LI5A 1NVSA 2GNIA 2R3NA 5CU6A 5LMKC 4O7YA 1U54A 3MS9A 3DXNA 5GIPE 5DEWA 2J6MA 4FL1A 2OU7A 3ODZX 3OWJA 4RX9A 2JFMA 4XG9A 1H01A 4Y46A 4GMYA 5DRBA 4FEWA 4K8AA 2YIWA 5L8LA 1PMEA 2VTIA 4DG3E 4FK3A 4YJOA 5IA4A 4RVLA 3Q6UA 3VHKA 3PLAE 5BUIA 5DOSA 4YTHA 1URCA 4RJ6A 2XIYA 4FG7A 3UZPA 4IJPA 4DINA 3PXQA 3LFQA 4ANBA 3M1SA 5IQHA 4L7SA 4C2VA 2DUVA 2EU9A 3H0YA 4PDYA 4I92A 1FINA 4IDVA 4QYHA 5FP6A 3LHJA 3Q9XA 5AJQA 3QD4A 5IEVA 2BRNA 3QCSA 4U40A 2R3JA 4IB0A 2ONLC 1GZKA 3I1AA 1OI9A 5AIRA 5M57A 2F4JA 2BRMA 4DC2A 2ZM4A 3KL8A 2NO3A 3RWPA 4CG8A 3BGZA 4C4FA 3QTRA 1Q4LA 4NEUA 4JRNA 5EW3A 4G3EA 4ZTRA 3VHEA 2AC5A 4FV1A 4TWCA 2BROA 5EDPA 5CAUA 1TKIA 3QWKA 1SVHA 3ZSGA 2UVYA 4HGTA 3W8QA 1XH9A 3ET7A 4MXXA 3P7AA 4YC8A 4AOTA 2NP8A 3CSVA 2BRBA 4GT3A 3NDMA 4L8MA 1H1WA 3V01A 4EKLA 2X81A 3BE2A 5H2UA 4FI1A 2R3HA 3PFQA 4K2RA 1OKWA 4G5JA 4JNWA 1PYXA 1Z57A 3T8OA 4ALVA 4TNDA 4RQVA 3FEGA 5HE0A 5IA3A 3E5AA 3L9PA 3UZTA 3NUAA 2CGWA 2WMQA 3G6HA 5E8XA 5HZNA 5CSWA 4KS8A 3SX9A 2IZUA 2DQ7X 4B9DA 3MH2A 2YCFA 3U51A 1G8SA 3AMBA 4LG4A 4FOBA 4U80A 4E93A 3TZ7A 4YLKA 4AU8A 1XH7A 2CGUA 2XCKA 3G5DA 4LM5A 3IGGA 5FDXA 2CKPA 2IPXA 2R3KA 2XVDA 3E63A 3ZRMA 5EYCA 3UVQA 4BGQA 1RQQA 5M53A 1B6CB 3MTLA 4QYEA 4R3CA 5BVWA 1R39A 2PHKA 2B9FA 3DFAA 4CXAA 1WCCA 5FTQA 3PVGA 3PA5A 4FL2A 3G0EA 3HZTA 4EQCA 4XG8A 4DAWA 3VW8A 2IO6A 5KBRA 2QG5A 2UZEA 4FNZA 3EH9A 3VRYA 4A4OA 3FAAA 4I0RA 4ZTMA 2PUIA 2J0MB 3QXOA 5ANKA 5M08A 4FSTA 3V3VA 3WI6A 3I0OA 4B99A 2JKOA 4I6QA 4JBQA 4ASZA 3P08A 3IS5A 2BFYA 3TJDA 1G5SA 4CFVA 2FSLX 4NK9A 5HCZA 4CT1A 3QD3A 3WZKA 5LJJA 3GC0A 4UXLA 4QYGA 4O7TA 3JVRA 3NSZA 4AGUA 5BYLA 4BZOA 5AM7A 3A2CA 3GCUA 3AC3A 4NM5A 3VO3A 5L2SA 2C6KA 1MP8A 3MWUA 4O0UA 3F7WA 4JT3A 5AUZA 3RM6A 2ERKA 2XK3A 2PMIA 4BCNA 3ATSA 3H4JA 4NSTA 5D12A 3GCPA 4O21A 4XRLA 1ZMWA 4YJNA 2OG8A 2Y6MA 3GEQA 3DV3A 2O0UA 3MVJA 5GJGA 3T9IA 3QTWA 4BCPA 3AXWA 2GQRA 2ITTA 3HAVA 2P33A 3ZCLA 4ANOA 1ZYJA 3TKHA 2ZM1A 5A4EA 4EHEA 2WEIA 3LPBA 3MPMA 4M67A 2BTRA 4XRJA 4BKZA 1XJDA 4A9TA 4YJUA 2CNUA 1ZZLA 2WQMA 3Q9YA 4J71A 1ZY5A 1JQHA 4BDFA 3NR9A 2ZYBA 3RCJA 5HE1A 3HV4A 4IWDA 3R8PA 3ROYA 5A4TA 5AEPA 5I5ZA 5LXMA 3EQGA 1UVRA 2IZTA 1SNUA 4I94A 4MBJA 3DGKA 4OR5A 4QYFA 5DVRA 4IWOA 1UWHA 3CGFA 3MYGA 1PXIA 3EHAA 3D14A 4L3PA 4AAAA 1KSWA 3Q3BA 3VAPA 3FPMA 1G8AA 3O7LB 3RAIA 3JYAA 4D2SA 5AUTA 4UWYA 3D7TB 3QGYA 2RF9A 3VW6A 4FE2A 4EH9A 2OFUA 4FR4A 4E5AX 1VYWA 3SHEA 2QU6A 4GJ2A 2FUMA 3KU2A 4PL4A 3W2SA 5CSVA 4DEIA 5AP7A 4FOCA 5LMBA 3NW7A 4X7QA 3QTXA 3F3UA 4O82A 2YCSA 5C26A 5EQEA 1OB3A 4IAFA 3KFAA 4JDJA 1APME 4PL5A 5HLWA 3LQ8A 4I4FA 3KMUA 5AX9A 4BCFA 4E20A 4QMLA 4GS6A 5EI2A 1YWRA 4ZIMA 4FKLA 5KMJA 1GOLA 2HWOA 2I40A 4BF2A 3MFSA 1E1VA 3FC2A 4NCTA 5IQIA 3L8XA 3LCDA 2GU8A 2QR7A 4EYMA 4OT5A 1FBNA 4KBAA 1CTPE 4GG7A 4MF1A 5KHXA 4P7EA 1OKZA 2PVMA 4EOLA 4QP1A 2QD9A 4MYGA 3LMIA 2WQBA 3I81A 3H10A 2F57A 4OTFA 3TXOA 4FSQA 3LCKA 4J98A 5I4NA 3N9XA 1BUHA 5HO8A 3HV6A 5EHOA 3LJ0A 3C4ZA 3FLQA 3FZ1A 3PIYA 2OSCA 5TE0A 3ZLYA 4LOPA 4R8QA 3UE4A 4AZVA 5A6OA 2JC6A 3QKLA 4RA5A 5JSMA 4P4CA 4D9UA 4O1OA 4F9BA 2I0VA 3IQ7A 2HXLA 4IQ6A 4X2GA 3WZDA 3SC1A 4H1MA 5HQ0A 4MXOA 4K77A 5I9ZA 3L1SA 3OWPA 3GCVA 5EYDA 3M2WA 1U54B 4YLLA 3SW4A 5IQAA 3JUHA 3OY1A 3R04A 4TYJA 3EN4A 1KV1A 3I5ZA 3TNHA 4HVGA 4F0FA 4TXCA 5CT7A 3HECA 3G33A 3MFUA 5ETCA 1ZMVA 3SRVA 5I9YA 2EVAA 3WF8A 3SG9A 4AFJA 1XH4A 5JK3A 1M2RA 5J9LA 4N0SA 4YTIA 3TG1A 4MEDA 5CU0A 2VNWA 3R7YA 2XNOA 3IDPA 4FTIA 4UB7A 4YZDA 4DH8A 4FNYA 4LGGA 4CZUA 5HIDA 3LLAA 2QVSE 4OTWA 3PG1A 5CNNA 2HZ4A 5L2TA 4UWCA 4R7BA 3AC4A 3OTUA 5AP3A 2Y8OA 2XMYA 4M13A 4YC3A 2BKZA 2YITA 5C9CA 4PMPA 4AG8A 2HXQA 3C0HA 3COHA 3UPZA 4FV6A 4MVFA 5FD2A 3F69A 1R3CA 5J9ZA 2JLDA 3PXFA 2WB8A 3QQKA 1LEZA 3K3IA 2PVYA 5JFXA 3IO7A 4OGRA 4EL9A 4O22A 3L9NA 3WF7A 2ETKA 2OF4A 3O17A 4XJ0A 4K33A 3DA6A 4UY9A 2GHMA 5LVPA 3U4WA 4FV2A 3KREA 3GCSA 4FV0A 1MRYA 4FTUA 3HKOA 1MRUA 4U97A 1EH4A 2G01A 1Q8WA 2RG5A 2VTJA 3KXNA 3MSSA 3NEWA 2ZOQA 2C68A 4RQKA 5EYKA 3BYVA 5J1VA 4Y83A 4YPDA 3EZRA 3LE6A 3ANRA 4BC6A 3C1XA 2J7TA 3B8RA 1S9IA 2JGZA 4Y73A 4FTTA 3AMAA 4DITA 3QCXA 4ZMEA 1OUYA 3E88A 4DN5A 4S2ZA 4BCJA 4M14A 2FYSA 5EQPA 3TT0A 3BPRA 4L9IA 4RC2A 1MQ4A 2Z7SA 5L6WL 2ITVA 3BIZA 3NWWA 4ZK5A 4F4PA 2JEDA 2PUUA 4IFCA 1GZNA 2WU7A 4PX6A 3RAWA 1JWHA 2YFXA 5CZHA 3NAXA 5AM6A 2VTHA 4O84A 2Z7RA 1YI4A 3C13A 4D1SA 1XH8A 1ERKA 5IU2A 2OJGA 3CQEA 3PJ2A 3RI1A 4ZS0A 3V5PA 4I22A 4IC7A 4EOSA 1JPAA 3DK7A 3RNIA 2CN8A 1FVTA 5EG3A 3TIZA 3V6RA 4QTAA 4YHFA 1E1XA 1H8FA 3O71A 1K9AA 2OXYA 4F1TA 4RIWA 1PXOA 2ZB0A 5CQWA 4LL0A 3CIKA 2GNHA 2ITQA 3PRFA 1E9HA 4P5ZA 4QMZA 4AZWA 4HVSA 2DYLA 3KXMA 5L3AA 5D7AA 1UU8A 4UMPA 5GZAA 2QCSA 5HTCA 2XRUA 2R7IA 2VTNA 2R64A 4X0MA 1QPDA 1NVQA 3TI1A 3UDBA 1YHVA 4KD1A 3U8WA 3UOLA 3ZOSA 3TUBA 4WG5A 3UO5A 2DWBA 4CTBA 3ITZA 4U0IA 3MPAA 4L44A 3TUDA 1H27A 4IJ9A 1YKRA 4CYIA 1MQBA 2PPQA 3G15A 3COMA 2R5TA 3OP5A 4AE6A 1YQJA 4ZZMA 4ZLOA 2FH9A 4OW8A 4BCKA 4CZYB 4EH4A 3FLZA 3PE1A 4ZTSA 2W4OA 4FKPA 2NRYA 3ODYX 3OUNB 4JQ7A 4L45A 4M69A 5AV3A 5L6PA 3HEGA 4L3JA 3IOKA 5GIOE 3I60A 4F9WA 4M97A 4RA4A 3OG7A 2BPMA 3KGAA 2Y4IB 3UG1A 2GTNA 2HENA 5IDNA 1M14A 3QA0A 3FJQE 4AXAA 2QI8A 3R22A 1UKIA 3PYYA 4XG3A 2ACXA 3CTHA 1PY5A 3CP9A 2O3PA 2CGXA 2W1IA 3O50A 3VS2A 3CEKA 2ZV7A 4OTGA 2GS7A 2WU6A 2ITWA 4ZP5A 2P55A 3FC1X 4FSRA 4EOOA 3UO6A 2OXDA 3DBQA 3QAME 2BIYA 3Q4TA 4DEEA 2RFNA 2J90A 2BAJA 3KK9A 3E8NA 1REJA 3PWYA 3P4KA 5IUGA 4IAAA 3NZ0A 2A27A 1YDTE 4NWMA 5EW9A 3DFCB 4DLIA 4L3LA 3TTJA 1WBTA 2YIXA 5IEYA 2NNWB 5DHJA 2BUJA 1OKVA 3QTUA 1JKTA 4JQEA 3VUHA 2EXEA 1TQPA 3ORNA 4BDEA 4QTEA 4DF3A 4G5PA 3FLYA 5TF9A 1KE9A 4C36A 1OKYA 4FVRA 4JG7A 5FLFA 3F2AA 2GNGA 2VZ6A 2YM5A 5EM7A 4XG4A 5J1WA 2X7FA 1G3NA 2VAGA 3K5UA 2HZ0A 4BDGA 4BB4A 2WOUA 2W06A 4EH2A 2C4GA 1CKPA 3FZOA 4FT5A 2IG7A 3NYVA 2YM4A 2WMAA 3QQFA 4RWIA 5KBQA 4OBQA 3ACJA 3JVSA 2VTPA 4FZ7A 3BE9A 4G17A 3R7VA 3DB6A 3CY3A 3GB2A 4ZLZA 3SV0A 3HA8A 3TNIA 5C4LA 4IVBA 4IACA 2W9ZB 3Q04A 3ZUUA 2W4KA 5ANJA 2J4ZA 2BDFA 1OL5A 5FDPA 2QKWB 4JX7A 4F64A 5IA2A 4ARKA 5AR8A 2QOFA 3S2PA 4USEA 4KABA 4EOMA 3QWJA 2UW5A 2J5FA 3BGQA 4X2FA 3IGOA 3W33A 4BTMA 5KMNA 3U87A 3G6GA 5BPYA 2QO9A 5AUXA 5HE2A 4Q5EA 4F7NA 5EFQA 2B9IA 3LCTA 4KBKA 3KMMA 5IEXA 3GC7A 2YM3A 3OTVA 4Z3VA 3SGCA 4HOKA 3FMKA 3QU0A 4FUXA 1Q24A 4KKGA 2W1FA 2I0EA 3LM0A 3PY0A 3DKCA 3O8TA 3VS7A 3FV8A 3S3IA 4KRCA 3ZH8A 1OVEA 2VTRA 4M8TA 1ATPE 3WARA 5K4JA 5CYIA 2GTMA 4EC8A 4GIIA 1JLUE 4JDKA 2W0JA 3T3UA 2CSNA 1QPEA 1DI8A 4XOZA 4MNEA 3U9NA 4GIHA 4QMOA 4ACMA 3KRLA 5CQUA 3RAHA 3OCTA 3SRVB 1Q3DA 3EYHA 3ZU7A 1HCLA 2C1AA 3WZEA 2BILB 1YHSA 3E87A 3DBCA 3FLWA 4NTSA 4HNIA 4PMTA 2XUUA 3IOPA 1Y6AA 3D5UA 4LUDA 4CRLA 2CKQA 1GIJA 4S30A 1GIHA 2VWYA 1XQZA 3TKIA 2JAVA 2PZPA 5CI7A 2Y4IC 3QC9A 2XK9A 4I1ZA 4A9SA 2VWBA 3VUDA 3C51A 4FKVA 1ND4A 3FI3A 3ZZEA 1B38A 3E7OA 4A9YA 2G15A 4QMTA 5C03A 4ZTNA 1Q8YA 3OD6X 2C0IA 3GC8A 5HEZA 4YO4A 2XK6A 3DCVA 3VIDA 4G31A 3PPJA 1WBNA 3LVPA 3W2PA 3BX5A 4CKRA 3Q60A 4FYNA 3DDPA 2W5HA 4FKQA 3QRUA 4ZOGA 4WIHA 3ORZA 4FIJA 3W32A 2VX1A 3FMJA 3I6UA 5EHLA 3V5TA 4BYIA 4Y5HA 3DK3A 4E6AA 4DGLC 5DLSA 4C37A 5EM6A 4USFA 3EL8A 4ZSLA 4M66A 4DGOA 1XKKA 2HK5A 3QRIA 4AP7A 4XUFA 4XH6A 3HL7A 5FWKK 4KNBA 4DYMA 3FZRA 5AV2A 2WIHA 5LWMA 3M11A 2CMWA 4QQCA 4DCEA 4FTQA 5HG7A 3WE4A 2XJ2A 3ORMA 5HVYA 3MPTA 3ORKA 4NCTC 4M0YA 4IE9A 3UIUA 4FSWA 4A4XA 3KULA 4X21A 4BHNA 5HTIA 2E9OA 3FLNC 4GUEA 4ASXA 3DBFA 3CGOA 4E4NA 4G9CA 3BBTB 2GCDA 5C8KA 1OIUA 4K6ZA 2VU3A 3HRFA 2UW6A 1W7HA 4FV7A 2WFYA 3FQSA 5KE0A 4GU6A 3VUGA 2WMBA 3PLSA 5HBJA 5LWNA 4C02A 3BWFA 4YGAA 4FT9A 2Z7LA 4GL9A 2VUWA 4EI4A 4BBEA 3DS6A 3FBVA 1H24A 2C3JA 4OTIA 5TT7A 1YHWA 1OZ1A 1WFCA 5DR9A 2XIRA 2YWVA 1Q97A 3ELJA 4I3ZA 3WF5A 3LXNA 1AGWA 4WSYA 4U43A 4D58A 3Q6WA 3NNXA 3ZXTA 2QQ7A 3GQLA 4J8MA 3FZPA 4I6HA 5CAOA 4B8LA 3W55A 5C1QB 4FKIA 5C8MA 3W2QA 4AX8A 3VBQA 1PF8A 2F2CB 4ITHA 2P3GX 3BQCA 3FHIA 4RMZA 5HIEA 4ANNA 3C4FA 3D5XA 1KUTA 5KZ0A 3KEXA 1ZYDA 4HZRA 3R01A 4FEVA 3FI4A 4PPBA 1H0WA 4FZAB 2VO6A 1PKGA 1YOMA 5ITAA 3D7ZA 3NUUA 2ITZA 3UGCA 1U46A 2XIXA 4F9CA 1XR1A 2JITA 1JVPP 3I0QA 4PV0A 4V0GA 4R5YA 5E8VA 3W16A 4EK5A 5HLNA 2W4JA 2X8IA 1WZYA 5DPVA 2O5KA 5HCYA 3ACKA 3PSBA 3GUBA 4ZSJA 4ANMA 4U3ZA 3LFBA 3PWDA 4G6NA 5CU3A 3LJ1A 1K3AA 4FTLA 2GNFA 4RVTA 4AOJA 3R9NA 3TNWA 3PPZA 2XIKA 3NMUF 4DH7A 4W9XA 5KHWA 2C0TA 4GEOA 4D2PA 2XA4A 3DDQA 1YRPA 4CD0A 3V6SA 4NW6A 3H3CA 2HY81 4R1YA 4RBLA 3MN3A 3FLSA 3KC3A 4FSNA 2W7XA 1JKLA 2IZRA 5H8EA 3OZ6A 4AACA 4EQUA 3R8MA 1SMHA 4YJVA 4E73A 2ZVAA 5A4CA 4ORKA 3BU5A 3Q5IA 2C6OA 3G9LX 2XM9A 5ANOA 2Z60A 3C50A 1GIIA 2PL0A 2PZRA 4TT7A 3DY7A 4A9UA 2VWXA 2RGPA 2PZYA 2ZM3A 3KY2A 2C69A 4UV0A 4USDA 4C3PA 3HMMA 2J2IB 5ANIA 3ZRLA 4IM2A 3GI3A 2HYYA 3C5UA 3GP0A 4L01A 3R30A 1GY3A 4X6QC 4E4XA 4FKGA 5A14A 2UZDA 3C4XA 2G9XA 3QHWA 4QD6A 5DBXA 3OCBA 4QTCA 3SW7A 3POOA 5K5NA 2RG6A 3KCKA 4O2ZA 4FC0A 5JEBA 2E2BA 2O8YA 4Y72A 5HBHA 2CLQA 4JX3A 4U3YA 4Q2AA 2Q0NA 4QRCA 4YP8A 4TRLA 4WNMA 3FQEA 2C47A 1M17A 2CLXA 3FY2A 4XX9A 3F2RA 4MHAA 2LAVA 4GRBA 2J51A 3O8UA 5E8WA 3S95A 3KN6A 4E6CA 3PPKA 3CCNA 3VBYA 2BR1A 4O6EA 5EK7A 1M7NA 4BIEA 3C7QA 3QUEA 4PY1A 2UUEA 4RIOA 4D4SA 4HPUE 4QQ5A 1H4LA 1HOWA 3OW3A 3CBLA 4EONA 5JRQA 4RJ8A 4ZEGA 5DMZA 3WF6A 2YEXA 5IF1A 2VO0A 3EQCA 3NLBA 1FGIA 2X39A 4V04A 4AUAA 4C3FA 2XZSA 4HVDA 4N57A 2ZV8A 2CCIA 1DI9A 3KRXA 1AD5A 4S31A 4Z9LA 3FMNA 4AT5A 1BI8A 3R63A 4AW5A 3BU3A 4FIGA 2WQEA 4FKSA 4BL1A 2HW6A 5A46A 3BV3A 3GNIB 4BI0A 1YOLA 4NFNA 4YSMA 3DQWA 5D1JA 5J5TA 3ZFYA 2QC6A 1CMKE 2UW0A 2VTSA 3R1NA 3GQIA 3QYWA 4I6BA 4FF8A 4K11A 4ERWA 3A7HA 4ZSAA 4WG4A 3NIZA 3AT2A 3SLSA 3AMYA 3HA6A 4BCQA 5C27A 3D5WA 4OAVB 2WQOA 1H1QA 3G90X 4GT4A 2UW8A 2C0OA 3QZFA 2ZV2A 1PYEA 1YI6A 3E8EA 4W8DA 5FEDA 4QT1A 3IW5A 3RGFA 4XP0A 4EJNA 4CV8A 4YJQA 2UZNA 2WD1A 2ZMDA 3SXRA 5FBNC 4F0GA 3EFLA 2RIOA 2RFEA 4PQNA 3UG2A 3FYJX 4F0IA 2IVTA 2JFLA 3DJ5A 4EOIA 3P0MA 2A4LA 1ZLTA 3OF0A 5TO8A 3CD3A 2C3LA 3SVVA 2RFSA 1M7QA 2JKQA 2WTJA 2R4BA 4AT3A 3BHVA 2OJIA 3ZM4A 4R3PA 2UZUE 3UYTA 1KE5A 4FTRA 3HRBA 4KWPA 5L6OA 4J99A 4EJ7A 3NUXA 3PTGA 3RAKA 1QPCA 1GZOA 3COKA 4IX5A 3ZDUA 1SVGA 3E8CA 4KIPA 4DEDA 4KIOA 5AP4A 2FSTX 5L4QA 3H0ZA 4BBMA 2BZJA 4ZY6A 2F7ZE 4S33A 2XK8A 1Q5KA 4O96A 2X8DA 3FHRA 4JAJA 5CEOA 2F2UA 2OICA 1H28A 4IH8A 5AP2A 5AAEA 1Q8ZA 3HV7A 3O7LD 3IW8A 3DB8A 2UZBA 3LFNA 4I41A 5DA3A 4BDBA 4G6OA 3TWJA 3RWQA 3U4UA 4QP9A 4R5SA 3VUMA 4XV2A 1JBPE 3A62A 4FYOA 4EH5A 1T46A 5HX8A 2YHVA 3KULB 2J50A 5M09A 4IZAA 1IAHA 3ALOA 2J0KA 4GV1A 3PIXA 4QMXA 2Z7QA 3HP5A 3E62A 5CEQA 4V01A 4NIFA 4IX3A 5ICPA 4RFYA 3PP1A 5AR3A 4D55A 3TDVA 2DS1A 5JRSA 4O91A 2QURA 3A8WA 1GZ8A 3TKUA 1Q8UA 2KTYA 3VN9A 4CFWA 4TYHA 5KKRB 4MQ1A 2XNEA 1Y91A 4LOOA 2VX0A 4JLCA 3HP2A 1O6KA 3FDNA 3ALNA 2J5EA 3R7GA 4OTPA 2RL5A 3K2LA 2QO7A 5M4CA 4UZDA 3B2TA 4WHZA 3GOKA 5HO7A 3VUIA 1IR3A 4RX7A 4RZVA 1ZMUA 4C2WA 5HCXA 4BDIA 4L43A 3FXZA 4IWPA 3F7ZA 1F0QA 2JD5A 4RX5A 4E5WA 4J97A 3COIA 2WPAA 5IUHA 3UZRA 4LFIA 3AC2A 4BY9E 1ZRZA 4O0WA 3JXWA 3EN9A 3MIAA 4BDKA 1L8TA 4AE9A 1H1RA 3AGLA 5B2MA 3PZHA 5A54A 4W4VA 4DFLA 1ZAOA 2OK1A 3PRIA 4PPCA 4ENYA 3TDWA 2PVLA 3QCQA 5F94A 4NFMA 3CKXA 4MQ2A 1UNHA 1URWA 4XS2A 2C5XA 3HMIA 5AP0A 4MXZA 5AR2A 2OZOA 3LLTA 3SXFA 4WBBB 4EHVA 5JGDA 4HGLA 2HELA 5CEPA 3R9OA 3F88A 2W1HA 3KVWA 2OO8X 4BTKA 4V0GB 1W84A 5HKMA 1UU3A 3A7FA 3F66A 4FT7A 4MXCA 2O63A 4BCOA 4Z7HA 3SQQA 4D28A 2PYWA 2PUNA 4YC6A 4I5CA 1NA7A 3ZXZA 2IN6A 4YZMA 4FTOA 3EL7A 3RM7A 2I0HA 4CYJA 4MH7A 2XEZA 4DEBA 4M15A 2JIIA 2PTKA 2VRXA 3QRTA 1W0XC 3GU6A 4DCAA 1OBDA 1OIQA 3N4TA 4RJ7A 4YJSA 2JKKA 3WF9A 1M52A 4O7ZA 2Z2WA 4ENXA 4O7WA 4X6RA 1J1CA 1OPJA 3BZ3A 4KRDA 4RWJA 4NM3A 4MD7E 4FTAA 2B0QA 4HW7A 4MD8E 3BGPA 4FIEA 3NUPA 5DYJA 2LGCA 2WOTA
chains in the Genus database with same CATH superfamily
3KB7A 4FZFB 4TN6A 4QMUA 5HG5A 4ANLA 3F82A 3O0GA 4PWNA 5E8YA 5EOBA 3V5JA 3F3TA 3R7IA 3BLRA 3FXWA 3IECA 4UMRA 5AA9A 3CY2A 3F3WA 4KIQA 4U9AA 4ITIA 3KRRA 4HCUA 2R3FA 1CKJA 3R2YA 4FTNA 4LUEA 2CNVA 4ALWA 1FMOE 2KULA 2QOOA 3II5A 4O83A 4QO9A 5FTGA 4RJ3A 4Y5QA 4PP7A 5IKWA 3D0EA 4UN0C 4AGCA 4C7TA 3D2IA 4AN3A 1NXKA 3EWHA 4MKCA 4MTAA 1XBBA 1Q99A 2YZLA 4BYJA 4CFMA 5M44A 4QMVA 2CPKE 3O8PA 4I21A 4EOKA 3ORLA 5K5XA 1HCKA 2I1MA 3DOGA 4IWQA 3LFFA 4E5BA 5IDPA 5L2IA 2JDVA 2BRGA 4H39A 2V22A 2B4SB 4EORA 2YM6A 3BKBA 3LXLA 4FEUA 2OFVA 3OOGA 3ZFMA 5HIBA 4EZ7A 2V7AA 3V04A 4JDHA 4BGGA 5KKRC 3DAKA 3KKVA 4HPTE 3DLSA 4U5JA 4UEUA 1RE8A 4FODA 4PDPA 4MWHA 4IHPA 5EKNA 3N51A 2OIBA 4RG0A 3G51A 3TEIA 2R3OA 3THBA 4OBPA 1V0PA 4YBKA 3O51A 2RKUA 4FEXA 5FG8A 3Q4ZA 4G3FA 3QQJA 3SD0A 3DJ7A 4FG9A 3NUYA 2XKDA 4QYYA 4WKQA 4FNWA 2HY0A 4EOQA 4RGJA 4CFXA 4KUJA 3RP9A 1ZXEA 3RTPA 4IX4A 3PXKA 4BTJA 3HMOA 3QRKA 4IFGA 4WO5A 4F63A 5CSXA 2VO7A 2B9HA 4NTTA 3DQXA 4U6RA 4CKIA 3KRJA 4TYIA 2IEWA 1M2QA 1PXJA 1U5QA 2BDJA 1Z9XA 2EXMA 4O0VA 4X2JA 4FA2A 1XBCA 3RK5A 5KX8A 3ID6C 1P4OA 3U9CA 4DG2E 4BICA 5DH3A 4GK3A 4RIYA 4D4YA 5CANA 2HZIA 4BKJA 5AADA 3FXXA 4ITJA 3UNJA 4CFFA 2R0IA 4ZSGA 4BI2A 2VTAA 4FMQA 3QRJA 3CTJA 2YDJA 2WMTA 5LMKA 5BVEA 5F4NA 1H08A 1Y8GA 2XJ1A 3PY1A 3CPCA 5DN3A 5FP5A 3OMVA 3POZA 3DU8A 4ANQA 2R9SA 3OFMA 3L8SA 4TY1A 2QU5A 4XV3A 4AT4A 4EBVA 1XH5A 2WMUA 2YJSA 5K4IA 3MTFA 4M3QA 4J1RA 1PXKA 2Y0AA 4FKRA 1GAGA 4FKUA 4X3JA 5D10A 2GQGA 3BHUA 4ID7A 4FVPA 2UZVA 4H3PA 3P79A 2OF2A 2XK7A 5E1EA 4HYIA 2QLQA 4LV8A 4EYJA 5GZ8A 5IA1A 5CU4A 2WTKB 3ZLXA 4AF3A 3RK7A 4G1WA 3KF4A 2FSMX 1QCFA 3DBEA 3LIJA 5GJFA 4AWIA 3RJCA 5CXZA 1JKSA 2YACA 3ZS5A 2WTWA 3BRBA 5I9WA 4EHZA 4DEHA 2PVRA 5IUIA 4PTCA 4BIBA 5LOHA 3GC9A 3VS1A 4UYAA 4J7BA 4L68A 3WYYA 4JG8A 2YLEA 2UZTA 3UMXA 4DG0E 2X0PA 3W2OA 3F5UA 5EH0A 3GBZA 4L7FA 3WYXA 1H25A 3EQIA 1FGKA 3QZIA 3PVBA 3PJ3A 1YXXA 4O0TA 3MB6A 3F5XA 3ZO1A 2ZB1A 4EH6A 3QQGA 1YDRE 2FO0A 4NIFB 3VS5A 3VVHA 4ZAUA 2IJMA 3A8XA 4BZDA 4G2FA 2WMRA 4LGDA 1OGYA 4RFZA 3D9VA 4C4HA 1YI3A 2A1AB 3PE2A 4FV5A 1O6YA 3GVUA 5HVKA 2IW6A 1RW8A 2X0GA 2XNBA 5M4UA 4NM7A 5AP6A 5EOLA 3R73A 1W8CA 5IA5A 3BLQA 3TUCA 2VTLA 5D41A 2YERA 3DLZA 4K1BA 2WTIA 3FL5A 4BDDA 4OTDA 2W17A 4QMMA 5H9BA 3FQHA 4OAUC 4JBOA 3KXGA 4QP4A 2OI4X 4Z16A 3UNKA 3TM0A 1IASA 3PXYA 1PKDA 3LJ2A 4GH2A 3W18A 4G34A 4XYFA 3EN6A 3NUSA 4D0WA 2XKCA 5H8GA 2PVKA 3TN8A 2Q83A 4K9YA 3GOPA 4MXYA 1BYGA 4AA5A 1BKXA 3NW6A 4EZ3A 2XB7A 5LVNA 3GU8A 3MY1A 2GHGA 3QUDA 3HMPA 4O0SA 3MH0A 2UW7A 4FL3A 4WA9A 1IAJA 2ERZE 4D5KA 5EQYA 4O4CA 2VGOA 3UVRA 5L8JA 2FGIA 3MBLA 3ZYAA 4NL0A 1BL6A 4YTFA 3AOXA 1Q3WA 1OIRA 2WTVA 4UZHA 3Q4UA 1VEBA 3V51A 2X7OA 4NZWB 4RPVA 3ZBXA 4GKHA 4QMSA 4TTHB 4CSVA 3AC5A 3LXPA 3RZFA 2AYPA 3UODA 4DFNA 5HX6A 3ZSHA 3EFJA 3OXZA 2H9VA 1DM2A 2R2PA 4YZCA 3UQGA 3ZC5A 2PZIA 2WIPA 4CLJA 4DT9A 4LMNA 1OL2A 4C8BA 4DGNA 5CTPA 4U81A 1LR4A 2B52A 2XCHA 4HCTA 3TV6A 2VN9A 3GU5A 4O0RA 3FSKA 3MH3A 3ZUTA 5JFWA 2AC3A 4O7SA 4CNHA 4IB1A 3QTZA 3MVMA 4FNXA 2W1DA 3KXHA 3MA6A 4KSQA 5CLPA 4GKIA 4FT0A 1I09A 1KE6A 3HGKA 5CVGA 3SA0A 5CF4A 3FMMA 2GNLA 4WG3A 5L2QA 2JBPA 3SXSA 3EMGA 3P1AA 1UU7A 4S32A 3W10A 2IVUA 4CVAA 2YN8A 3GU4A 3KCFA 4EC9A 4Z55A 2PE2A 3R00A 2HZNA 2WHBA 3ZZWA 2BMCA 2QOKA 5IISA 4ZLYA 2VWUA 2QOCA 4RJ4A 5E9EA 3BYSA 3PXRA 5IH5A 2BALA 2WTKC 3CKWA 1V0OA 3Q4CA 2BVAA 1Q41A 4F70A 2XIZA 5BVNA 5J5SA 1YOJA 4BCGA 2UZWE 4FIIA 5BVFA 4MD9E 4YMJA 1T45A 3MGYA 3HDMA 4L46A 5AUUA 3P23A 5FXRA 3WIGA 2EUFB 3AC8A 3UOHA 1KOBA 3L8VA 5F95A 3GT8A 3ZUVA 4DHZA 4EH3A 4YTCA 2EB3A 2YA9A 3VJNA 4FIFA 2R3MA 5CAVA 2J0JA 2ZDUA 4GU9A 3JY0A 3UPXA 4O6LA 2ITOA 3E7VA 4G9RA 4JIKA 4ZXTA 4YJTA 3ZC6A 4CZTA 2WO6A 4YU2A 3G0FA 5DE2A 3WIKA 3KN5A 3OY3A 1PMVA 4R7HA 4MAOA 4A06A 4HVHA 4D5HA 1IG1A 2UW3A 4IM3A 5AIKA 5J95A 2YAKA 3SKCA 3HLLA 4DHFA 3BEAA 3QBNA 4EUUA 1U59A 3TIYA 2WAJA 3SDJA 4WBOA 3GFWA 4TKSA 3SOAA 4IZ5A 4PDSA 3TV4A 4D2TA 4U44A 3U6IA 4RFMA 4X2KA 5IH6A 4ZZOA 3F3ZA 3O23A 2HWPA 3QKMA 1V0BA 3R8ZA 5CEIA 5AX3A 3T9TA 2JDTA 4PP9A 3S0OA 4UMUA 5CAQA 5KMOA 1SZMA 4F6UA 3ZRKA 5FXQA 3BL7A 4EH7A 2GFSA 1H07A 3NNUA 1UNGA 1LEWA 1JSUA 3WZJA 1SNXA 3FWQA 4YHTA 3QQHA 4FTJA 4FUYA 3OS3A 2R3LA 1R78A 5J8IA 3C4EA 1YVJA 4AGWA 2WNTA 5AAFA 4RX8A 3UVPA 4I93A 4C59A 3QD0A 5JH6A 3FSFA 2CKEA 5DNRA 2Y9QA 4EHGA 5BX0A 4EWQA 3OWLA 5LARA 3F6XA 3S1HA 3NGAA 1YXVA 4OT6A 4LOQA 5BMMA 4FKTA 3FKNA 4LMUA 5JZNA 4KBCA 5CS6A 4QMPA 4WT6A 4ANSA 4F7SA 5EM5A 3BCEA 3E8DA 5FRIA 4MBLA 4TWOA 4E8AA 5DIAA 4CLIA 2VWVA 4RIYB 5FQDC 3LQ5A 4CCUA 1SM2A 2G2FA 1K2PA 5BMSA 2IVVA 2GHLA 4FRFA 3F5GA 4F6SA 4O0XA 5CI6A 1J1BA 1OGUA 5AUYA 5A3XA 3TNQB 3MV5A 3PSDA 3BYOA 4RRVA 4B4LA 4CGAA 2B1PA 2R3GA 4RIWB 4Y95A 1PJKA 3R1QA 4BFMA 4RT7A 4PF4A 5H8BA 4D2RA 5LVOA 4XOYA 4KKEA 1J91A 4V05A 3OC1A 4FTMA 2Y4PA 5L8KA 3NIEA 3QC4A 4O81A 1OITA 2OIDA 2XNMA 4FICA 2V62A 3LFCA 3B2WA 4BKYA 3FMHA 4M68A 1WBSA 2UZOA 2C1BA 2Z8CA 5EM8A 5M55A 5KUPA 2NRUA 5M4FA 3VULA 3MFTA 2OWBA 3O2MA 4BWPA 1M2PA 3I4BA 2P4IA 5JQ8A 4QNYA 2UVZA 4X2NA 4O1PA 1Y57A 4ZJJA 4O7LA 4FV4A 3HAMA 4CEGA 1BL7A 3QTQA 3Q9ZA 4NM0A 3OVVA 2NPQA 3FKLA 3ZLSA 2OKRA 1WVYA 2X9FA 4H58A 5BYZA 4PRJA 3ZM9A 2YISA 4M69B 4U7ZA 4WNPA 3UC3A 4IX6A 2YCQA 4BIDA 4DH1A 3OCSA 4UALA 4APPA 4IZYA 4AGDA 2BZIB 4GFGA 2HAKA 2FA2A 2XNPA 3QXPA 3FL4A 1YW2A 4KKHA 2CHLA 3D4QA 1W98A 3PA3A 1BI7A 4CMOA 3EKKA 3ROCA 4CMTA 5AR5A 3BBWA 2W05A 2ITYA 2GNJA 3EQHA 1F5QA 1OL6A 3AD6A 3D7TA 4YPSA 4AW1A 5IQDA 4FIHA 3UYSA 5AV4A 4G3GA 4DEGA 3M42A 2REIA 5M56A 1LP4A 4OTRA 5E1SA 4I6FA 1H00A 3KMWA 5EDQA 4ZSEA 3PG3A 5TKDA 3G9NA 5FGKA 4GW8A 2GFCA 2WMXA 4M7IA 5HD7A 3R02A 4EK4A 1TVOA 1VZOA 2XNNA 4I0SA 1F3MC 4X3FA 5E90A 2F49A 3HDNA 5HO6A 3I7BA 5C4KA 4P5QA 2FB8A 3TV7A 3ZDIA 5KMIA 4H3BA 3RPOA 3UQFA 1O9UA 4LRJA 4TW9A 4YZ9A 5CZIA 5EHYA 3S00A 2AUHA 3PDTA 3VONA 5B2KA 5KMKA 2B7AA 2V0DA 4D0XA 3GU7A 2EXCX 3Q2JA 4QP7A 3BU6A 3T3VA 4HZSA 3E64A 4O27B 3A4PA 3DJ6A 1SYKA 5CT0A 5G6VA 3DBDA 4XV9A 2HCKA 4AZSA 2CJMA 4D4RA 4RLKA 4DH5A 4Q9ZA 2C3KA 2ITXA 3MIYA 4XCUA 5EI8A 3REPA 5HE3A 3R7EA 2XYNA 1KE7A 2H96A 5D9HA 4EQMA 4F09A 2VO3A 3HUBA 3IW4A 1ZOGA 1B39A 3H30A 3EYGA 4PMSA 4XMOA 5BVKA 4ZY4A 1WBPA 3I6WA 4A7CA 4BRXA 4N4SA 4IC8A 4QTBA 1UU9A 4BDCA 2PU8A 4H1JA 2QG7A 4IEBA 4JG6A 4EWHA 2H34A 4IIRA 3C0GA 4MF0A 2WMWA 3EFWA 2QR8A 4PDOA 1ZOHA 2C6MA 5BUJA 4L67A 5A6NA 4A9RA 4D9TA 4MX9A 2OXXA 4EK6A 2WELA 4D4VA 4PTEA 4YNOA 2B55A 5GHVA 4XG6A 5DI1A 4XG2A 4YNEA 4JBVA 2OJFE 4KIKA 5EW8A 5HLPA 2HOGA 4QPSA 4I20A 4A07A 2Z02A 4HCVA 2WTDA 5HOAA 4O7RA 5J7BA 2BZKB 3A4OX 4FSZA 1DAWA 4I5PA 4WNKA 3CC6A 4DFYA 3DXPA 3L9LA 5AR7A 1R1WA 3ORIA 2P0CA 3JY9A 3TJCA 4QP2A 4XLIA 4F78A 2Y7JA 5DEYA 3VQHA 3AGMA 1YXTA 3OBGA 3OXTA 5B0XA 3FE3A 4AZTA 3VBWA 3FUPA 2QONA 3QLGA 5ANEA 5JGBA 1X8BA 4WD5A 2QOQA 4BDAA 2OGVA 2C5YA 2XKEA 3EKNA 4NW5A 1BX6A 4MNEB 2OH4A 5T3QA 3ZBFA 3UOKA 4L53A 5JMSA 1IA8A 4QNAA 2QLUA 4FV8A 5CSHA 1RJBA 4FV3A 1ZYSA 3B8QA 3PY3A 4GJ3A 3DKGA 5CVFA 5G1XA 1UV5A 4DTBA 3F9NA 2BHEA 1Q8TA 3ORPA 4CTCA 4F9YA 2VWWA 4YHJA 4KA3A 3A7JA 5FBOA 5T6KA 4Z7GA 3KA0A 2R3PA 3NCGA 5CVHA 3TZ9A 3VWAA 3W2CA 5I0BA 4AXCA 3NVKI 4U42A 4LRKA 5IQBA 4BWKA 2P2IA 3LXKA 4QPMA 1OECA 3PP0A 2FSOX 4C4GA 3IW7A 3OCGA 3TNPC 3HVCA 3LM5A 1XWSA 2F7XE 2ESMA 1CDKA 3E3BX 3RK9A 1GJOA 2J0IA 2Y6OA 5IG1A 3EQRA 5EYMA 3LOKA 5GZ9A 2QNJA 1J7UA 4QEBA 5DRDA 2UW9A 1ZYLA 4EK3A 4I24A 2R3QA 2PVJA 5FTOA 2VTQA 4I4EA 4II5A 4W4WA 3UOJA 3C4WA 4LV7A 4O7NA 3WZUA 4E4MA 4N6YA 3AT4A 5H3QA 3MVLA 1ZY4A 3C5IA 4XNEA 3QQLA 5LCJA 4GCJA 4FEQA 3F3VA 3VS4A 4M12A 1TQMA 5CALA 3QKKA 4R3RA 5E91A 2QHNA 2XP2A 2XEYA 4GSBA 4F9AA 2GDOA 5HNBA 3S4QA 4D2VA 3BLHA 4QQTA 3U55A 4XBRA 3ZO4A 2E9UA 5BUEA 2YIRA 1PXLA 4LDTA 4XG7A 3ANQA 4DEAA 1PXNA 4O4EA 5JFSA 2A98A 5ANGA 4AS0A 4R1VA 3DKOA 4RC4A 3BYMA 5JGAA 1PXPA 4ONAA 4YR8A 3VS6A 3VUTA 3P86A 3Q53A 1AQ1A 3NS9A 3TTIA 2UVXA 4J53A 2X8EA 4GVJA 5JKGA 4AZEA 4BDJA 1PW2A 3H9RA 5CF8A 1YWVA 3QYZA 1DS5A 3PJ8A 3R8LA 1WBOA 4C4IA 2B53A 3KK8A 3QTIA 5FEQA 4UXQA 2XBJA 2JDSA 4PUZA 4QOXA 4CMUA 4PNKA 3DNEA 4XP3A 5ETIA 5LMAA 3EN7A 1NT2A 4ACCA 3I7CA 2W1EA 3HNGA 1VJYA 1CKIA 2JIVA 3F61A 4GG5A 4JOAA 5DGZA 1PMNA 3UIMA 3UO4A 4IBMA 1PMUA 2XYUA 4IAKA 4CQGA 3BV2A 5ACBC 4PTGA 3EOCA 5DR6A 4AQCA 2C5NA 4DTAA 1RDQE 2VGPA 2ZMCA 3R83A 5CNOA 3SOCA 1JSTA 1Y8YA 3R8VA 4MXAA 3FMDA 4QPAA 4IB5A 5E92A 2BFXA 5EDRA 4RVMA 5CASA 3A99A 4JL9A 4J8NA 3UNZA 4AW2A 3TL8A 1JAMA 4MBIA 4XEYA 5HNGA 3RINA 4TWNA 3V8WA 4DGGA 4DDIA 3N4VA 4EH8A 3KIOC 5B7VA 4U79A 5KMLA 1CSNA 3Q2MA 2C5OA 2OZAA 4B0GA 2R3IA 4BJJB 5CY3A 3CJGA 5CEMA 1XMMA 2BDWA 3RPVA 3P7BA 3PSCA 3ULIA 2HIWA 3NVMB 4TL0A 3D5VA 2ITUA 1BLXA 2PVFA 4U45A 5ANDA 3VS3A 4EBWA 1FOTA 1Q62A 3A7IA 5E8ZA 4FKJA 1FVRA 4DGMA 4E6QA 2I0YA 4FSYA 4NJ3A 4O4DA 3OT3A 4KINA 2BAKA 4ZZNA 2WMVA 4S34A 3BYUA 3AQVA 4AOIA 3QFVA 3BL9A 4H05A 4I23A 2CKOA 1UWJA 2P2HA 2VNYA 2W96B 3D83A 3CXWA 4M84A 4O4BB 3NRMA 4X3FB 3ZO2A 3R71A 3P9JA 4FV9A 3C0IA 2XKFA 4C0TA 5K9IA 4JXFA 1TQIA 2BHHA 1UKHA 2V7OA 4B8MA 2FVDA 4YZBA 4DTKA 5CSPA 5IH4A 4E4LA 2BCJA 2YM7A 1VR2A 2GMXA 3D15A 4U8ZA 2A19B 4W8EA 4C57A 2PWLA 2YLFA 4OLIA 3ZONA 1J3HA 2O2UA 4NYEA 2BZHB 3WBLA 4UMTA 3FMLA 4E3CA 4JR3A 2WZJA 2XF0A 5HI2A 5AUWA 4R77A 4Q5HA 3PXZA 4DBNA 4OTHA 5DG5A 4DLJA 3F5PA 1FVVA 3R7OA 3HUCA 4BWXA 3AD4A 4HYUA 3VUKA 4BCMA 2C30A 3QHRA 2CCHA 3GXLA 2OJJA 2F7EE 2IW9A 4RJ5A 4KAOA 3HV3A 3TZ8A 3EFKA 3U6JA 4O38A 2V55A 2IZSA 1JSVA 4FG8A 3DKFA 2I7QA 3BI6A 4RWKA 3IK3A 2Q0BA 3ZMMA 4TNBA 4F65A 3KRWA 2IVSA 1WBWA 1W83A 2CN5A 4F99A 1XO2B 2ZDTA 4YZNA 1I44A 3OEFX 1JOWB 2CGVA 3QGWA 4L00A 5A9UA 2BKKA 4EK8A 4ZMFA 4DBXA 3QX2A 4NKSA 2YM8A 4WUAA 2PE1A 4XBUA 2AEGA 4L42A 4JQ8A 5A4QA 3KQ7A 3UP7A 2QOIA 4KIKB 4OUCA 5D11A 4EZ5A 2YIYA 4HGSA 3G2FA 5IMXA 1JKKA 3RHXA 3GENA 3NX8A 3QD2B 5K0KA 3QUPA 5DR2A 2OH0E 5AWMA 3NW5A 2H8HA 1V1KA 2XANA 4PL3A 5CWZA 4QP6A 3R8UA 4QQJA 4ZTQA 4ZS4A 4HVIA 4K18A 4QMYA 2JIUA 4O0YA 3RPRA 1KE8A 2VWZA 4JJRA 5D7VA 3VC4A 3C4CA 3FZSA 3IW6A 3PA4A 4UMQA 4FGBA 1OPKA 3IKAA 3DZQA 4FT3A 3DAEA 4FX3A 2WMSA 5AUVA 4BGHA 3AKKA 4RIXA 4QDVA 3MJ2A 3VBVA 4FBXA 4UWBA 5TOZA 3R2BA 3I5NA 1WVXA 4MNFA 2RSVA 4EKKA 5BVDA 3NYNA 4TYEA 1J7IA 4WNOA 3UMWA 5CEKA 3UIXA 3IONA 3ENMA 3VJOA 5I3OA 3R21A 3FI8A 5FM2A 4W4YA 3BHHA 4WOVA 2O65A 3DK6A 3Q9WA 4ZTHA 4F08A 4CCBA 2OIQA 3QCYA 5HU3A 3VQUA 4BI1A 5BQ0A 4HJOA 2WKMA 4ACGA 5IQGA 2QOBA 3HYHA 4F7LA 2QODA 2VTOA 5AMNA 4BDHA 3LFAA 2AQXA 3P78A 4W4XA 5M07A 4FTKA 2PULA 3HX4A 4CFUA 3E92A 4E7WA 3K54A 2YCRA 2X7GA 2E9PA 1XBAA 2W1CA 4OTQA 5FUTA 2X1NA 1A9UA 3R28A 2ZJWA 4X3FC 4AN9A 4EOPA 2C5VA 3BEGA 1S9JA 2G2IA 3H9OA 4IB3A 5EI6A 1OL1A 5F1ZA 4C61A 3CPBA 2A2AA 4ZJIA 1P5EA 2X2MA 4QTDA 3LFSA 2CNQA 1WAKA 5IPJA 1ST4A 4MK0A 4F1MA 1R0EA 1G8KA 1LUFA 5CENA 4BN1A 3QL8A 4KS7A 5BYYA 4DDGA 2XS0A 2C6IA 3GFEA 4BTFA 4IAIA 1NY3A 4IVAA 5BV3A 2XK4A 3DZOA 1P4FA 3OBJA 2ONLA 3BELA 5K3YA 3AC1A 4LGHA 2QOLA 1WBVA 4AN2A 1REKA 2YJRA 4BCIA 3FZTA 3O96A 3UDZA 1YWNA 3DT1A 3NYXA 5AAGA 2GS6A 5KCVA 5DT0A 2X9EA 1ZYCA 3JR1A 3OW4A 4YJPA 4FVQA 4AA0A 4J52A 4YURA 3RCDA 2B54A 5HVJA 5LVMA 5ETFA 2UV2A 5K0XA 4JIAA 2XNGA 4UBAA 4BR3A 2R0UA 1H1PA 3AT3A 3F2NA 1IA9A 3EB0A 4C38A 4HYHA 1IRKA 3OOMA 4GYGA 3OXIA 2EWAA 5GNKA 2CDZA 5HESA 3NAYA 2ZV9A 3ZLWA 4O7VA 4TYHB 3QF9A 3IG7A 4G16A 4MCVA 3LCSA 3ERKA 5E8SA 4NUSA 2JAMA 4G3CA 4CFNA 3OWKA 3W8LA 4FSMA 1OBGA 4L6QA 1PXMA 4IDTA 4Y85A 1ZOEA 3UP2A 4APCA 3UJGA 2XH5A 4BHZA 4ACHA 3RPYA 4C35A 1LPUA 4GT5A 2W5BA 4TPTA 5HG8A 4C4EA 1P2AA 2C6TA 1JNKA 4ACDA 5CF5A 3I79A 1NVRA 5CF6A 1KWPA 3BWJA 5HHWA 4O86A 3NNWA 4G3DA 4J96A 4BJJA 1QMZA 3OT8A 4L52A 4U41A 4NU1A 4C4JA 5I9XA 2GS2A 2GSFA 3LMGA 1OL7A 5E4HA 1MUOA 1QL6A 4GUBA 4KSPA 4BZNA 5E7RA 4F7JA 5KNJA 2R7BA 2EB2A 3CQWA 4AAYA 1FQ1B 4DFBA 4E1ZA 4FK6A 3R9HA 4QMWA 3R9DA 3V8SA 4FSUA 3ZEWA 2ZAZA 3OHTA 4A4LA 4O2PA 2JKMA 3OROA 1UA2A 3E3PA 4FKOA 2PSQA 3UBDA 3FMEA 3LKMA 3KXZA 3P5JC 2OZAB 4DT8A 4W9WA 1SVEA 5JT2A 5J7HA 4FTCA 2IWIA 3CJFA 2XRWA 3EQBA 4D1XA 5B2LA 1H26A 3LAUA 2RFDA 4FGRA 4RSSA 3RHKA 4B6LA 5BNJA 3H9FA 2WXVA 4GFMA 4IADA 1W2CA 2OJ9A 2XARA 3LFDA 4CG9A 3RNYA 1WVWA 4CRSA 4B7TA 5I3RA 4RLLA 3R0TA 4DH3A 3TMOA 1OMWA 4WSQA 4WRSA 2YAAA 4GFOA 3NUNA 3QTSA 1WMKA 4C58A 5KMMA 2X4ZA 4ERKA 3EIDA 5IQEA 3R6XA 4IM0A 4XHKB 2W1ZA 5AV0A 4E26A 4AZFA 3R1SA 2PUPA 4C3RA 1OPLA 2PVHA 3DAJA 4G6LA 4RZWA 2B9JA 4K0YA 2H6DA 3PVWA 5FXSA 4ZY5A 4I0TA 2YDIA 2XALA 5LVLA 5HG9A 1NW1A 4TYGA 2BRHA 3MH1A 3NYOA 4D2WA 2UW4A 2A0CX 2ITPA 5HU9A 5IZFA 4LYNA 4HGEA 5J87A 5HTBA 2GQSA 4P90A 2C3IB 4GK4A 2W1GA 3SAYA 5HORA 4LQMA 2OW3A 1P14A 3OUKA 5M51A 3A7GA 2G1TA 4JVGA 2ETMA 4AFEA 3PUPA 4JDIA 2PMOX 2UZLA 1IEPA 1XHAA 5GJDA 3RBWA 3UQCA 4ZTLA 3QZHA 1BMKA 4NT4A 1ZARA 3L9MA 4QP3A 4CQEA 2OLCA 4AXDA 4NH1A 3VS0A 2BTSA 1MRVA 4IVCA 4GVAA 5AA8A 3RKBA 2QO2A 5I9VA 3GGFA 5J79A 3N4UA 5A4LA 5EKOA 2VWIA 3ZO3A 2WEVA 4ALUA 5ETAA 5E8UA 3ZEPA 3P7CA 3Q52A 3EQPA 2PMNX 2BIKB 3DTCA 3WOWA 3PJCA 1YXUA 4H3QA 4N6ZA 2YABA 3RVGA 4FZDB 4IXPA 4XP2A 4BVUA 5M4IA 4DA5A 3TCPA 2WTCA 2J9MA 1KOAA 2W5AA 1FPUA 5FM3A 3PZEA 3VF8A 3AD5A 2XM8A 3CE3A 2JBOA 3HMNA 4JI9A 4EEVA 3R9RA 3A60A 3VRZA 5J9YA 1R0PA 1ZWSA 3P5KA 4LL5A 3RZBA 5JFVA 4PMMA 4DFUA 4F6WA 2OBJA 4IAYA 4GYIA 3V5QA 2E9VA 3BHYA 3GCQA 3W1FA 4PPAA 4MWIA 3WE8A 2NYAA 3CS9A 3UIBA 4QMNA 2PZ5A 3Q5ZA 4FKWA 3PIZA 5AP5A 3ZFXA 3R1YA 5JZJA 5HBEA 3ATTA 4D1ZA 3BQRA 1OUKA 4RWLA 2XAOA 3ORXA 4J95A 2I6LA 2G2HA 2PVNA 3WILA 1J7LA 3DXQA 5IQFA 2GPHA 2YIQA 3MW1A 3VBXA 4C34A 3PJ1A 2C6DA 4FZ6A 3ORTA 3EZVA 4RIXB 5DT3A 5I9UA 4BCHA 5CAPA 3FPQA 5IQCA 4GK2A 4ZJVA 4R78A 2XJ0A 3K3JA 3MA3A 3CLYA 4KB8A 4N70A 3TACA 3IDBA 5DWRA 4EOJA 1H0VA 1FMKA 2HW7A 4DFXE 5HNIX 3MDYA 4MUQA 2X2KA 2ETRA 3D94A 4LRMA 3RMFA 3SG8A 5HICA 1OM1A 3HRCA 3QA8A 4H36A 5KZIA 5JQ5A 4TWPA 5TR6A 3LZBA 3UTOA 4CV9A 3EQDA 3NPCA 4IW0A 4QP8A 2SRCA 3MB7A 2IW8A 2JDRA 2PMLX 3FY0A 2V5QA 4UYNA 3W2RA 1U4DA 2C6LA