3POOA

Human camp-dependent protein kinase in complex with an inhibitor
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
337
structure length
331
Chain Sequence
SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase catalytic subunit alpha
publication title fragment based drug design on PKA
rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 109
structure length 331
sequence length 337
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2010-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3pooA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3pooA02
5EG3A 4PUZA 3UOHA 3U51A 2JLDA 4GYGA 4AW5A 2OJGA 4W4XA 2C6TA 2CCHA 2ZM4A 3KF7A 3QTWA 3UBDA 4AGDA 4EHGA 4JBPA 4EH2A 1FGKA 1O6LA 3BU3A 5CSWA 4FEQA 4II5A 5AV1A 2ETRA 3MTLA 3QC9A 4RWLA 1NXKA 1WBNA 1YXVA 4EQMA 3LKMA 4K18A 3F3UA 5LQFA 4D2SA 2FA2A 2V22A 2PZYA 4AA5A 3UZRA 4G6OA 4NW5A 4QMVA 3TTJA 3PIZA 4KINA 4RZWA 4YU2A 3MVLA 4O84A 3DTCA 1XQZA 2PE1A 4G16A 5HX6A 4EOIA 4YHFA 4KNBA 1SVHA 3GFWA 4IZ7A 4V0GB 4R6VA 1SMHA 2CN5A 2HXLA 3FZOA 4IWOA 3CCNA 2PVMA 4Y5HA 2XNBA 3FZRA 3NGAA 4CGAA 1Q99A 3P7AA 4E4LA 3ET7A 2BRHA 4QP4A 4D9UA 3L1SA 4TYHA 4KWPA 3COKA 3IW8A 5GHVA 3LW0A 3ZM4A 3F2NA 3H9FA 4QPAA 4FKRA 5C01A 1PHKA 4ANLA 3GNIB 5C26A 1YOMA 2QCSA 3VAPA 5DT0A 5LVOA 2WTKB 2OFVA 4Y85A 5BVDA 5HBJA 5GIPE 1NT2A 2ZAZA 3M11A 5HE0A 3MB6A 5FP5A 3MA6A 3HV4A 3FC1X 5HHWA 3T9IA 4IADA 4DLIA 3MTFA 3Q2MA 3GUBA 3OUNB 4DGOA 3P23A 2GPHA 3TKUA 5LWMA 4S2ZA 4IZ5A 5GJGA 3SKCA 4DA5A 1JWHA 4CSVA 4I23A 1ZLTA 3SXRA 3W8LA 3R01A 1YXSA 3MPAA 4JLCA 4PQNA 1TQPA 4WG4A 2H6DA 4CYIA 2P3GX 2JKOA 3BV3A 2XK8A 3RWQA 2BROA 5AP7A 3R7OA 3QTZA 3ZRMA 4CEGA 3DK7A 3BEAA 3F82A 4GIIA 2WHBA 4MNEB 4BWKA 4DGMA 4AT5A 2GQSA 3D7ZA 4I6HA 3ZFYA 3VWAA 5AP2A 3F3ZA 5KUPA 1E9HA 3MY0A 3UC3A 2XM8A 5HE3A 3MY1A 2GHMA 5EW8A 4L67A 4WUNA 4IAIA 2CSNA 3QD3A 2XKCA 1BI8A 4PL3A 5HLPA 4ACHA 4GKHA 3LAUA 4M97A 1BLXA 3DKGA 3EN6A 4QP8A 3KRXA 4LM5A 5CZHA 3V5QA 2UZNA 4F9WA 5AR8A 3HGKA 4IAAA 3TNPC 5TR6A 2O65A 1JBPE 3GEQA 1IR3A 3C51A 4NT4A 4AF3A 4C35A 5DMZA 4H05A 4FOBA 4TTHB 2GMXA 3LFQA 4L53A 4BBFA 1UVRA 2PK9A 2X2MA 3IGGA 3PY1A 4OGRA 2JDSA 5B2KA 3VW6A 4E4XA 3R71A 2ZV7A 3E8CA 3IOPA 3PY0A 3FXXA 5GZ9A 5EYDA 4FOCA 3W32A 4HVIA 3FXWA 4ANMA 2NP8A 4R7IA 5HVYA 1BI7A 2W9FB 4TNBA 2GFCA 3NLBA 3ZUUA 2XRWA 3V5WA 4W4WA 4G2FA 2ITZA 2OKRA 4I0TA 2XYNA 4PRJA 2WMTA 3Q6UA 4LOOA 5IQGA 3QQGA 4FNZA 4TXCA 3MYGA 5DR6A 4IAYA 4I93A 2VO0A 1JQHA 4DH8A 3ORTA 3TZ9A 4EH9A 4RZVA 4FT0A 4GV1A 4YHTA 3T3VA 5M57A 4YMJA 3G9LX 4FIFA 4C4FA 4CFFA 4D58A 2B53A 5EDRA 4DEBA 5AA8A 2FUMA 5DH3A 3RVGA 4BGQA 4O81A 3ULZA 3W10A 2WIPA 3EKNA 1FPUA 3AQVA 3QZFA 3VBYA 5DYJA 5LCJA 5FDPA 1PF8A 3R63A 2C6LA 3DBDA 4DGLC 1SNUA 3E87A 1FQ1B 3LM5A 4UV0A 4OW8A 5CEOA 1YRPA 4O38A 5GIOE 3DKCA 3NUPA 4CZUA 3NIZA 4NU1A 2GTMA 5CNOA 3LQ8A 1H0VA 3UG1A 4PX6A 3K54A 2HWPA 4QMQA 3KU2A 3G6GA 1OKZA 1XR1A 4WNPA 5DR9A 4G9CA 4BDBA 2FH9A 2Y8OA 2X39A 2X81A 4GK2A 4KRCA 2BZHB 4O1PA 4BI2A 2W1HA 5I0BA 5M07A 3QTRA 4FKTA 4FEVA 1Q8WA 2NO3A 4F08A 4MXOA 4JVGA 4MXCA 2GTNA 4A4OA 3L8PA 3GENA 5T3QA 2GQGA 3E8EA 2WELA 3UYTA 3ZLWA 2IG7A 3QLFA 4F9BA 4Y72A 3QFVA 5ITAA 3S00A 2XK6A 2RG5A 3BHTA 1IAJA 4I0SA 1W7HA 3MA3A 5HG8A 5HD7A 1MP8A 3QLGA 5IUGA 5C27A 5KKRC 4C4JA 2O8YA 2BHHA 1M2PA 3FMDA 3QTXA 2YLEA 3PPZA 4RMZA 3MS9A 4TYGA 3QTUA 1ZRZA 3K5UA 2CKEA 2HAKA 4U5JA 2WAJA 3Q4ZA 5HEZA 2OK1A 4M69A 2Z2WA 3COMA 1YHWA 4AGUA 1J1CA 2VX3A 2NRUA 2BIKB 5FD2A 3WZUA 3IDBA 3G90X 4UBAA 1UU8A 3FBVA 4C34A 5BYZA 3VQHA 4EH8A 3DXPA 4FGRA 2VNYA 4CZYB 4CCBA 2OW3A 3BE9A 4ZTHA 1S9IA 1VYZA 2V55A 4FG7A 3LHJA 4I1ZA 5LARA 3DAEA 4D5HA 4EHVA 1TVOA 5KZ0A 1P4OA 4BL1A 3BLRA 5CY3A 2IZSA 4BF2A 5CAOA 4BGGA 4X3FC 4Z7GA 3UPXA 3SOCA 3RJCA 3Q52A 2YAAA 4W8DA 4MXXA 1DAYA 1KE6A 4OTIA 4Q5EA 2ZYBA 1OM1A 3A8WA 3PJ2A 3VRYA 3ZDIA 3PLSA 1Q62A 5CX9A 3DAKA 4Y46A 3KVXA 4AS0A 1U5RA 2EB2A 1YDRE 1U54B 4BI1A 1U46A 2UVXA 3UIMA 3I7CA 3TUDA 2HW7A 3S3IA 1XH5A 4XG3A 3TG1A 3LM0A 4GK3A 5FUTA 4O0XA 1T45A 5DRBA 1GIIA 5FWKK 3ZS5A 5JMSA 2JIIA 2P2IA 2VTPA 2V5QA 4GJ2A 3FSFA 4ALVA 4W4YA 5FEQA 3FE3A 3ZZEA 4I4EA 2UZEA 4U6RA 1R1WA 3U6JA 5KMOA 4ZTSA 4B6LA 5C03A 1UU7A 2CGUA 3D2KA 4JG6A 4FNYA 4QD6A 2X9EA 4YJTA 4C37A 2BDWA 3SD0A 4F7JA 1WVWA 4E8AA 4CFUA 4PPCA 2W1IA 4FSQA 5AAGA 5B7VA 4ID7A 3GT8A 3QA0A 3AXWA 2PE0A 3OXZA 1VZOA 2VTOA 3R6XA 3E63A 4APPA 4IB3A 5BVWA 3DZOA 5CSXA 2ZMDA 4O0WA 3TN8A 5BVKA 4E7WA 4D1SA 4L46A 1Q8UA 3QQUA 4AGWA 3CPBA 2XH5A 1P2AA 2OZAA 2RFSA 3JVSA 4WNKA 2X1NA 1P14A 4IFCA 4RX8A 1ZYJA 4EEVA 2IO6A 1O6KA 3VRZA 4R5SA 2HK5A 2XCKA 4GFOA 4E1ZA 3QQJA 5K4IA 3RZFA 4FKLA 4FL3A 2AYPA 4LG4A 1M2RA 3UDBA 3VUKA 1TQMA 3COHA 1R39A 4FV9A 4RLLA 4AGCA 5GJDA 4V01A 2R9SA 3FJQE 5BYYA 3QUEA 3G15A 5K3YA 2V62A 1K3AA 4ASXA 3UQCA 2WTCA 2ZJWA 3TT0A 4DT8A 1CKJA 4WKQA 5AX9A 4EORA 3VJNA 2C69A 3TACA 1H1RA 3LFDA 5HKMA 4DFNA 2A4LA 5CVGA 4JR3A 4QP3A 3KRLA 3GXLA 2CHLA 4Q2AA 2BVAA 3W2OA 3K5VA 4L7SA 5CEQA 3RK5A 4KIPA 4ANSA 4GU9A 1YXUA 2RKUA 3QZIA 1BUHA 2ITVA 4GFMA 4A07A 4BWPA 4JDKA 3TZMA 5AFVA 4DEGA 4RVKA 5BPYA 3PXYA 4ZOGA 1ZOHA 3EYHA 4D2TA 3R02A 3QKKA 4FIEA 3LQ3A 1B6CB 2ZV2A 2B1PA 3PPJA 3AGMA 4E5WA 4YJRA 4AFJA 1OIYA 4OTWA 2ITPA 3QAME 5FTGA 4FR4A 1S9JA 2LAVA 3O2MA 2WMUA 3PIXA 4FVRA 3DFAA 2XM9A 4QYYA 1U59A 4ZTNA 2W5HA 3TNHA 5GZAA 5LMBA 4FL2A 2FSOX 3SQQA 4C2WA 2XCHA 5CU0A 1Q8YA 1YW2A 4I3ZA 4EH3A 2ITYA 2UV2A 4RQVA 2BHEA 1PMUA 2ZV8A 3ITZA 4G5PA 4AZFA 3KRRA 4I92A 5HNIX 4R7HA 4GRBA 5AP4A 4UN0C 3DB8A 3AMBA 3HEGA 4I94A 3PA5A 5HVKA 1KE5A 4NM3A 3TV4A 2OXXA 3PA3A 3OTUA 3LXKA 3PJ8A 2OIQA 3WF6A 4BYIA 1G5SA 4C3FA 5L8KA 2CNUA 4EI4A 2CGVA 3D5WA 5HCXA 3WILA 3VO3A 2R5TA 2VO6A 4GL9A 1QPDA 2IVUA 2W4OA 4JRVA 2VAGA 4O2ZA 4V04A 3A7HA 3NWWA 5L2WA 2YIWA 4AWIA 1WBTA 2XJ1A 3C0HA 3LCSA 3PWYA 3LCTA 4I6QA 3UZPA 2YZLA 4RIOA 3VVHA 3SRVB 5LVMA 3FV8A 1Z5MA 4OBPA 2XRUA 2WOTA 3DAJA 3U4UA 3K3JA 3V01A 5I9WA 2OGVA 5JRQA 5HG9A 4RG0A 4P5ZA 2EXCX 2YM3A 4XP3A 5DRDA 2C6MA 4WSYA 3UIUA 2VTNA 3NVMB 1OL1A 5EI6A 4O7VA 3IW4A 4AX8A 4CD0A 3NNVA 1QPCA 3A7JA 4QTAA 1PYEA 5ANEA 3O7LD 3FYKX 4JBOA 5AM7A 4ZTQA 5HVJA 3P7BA 4ZEGA 3C9WA 4CT2A 2IPXA 5M06A 3NVKI 4IBMA 3OT8A 4QPMA 1JKTA 4HCUA 2UW8A 4PDYA 4IVBA 4L43A 3ZC5A 4WBBB 3Q4CA 4QYHA 3R0TA 2VU3A 1Q4LA 5EK7A 3PXRA 1JKSA 1B38A 3C0GA 1IEPA 3RAIA 2FO0A 3DDPA 3HRCA 5F20A 3WZDA 3JR1A 4EYMA 1E1XA 3C7QA 1YKRA 3H3CA 1M52A 3C5IA 3TNWA 3NAYA 4KRDA 4MYGA 3ZSHA 4E4MA 4D4YA 3Q96A 4J52A 5IUHA 4FMQA 4JAIA 3CLYA 3QCXA 3ZLSA 4ORKA 2PMOX 5C8MA 5HLNA 1BL6A 3RNYA 3UNJA 3BYMA 5FEDA 3O96A 3FLNC 3WOWA 3ZRKA 3GCPA 5EHYA 4DFUA 3QD2B 4D5KA 5HTCA 1OZ1A 4C4EA 2C0IA 3KULA 4FKPA 4O91A 1HCLA 4DG2E 3NPCA 4FZFB 3R8PA 1WBWA 3OEFX 4DEEA 1XH7A 4NFMA 4XBUA 5FLFA 1WFCA 4HVHA 2PVRA 3OWKA 5L2TA 3N4VA 3LLAA 3VS6A 5B0XA 4HGEA 3E92A 3RZBA 4FG9A 3MFSA 5FM3A 2VV9A 1CTPE 3HA6A 4FK3A 5LVLA 3Q9XA 4WIHA 3UOLA 2HENA 2WMXA 4R1YA 1WBPA 2XA4A 3L8VA 3LFFA 3HUCA 4UB7A 5DR2A 3ZM9A 4J97A 1H1PA 2W1EA 2XKEA 2YACA 3C4EA 3VUTA 3RHXA 3QTQA 3TUBA 1YXXA 2AC3A 3E3BX 3O0GA 1NVQA 4YLLA 2YJSA 2YM7A 3QHWA 4Z3VA 1BL7A 3D14A 3QGYA 3R21A 5HE2A 3ORZA 1GNGA 5D7VA 2VWBA 5EOLA 5H8GA 2EUFB 4NK9A 2VWXA 4IWDA 2XKFA 3HDNA 4FKJA 1G3NA 4U44A 2XUUA 4EBWA 5HO8A 4G3CA 3F9NA 3ZFMA 3IDPA 3PE2A 3DLSA 1BX6A 5EDPA 5JQ8A 1OB3A 5D41A 5EYMA 5H2UA 2CKOA 3FMNA 5HGIA 2OJ9A 4I20A 2IZUA 1Y6AA 2NNWB 3G9NA 4H3QA 2R3IA 4H1JA 5LOHA 4CFWA 1WCCA 3KFAA 5DHJA 4ZY6A 3V8WA 4F6WA 5E1EA 4G5JA 3MSSA 3GQLA 2XIZA 3I5ZA 3AC5A 4WNMA 2I1MA 3NUYA 5AUVA 2G9XA 2CLQA 4XJ0A 3FPMA 1M7NA 1DAWA 3OTVA 4HPUE 3VBQA 2OBJA 1GIHA 3ZBFA 5M4FA 1J1BA 3TEIA 4C58A 2EXMA 2HELA 2BILB 3P4KA 1PXOA 2VTLA 1GOLA 2X4FA 4YP8A 3FMMA 4QMYA 3UNKA 4TZRA 1JSUA 4FYOA 3FZ1A 3FSKA 4LUEA 3IW5A 1H27A 2J0LA 3EKKA 4AN2A 5CXHA 3OY1A 4UZDA 4OAVB 5H8BA 2UVZA 1ZY4A 2PUNA 1Q24A 3DZQA 3WIGA 3MIYA 3P1AA 4IW0A 3N51A 2QO7A 3IO7A 5D7AA 1MRUA 4EZ5A 4LFIA 1AD5A 4BHZA 5J87A 3ODYX 3ORXA 4QMXA 4AW1A 5HQ0A 3SW4A 3I0QA 2GNHA 4K77A 4ENXA 5I4NA 1EH4A 3FLSA 3RPSA 2HZ4A 3VIDA 3LMHA 1LR4A 2YFXA 4RC4A 3UC4A 3GU7A 4M14A 1PMVA 1YHVA 3LFSA 2GNJA 4D0XA 4D2PA 4HGSA 4PV0A 4EOJA 3ATSA 3VBXA 3S0OA 3HRBA 4BTKA 3F6XA 4EKLA 5HICA 1ND4A 4FKOA 2VUWA 1X8BA 2YEXA 3H9OA 4KS7A 2Q0NA 2XMYA 3QQKA 3EMGA 5A3XA 1YOJA 2J4ZA 3EHAA 3GC0A 3GOKA 4F09A 3VBVA 4FKUA 4YUQA 2HZ0A 4RQKA 2PWLA 1A48A 4IX6A 4G9RA 2IZTA 4QTBA 5IQBA 5CI7A 2P55A 4EBVA 3RPYA 4WT6A 5DWRA 3U55A 4B99A 4M12A 1OPKA 1SZMA 3WE4A 3VNTA 3Q2JA 3EQIA 5FP6A 1GZOA 3GC9A 2XNNA 3Q9WA 3SA0A 5IQIA 1MRVA 2JDRA 5CEKA 3B8RA 4BR3A 4YPSA 4U42A 2WMVA 5LMAA 3D5XA 4CCUA 1PYXA 3EFJA 3VBWA 2CGWA 2G1TA 4DFZE 3KA0A 4J98A 5C8NA 2YIYA 4XV9A 4GFGA 4O86A 5IA2A 2UZWE 1NVSA 3BLHA 3I0OA 4U3ZA 3Q60A 4GJ3A 5TO8A 2BR1A 2XK3A 2F57A 3KXGA 4RWIA 2J5EA 2VTJA 4LL5A 1IA8A 2B52A 2FVDA 2ZM1A 4JR7A 2ZOQA 3PJCA 4IMYA 4NTTA 5DT3A 3T9TA 5HO7A 3ZONA 2JDTA 5F95A 4ASZA 4PNIA 3LZBA 3OP5A 3L9PA 4GIHA 2I0EA 3SX9A 2VTIA 4NM7A 2J2IB 4ITJA 2JDOA 4O7ZA 2JGZA 1PMEA 2OSCA 2C5VA 1UKHA 1K9AA 4C4IA 5CQWA 5DI1A 2IW8A 5CASA 2UZVA 5HO6A 3GC8A 2KTYA 4RIXA 4YZBA 3PJ3A 3RAWA 2A19B 2ITNA 2OZOA 4EOQA 1ZZLA 1F5QA 4UMPA 2ITWA 4I6BA 5CSPA 4U3YA 3DBFA 4DH5A 2ZVAA 2ITOA 5A6OA 1KE7A 1GZ8A 4X3FB 4AZTA 3C4FA 2HZIA 2AC5A 3L9NA 4ZSLA 5AV2A 5AV0A 5H8EA 2YCSA 1KUTA 4YSMA 2W06A 5E90A 4CRLA 3NYOA 4Z9LA 4E73A 2J0KA 5HD4A 4GG5A 4FTLA 3O8PA 4ZXTA 4D1XA 2QODA 5J5SA 3AC8A 2YCRA 3OBGA 1GIJA 3DKOA 3HV3A 3NUNA 4IX3A 5I5ZA 1REKA 4XP0A 1OKWA 3UVPA 3O51A 4RA5A 2GCDA 1OBDA 4D4SA 3FC2A 5T68A 4FC0A 3FWQA 4S31A 4RVMA 3BHHA 2XIKA 3NW7A 3VS3A 3KMUA 4N6YA 4MWHA 3IG7A 4U41A 3DBQA 1YI3A 4EOOA 4YLKA 5BVOA 3WZJA 4O7NA 2W4KA 2QR7A 4FTUA 3C4XA 3K3IA 4EK8A 2J0JA 3HZTA 1SVGA 1Y8GA 4X6QC 4BCFA 5I3OA 4DE4A 4RJ3A 3MWUA 2QOOA 2UZDA 2R3FA 3EQBA 4JG8A 2WTJA 4J1RA 5CWZA 2JDVA 3G5DA 4RFMA 3RALA 2BRGA 2Q83A 3LMIA 1YVJA 3BBWA 4IH8A 4YLJA 3V8SA 1OUKA 5F94A 4BDEA 3UO4A 2XP2A 3NW6A 4BCPA 3Q32A 4WOVA 2JBPA 4UALA 1A9UA 1WBSA 4BTMA 5IQEA 3L9MA 2R3NA 4WO5A 2PVLA 3TIYA 2IZRA 3C50A 2PUUA 4QQCA 3OOMA 4FEWA 3LJ0A 4UYAA 3DA6A 4ZZMA 4XG6A 5IQHA 5A46A 4EJ7A 2J0IA 4UWCA 5J79A 5ETAA 2GU8A 4O1OA 4CYJA 5KBQA 3BGQA 4GMYA 4GU6A 4XBRA 3TNIA 3U9NA 2OF2A 3C5UA 2OFUA 3F88A 4NFNA 2OXYA 2WD1A 3UP7A 3W2QA 4BTFA 5HZNA 2X8EA 2GFSA 4PDOA 5CAPA 1H01A 3ORLA 3AOXA 4D28A 5HX8A 4BRXA 3QXOA 3MW1A 4AN3A 3HA8A 3WF8A 3W2RA 4AZVA 3UNZA 3DQXA 1OL5A 1OPJA 4F0GA 4R1VA 1JOWB 3D83A 1PMNA 1UNHA 4AAAA 1Z57A 3JYAA 4FYNA 4RJ5A 4O21A 1P5EA 4IANA 3VS7A 3ORIA 2VRXA 5LVPA 4FKVA 5EDQA 1ZMWA 5KZIA 3FDNA 2BAQA 4FIJA 3BYSA 3EB0A 2AUHA 3R2BA 2CJMA 4TWPA 2B9JA 2O0UA 4FUYA 3WZEA 3ZSGA 3H4JA 2WNTA 4FX3A 3MVMA 4RJ8A 5I9ZA 4FV3A 4DG0E 2J6MA 4NM5A 4FKIA 3KMMA 1JSTA 2XBAA 2QOKA 5TF9A 4EHEA 4FTCA 2XNPA 3KQ7A 5AWMA 2JAMA 3EL7A 1APME 4QT1A 5ANOA 2JD5A 1SYKA 3MH2A 4CFVA 1YI6A 3ZUTA 2CMWA 5G6VA 3BLQA 4QTDA 3RCJA 2XB7A 5IEXA 1R0EA 3DK3A 4FTNA 3AMYA 2BZKB 3SC1A 3F7ZA 4N0SA 3KCKA 3VHEA 5E8TA 3MGYA 2Z60A 1DM2A 3AC4A 4JIKA 4YZDA 2YAKA 3HDMA 3QCQA 2XZSA 3LFCA 4FNXA 4PL4A 4CKJA 3AT2A 4RIYB 2VWWA 3MH0A 4FEUA 3DCVA 4DLJA 3WI6A 4BDGA 4LRJA 2VTRA 2WMRA 1JKLA 3CIKA 3FKOA 4LQMA 5FRIA 3UYSA 5CTPA 4U9AA 2C3IB 2BCJA 4L01A 4YZCA 5FXRA 5HU9A 5TOZA 2WPAA 4U97A 2UW4A 3FYJX 2QOQA 3VUDA 5KMKA 1JPAA 1L3RE 3QTIA 1ZZ2A 1U54A 5AUUA 5A4LA 4HGTA 1TKIA 4AE9A 5CAVA 2QNJA 5LMKA 2FB8A 5DA3A 4IQ6A 4A4XA 4CXAA 2FGIA 3TV7A 3A99A 4JDHA 1FOTA 4PMTA 3W8QA 3BV2A 3VC4A 4ZLOA 3WF9A 2R3HA 4ZLZA 2PVFA 3CY3A 3EN4A 3LFBA 3RNIA 1HCKA 4IE9A 4RWJA 2OJIA 2B55A 3H0YA 3H10A 1LP4A 4FV7A 4O6EA 4QP2A 3RP9A 5L6WL 4BIEA 3LCDA 3UJGA 4E5AX 3GFEA 4W4VA 3ALOA 5CLPA 3ZCLA 5M4UA 4DINA 4BGHA 3U54A 1H08A 3N9XA 4YJSA 4R77A 3RK7A 4J53A 4C57A 4TYHB 4B9DA 3V51A 5AUXA 2BRNA 2YIXA 4IWPA 4O27B 2JC6A 3SHEA 2YM6A 2WTIA 3ZLXA 4FIIA 5KHWA 3U6IA 4MCVA 5F9EA 3F3WA 3RCDA 4E6CA 4YJPA 3MPMA 4NW6A 2PMIA 2PSQA 2UVYA 4IM2A 3ANRA 3BYUA 4FV2A 4CQEA 3ZEWA 5KX8A 4KSPA 3QGWA 2WMBA 4OT6A 4KIQA 3Q04A 4YHJA 4ERKA 2FSMX 2OU7A 4Y5QA 3ETAA 3LOKA 4AOIA 2WTWA 1M7QA 3F66A 3FHIA 3OWLA 4XV1A 2GHLA 5EW3A 3KC3A 3IDCA 4CLIA 1WZYA 3QZGA 2WIHA 3HMNA 4OLIA 3F3VA 4ZSJA 2C5XA 2VTTA 3V5TA 4G31A 3KEXA 3LCKA 4FICA 3R22A 2XEZA 4NIFA 2CKQA 4G6LA 4YBKA 3QD4A 4M13A 4MD9E 5K5XA 4D0WA 3H0ZA 4XG4A 4KSQA 4J99A 4KAOA 5A6NA 3ZOSA 2JEDA 2QC6A 4UEUA 4CRSA 4MH7A 4BFMA 2WU6A 1PKGA 5D9HA 1Y57A 3OW4A 4NWMA 4R8QA 3RINA 4EUTA 3R8LA 3LFEA 3IS5A 1UNGA 4AUAA 2IWIA 3IPHA 3P78A 2PMLX 5M56A 4YJQA 2W4JA 3ZXTA 4BDHA 3ZBXA 4GH2A 3GU5A 1IRKA 4R7BA 4QTEA 2GNIA 3R7VA 5FBNC 3ZDUA 5JGAA 1OL7A 1R78A 2G15A 4GYIA 3EWHA 3ORNA 4DH1A 3EFLA 3SG9A 1OIRA 1W8CA 2QOBA 4XNEA 1MQ4A 2Y7JA 1W82A 3VS1A 1CKPA 1ZYCA 3FL4A 3KRJA 2W1GA 5ANGA 4BBMA 5CAQA 3BEGA 5ETFA 4QQJA 3O7LB 4MF1A 4P5QA 3RPVA 3BPRA 4JJRA 2O63A 3PZEA 2QONA 4QOXA 2YCFA 2E9PA 1WMKA 1Q97A 4IM3A 3QUDA 2Y9QA 1H26A 2CN8A 3PZHA 4FTKA 1Y8YA 3R9HA 4ZZOA 5L4QA 4X2FA 3U8WA 4L7FA 3VBTA 3DTWA 4I21A 4M0YA 4BKYA 1PXMA 5F4NA 2X7FA 4TRLA 2RFNA 2VN9A 3ULIA 3VUHA 4UXLA 1VR2A 2X6DA 3HNGA 4XG2A 5KMNA 4C02A 2CKPA 2VTAA 1XKKA 4X21A 1ATPE 2BZIB 3Q5ZA 4XRLA 5L8LA 1OPLA 3R00A 2R0IA 3FMJA 4IZYA 4O0YA 3PXFA 4NSTA 5FGKA 3JVRA 5B2LA 3AG9A 3HMMA 3P7CA 4H3PA 3HP2A 3U4WA 3JPVA 5HLWA 4W9WA 4IC7A 3QRTA 4L3LA 4KD1A 5E8VA 3A4OX 3BGPA 3W2CA 5JFVA 3TCPA 2XBJA 4LYNA 4EC8A 5FXSA 2W1FA 3ACKA 1Q61A 2E2BA 2WQNA 3Q9ZA 1W98A 5IMXA 2R3GA 3U6HA 3OT3A 3ZO4A 4YPDA 5EHLA 2VX1A 2XNOA 3FI2A 3OC1A 3EN9A 4ONAA 5CNNA 4YR8A 2DYLA 5HCYA 3RAHA 4QNAA 5A14A 3HVCA 2R64A 4LUDA 4O6LA 5E8UA 4B4LA 4DCAA 4RVTA 4UMRA 5JFXA 3TJDA 2BFXA 4F1OA 4JDJA 2C6IA 4XMOA 3LFAA 5JN2A 4QQTA 3OD6X 4EWHA 3BZ3A 4YZMA 3CPCA 3A7FA 2F7EE 4RIWB 3RPRA 1H28A 1V1KA 3QKLA 3OZ6A 5EYCA 3R7YA 3F5UA 4N6ZA 4MD7E 4ALWA 2PPQA 2QU5A 4HNFA 1FVTA 2RFEA 3A8XA 3P86A 3E8NA 4M0ZA 4QMUA 1XH9A 3QBNA 4MXYA 3MN3A 2GNFA 4FSMA 4K8AA 3OOGA 3NX8A 2GNGA 3D4QA 4DTBA 4M69B 2HIWA 4EJNA 5LVNA 3Q4UA 5L6PA 2R3RA 3HV5A 5CT7A 4EH6A 3V04A 2QOHA 3BQCA 2R7BA 5HE1A 3KK8A 5ANKA 5IKWA 3RM7A 3OVVA 3A62A 1UV5A 3W33A 1ZWSA 5E91A 4TNDA 1IA9A 3PFQA 4PDSA 5EI8A 4QP1A 5AP0A 4M66A 5DEYA 1J7LA 4L44A 4PNKA 3IONA 4HW7A 1IG1A 3KMWA 5CI6A 1RQQA 3DGKA 4EQCA 3AD5A 5JT2A 4F70A 3F61A 4IVDA 3FI8A 1NA7A 3Q4TA 4CTBA 3KXNA 2ZB0A 3O8TA 2QHMA 2JKMA 4XEYA 4X3JA 5HBEA 2XEYA 5IZFA 4FL1A 1GJOA 3QYWA 1P4FA 4G6NA 4YURA 3QL8A 3CKWA 4BZOA 2X7OA 5AUTA 5KO1A 3UVRA 4ZTMA 1YDSE 2C6KA 3FY2A 3O8UA 2OO8X 4IC8A 5ANJA 2I0HA 2BZJA 1V0OA 3F5XA 3ID6C 4EK6A 1ZOEA 2ESMA 3KN6A 4CLJA 3KXXA 5JGBA 3KREA 4FF8A 4S33A 3UMWA 5BQ0A 3I4BA 5KCVA 2YHVA 5ACBC 5FTOA 4A9YA 4EK5A 1OKVA 3PA4A 5DPVA 2SRCA 3MBLA 4G3DA 4C33A 4ZIMA 3R7GA 3FHRA 4K11A 5HTIA 5TKDA 2O2UA 2W5AA 3KB7A 3NUUA 5J9ZA 3OWPA 4FIGA 1XWSA 3GCVA 3VW8A 3CGOA 4M7IA 4BKZA 2YIRA 4QMMA 3ALNA 2OLCA 3FLZA 1XH6A 2W17A 4KIKA 4L45A 2W1CA 3CD8A 1R3CA 3OUKA 4NYEA 2PHKA 1ZXEA 4L9IA 2XS0A 3E3PA 2X8IA 2Y4PA 3JS2A 2PMNX 4HPTE 5E8YA 3BWJA 2IW6A 1YOLA 3HP5A 2C3LA 4O96A 4E20A 4I22A 3MPTA 4PTCA 3R9NA 4O83A 1V0BA 4XHKB 5EKNA 4AE6A 4QMOA 3QTSA 4MBIA 4ZJJA 2IVSA 3ZFXA 3F5PA 4EWQA 2UW7A 1MRYA 3I6WA 3OEZA 5AIRA 2PVNA 5E8ZA 1RE8A 2BFYA 3PXQA 5K9IA 4GG7A 1W0XC 1XBBA 5L8JA 2HW6A 4F9AA 4XOYA 5IQFA 2B54A 2YDKA 3NIEA 3DNEA 4FTJA 5AR4A 3HV7A 4Y83A 4RSSA 1DI8A 1H07A 4E6AA 1YWNA 4RX7A 2ITUA 1OL6A 3E93A 4EHZA 3HL7A 4H58A 2YM8A 3O23A 4AXAA 4DFYA 2OIBA 2GS6A 4PPAA 4L3PA 3NR9A 4ERWA 2OI4X 3UTOA 2WTVA 3GOPA 5E9EA 1UWJA 3WE8A 3ZU7A 4FSUA 5A4CA 2WZJA 5K4JA 2X2LA 3EQRA 4EQUA 2W7XA 3BI6A 3FQSA 3UIBA 3EFWA 4ANQA 3AGLA 3LXNA 5K0XA 3PVWA 3FEGA 3R9RA 2PVKA 3ENHA 4I5MA 3W16A 3V8TA 3PXZA 1ERKA 1O6YA 3DBEA 4USEA 3CR0A 2JKQA 4L3JA 3AC3A 5IDPA 3S1HA 3LJ2A 4W9XA 5J95A 4L00A 1YI4A 2B7AA 2PTKA 2RL5A 3OCBA 4BC6A 4BKJA 3QX4A 3WARA 5KMIA 4ZK5A 3ROYA 1STCE 2VWVA 4NL0A 4AQCA 3NNXA 4JQ8A 4YZ9A 4DN5A 4J8NA 4A9UA 5GINE 1QPEA 5J9YA 1URWA 4DGGA 4EKKA 5HIDA 3O71A 3EJ1A 3NYVA 4U81A 3UE4A 3UGCA 2ONLA 1H8FA 2PVHA 4F1TA 2FSTX 4QP7A 3NDMA 3MJ1A 5HCZA 4E6DA 3QRUA 4LGHA 5HU3A 2YZAA 3N4UA 3MFUA 2YLFA 2A1AB 5CALA 3FMKA 2EB3A 3L9LA 4X2KA 3SOAA 5EH0A 3ZHPC 3I6UA 4TWNA 3R7IA 4C2VA 3EQGA 2YM4A 3W2PA 3JUHA 2GS2A 5DVRA 5J1WA 4QP6A 1OMWA 3CJGA 3E62A 3EN7A 4FGBA 4F64A 3EN5A 4RT7A 5LXMA 3EQDA 4FT9A 5AUYA 2EWAA 3R8ZA 4FIHA 3D7TB 4F65A 5KE0A 4BWXA 5BX0A 4JX3A 3RGFA 1YQJA 4OBQA 4ZTRA 3C1XA 4WD5A 4KA3A 5LMKC 4UX9A 3PE1A 1M2QA 5CU2A 4BCGA 2YWVA 2EVAA 1UU3A 4RLKA 5IA5A 4AACA 4IVCA 5H9BA 4MX9A 2VTMA 2ETKA 5AADA 4D9TA 3SXSA 5CS6A 3BHYA 2OICA 5JKGA 4JRNA 4OTDA 3TV6A 1KE9A 4D1ZA 4PY1A 1Q5KA 4IDTA 4BCQA 2JIVA 3LFNA 4PWNA 3GBZA 2PZ5A 4KBKA 4ZJIA 4J95A 4RX9A 4O7WA 4O22A 5FBOA 4AA0A 3FI3A 4EOSA 4BDIA 2BKKA 3CY2A 3UMXA 3R8VA 4B8LA 2E9OA 4QMNA 4K0YA 4RC2A 4XUFA 5A9UA 4JI9A 5J1VA 3C13A 1W84A 3AD6A 3UVQA 4MWIA 2F4JA 4DEDA 2DS1A 2X8DA 2WMSA 4K9YA 3RI1A 5A4QA 3UQFA 4NJ3A 3FLYA 3BHVA 3UO5A 2PYWA 4HYSA 1JSVA 2VGOA 4DCEA 4HZRA 1QMZA 4XV2A 5L6OA 4UXQA 4FKWA 2BAKA 1JNKA 5IU2A 3W2SA 4C0TA 3KGAA 3G0EA 5J5TA 2OJFE 4F63A 3OCTA 3BYVA 2RIOA 4ZSAA 1OIQA 4WG3A 4YTFA 2XK9A 5D12A 4ZJVA 4O7TA 4UMTA 2UZOA 3ZC6A 5CANA 3BCEA 4FV0A 2OWBA 2OH4A 2R3OA 3ACJA 4QYGA 5HG7A 2ZMCA 2QI8A 4USDA 3VJOA 3WZKA 3ZLYA 5M53A 3MY5A 3DKFA 4QQ5A 2VTSA 3JXWA 5EFQA 2OXDA 2C5NA 1PXJA 4AT4A 4KKEA 4V0GA 3DJ6A 3KK9A 1ZYLA 3MVJA 4YJVA 3T8OA 1SM2A 2G2HA 2XNMA 2C3JA 5DLSA 2WMQA 3FZPA 3PTGA 4O7RA 2VWYA 4I5HA 2R0UA 3G2FA 4HYUA 4QMLA 4NKSA 2O64A 2BALA 2R4BA 2B0QA 4R3RA 3R1YA 4C36A 3NUAA 3AT3A 1XH8A 4YTIA 5M4CA 2GS7A 3HMIA 4NUSA 1H1WA 3R28A 5CU6A 3IK3A 4CZTA 3PLAE 4AW0A 4I41A 4QRCA 4YTCA 3CQEA 1WBOA 5GJFA 3ZO1A 4ZMEA 3GCQA 3MFRA 4BCKA 2C0OA 3GI3A 4JAJA 5AV3A 3POOA 2HOGA 5C4KA 4ZP5A 2YABA 4O82A 3PYYA 5CSVA 5CAUA 4AFEA 2J9MA 2CCIA 2XVDA 1UKIA 3F3TA 3BKBA 3IKAA 1AQ1A 1DS5A 5KMJA 2QG7A 4CKIA 4MNEA 2H9VA 2WEVA 3QU0A 1ZY5A 3WF7A 2B9IA 1Q8ZA 3DB6A 3EL8A 3ZXZA 4FG8A 4F7SA 3TUCA 3KN5A 3KVWA 5ICPA 5EM7A 3COIA 4HYHA 4OR5A 4DITA 4XLIA 5E8XA 1CM8A 4MVFA 4P4CA 5AR2A 3V5JA 4TL0A 4CMUA 3HMPA 4F6SA 3NCZA 5CZIA 4IAKA 4TW9A 3EQPA 2J50A 3KCFA 4UZHA 5JFSA 3CJFA 2XIRA 4O0RA 3QZHA 3K2LA 2ZV9A 4TY1A 3ORKA 4G3FA 2EU9A 2A2AA 3VUGA 4DH3A 4HCTA 4CG8A 2UUEA 4MKCA 2R3QA 3F7WA 2W0JA 2ACXA 5HNBA 2YA9A 2QO9A 3GC7A 2Y4IC 2X4ZA 2F2CB 2JFMA 4IM0A 4C59A 5JZJA 3UOJA 4LI5A 5FQDC 3D9VA 4KUJA 4BICA 4XH6A 1PRYA 3NZ0A 3ZO2A 4PMPA 2RGPA 5K0KA 2CLXA 3VF8A 4BBEA 4BIDA 3TTIA 1L8TA 4P7EA 1KWPA 4DTKA 3OCSA 4RJ4A 1Y91A 4OTFA 5DOSA 3TI1A 3QWJA 2J0MB 3I7BA 3KY2A 2Z7QA 2G01A 4N70A 4ALUA 4EOLA 1XBCA 3UQGA 2XNEA 1OVEA 4HJOA 4ACGA 4AZEA 1JVPP 3FUPA 4HCVA 3OROA 3HRFA 4R3CA 4G34A 5EM6A 5JRSA 3RKBA 4E6QA 4E4NA 4IB1A 4NJDA 4E3CA 4LL0A 3DU8A 5HORA 4JOAA 1DI9A 4C3RA 5EQYA 3E88A 4ACMA 5BUJA 3NUSA 5CU3A 5LJJA 4LRMA 2UW3A 3JY0A 4U0IA 4J8MA 2OJJA 3QRIA 3DNDA 3I1AA 4CMTA 5DFPA 4RFZA 4BVUA 4MBJA 5IF1A 3QKMA 3LVPA 5EM5A 1B39A 4U7ZA 4A4LA 3PSCA 3OFMA 2HY81 3D5UA 5I9VA 2ITQA 4M68A 3R8UA 1OKYA 4JQ7A 2UZLA 4C4HA 4LMUA 1OI9A 4FTTA 4O7LA 4JXFA 3HMOA 4DAWA 3QA8A 4L42A 4M8TA 4M3QA 2IVVA 3C0IA 4C61A 3ZO3A 2FYSA 1FINA 5CF6A 3DXQA 3C4WA 5I9YA 4QP9A 3VS0A 3O50A 4ACDA 4DC2A 4RVLA 1KOAA 3CTQA 4WSQA 4PTEA 1BKXA 3NNUA 5AR3A 3A4PA 3BE2A 4TYEA 4JQEA 4B7TA 4BDFA 4DEIA 5EM8A 2C68A 2QU6A 1JKKA 2I40A 4FSWA 4K2RA 4P2KA 3S95A 4F0FA 4FNWA 3R73A 1LUFA 4MXZA 4NH1A 4F0IA 1UA2A 2GSFA 3UO6A 2R3LA 3QQLA 2JIUA 4LOQA 5KBRA 4PP7A 5HBHA 2GQRA 4BCHA 3SGCA 1XH4A 3CKXA 4ANOA 4RWKA 2BRBA 2GDOA 4YGAA 4C62A 4BHNA 1XO2B 1OECA 4HVSA 1G8AA 4BY9E 3R9OA 1RDQE 4C8BA 4QYEA 3RTPA 4YC3A 4F9YA 2VTQA 4LRKA 4FV5A 4AT3A 3UG2A 5L2IA 5AR5A 1GY3A 2UW5A 4CTCA 3VULA 1FGIA 3ANQA 1F3MC 4RIXB 4KABA 2IJMA 4FV6A 3MI9A 3PSDA 2O5KA 3EZVA 2A0CX 4QMSA 2Z8CA 4IIRA 1ZAOA 3ORPA 1VYWA 2PE2A 3QXPA 4OTGA 5GNKA 4M15A 4BB4A 5CEMA 4FT5A 3I79A 3D15A 2G2FA 1FBNA 4XG8A 2ZM3A 3PP1A 2I0VA 2KULA 4IX5A 5CENA 3IW6A 1GZKA 2Y0AA 1IAHA 4ZTLA 4JIAA 4IJPA 3W55A 4EOPA 4EOMA 1PXLA 3EIDA 1Z9XA 2QOIA 5JEBA 4IVAA 3DY7A 4WUAA 4JL9A 4DHFA 5M51A 4QPSA 3GCSA 1O9UA 4JBVA 4LMNA 2W1DA 4ZMFA 4EUUA 3ZMMA 4RBLA 3UODA 3V3VA 3A7IA 1E1VA 4FSYA 4AOJA 3VQUA 5AAEA 5CEPA 3TZ7A 4KBCA 4CKRA 1V0PA 3EQHA 2JBOA 4JG7A 5G1XA 4FT3A 5A54A 2BTRA 2ZDTA 4FV8A 5AAFA 2PVJA 4C38A 5FTQA 4CG9A 3NSZA 4RJ6A 4U79A 2QURA 3HUBA 3IOKA 3NCGA 3F2RA 4FZAB 4F7NA 3P5KA 4V05A 3FI4A 5HG5A 3EQCA 2YJRA 3GU6A 4M84A 3R04A 4YNEA 3TXOA 3POZA 3RMFA 4EZ3A 5BMSA 2J7TA 2H8HA 5D11A 4IAFA 5BYLA 3ZH8A 4GT4A 4D2VA 2ZDUA 3EFKA 4MBLA 1VEBA 3BELA 4A9TA 4AOTA 3F5GA 4XRJA 2C30A 4JX7A 5AM6A 5BMMA 4Z55A 4R3PA 4HYIA 4S34A 3RM6A 2I0YA 1XBAA 4MTAA 5CEIA 3CE3A 2VX0A 5BNJA 2NPQA 2WXVA 3NRMA 4H36A 5L2QA 2C1AA 4ITIA 1M14A 3CXWA 4KKHA 4FZDB 3EYGA 2VTHA 3UOKA 5J8IA 4MNFA 5KKRB 5KMMA 3LJ1A 4WG5A 3DPKA 3CC6A 2P4IA 2RF9A 3TZ8A 1U5QA 4BDAA 3M42A 2QKRA 4IHPA 3PY3A 5AX3A 2BPMA 2DWBA 1PW2A 2ONLC 4BCMA 1REJA 5CT0A 5FEEA 3HECA 3HAMA 4FODA 3AD4A 3NYNA 4G17A 4OBOA 3MESA 4WBOA 4MXAA 3EOCA 4DBNA 3AT4A 2B9HA 4RIWA 4XG7A 4YC8A 4CVAA 2WKMA 3HYHA 2PL0A 3QX2A 1J7UA 3PWDA 1JAMA 3HAVA 4NM0A 4GW8A 4GSBA 4FSTA 4LGGA 4NCTA 3T3UA 4BCIA 3KXHA 3CTHA 1SVEA 4FEXA 3CS9A 4NTSA 3ATTA 5LCKA 5HESA 3PVUA 3CP9A 1PXNA 1H1QA 2XYUA 5I9UA 4OT5A 4PP9A 5IEYA 4FSNA 2ERZE 4KS8A 1PJKA 3PSBA 1OBGA 4AP7A 4HVDA 4GCJA 3WYXA 1I44A 3DV3A 2Z7RA 3TDVA 2R2PA 4G1WA 4PMSA 4O7SA 2X6EA 2VGPA 3CGFA 3ELJA 3SDJA 3E7OA 5DEWA 4XYFA 2I7QA 3R8MA 2OH0E 1FMOE 2X2KA 4G3EA 2C6OA 3GP0A 3R1NA 5ANIA 4IX4A 1KSWA 4BTJA 5HOAA 5E4HA 4MEDA 5DIAA 5IPJA 2BTSA 2BDFA 4MQ1A 5HIEA 3TL8A 2YISA 3I60A 2WQOA 2W96B 1NVRA 4YC6A 3QC4A 5C9CA 2W05A 4J7BA 2GNLA 2QOCA 2HZNA 4CFNA 4EH4A 5BVEA 1SNXA 3IW7A 2QQ7A 2XJ0A 3FZSA 3PRIA 5EW9A 2EXEA 4A9RA 2WQEA 3PG1A 2A27A 4YBJA 4DFLA 3GU8A 2XK7A 4BCOA 2E9UA 2IVTA 1FMKA 3FL5A 2VO7A 3LPBA 3P79A 2C5YA 3MB7A 3BWFA 3REPA 5ACKA 4ZLYA 3Q5IA 4WNOA 3LLTA 4OTPA 2QKWB 3RHKA 4BZDA 3H9RA 4FTMA 4FZ7A 3DFCB 4I6FA 4JNWA 4FSRA 4DH7A 4AA4A 1IASA 4ZAUA 2PY3A 4TPTA 4AW2A 4EOKA 1YWVA 5A4TA 5CXZA 2G2IA 3SRVA 3ZZWA 4DEHA 3FQEA 5IA4A 4UWBA 5AV4A 3PDTA 2X9FA 4YJUA 2O3PA 4FKSA 4IXPA 5JSMA 4EC9A 5KNJA 2ITXA 2BIYA 2JKKA 3NMUF 3OXIA 3GU4A 1FVRA 1H4LA 4U80A 1YWRA 2WMWA 5KHXA 3AMAA 1OIUA 4WRGA 4DYMA 4RX5A 2QOFA 4FSZA 5HNGA 1Q41A 2QR8A 4O2PA 5ETIA 3WBLA 5BVNA 1PXIA 2VWUA 5JFWA 2B9FA 5HI2A 3DDQA 5BUEA 2R7IA 3MJ2A 3R7UA 4C4GA 2WFYA 4IWQA 3LXLA 5DNRA 3Q3BA 3QQHA 4MHAA 4O0TA 2QVSE 4CT1A 1G8SA 4BDKA 4YJOA 4E93A 2WTKC 2FSLX 4BYJA 3RWPA 1ZYDA 4H1MA 3R1SA 2UW6A 4ZY5A 3NS9A 3CEKA 4F9CA 5AEPA 3GQIA 5IQCA 2YIQA 3MDYA 3GGFA 2C6EA 3VS4A 4ZS4A 4PTGA 3KXZA 4L6QA 4JS8A 4B0GA 2C0TA 4Q9SA 3B2TA 4Z16A 3NYXA 3OS3A 4D4VA 4PDPA 3FMHA 5E8SA 3A60A 4KB8A 4NIFB 5EOBA 4U8ZA 3NAXA 3FLQA 3Q9YA 4KBAA 2J51A 4JDIA 4YTHA 2HXQA 1MUOA 5IA1A 3SW7A 4O7YA 3CQUA 5IQDA 4IAZA 3D5VA 5AUWA 1PKDA 3DBCA 2QHNA 2PZPA 4FTQA 5GZ8A 4UMQA 4F6UA 2LGCA 4IDVA 2WQMA 3L8SA 3R7EA 2VNWA 4GKIA 5EQEA 5AIKA 2CPKE 3CTJA 2CNVA 4E5BA 2XIYA 4FV1A 4S32A 4IEBA 4F7LA 1PXPA 3BX5A 4FTRA 2F7ZE 3QQFA 3A2CA 4F1MA 4N57A 3ZTXA 5AP5A 3F2AA 4CFXA 5AP3A 1FVVA 3VS2A 4U40A 5CVHA 1YXTA 3B2WA 1LEZA 3II5A 4APCA 3PJ1A 2UW0A 3C4ZA 4I5PA 2BUJA 3N4TA 3E5AA 5FG8A 4FKGA 1WBVA 4MAOA 3THBA 4ASEA 2F9GA 5CF8A 5DG5A 2ETMA 3MIAA 3D2IA 2DUVA 3ROCA 1ZMUA 1OL2A 3BIZA 3VUMA 3F69A 4QMZA 3ZUVA 5IMEA 4DF3A 2BDJA 4RPVA 3WYYA 3OBJA 3FAAA 5E7RA 4RGJA 4XG9A 2P2HA 3HLLA 5ANDA 2Z7SA 3FLWA 3JY9A 2XIXA 1KV1A 3FPQA 3BRBA 3GCUA 5M09A 2R3MA 4ZY4A 2NRYA 2VD5A 3MFTA 1Q8TA 1URCA 3RK9A 2UZTA 4PL5A 4G3GA 2Y6MA 4I24A 1XJDA 2OF4A 3FY0A 4QO9A 4CNHA 4Z7HA 5DN3A 4TYIA 2WGJA 4FA2A 3B8QA 4ASDA 2XNGA 2PVYA 3PG3A 3ZYAA 4GT3A 3OF0A 1BYGA 2IN6A 5IA3A 2YWPA 4GVAA 3TJCA 3D7TA 3RBWA 2QD9A 5CSHA 4K6ZA 2QG5A 2W9ZB 4RRVA 5BUIA 4HZSA 4OAUC 2YDIA 2JFLA 3W1FA 4IB0A 4XCUA 4TYJA 4YO4A 3SVVA 2OG8A 3Q53A 4FVPA 4P90A 4RA4A 3DQWA 2Z7LA 1H1SA 2OZAB 4OTHA 2C6DA 2H34A 2WU7A 4YNOA 4D55A 5D1JA 4YZNA 1I09A 2Y4IB 3R2YA 3S4QA 3TM0A 4LV8A 2C5OA 4PPBA 1H24A 3QF9A 1YDTE 2BAJA 5C1QB 3HKOA 3CQWA 4JT3A 4K33A 4MD8E 4ZSGA 4BDCA 4ENYA 3ZEPA 4RFYA 2HY0A 3FMLA 2H96A 2YM5A 4GK4A 4HGLA 5TE0A 5IH4A 3OCGA 5AP6A 5HIBA 3LCOA 4TWCA 1KE8A 1VJYA 5JQ5A 4WA9A 2X0GA 2RG6A 5DBXA 4KIOA 3MH3A 4YJNA 4FKQA 5L3AA 1CKIA 1A06A 3E64A 1OITA 2P0CA 3QUPA 5DGZA 4BIBA 3CBLA 4MQ2A 3E7VA 1ZARA 4X2GA 5IISA 3QCYA 4BCNA 2I6LA 5E1SA 2W5BA 5DT4A 3GVUA 4EH5A 4OTRA 2E9VA 3IECA 1LPUA 2J5FA 5LWNA 1Q3WA 3IGOA 5AMNA 1T46A 4IFGA 2VO3A 3OXTA 1ZYSA 3EZRA 4MK0A 4X7QA 5DE2A 2HYYA 4Y73A 5AA9A 3A61A 3ENMA 4FTOA 3LE6A 2ERKA 2XKDA 1GAGA 2BRMA 1YHSA 2JITA 3G33A 4U45A 3NEWA 5AUZA 4C7TA 4FUXA 3LXPA 3D0EA 3MV5A 4H3BA 3Q6WA 1Q3DA 4BDJA 3DK6A 1PY5A 4D2RA 1WAKA 3PP0A 3PUPA 3G51A 3FMEA 2HCKA 4OUCA 4FT7A 4Y95A 3UIXA 4BZNA 3HV6A 4GS6A 2Q0BA 2V7OA 3EQFA 3TWJA 2BKZA 3KKVA 3OMVA 1RW8A 3I5NA 4FV4A 5IG1A 2C3KA 4Q9ZA 1AGWA 1CDKA 4I4FA 1H25A 3OG7A 4K1BA 3WF5A 3HX4A 4CV8A 5E8WA 3MVHA 1KOBA 5EYKA 5B2MA 2VWZA 3M1SA 4WHZA 3KRWA 4DBXA 3WIKA 4FVQA 3BGZA 4FZ6A 3C4CA 5FXQA 4LOPA 4Q5HA 2F2UA 4M67A 5CVFA 3TIZA 3GB2A 4X2NA 4EK4A 2ZB1A 5KMLA 4HNIA 4ZZNA 1OUYA 5C8KA 3SAYA 3FQHA 3DS6A 4AN9A 3DJ5A 3FXZA 4KKGA 5EKOA 1UWHA 5IUIA 3KXMA 5M55A 4DFBA 4E26A 3ODZX 4ANBA 1UU9A 3R9DA 3UZTA 1W83A 4CMOA 5M4IA 4L52A 2R3PA 4GT5A 1PXKA 4A9SA 4I0RA 5E92A 5CF4A 3SG8A 4AZWA 3LMGA 1U4DA 4W8EA 4ZSEA 2C4GA 4ANNA 3PPKA 2GHGA 2OIDA 4A7CA 2WQBA 3LIJA 2XF0A 3UPZA 3NW5A 5C4LA 3U9CA 4DT9A 5CQUA 4BCJA 4DG3E 4EONA 4KIKB 4A06A 3QYZA 4X3FA 1BMKA 4CV9A 5HTBA 2UZBA 3V6RA 2YDJA 4RC3A 4UYNA 2XK4A 4TN6A 1UNLA 2HWOA 3DT1A 3RPOA 1J7IA 4R78A 2F49A 3U87A 3UP2A 3PRFA 3P0MA 4TT7A 5JK3A 3RAKA 4JBQA 3SXFA 3TDWA 4UWYA 4NKAA 1H0WA 4ACCA 4ITHA 5CYIA 4QMWA 2P33A 3I81A 5IH5A 4FI1A 2DQ7X 4R5YA 4IZAA 4RJ7A 3FKNA 4TWOA 5J7BA 3CSVA 2C47A 2V0DA 2J90A 4X6RA 3SLSA 3V5LA 3O17A 3VUIA 1H00A 4FE2A 5EI2A 5JZNA 1HOWA 2E9NA 2YCQA 3PXKA 2UZUE 5JH6A 4AZSA 3BQRA 4D2WA 4AU8A 3DOGA 3QCSA 3W18A 5AP1A 1J91A 3P08A 4CFMA 5EQPA 4USFA 5AR7A 4EH7A 3G6HA 4LGDA 1CSNA 1KV2A 5FDXA 3KULB 3KL8A 4HOKA 1WVYA 2VWIA 4EZ7A 4FBXA 2WO6A 4XOZA 4LV5A 2PZIA 3EH9A 4BN1A 3D94A 1OGUA 1K2PA 4XV3A 3PIYA 2B4SB 2RFDA 3OW3A 4GUEA 4NCTC 4I5CA 4L68A 2PU8A 5CU4A 4NZWB 3TKHA 4Y8DA 3QRKA 2WOUA 3QWKA 4NEUA 3DXNA 5IH6A 5TT7A 5AJQA 2WTDA 4MF0A 2PULA 2IW9A 4O0UA 5F1ZA 4GEOA 3QALE 4GUBA 4X0MA 4DGNA 4TKSA 3TNQB 2YN8A 3QRJA 2WMAA 1QL6A 4QYFA 2YERA 5I9XA 3BU6A 2PUIA 3VHKA 4PMMA 3SV0A 3ZSIA 4PF4A 5J7HA 2PUPA 3FKLA 1LEWA 4YO6A 4EYJA 5M08A 2QOLA 4X2JA 4XS2A 3MH1A 4IACA 2R3KA 5K5NA 2F7XE 4O0SA 2CDZA 4N4SA 5BVFA 4XLVA 5J9LA 3LQ5A 2W99B 1GZNA 3FZTA 4O0VA 3KF4A 3QHRA 4HVGA 3A7GA 5A4EA 3PVGA 2XJ2A 3BHUA 3H30A 3OY3A 1JLUE 5IQAA 2W1ZA 3VN9A 4QTCA 1TQIA 3G0FA 4AG8A 4FTAA 3V6SA 1CMKE 1QPJA 5JGDA 2QO2A 3DLZA 3QD0A 5ETCA 3BU5A 4ZS0A 2CGXA 4XX9A 1R0PA 5IEVA 3S2PA 4D4RA 4L8MA 4J96A 5IA0A 3VS5A 4F4PA 4QMTA 3OWJA 2BMCA 4EK3A 5D10A 3ORMA 5H3QA 3P9JA 4IJ9A 3OHTA 1Y6BA 4BDDA 5I3RA 3E8DA 2JAVA 3VF9A 2R3JA 2Y6OA 5L2SA 4EL9A 4DTAA 1ZOGA 3M2WA 5IDNA 4FTIA 4ARKA 4DEAA 2CNQA 2WEIA 3R83A 2QLQA 4IB5A 3PVBA 1ZMVA 2VZ6A 5FM2A 2UW9A 1M17A 3BBTB 4S30A 4U43A 5EHOA 4CQGA 4YSJA 4OTQA 2REIA 2C1BA 2V7AA 4UMUA 3ERKA 4J71A 3NNWA 4QNYA 3R1QA 5T6KA 1J3HA 1NY3A 1QCFA 1XHAA 4GVJA 4UY9A 5CF5A 2Z02A 3IQ7A 3TKIA 4RIYA 3AC2A 2PZRA 4WRSA 2WB8A 4DFXE 4BI0A 3L8XA 3V5PA 5M44A 1NW1A 2ITTA 4FK6A 4XP2A 3CD3A 4QMPA 2YITA 4H39A 2QLUA 3AC1A 4B8MA 3ZRLA 4C3PA 2RSVA 1F0QA 2X7GA 1MQBA 1RJBA 3BYOA 3NUXA 1WVXA 3R30A 4F99A 3DJ7A
chains in the Genus database with same CATH superfamily
5EG3A 4PUZA 3UOHA 3U51A 2JLDA 4GYGA 4AW5A 2OJGA 4W4XA 2C6TA 2CCHA 2ZM4A 3KF7A 3QTWA 3UBDA 4AGDA 4EHGA 4JBPA 4EH2A 1FGKA 1O6LA 3BU3A 5CSWA 4FEQA 4II5A 5AV1A 2ETRA 3MTLA 3QC9A 4RWLA 1NXKA 1WBNA 1YXVA 4EQMA 3LKMA 4K18A 3F3UA 4O4CA 5LQFA 4D2SA 2FA2A 2V22A 2PZYA 4AA5A 3UZRA 4G6OA 4NW5A 4QMVA 3TTJA 3PIZA 4KINA 4RZWA 4YU2A 3MVLA 4O84A 3DTCA 1XQZA 2PE1A 4G16A 5HX6A 4EOIA 4YHFA 4KNBA 3UDTA 1SVHA 3GFWA 4IZ7A 4V0GB 4R6VA 1SMHA 2CN5A 2HXLA 3FZOA 4IWOA 3CCNA 2PVMA 4Y5HA 2XNBA 3FZRA 3NGAA 4CGAA 1Q99A 3P7AA 4E4LA 3ET7A 2BRHA 4QP4A 4D9UA 3L1SA 4TYHA 4KWPA 3COKA 3IW8A 5GHVA 3LW0A 3ZM4A 3F2NA 3H9FA 4QPAA 4FKRA 5C01A 1PHKA 4ANLA 3GNIB 5C26A 1YOMA 2QCSA 3VAPA 5DT0A 5LVOA 2WTKB 2OFVA 4Y85A 5BVDA 5HBJA 5GIPE 1NT2A 2ZAZA 3M11A 5HE0A 3MB6A 5FP5A 3MA6A 3HV4A 3FC1X 5HHWA 3T9IA 4IADA 4DLIA 3MTFA 3Q2MA 3GUBA 3OUNB 4DGOA 3P23A 2GPHA 3TKUA 5LWMA 4S2ZA 4IZ5A 5GJGA 3SKCA 4DA5A 1JWHA 4CSVA 4I23A 1ZLTA 3SXRA 3W8LA 3R01A 1YXSA 3MPAA 4JLCA 4PQNA 1TQPA 4WG4A 2H6DA 4CYIA 2P3GX 2JKOA 3BV3A 2XK8A 3RWQA 2BROA 5AP7A 3R7OA 3QTZA 3ZRMA 4CEGA 3DK7A 3BEAA 3F82A 4GIIA 2WHBA 4MNEB 4BWKA 4DGMA 4AT5A 2GQSA 3D7ZA 4I6HA 3ZFYA 3VWAA 5AP2A 3F3ZA 5KUPA 1E9HA 3MY0A 3UC3A 2XM8A 5HE3A 3MY1A 2GHMA 5EW8A 4L67A 4WUNA 4IAIA 2CSNA 3QD3A 2XKCA 1BI8A 4PL3A 5HLPA 4ACHA 4GKHA 3LAUA 4M97A 1BLXA 3DKGA 3EN6A 4QP8A 3KRXA 4LM5A 5CZHA 3V5QA 2UZNA 4F9WA 5AR8A 3HGKA 4IAAA 3TNPC 5TR6A 2O65A 1JBPE 3GEQA 1IR3A 3C51A 4NT4A 4AF3A 4C35A 5DMZA 4H05A 4FOBA 4TTHB 2GMXA 3LFQA 4L53A 4BBFA 1UVRA 2PK9A 2X2MA 3IGGA 3PY1A 4OGRA 2JDSA 5B2KA 3VW6A 4E4XA 3R71A 2ZV7A 3E8CA 3IOPA 3PY0A 3FXXA 5GZ9A 5EYDA 4FOCA 3W32A 4HVIA 3FXWA 4ANMA 2NP8A 4AQKA 4R7IA 5HVYA 1BI7A 2W9FB 4TNBA 2GFCA 3NLBA 3ZUUA 2XRWA 3V5WA 4W4WA 4G2FA 2ITZA 2OKRA 3NFFB 4I0TA 2XYNA 4PRJA 2WMTA 3Q6UA 4LOOA 5IQGA 3QQGA 4FNZA 4TXCA 3MYGA 5DR6A 4IAYA 4I93A 2VO0A 1JQHA 4DH8A 3ORTA 3TZ9A 4EH9A 4RZVA 4FT0A 4GV1A 4YHTA 3T3VA 5M57A 4YMJA 3G9LX 4FIFA 4C4FA 4CFFA 4D58A 2B53A 5EDRA 4DEBA 5AA8A 2FUMA 5DH3A 3RVGA 4BGQA 4O81A 3ULZA 2XAOA 3W10A 2WIPA 3EKNA 1FPUA 3AQVA 3QZFA 3VBYA 5DYJA 5LCJA 5FDPA 1PF8A 3R63A 2C6LA 3DBDA 4DGLC 1SNUA 3E87A 1FQ1B 3LM5A 4UV0A 4OW8A 5CEOA 1YRPA 4O38A 5GIOE 3DKCA 3NUPA 4CZUA 3NIZA 4NU1A 2GTMA 5CNOA 3LQ8A 1H0VA 3UG1A 4PX6A 3K54A 2HWPA 4QMQA 3KU2A 3G6GA 1OKZA 1XR1A 4WNPA 5DR9A 2NYAA 4G9CA 4BDBA 2FH9A 2Y8OA 2X39A 2X81A 4GK2A 4KRCA 2BZHB 4O1PA 4BI2A 2W1HA 5I0BA 5M07A 4AXFA 3QTRA 4FKTA 4FEVA 1Q8WA 2NO3A 4F08A 4MXOA 4JVGA 4MXCA 2GTNA 4A4OA 3L8PA 3GENA 5T3QA 2GQGA 3E8EA 2WELA 3UYTA 3ZLWA 2IG7A 3QLFA 4F9BA 4Y72A 3QFVA 5ITAA 3S00A 2XK6A 2RG5A 3BHTA 1IAJA 4I0SA 1W7HA 3MA3A 5HG8A 5HD7A 1MP8A 3QLGA 5IUGA 5C27A 5KKRC 4C4JA 2O8YA 2BHHA 1M2PA 3FMDA 3QTXA 2YLEA 3PPZA 4RMZA 3MS9A 4TYGA 3QTUA 1ZRZA 3K5UA 2CKEA 2HAKA 4U5JA 2WAJA 3Q4ZA 5HEZA 2OK1A 4M69A 2Z2WA 3COMA 1YHWA 4AGUA 1J1CA 2VX3A 2NRUA 2BIKB 5FD2A 3W0RA 4AAYA 3WZUA 3IDBA 3G90X 4UBAA 1UU8A 3FBVA 4C34A 5BYZA 3VQHA 4EH8A 3DXPA 4FGRA 2VNYA 4CZYB 4CCBA 2OW3A 3BE9A 4ZTHA 1S9IA 1VYZA 2V55A 2ZFYA 3AKJA 4FG7A 3LHJA 4I1ZA 5LARA 3DAEA 4D5HA 4EHVA 1TVOA 5KZ0A 1P4OA 4BL1A 3BLRA 5CY3A 2IZSA 4BF2A 5CAOA 4BGGA 4X3FC 4Z7GA 3TMOA 3UPXA 3SOCA 3RJCA 3Q52A 2YAAA 4W8DA 4MXXA 1DAYA 1KE6A 4OTIA 4Q5EA 3W0MA 2ZYBA 1OM1A 3A8WA 3PJ2A 3VRYA 3ZDIA 3PLSA 1Q62A 5CX9A 3DAKA 4Y46A 3KVXA 4AS0A 1U5RA 2EB2A 1YDRE 1U54B 4BI1A 1U46A 2UVXA 3UIMA 3I7CA 3TUDA 2HW7A 3S3IA 1XH5A 4XG3A 3TG1A 3LM0A 4GK3A 5FUTA 4O0XA 1T45A 5DRBA 1GIIA 5FWKK 3ZS5A 5JMSA 2JIIA 2P2IA 2VTPA 2V5QA 4GJ2A 3FSFA 4ALVA 4W4YA 5FEQA 3FE3A 3ZZEA 4I4EA 2UZEA 4U6RA 1R1WA 3U6JA 5KMOA 4ZTSA 4B6LA 5C03A 1UU7A 2CGUA 3D2KA 4JG6A 4FNYA 4QD6A 2X9EA 4YJTA 4C37A 2BDWA 3SD0A 4F7JA 1WVWA 4E8AA 4CFUA 4PPCA 2W1IA 4FSQA 5AAGA 5B7VA 4ID7A 3GT8A 3QA0A 3AXWA 2PE0A 3OXZA 1VZOA 2VTOA 3R6XA 3E63A 4APPA 4IB3A 5BVWA 3DZOA 5CSXA 2ZMDA 4O0WA 3TN8A 3TYKA 5BVKA 4MUQA 4E7WA 4D1SA 4L46A 1Q8UA 3QQUA 4AGWA 3CPBA 2XH5A 1P2AA 2OZAA 2RFSA 3JVSA 4WNKA 2X1NA 1P14A 4IFCA 4RX8A 1ZYJA 4EEVA 2IO6A 1O6KA 3VRZA 4R5SA 2HK5A 2XCKA 4GFOA 4E1ZA 3QQJA 5K4IA 3RZFA 4FKLA 4FL3A 2AYPA 4LG4A 1M2RA 3UDBA 3VUKA 1TQMA 3COHA 1R39A 4FV9A 4RLLA 4AGCA 5GJDA 4V01A 2R9SA 3FJQE 5BYYA 3QUEA 3G15A 5K3YA 2V62A 1K3AA 4ASXA 3UQCA 2WTCA 2ZJWA 3TT0A 4DT8A 1CKJA 4WKQA 5AX9A 4EORA 3VJNA 2C69A 3TACA 1H1RA 3LFDA 5HKMA 4DFNA 2A4LA 5CVGA 4JR3A 4QP3A 3KRLA 3GXLA 2CHLA 4Q2AA 2BVAA 3W2OA 3K5VA 4L7SA 5CEQA 3RK5A 4KIPA 4ANSA 4GU9A 1YXUA 2RKUA 3QZIA 1BUHA 2ITVA 4GFMA 4A07A 4BWPA 4JDKA 3TZMA 5AFVA 4DEGA 4RVKA 5BPYA 3PXYA 4ZOGA 1ZOHA 3EYHA 4D2TA 3R02A 3QKKA 4FIEA 3LQ3A 1B6CB 2ZV2A 2B1PA 3PPJA 3AGMA 4E5WA 4YJRA 4AFJA 1OIYA 4OTWA 2ITPA 3QAME 5FTGA 4FR4A 1S9JA 2LAVA 3O2MA 2WMUA 3PIXA 4FVRA 3DFAA 2XM9A 4QYYA 1U59A 4ZTNA 2W5HA 3TNHA 5GZAA 5LMBA 4FL2A 2FSOX 3SQQA 4C2WA 2XCHA 5CU0A 1Q8YA 1YW2A 4I3ZA 4EH3A 2ITYA 2UV2A 4RQVA 2BHEA 1PMUA 2ZV8A 3ITZA 4G5PA 4AZFA 3KRRA 4I92A 5HNIX 4R7HA 4GRBA 5AP4A 4UN0C 3DB8A 3AMBA 3HEGA 4I94A 3PA5A 5HVKA 1KE5A 4NM3A 3TV4A 2OXXA 3PA3A 3OTUA 3LXKA 3PJ8A 2OIQA 3WF6A 4BYIA 1G5SA 4C3FA 5L8KA 2CNUA 4EI4A 2CGVA 3D5WA 5HCXA 3WILA 3VO3A 2R5TA 2VO6A 4GL9A 1QPDA 2IVUA 2W4OA 4JRVA 2VAGA 4O2ZA 4V04A 3A7HA 3NWWA 5L2WA 2YIWA 4AWIA 1WBTA 2XJ1A 3C0HA 3LCSA 3PWYA 3LCTA 4I6QA 3UZPA 2YZLA 4RIOA 3VVHA 3SRVB 5LVMA 3FV8A 1Z5MA 4OBPA 2XRUA 2WOTA 3DAJA 3U4UA 3K3JA 3V01A 5I9WA 2OGVA 5JRQA 5HG9A 4RG0A 4P5ZA 2EXCX 2YM3A 4XP3A 5DRDA 2C6MA 4WSYA 3UIUA 2VTNA 3NVMB 1OL1A 5EI6A 4O7VA 3IW4A 4AX8A 4CD0A 3NNVA 1QPCA 3A7JA 4QTAA 1PYEA 5ANEA 3O7LD 3FYKX 4JBOA 5AM7A 4ZTQA 5HVJA 3P7BA 4ZEGA 3C9WA 4CT2A 2IPXA 5M06A 3NVKI 4IBMA 3OT8A 4QPMA 1JKTA 4HCUA 2UW8A 4PDYA 4IVBA 4L43A 3ZC5A 4WBBB 3Q4CA 4QYHA 3R0TA 2VU3A 1Q4LA 5EK7A 3PXRA 1JKSA 1B38A 3C0GA 1IEPA 3RAIA 2FO0A 3DDPA 3HRCA 5F20A 3WZDA 3JR1A 4EYMA 1E1XA 3C7QA 1YKRA 3H3CA 4AXDA 1M52A 3C5IA 3TNWA 3NAYA 4KRDA 4MYGA 3ZSHA 4E4MA 4D4YA 3Q96A 4J52A 5IUHA 4FMQA 4JAIA 3CLYA 3QCXA 3ZLSA 4FJVA 4ORKA 2PMOX 5C8MA 5HLNA 1BL6A 3RNYA 3UNJA 3BYMA 5FEDA 3O96A 3FLNC 3WOWA 3ZRKA 3GCPA 5EHYA 4DFUA 3QD2B 4D5KA 5HTCA 1OZ1A 4C4EA 2C0IA 3KULA 4FKPA 4O91A 1HCLA 4DG2E 3NPCA 4FZFB 3R8PA 1WBWA 3OEFX 4DEEA 1XH7A 4NFMA 4XBUA 5FLFA 1WFCA 4HVHA 2PVRA 3OWKA 5L2TA 3N4VA 3LLAA 3VS6A 5B0XA 4HGEA 3E92A 3RZBA 4FG9A 3MFSA 5FM3A 2VV9A 1CTPE 3HA6A 4FK3A 5LVLA 3Q9XA 4WIHA 3UOLA 2HENA 2WMXA 4R1YA 1WBPA 2XA4A 3L8VA 3LFFA 3HUCA 4UB7A 5DR2A 3ZM9A 4J97A 1H1PA 2W1EA 2XKEA 2YACA 3C4EA 3VUTA 3RHXA 3QTQA 3TUBA 1YXXA 2AC3A 3E3BX 3O0GA 1NVQA 4YLLA 2YJSA 2YM7A 3QHWA 4Z3VA 1BL7A 3D14A 3QGYA 3R21A 5HE2A 3ORZA 1GNGA 5D7VA 2VWBA 5EOLA 5H8GA 2EUFB 4NK9A 2VWXA 4BJJB 4IWDA 2XKFA 3HDNA 4FKJA 1G3NA 4U44A 2XUUA 4EBWA 5HO8A 4G3CA 3F9NA 3ZFMA 3IDPA 3PE2A 3DLSA 1BX6A 5EDPA 5JQ8A 1OB3A 5D41A 5EYMA 5H2UA 2CKOA 3FMNA 5HGIA 2OJ9A 4I20A 2IZUA 1Y6AA 2NNWB 3G9NA 4H3QA 2R3IA 4H1JA 5LOHA 4CFWA 1WCCA 3KFAA 5DHJA 4ZY6A 3V8WA 4F6WA 5E1EA 4G5JA 3MSSA 3GQLA 2XIZA 3I5ZA 3AC5A 4WNMA 2I1MA 3NUYA 5AUVA 2G9XA 2CLQA 4XJ0A 2IF8A 3FPMA 1M7NA 1DAWA 3OTVA 4HPUE 3VBQA 2OBJA 1GIHA 3ZBFA 5M4FA 1J1BA 3TEIA 4C58A 2EXMA 2HELA 2BILB 3P4KA 1PXOA 2VTLA 1GOLA 2X4FA 4YP8A 3FMMA 4QMYA 3KIOC 3UNKA 4TZRA 1JSUA 4FYOA 3FZ1A 3FSKA 4LUEA 3IW5A 1H27A 2J0LA 3EKKA 4AN2A 5CXHA 3OY1A 4UZDA 4OAVB 5H8BA 2UVZA 1ZY4A 2PUNA 1Q24A 3DZQA 3WIGA 3MIYA 3P1AA 4IW0A 3N51A 2QO7A 3IO7A 5D7AA 1MRUA 4EZ5A 4LFIA 1AD5A 4BHZA 5J87A 3ODYX 3ORXA 4QMXA 4AW1A 5HQ0A 3SW4A 3I0QA 2GNHA 4K77A 4ENXA 5I4NA 1EH4A 3FLSA 3RPSA 2HZ4A 3VIDA 3LMHA 1LR4A 4LV7A 2YFXA 4RC4A 3UC4A 3GU7A 4M14A 1PMVA 1YHVA 3LFSA 2GNJA 4D0XA 4D2PA 4HGSA 4PV0A 4EOJA 3ATSA 3VBXA 3S0OA 3HRBA 4BTKA 3F6XA 4EKLA 5HICA 1ND4A 4FKOA 2VUWA 1X8BA 2YEXA 3H9OA 4KS7A 2Q0NA 2XMYA 3QQKA 3EMGA 5A3XA 1YOJA 2J4ZA 2XAMA 3EHAA 3GC0A 3GOKA 4F09A 3VBVA 4FKUA 4YUQA 2HZ0A 5BV3A 4RQKA 2PWLA 1A48A 4IX6A 4G9RA 2IZTA 4QTBA 5IQBA 5CI7A 2P55A 4EBVA 3RPYA 4WT6A 5DWRA 3U55A 4B99A 4M12A 1OPKA 1SZMA 3WE4A 3VNTA 3Q2JA 3EQIA 5FP6A 1GZOA 3GC9A 2XNNA 3Q9WA 3SA0A 5IQIA 1MRVA 2JDRA 5CEKA 3B8RA 4BR3A 4YPSA 4U42A 2WMVA 5LMAA 3D5XA 4CCUA 1ST0A 1PYXA 3EFJA 3VBWA 2CGWA 2G1TA 4DFZE 3BL9A 3KA0A 4J98A 5C8NA 2YIYA 4XV9A 4QDEA 4GFGA 4O86A 5IA2A 2UZWE 1NVSA 3BLHA 3I0OA 4U3ZA 3Q60A 4GJ3A 5TO8A 2BR1A 2XK3A 2F57A 3KXGA 4RWIA 2J5EA 2VTJA 4LL5A 1IA8A 2B52A 2FVDA 2ZM1A 4JR7A 2ZOQA 3PJCA 4IMYA 4NTTA 5DT3A 3T9TA 5HO7A 3ZONA 2JDTA 5F95A 4ASZA 4PNIA 3LZBA 3OP5A 3L9PA 4GIHA 2I0EA 3SX9A 2VTIA 4NM7A 2J2IB 4ITJA 2JDOA 4O7ZA 2JGZA 1PMEA 2OSCA 2C5VA 1UKHA 1K9AA 4C4IA 5CQWA 5DI1A 2IW8A 5CASA 2UZVA 5HO6A 3GC8A 2KTYA 4RIXA 4YZBA 3PJ3A 3RAWA 2A19B 2ITNA 2OZOA 4EOQA 1ZZLA 1F5QA 4UMPA 2ITWA 4I6BA 5CSPA 4U3YA 3DBFA 4DH5A 2ZVAA 2ITOA 5A6OA 1KE7A 1GZ8A 4X3FB 4AZTA 3C4FA 2HZIA 2AC5A 3L9NA 4ZSLA 5AV2A 5AV0A 5H8EA 2YCSA 1KUTA 4YSMA 2W06A 5E90A 4CRLA 3NYOA 4Z9LA 4E73A 2J0KA 5HD4A 4GG5A 4FTLA 3O8PA 4ZXTA 4D1XA 2QODA 5J5SA 3AC8A 2YCRA 3OBGA 1GIJA 3DKOA 3HV3A 3NUNA 4IX3A 5I5ZA 1REKA 4XP0A 1OKWA 3UVPA 3O51A 4RA5A 2GCDA 1OBDA 4D4SA 3FC2A 5T68A 4FC0A 3FWQA 4S31A 3ML1A 4RVMA 3BHHA 2XIKA 3NW7A 3VS3A 3KMUA 4N6YA 4MWHA 3IG7A 4U41A 3DBQA 1YI3A 4EOOA 4YLKA 5BVOA 3WZJA 4O7NA 2W4KA 2QR7A 4FTUA 3C4XA 3K3IA 4EK8A 2J0JA 3HZTA 1SVGA 1Y8GA 4X6QC 4BCFA 5I3OA 4DE4A 4RJ3A 3MWUA 2QOOA 2UZDA 2R3FA 3EQBA 4JG8A 2WTJA 4J1RA 5CWZA 2JDVA 3G5DA 4RFMA 3RALA 2BRGA 2Q83A 3LMIA 1YVJA 3BBWA 4IH8A 4YLJA 3V8SA 1OUKA 5F94A 4BDEA 3UO4A 2XP2A 3NW6A 4BCPA 3Q32A 4WOVA 2JBPA 4UALA 1A9UA 1WBSA 4BTMA 5IQEA 3L9MA 2R3NA 4WO5A 2PVLA 3TIYA 2IZRA 3C50A 2PUUA 4QQCA 3OOMA 4FEWA 3LJ0A 4UYAA 3DA6A 4ZZMA 4XG6A 5IQHA 5A46A 4EJ7A 2J0IA 4UWCA 5J79A 5ETAA 2GU8A 4O1OA 4CYJA 5KBQA 3BGQA 4GMYA 4GU6A 4XBRA 3TNIA 3U9NA 2OF2A 3C5UA 2OFUA 3F88A 4NFNA 2OXYA 2WD1A 3UP7A 3W2QA 4BTFA 5HZNA 2X8EA 2GFSA 4PDOA 5CAPA 1H01A 3ORLA 3AOXA 4D28A 5HX8A 4BRXA 3QXOA 3MW1A 4AN3A 3HA8A 3WF8A 3W2RA 4AZVA 3UNZA 3DQXA 1OL5A 1OPJA 4F0GA 4R1VA 1JOWB 3D83A 1PMNA 1UNHA 4AAAA 1Z57A 3JYAA 4FYNA 4RJ5A 4O21A 1P5EA 4IANA 3VS7A 3ORIA 2VRXA 5LVPA 4FKVA 5EDQA 1ZMWA 5KZIA 3FDNA 2BAQA 4FIJA 3BYSA 3EB0A 2AUHA 3R2BA 4QDVA 2CJMA 4TWPA 2B9JA 2O0UA 4FUYA 3WZEA 3ZSGA 3H4JA 2WNTA 4FX3A 3MVMA 4RJ8A 5I9ZA 4FV3A 4DG0E 2J6MA 4NM5A 4FKIA 3KMMA 1JSTA 2X0QA 2QOKA 2XBAA 5TF9A 4EHEA 4FTCA 2XNPA 3KQ7A 5AWMA 2JAMA 3EL7A 1APME 4QT1A 5ANOA 2JD5A 1SYKA 3MH2A 4CFVA 1YI6A 3ZUTA 2CMWA 5G6VA 3BLQA 4QTDA 3RCJA 2XB7A 5IEXA 1R0EA 3DK3A 4FTNA 3AMYA 2BZKB 3SC1A 3F7ZA 4N0SA 3KCKA 3VHEA 5E8TA 3MGYA 2Z60A 1DM2A 3AC4A 4JIKA 4YZDA 2YAKA 3HDMA 3QCQA 2XZSA 3LFCA 4FNXA 4PL4A 4CKJA 3AT2A 4RIYB 2VWWA 3MH0A 4FEUA 3DCVA 4DLJA 3WI6A 4BDGA 4LRJA 2VTRA 2WMRA 1JKLA 3CIKA 3FKOA 4LQMA 5FRIA 3UYSA 5CTPA 4U9AA 2C3IB 2BCJA 4L01A 4YZCA 5FXRA 5HU9A 5TOZA 2WPAA 4U97A 2UW4A 3FYJX 2QOQA 3VUDA 5KMKA 1JPAA 1L3RE 3QTIA 1ZZ2A 1U54A 5AUUA 5A4LA 4HGTA 1TKIA 4AE9A 5CAVA 2QNJA 5LMKA 2FB8A 5DA3A 4IQ6A 4A4XA 4CXAA 2FGIA 3TV7A 3A99A 4JDHA 1FOTA 4PMTA 3W8QA 3BV2A 3VC4A 4ZLOA 3WF9A 2R3HA 4ZLZA 2PVFA 3CY3A 3EN4A 3LFBA 3RNIA 1HCKA 4IE9A 4RWJA 2OJIA 2B55A 3H0YA 3H10A 1LP4A 4FV7A 4O6EA 4QP2A 3RP9A 5L6WL 4BIEA 3LCDA 3UJGA 4E5AX 3GFEA 4W4VA 3ALOA 5CLPA 3ZCLA 5M4UA 4DINA 4BGHA 3U54A 1H08A 3N9XA 4YJSA 4R77A 3RK7A 4J53A 4C57A 4TYHB 4B9DA 3V51A 5AUXA 2BRNA 2YIXA 4IWPA 4O27B 2JC6A 3SHEA 2YM6A 2WTIA 3ZLXA 4FIIA 5KHWA 3U6IA 4MCVA 5F9EA 3F3WA 3RCDA 4E6CA 4YJPA 3MPMA 4NW6A 2PMIA 2PSQA 2UVYA 4IM2A 3ANRA 3BYUA 4FV2A 4CQEA 3ZEWA 5KX8A 4KSPA 3QGWA 2WMBA 4OT6A 4KIQA 3Q04A 4YHJA 4ERKA 2FSMX 2OU7A 4Y5QA 3ETAA 3LOKA 4AOIA 2WTWA 1M7QA 3F66A 3FHIA 3OWLA 4XV1A 2GHLA 5EW3A 3KC3A 3IDCA 4CLIA 1WZYA 3QZGA 2WIHA 3HMNA 4OLIA 3F3VA 4ZSJA 2C5XA 2VTTA 3V5TA 4G31A 3KEXA 3LCKA 4FICA 3R22A 2XEZA 4NIFA 2CKQA 4G6LA 4YBKA 3QD4A 4M13A 4MD9E 5K5XA 4D0WA 3H0ZA 4XG4A 4KSQA 4J99A 4KAOA 5A6NA 3ZOSA 2JEDA 2QC6A 4UEUA 4CRSA 4MH7A 4BFMA 2WU6A 1PKGA 5D9HA 1Y57A 3OW4A 4NWMA 4R8QA 3RINA 4EUTA 3R8LA 3LFEA 3IS5A 1UNGA 4AUAA 2IWIA 3IPHA 3P78A 2PMLX 5M56A 4YJQA 2W4JA 3ZXTA 4BDHA 3ZBXA 4GH2A 3GU5A 1IRKA 4R7BA 4QTEA 2GNIA 3R7VA 5FBNC 3ZDUA 5JGAA 1OL7A 1R78A 2G15A 4GYIA 3EWHA 3ORNA 4DH1A 3EFLA 3SG9A 1OIRA 1W8CA 2QOBA 4XNEA 1MQ4A 2Y7JA 1W82A 3VS1A 1CKPA 1ZYCA 3FL4A 3KRJA 2W1GA 5ANGA 4BBMA 5CAQA 3BEGA 5ETFA 4QQJA 3O7LB 4MF1A 4P5QA 3RPVA 3BPRA 4JJRA 2O63A 3PZEA 2QONA 4QOXA 2YCFA 2E9PA 1WMKA 1Q97A 4IM3A 3QUDA 2Y9QA 1H26A 2CN8A 3PZHA 4FTKA 1Y8YA 3R9HA 4ZZOA 5L4QA 4X2FA 3U8WA 4L7FA 3VBTA 3DTWA 4I21A 4M0YA 4BKYA 3P5JC 1PXMA 5F4NA 2X7FA 4TRLA 2RFNA 2VN9A 3ULIA 3VUHA 4UXLA 1VR2A 2X6DA 3HNGA 4XG2A 5KMNA 4C02A 2CKPA 2VTAA 1XKKA 4X21A 1ATPE 2BZIB 3Q5ZA 4XRLA 5L8LA 1OPLA 3R00A 3AKLA 2R0IA 3FMJA 4IZYA 4O0YA 3PXFA 4NSTA 5FGKA 3JVRA 5B2LA 3AG9A 3HMMA 3P7CA 4H3PA 3HP2A 3U4WA 3JPVA 5HLWA 4W9WA 4IC7A 3QRTA 4L3LA 4KD1A 5E8VA 3A4OX 3BGPA 3W2CA 5JFVA 3TCPA 2XBJA 4LYNA 4EC8A 5FXSA 2W1FA 3ACKA 1Q61A 2E2BA 2WQNA 3Q9ZA 1W98A 5IMXA 2R3GA 3U6HA 3OT3A 3ZO4A 4YPDA 3UDSA 5EHLA 2VX1A 2XNOA 3FI2A 3OC1A 3EN9A 4ONAA 5CNNA 4YR8A 2DYLA 5HCYA 3RAHA 4QNAA 5A14A 3HVCA 2R64A 4LUDA 4O6LA 5E8UA 4B4LA 4DCAA 4RVTA 4UMRA 4O4DA 5JFXA 3TJDA 2BFXA 4F1OA 4JDJA 2C6IA 4XMOA 3LFAA 5JN2A 4QQTA 3OD6X 4EWHA 3BZ3A 4YZMA 3CPCA 3A7FA 2F7EE 4RIWB 3RPRA 1H28A 1V1KA 3QKLA 3OZ6A 5EYCA 3R7YA 3F5UA 4N6ZA 4MD7E 4ALWA 2PPQA 1XMMA 2QU5A 4HNFA 1FVTA 2RFEA 3A8XA 3P86A 3E8NA 4M0ZA 4QMUA 1XH9A 3QBNA 4MXYA 3MN3A 2GNFA 4FSMA 4K8AA 3OOGA 3AKKA 3NX8A 2GNGA 3D4QA 4DTBA 4M69B 2HIWA 4EJNA 5LVNA 3Q4UA 5L6PA 2R3RA 3HV5A 5CT7A 4EH6A 3V04A 2QOHA 3BQCA 2R7BA 5HE1A 3KK8A 5ANKA 5IKWA 3RM7A 3OVVA 3A62A 1UV5A 3W33A 1ZWSA 5E91A 4TNDA 1IA9A 3PFQA 4PDSA 5EI8A 4QP1A 5AP0A 4M66A 5DEYA 1J7LA 4L44A 4PNKA 3IONA 4HW7A 1IG1A 3KMWA 5CI6A 1RQQA 3DGKA 4EQCA 3AD5A 5JT2A 4F70A 3F61A 4IVDA 3FI8A 1NA7A 3Q4TA 4CTBA 3KXNA 2ZB0A 3O8TA 2QHMA 2JKMA 4XEYA 4X3JA 5HBEA 2XEYA 5IZFA 4FL1A 1GJOA 3QYWA 1P4FA 4G6NA