3QKKA

Spirochromane akt inhibitors
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
326
Chain Sequence
RVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITIMECVDSERRPHFPQFDYSASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title Discovery and SAR of spirochromane Akt inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 326
sequence length 335
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qkkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qkkA01
5CU2A 4C33A 2R3LA 4KIPA 4DH7A 4OTGA 3BYVA 3FKLA 4AW5A 4UYAA 3I7BA 3F3WA 5CF4A 2OG8A 3T3VA 2PZYA 2WD1A 5D41A 5HX8A 4GVJA 2C5VA 5J7HA 1BX6A 2ETKA 3NDMA 2EXCX 2HAKA 4YBJA 3DXPA 2R5TA 3UO5A 2VTSA 2ETMA 3G9LX 3P1AA 3PIZA 3A8WA 3ZC5A 1EH4A 4PUZA 4QPSA 4QPMA 2IVUA 4F7JA 3U55A 3C7QA 4L67A 4ZSAA 2W17A 4OR5A 5E90A 5HVYA 4DHFA 2XNNA 3FLZA 4DBNA 5M4CA 1OKYA 1YWVA 5ANJA 3ROCA 2QONA 5E8WA 5EDPA 4YLLA 3PXYA 1GIHA 4AP7A 2YHVA 4I5CA 5ITAA 2I0HA 2WGJA 1H25A 4YNOA 4IX5A 3FMKA 4M15A 2P0CA 3UC4A 4IVAA 5I9VA 3RPOA 4C37A 2I0YA 2GNIA 3RI1A 2XF0A 3W2SA 4GH2A 3R04A 1GAGA 4O7WA 4CMUA 4PPAA 1IAJA 4E4NA 4XG8A 2XKEA 1P4FA 4AGCA 5AP6A 5DOSA 5HE0A 4JJRA 4FTLA 1FVRA 4ZTQA 2XNGA 2ZM1A 3V01A 2X0GA 3QTXA 5DR9A 3KK8A 3CD8A 3ZDIA 3BU3A 2QLUA 2YIQA 4FIFA 4K0YA 2B0QA 3ZH8A 4JIKA 3MFRA 4ANSA 3FI2A 3ZSHA 2VTJA 4TKSA 5LVOA 4BCKA 4CVAA 5EI8A 1F3MC 4XG6A 1BLXA 4OTDA 3V6SA 3ZOSA 3LFSA 3MW1A 4C61A 1YXXA 3KA0A 1AQ1A 3DBQA 3L9LA 4QP8A 3FDNA 5IQCA 5HHWA 5JRSA 3MB7A 3DAEA 4PL3A 3HP2A 4B6LA 4C59A 2ITVA 4NTSA 4EKKA 4F63A 3MV5A 3PY1A 2J90A 5AAFA 2WMAA 2HZ4A 2PMIA 4FSUA 3LXLA 2ZV2A 5FTQA 3EIDA 5HIDA 4JDHA 2IZRA 3HVCA 3T9IA 4CNHA 4KIKA 5FUTA 1KE9A 3GU4A 2UZLA 3CGFA 3PYYA 4J53A 4DTKA 3QX2A 2OK1A 4BDJA 2OLCA 3Q53A 1MRVA 3UQGA 4IZ5A 4UZHA 3MESA 3FMNA 2QU6A 4NJ3A 4QOXA 3G0FA 4FEXA 2ITXA 2V7AA 2WPAA 4MF1A 3FV8A 4Z3VA 1OL7A 4MD7E 4DFYA 3KRRA 3ACJA 5E7RA 3G6HA 4FC0A 2X8EA 4O22A 5IQDA 3D15A 2VWVA 3DZQA 1ZYDA 1YHSA 5M53A 4ZTMA 1AD5A 3R83A 2OSCA 3TKHA 3ZRLA 4IDVA 2X7GA 4TYJA 4XBRA 5L6OA 4KSQA 4L44A 3VS1A 3ZLWA 3NCZA 3ZU7A 3QA0A 4OTHA 4NH1A 4YJPA 3FI4A 3TNPC 3R7UA 5HESA 4LYNA 5E4HA 4IB1A 2OH4A 2BTSA 4BTMA 3TN8A 3KRXA 1DAWA 3MA6A 3WF6A 3A4OX 4Z55A 4CRLA 2BAKA 3EQFA 5HG8A 2JDTA 1NY3A 3ANQA 2EB3A 3WYXA 1WBSA 3UZTA 2UW4A 3QQJA 3QD0A 4TNDA 2CMWA 5HVJA 3CS9A 3QGYA 3BHYA 1MQ4A 4RC2A 4D2TA 4L01A 4B4LA 5M44A 3WF8A 3SX9A 3OWKA 2IJMA 1UU9A 4FBXA 3OCGA 3WARA 2O65A 5FLFA 4F1MA 3QC9A 3U9CA 3BEGA 3EH9A 5K9IA 2ZJWA 3UNZA 1PXNA 2UZOA 4FKQA 5DT3A 5KUPA 4ALWA 1DI9A 1REJA 3E5AA 2QOBA 3LE6A 4XMOA 3O2MA 5AX9A 4BIDA 1KSWA 3UIXA 4R77A 3ITZA 3DFAA 3E7VA 3G2FA 5AUVA 3KB7A 2PULA 1BYGA 4D2SA 4GKIA 2XMYA 4FA2A 4UBAA 4IX6A 2ZB1A 4H39A 2PUNA 4O7ZA 3EYGA 5HO7A 3PRIA 4GCJA 4ZK5A 3UODA 4ZMEA 3GCUA 3WZKA 3L9NA 2PVJA 1H07A 2XKDA 4D9TA 5E8XA 5FTGA 1XH8A 4QP1A 3ZFMA 5AV2A 4QMOA 3AT4A 3PJCA 1CDKA 4PL5A 5HCYA 1JSVA 1OKVA 4MXZA 4FZDB 3CY2A 3B2WA 3GGFA 3NUPA 3EN4A 4P90A 4W4XA 4X6QC 3OTVA 3PUPA 2BDJA 4M14A 3HL7A 4QMUA 4RZVA 2QNJA 2FB8A 3RBWA 4IAAA 4HYSA 3FPQA 5HD7A 4GEOA 3ROYA 5IKWA 1DI8A 5TOZA 2GTMA 4I21A 3POZA 1BKXA 3C0IA 1JSTA 3A8XA 3QTIA 1W84A 4MWIA 3T8OA 4FV0A 1Q3DA 2W9ZB 3MJ1A 3SAYA 3W2QA 1R78A 4AE9A 4FSWA 1NT2A 3FI8A 4XV3A 3ZM9A 1YW2A 2XK7A 3N4UA 5LWNA 1Q8YA 4CKIA 1FGKA 5LCKA 3PTGA 3AD6A 3R2YA 2HXQA 4G3DA 1U54A 4JOAA 4QMSA 5DEYA 5JGBA 3R1QA 3KL8A 4YGAA 4MXAA 1OIYA 3TACA 3WIKA 3UQCA 5KKRC 2CGWA 4QYEA 5D10A 5EW9A 3VO3A 3HEGA 4YJUA 3VS0A 3ET7A 3CKXA 3SQQA 4TWPA 3NNXA 3ORMA 2RFNA 3TCPA 4C58A 3E88A 4GUBA 2BMCA 4FX3A 4XP0A 5I9UA 1TQMA 3EMGA 1SNXA 2C3LA 5I3OA 4DH1A 3EB0A 2OZAB 3UPXA 5CAUA 3FJQE 4AA0A 3REPA 3TTJA 4BDIA 4J52A 4MNEA 3QAME 2GSFA 4O91A 2ZAZA 2O63A 3OF0A 1NVQA 1H08A 4WBBB 4I3ZA 3O8TA 2IVSA 3VF9A 1PHKA 4RVLA 3ZMMA 5IEVA 3VBXA 1FVVA 3KXNA 3VUDA 5A4CA 5HO8A 4TWNA 2J6MA 4YZNA 2NPQA 5BX0A 4O1PA 3R9HA 4DLIA 5CF8A 5JKGA 2UZDA 3AOXA 2QOFA 4J99A 4IM3A 4KAOA 3V5PA 4E26A 4ZY5A 2CNVA 1P2AA 4J95A 4GL9A 4FT0A 4BHZA 4EWQA 4HVSA 4F6SA 2C5NA 4FTTA 5F20A 4AFEA 2YCRA 2W1ZA 4JX3A 4EJ7A 3TTIA 3OEFX 4QTEA 2PVFA 5D11A 3V8WA 2WMXA 4CD0A 5AP0A 1LP4A 4TYGA 2J9MA 3PXZA 4V0GA 4AT4A 5JMSA 2PK9A 4A9SA 4RGJA 1WBWA 4UWYA 3ZFYA 5KKRB 3BYSA 4FKIA 5E8TA 3BBTB 1ATPE 1FMOE 4FYOA 4O0UA 1KV2A 4O7NA 2YZAA 3OOMA 3WBLA 3FY0A 3DDQA 4GT5A 1R0PA 1XJDA 2WMTA 2WU7A 3FLNC 3KK9A 3V6RA 2CPKE 3DKGA 5I9YA 3NYXA 2IVVA 4FT9A 2ZDTA 5EW8A 4DEHA 1H28A 1YDRE 3QRJA 1MUOA 4G31A 4WNPA 1H00A 2GHMA 2UW8A 4IADA 4L3JA 4B8MA 2W4JA 2WTJA 3VNTA 5IDPA 2Y4PA 3R6XA 4FSZA 3ZO1A 1Y6AA 4FMQA 4QP9A 2ITYA 3DB8A 1ZYCA 4G2FA 5JZNA 2GTNA 2W5BA 3P7AA 3PJ1A 4HVDA 1XH6A 3BIZA 3LOKA 1PJKA 2Z7SA 3E63A 4FUYA 3KFAA 2W06A 1NVRA 5FQDC 1OMWA 4ALUA 5LMKA 1KOAA 4Y8DA 5DEWA 1H01A 3UG1A 3CD3A 1VYZA 3O96A 4G5JA 3TEIA 5JFSA 4F09A 2YIXA 4IWPA 4PMSA 3RJCA 5IU2A 4ENYA 4IAIA 2XBJA 3UQFA 4HZRA 1M2RA 4PNKA 1PXJA 5J79A 3TIZA 3B8RA 2RL5A 5L8KA 4W9WA 2P2IA 1DAYA 5CSVA 2A0CX 2NO3A 5K4JA 5FXQA 4F08A 4JG6A 5GZ8A 3DV3A 3QYWA 4FODA 4EKLA 4FG7A 4MCVA 2C3JA 4J7BA 3TNIA 4UWBA 1J3HA 4YURA 5IQIA 4U42A 4RFZA 4A4LA 5JSMA 3JPVA 4OBOA 3O0GA 2JEDA 4CFVA 3LCOA 2BZIB 2NRYA 5BMSA 4S33A 2HY0A 3P78A 3EL8A 2X81A 2B55A 3ULIA 1STCE 5IUIA 3VF8A 2ZM3A 2F4JA 3BU5A 1U59A 3DJ6A 3W55A 3W2RA 5CU6A 3G51A 4O0XA 5CS6A 4N6YA 4KS8A 2A2AA 4FKTA 2RFSA 1B39A 3R8LA 3RM6A 2RG5A 4FSRA 5HG7A 4GV1A 4ERKA 4PDYA 4XG3A 4F7LA 1FQ1B 3NWWA 3R1NA 4IX4A 3QGWA 2VX0A 3COMA 4G5PA 2UZVA 4ZOGA 2WIPA 4FKWA 1VYWA 3HAMA 2VWBA 3ATTA 4FSYA 4BI2A 3BQCA 1XR1A 3ORKA 4MQ2A 3C4ZA 3GC8A 5CU4A 3RWPA 3R28A 4FUXA 2XIXA 3O23A 4JI9A 4YO6A 4I22A 3NUSA 4FTCA 2PHKA 3ZUUA 2X4FA 4ARKA 4I41A 4AW1A 4EHZA 5M07A 3GI3A 5AV3A 1KUTA 4IB5A 1H1SA 3ZEPA 3UOHA 3U54A 4CT2A 2H34A 5A46A 1J7IA 3MS9A 4UMUA 5C4LA 4MBJA 4ZSEA 2JDSA 2CKQA 5EQPA 4R78A 3RINA 4GFMA 1ZOEA 4ANOA 1CKJA 4I0RA 3PXFA 3LXPA 2YITA 4F1OA 5IPJA 4YZMA 4UX9A 4G16A 2W1IA 4GU9A 5LVMA 5BYLA 1M52A 2H96A 2X2MA 3IW6A 2FGIA 4BN1A 4C35A 3GB2A 4EUTA 4JDIA 4UALA 4AWIA 4AZSA 3FLQA 5AIKA 4AOTA 2JAMA 2YACA 3HKOA 4FG8A 4FIGA 2VTOA 3BHVA 2GQGA 3C0GA 1NA7A 4C4HA 1JOWB 3RNIA 2ZVAA 3F3VA 4QP3A 4IAFA 1OVEA 4YHJA 5CENA 4CLIA 2W0JA 5CT7A 3FYKX 1H24A 4Q5EA 2UZUE 2VTLA 3MIYA 4BGQA 5CVGA 3BLQA 4N4SA 2UZWE 3IOKA 4LMUA 1M2QA 3F5PA 3BWJA 5JZJA 5EK7A 2H8HA 3MVMA 1Y91A 4WKQA 2ERKA 3KQ7A 3Q9ZA 1MRYA 1U5RA 4LUDA 4EK4A 3D94A 5D1JA 5DHJA 1R1WA 2HELA 4FV8A 1JSUA 1KE7A 4JX7A 4BCHA 2J2IB 3QCXA 4AOJA 2PMLX 2PZRA 3HX4A 4AA5A 4PDOA 4U97A 5FBOA 2QOQA 4AGWA 2UUEA 4RIWA 3A7FA 4S2ZA 4JL9A 2OH0E 3G0EA 5HGIA 3NLBA 3ZRMA 4JT3A 4C3PA 1IASA 3L8XA 4RA5A 4UV0A 5D12A 3VS3A 2YLEA 3FY2A 4UEUA 4V05A 4BVUA 3ID6C 3EQCA 5JFWA 3V8SA 3A99A 2OJGA 3M2WA 2PY3A 2A1AB 4L46A 4C34A 1ZMWA 3TI1A 2IZTA 4C0TA 2AUHA 2CN5A 2Z60A 2VTQA 5C01A 1OITA 2F49A 2XS0A 3JVRA 3CP9A 3SXRA 5HEZA 4YHFA 4IAZA 5J1WA 4HNFA 2WQEA 5JN2A 4DTAA 3EQDA 1OPJA 2XIYA 3D14A 3DQXA 3QCSA 3NUUA 4UWCA 3S2PA 1QPEA 5G1XA 4FTJA 4PL4A 2YABA 4W9XA 4EHGA 2ONLC 3BCEA 4KUJA 3GOPA 3RK5A 4BCQA 3O7LD 3QUDA 5ETIA 3EQHA 3PA4A 2BKZA 2PUUA 4YJSA 4CFNA 2YWPA 2BRBA 3LQ3A 3GQLA 3UJGA 3JUHA 3NW5A 4BCGA 1ERKA 2REIA 1J7UA 1XBBA 5ANGA 4GSBA 3OT3A 4JXFA 2QOIA 3R8PA 3RTPA 2BHEA 2PMOX 1E1VA 2UW0A 5AR2A 3SD0A 4JQ8A 4PF4A 4NTTA 3L9PA 4E20A 2XCHA 4KKEA 4YC8A 5GIPE 5EYKA 3CEKA 2J5EA 4GIHA 5EM6A 3NX8A 4MNFA 4BDEA 5HTCA 4MX9A 1B6CB 4EQCA 3L1SA 3PE1A 3ORPA 3D7ZA 2CNUA 1R0EA 4EEVA 4NM5A 1TQIA 2IO6A 3VJOA 3FSKA 3FMDA 3QX4A 4IDTA 5AJQA 3CQEA 2OIDA 2BZJA 4CKRA 2XP2A 4F9BA 2YAAA 4RX5A 4UN0C 5IH4A 4NZWB 4R1VA 4XEYA 1S9IA 4AACA 5LQFA 1WVYA 5HZNA 5JEBA 3GENA 4ZZNA 2YIRA 4IB0A 5CALA 1Y57A 1OPLA 4Q5HA 1YI3A 3RMFA 4W4VA 4QRCA 2XCKA 1PMUA 2FVDA 2OJJA 1A06A 4JBOA 2G1TA 2HENA 2R64A 2XH5A 3DPKA 3KF4A 3NS9A 4M7IA 4Y5QA 2QD9A 3KEXA 3QBNA 3LMGA 5EOLA 4LL5A 2HWOA 3E7OA 3FUPA 1Q41A 4PV0A 5CSHA 1G3NA 4F7NA 5CXZA 4C2WA 3FC2A 3EQGA 4LI5A 1WBTA 4XP2A 5EDQA 3V5QA 5KMMA 3K3JA 4R7BA 1SZMA 3JY9A 3QKKA 1GZKA 4WUNA 3ORZA 4IVCA 4OTIA 5GJFA 3DK3A 4XBUA 3ZSIA 2WMBA 3ZYAA 4K11A 2VTIA 4Z7HA 3Q3BA 4DAWA 2QOKA 3LQ5A 3TZMA 4ACCA 4MD9E 5A4EA 5M06A 3UZRA 4FEUA 3G90X 4RX8A 3RPVA 1FINA 1H26A 5CLPA 3MIAA 2YM7A 4S34A 4W4WA 5GZ9A 1YHVA 3E8DA 5DVRA 2G9XA 4IACA 4GRBA 3AC1A 4D28A 3QXPA 3AT3A 1URCA 5AP2A 4JQEA 1KOBA 1YXSA 4ACMA 2ZOQA 2QU5A 3IPHA 3PPJA 3UYSA 1NXKA 1PY5A 4RX9A 5KMOA 3DOGA 3I1AA 4RVMA 3GCVA 5AP5A 4BWKA 4I0SA 2AC5A 3IONA 4TWOA 4WD5A 3LCKA 3H9RA 3CXWA 1V0PA 2VTPA 3AMBA 5ANIA 4KIQA 4QMVA 1TKIA 2E9UA 5LCJA 4AOIA 2JGZA 2O64A 4H36A 2XVDA 3DBFA 4PDSA 2RF9A 3V3VA 3O50A 2XJ2A 1V1KA 4MXCA 5CAPA 2CSNA 4I5MA 5J95A 1P5EA 3B2TA 3TDWA 3GU6A 4IQ6A 4C7TA 4ZMFA 1OI9A 1ZMUA 2PVMA 1OBGA 4W8DA 3AG9A 4U43A 3CSVA 4YC3A 4MAOA 2G15A 3MA3A 5AM7A 4D2WA 3PVGA 3TNWA 4PMPA 3F3ZA 2O0UA 4E1ZA 2C3KA 1FPUA 3S95A 4F65A 2WMVA 5HBEA 1OUYA 3MWUA 4QMTA 5I0BA 4IFCA 5AUZA 4D4VA 3UVPA 1OB3A 3GCPA 4IE9A 4AAAA 4L8MA 1UV5A 2X2KA 5DBXA 2V22A 4KWPA 4BZOA 2W1GA 2EXEA 4G9CA 4YJNA 5HD4A 4MVFA 2O3PA 3Q5IA 5G6VA 1Y6BA 4ZP5A 2PE0A 4LGHA 3DKCA 3PSDA 4F6UA 2WHBA 5EM5A 3OHTA 2YM3A 1E9HA 4XYFA 2V5QA 3DBDA 2AC3A 5J7BA 5KMIA 4G1WA 3JR1A 4DFBA 4D1SA 3U8WA 2YDIA 1MP8A 5CEOA 4WIHA 5HNGA 1H4LA 4FGBA 1Q4LA 5HTIA 4OAVB 4BGGA 3OBJA 2A19B 2GCDA 5IEYA 4QO9A 3KMUA 3OUKA 4Y85A 2Y0AA 4E6AA 5I3RA 4I23A 3FAAA 1WCCA 4CYJA 3K5UA 2BIKB 2X6EA 5BYYA 3ZUVA 3HYHA 3MVHA 3V04A 1OGUA 3PY3A 3RZBA 4BFMA 4F9AA 4GKHA 2Y7JA 4U3ZA 1YWRA 4QP2A 2IZUA 4AQCA 2JIIA 2GPHA 3TNQB 3FHIA 5BNJA 5DWRA 3MI9A 1W83A 1JWHA 2B52A 1UWHA 3E93A 5K0KA 4AGUA 3FXZA 3LM5A 3QUPA 2B9FA 5GNKA 4EOKA 1ZXEA 2Q83A 3NW6A 4TYIA 4FNWA 2BAQA 3F7WA 3U6IA 4OBPA 2R3OA 2UZEA 4X2JA 3KRJA 3ORLA 1O6KA 4I6HA 4JBQA 2YFXA 4H3PA 4O2ZA 4IJPA 1YKRA 2YZLA 2JKQA 1YQJA 4S32A 4YPSA 4AT3A 2FUMA 1OKZA 3CE3A 3ERKA 2J0JA 3CGOA 3MYGA 4FV2A 4GJ2A 3VBVA 3NEWA 4E6CA 5L2SA 2ZV7A 4XV2A 5IG1A 2XBAA 3IGGA 3KMMA 2VTMA 4E5WA 3CC6A 1Q8ZA 2OXDA 5IUGA 5JQ8A 4FKOA 3LFNA 3NZ0A 5DFPA 5BVKA 4QQ5A 4QT1A 4FGRA 1KE8A 5ANDA 3R7GA 4HNIA 5C9CA 5KBQA 5HOAA 3GC7A 4RIXB 2XJ1A 3FLSA 3EQIA 4P7EA 5AR8A 3OXZA 3QTZA 3QTWA 4U7ZA 3NGAA 1W0XC 2R3KA 3QCQA 4BDGA 2GQSA 2XNBA 4F0IA 4EH3A 5K0XA 5CAQA 4L53A 4E7WA 2VTHA 4IFGA 1JNKA 2FSOX 2UV2A 3OVVA 4BKJA 3IDPA 4QTDA 2QR8A 3CPBA 3F5GA 2R9SA 2ITUA 3KC3A 3ZLYA 4FK6A 4OGRA 3SW7A 4E4XA 4GT4A 1OZ1A 4KBCA 3PIYA 4NKAA 3H30A 2G01A 4FEWA 4HGSA 3PVBA 4I5HA 4NCTC 3R73A 2A27A 4DH8A 2CCIA 1UNLA 2IW8A 3NR9A 3E8NA 4DEGA 3LLAA 4H3QA 4IMYA 3F5UA 4GFGA 4GS6A 3IDBA 1QL6A 4YZCA 5EHOA 4M8TA 3OZ6A 4BCNA 4CSVA 3BYMA 3F3UA 4KRCA 4R8QA 4QMQA 1NW1A 2X9FA 3QRUA 3W33A 2C0OA 3I4BA 4KS7A 4EK3A 3UP2A 3Q32A 4D4SA 3VS5A 1Q8WA 3BE2A 3HZTA 2ITTA 4QYFA 4Y83A 3ZBFA 5HLWA 5DGZA 5M4FA 2W7XA 4ZTHA 2VX3A 2E9OA 1CM8A 2Y9QA 4BDCA 2VTRA 3LIJA 4GMYA 4E93A 4I4EA 5CANA 3SRVA 4TTHB 4EUUA 3PDTA 4A9YA 5M09A 3WYYA 5HVKA 2VTTA 5ACKA 3CQUA 2UZTA 4EOPA 5CZIA 5AP3A 2WQBA 1WAKA 2WMSA 2VWYA 1RQQA 5CEMA 4H58A 3LFAA 1W8CA 4N0SA 4X3FC 3SHEA 1LEZA 1WBPA 2QKWB 5AAGA 4RJ7A 4B8LA 4YR8A 2CKPA 4FIJA 2X7OA 3PWYA 4YTHA 1ZYJA 4M0YA 2FA2A 2JBPA 5F95A 4NFMA 2VNYA 2VWUA 3Q2MA 1HOWA 4CXAA 1KE6A 5M08A 2X8DA 3LCSA 3HGKA 2Y4IC 3LXNA 3VUHA 2YA9A 4M69B 4E5AX 2ONLA 3A60A 5T68A 4ANMA 3D2KA 5KBRA 3TDVA 4RIYB 4FV3A 3QUEA 3D7TB 4U80A 4C4IA 4XRLA 2WAJA 3Q9WA 5AAEA 4TPTA 4KIOA 4H3BA 5KMKA 3TUBA 5K5NA 4DINA 3D5WA 4RWJA 5KMNA 2VO0A 5B2MA 2BROA 4RJ6A 5IMXA 3BBWA 3EQPA 3TL8A 5JQ5A 2F7EE 4DH5A 3A7GA 3G6GA 4Y73A 4L9IA 4U40A 2F7ZE 4YUQA 3DNEA 4IVBA 3RAIA 5JGAA 4I93A 3CPCA 2XYNA 1RW8A 4O38A 4M3QA 3PZHA 2ZV8A 3BI6A 3QHWA 4GW8A 5I4NA 2GS2A 3F6XA 4YJOA 3KN5A 4FTRA 4QQTA 1KWPA 3R8VA 4RX7A 2QURA 5AUTA 1UU3A 2XRWA 3OG7A 3QYZA 4X3FB 4PMMA 3VN9A 1J7LA 3NVMB 2IW9A 3EKKA 4FKSA 3KU2A 5DR6A 2JFLA 3AC4A 2WMRA 4WG4A 2UZNA 3SDJA 2OU7A 3PY0A 2W1DA 4J71A 5ETAA 3U4WA 1FBNA 3ZFXA 3QWJA 3ZC6A 4ZS0A 2Y4IB 3HUBA 1JQHA 2VNWA 4J8MA 3AMYA 4RIOA 1IAHA 2EUFB 1S9JA 5IISA 4F7SA 2J4ZA 4WNKA 4YSMA 4QMZA 4D58A 4FNXA 4XNEA 4Z16A 5C8NA 4UYNA 3VUKA 3TKIA 3COKA 2XK9A 3R02A 4FKVA 3FZSA 3FZTA 4L6QA 3ZSGA 1QPDA 4ERWA 2WNTA 2XK4A 3D5UA 4U81A 3O7LB 4GUEA 3BHHA 4Y72A 3Q4CA 2E9PA 5E92A 3TJDA 2VZ6A 4Q9ZA 3I81A 4BC6A 2WQMA 5GJDA 2PZ5A 4AS0A 2VWZA 4FYNA 5CXHA 2OJIA 4XG2A 2FH9A 4CGAA 3GEQA 3HMNA 4FL2A 4YC6A 4BICA 4YZ9A 1VR2A 3GFWA 5M56A 1WBOA 5D9HA 2C5XA 3QRIA 4QNYA 2R0IA 4HVHA 3NNWA 2C4GA 2X2LA 2OXYA 5GZAA 5K4IA 4DGNA 3KXGA 2CDZA 3O8UA 2EWAA 2YM5A 4GK2A 3V5LA 3ZDUA 4KABA 2PUPA 4R5SA 2VO7A 4ANLA 3TUDA 4XLVA 5HO6A 4AGDA 5EM8A 3T9TA 3TG1A 2I7QA 3MVJA 4EK8A 4RPVA 2WFYA 3RPYA 2QHNA 4R6VA 4FT3A 3PLAE 2QO9A 1GZOA 4BY9E 3NRMA 3OCTA 4C38A 5CSPA 2JC6A 2F7XE 5E1EA 2FO0A 4M84A 3Q52A 4YLJA 4ZJIA 4GYIA 3BLHA 2HZNA 4BB4A 2I1MA 4Q9SA 1Y8GA 3OUNB 4EBVA 5HU3A 4O0TA 3Q4UA 2C68A 3TV7A 4HPUE 5J1VA 3EKNA 5L8LA 5KCVA 3WZJA 2WEVA 1Q97A 2W4KA 1Q5KA 4BDAA 1SVGA 5CASA 4FTKA 1SM2A 2JBOA 2BCJA 3A2CA 2XNEA 4OBQA 2GDOA 3W8QA 1XQZA 4WG3A 3UG2A 1LEWA 3PA5A 4EOSA 1OL5A 3ATSA 5A6NA 4BRXA 3AD4A 3FE3A 2XIKA 4EWHA 4ZZMA 1FGIA 4RC4A 4W8EA 5LMBA 4Z9LA 3C4CA 3BKBA 4F9WA 3R7EA 4C36A 1HCKA 3FQEA 2J50A 3FHRA 3V5TA 3W2CA 4CV9A 2GNJA 2YJRA 3KF7A 3WZUA 1G8AA 3UIBA 3OBGA 3TZ9A 4TYHB 4CYIA 4DH3A 4C8BA 4NIFB 3IDCA 4F4PA 2YISA 2VAGA 1PRYA 3KULB 3OEZA 4CMTA 2OJFE 5B0XA 4G9RA 4ORKA 2PVNA 4FTAA 4RFMA 4MXXA 3WE8A 4EBWA 5JFXA 2PYWA 5AWMA 4O7LA 5I9ZA 2YLFA 1SMHA 3AGLA 3F9NA 3R0TA 4APCA 4D0XA 4QMWA 4CQGA 5IA2A 2R3QA 3VW6A 2BZHB 4U45A 1QMZA 2R3IA 3P79A 5HICA 3NUAA 2R2PA 1H1PA 2EVAA 3EL7A 4BZNA 4NFNA 2VTAA 2ZDUA 3KN6A 2PZPA 5BMMA 4YZDA 3U87A 5A4QA 5IA1A 3B8QA 5HLPA 3UZPA 4M68A 3DBEA 4PP7A 3ORXA 2QG5A 2F9GA 2XNOA 3QA8A 3R7OA 5K3YA 1OIUA 3ORNA 2I6LA 2GNGA 5HORA 4ANQA 1UVRA 4XHKB 4IM0A 3RK9A 4NK9A 4BBEA 4E8AA 4U6RA 2DWBA 1H8FA 3MFSA 3LMIA 1M7QA 3F2NA 2QOHA 3HV6A 4LRKA 4EK5A 1Z5MA 4D2PA 2HZIA 3ELJA 3PE2A 4K2RA 1K3AA 3C4WA 3DQWA 1YI4A 4QYGA 2BUJA 1T45A 1UA2A 3R8MA 4LGDA 4CFMA 5BVFA 3RAKA 1YOMA 1UWJA 1MRUA 4TWCA 2ITQA 5EDRA 5AR4A 5F4NA 4ALVA 3LFQA 4PQNA 3O8PA 3UIUA 4JR3A 3V5WA 4IAYA 2UW5A 4FTUA 2BAJA 4FV5A 4WHZA 5BVEA 4EH6A 1RJBA 3NPCA 2VX1A 4O27B 2YEXA 5FP6A 4DGLC 2XK3A 2JDRA 2G2HA 3MY1A 2BDFA 1YOJA 3NMUF 3DK6A 2NP8A 2QQ7A 1ZMVA 3KXXA 4QNAA 1OECA 5LARA 2C6EA 3P9JA 2XM8A 2IWIA 5BUEA 1F0QA 3Q4TA 3AGMA 3OWLA 3FXWA 5AV1A 3Q9YA 2R3JA 3JY0A 5BVDA 3MY0A 3UMWA 2G2IA 5CWZA 1M17A 4LG4A 4DFZE 4HGEA 3S4QA 3FKOA 3FPMA 3HRBA 4WT6A 5IZFA 1UU7A 4IH8A 2PU8A 1GY3A 1GZ8A 5EYCA 4ONAA 5HE2A 3POOA 4F70A 2DS1A 4G3FA 2KULA 3SOCA 4IWQA 3UO6A 4EH8A 4I6QA 4NM0A 2B1PA 4L42A 3FMMA 3IW5A 3CTQA 5HE1A 5A54A 3AT2A 5J8IA 3R7YA 4K77A 4UXLA 4EH7A 5IQEA 2PVKA 3A7IA 3UVQA 4K33A 1OIQA 3K54A 3E62A 4FR4A 3S00A 4DFUA 2ITZA 4CZYB 4FIHA 4KSPA 5IA4A 3DLZA 3MH2A 2GFSA 2BFYA 4UMQA 4FSTA 4C4EA 2AYPA 5H8BA 4FV9A 2Z8CA 1ZRZA 4GG5A 3E64A 3QWKA 4DG0E 3GBZA 3DAKA 3Q5ZA 2IZSA 1M14A 5LXMA 4MQ1A 4AE6A 5CAOA 4F0FA 5DA3A 4FTNA 1ZYSA 1V0BA 4Q2AA 2GNHA 4JBPA 4AXAA 4HOKA 4JQ7A 5L6WL 5HG5A 1JKLA 1H1QA 4PTGA 5CEIA 4JRVA 4QTBA 4EZ7A 5AV4A 4ZLYA 2QCSA 3E3BX 3EWHA 2VD5A 3RGFA 3D4QA 3LVPA 3QU0A 4ZTLA 3KY2A 3HV7A 4O86A 2CKEA 1I09A 2J7TA 3OD6X 4FKJA 3P7BA 4QP6A 4FZFB 1W98A 1A48A 3GU8A 3IGOA 3TV4A 3Q9XA 4ENXA 5DT0A 2R4BA 3ZLXA 4TYEA 5HNBA 2WMUA 4BDBA 3E8CA 3OWPA 4O0WA 3FSFA 2OFVA 1PXOA 3DBCA 3UVRA 1QCFA 4H05A 2WOUA 2W4OA 3KRWA 2FSLX 3QKLA 4PPBA 4BCMA 5ACBC 3DFCB 3VHEA 2YCFA 3CIKA 2JAVA 3LFBA 4KBKA 4PWNA 4TZRA 5F9EA 2HW7A 3IOPA 3UBDA 4UMRA 4OTWA 2BTRA 3OC1A 2F57A 4KRDA 1G5SA 5AIRA 2YERA 2O8YA 2RFDA 4JLCA 2W1FA 4HVGA 4JAJA 2OWBA 4O6EA 2XK8A 4XG9A 3ZZWA 4ITIA 4DGMA 1AGWA 3MH3A 3HA8A 3PG1A 4FVQA 4HW7A 4X2FA 5KHXA 5IQAA 1ZY5A 5HQ0A 3Q6UA 2JLDA 1WVXA 3C51A 5C8MA 4TN6A 1PMNA 3SW4A 2F2UA 2YCQA 3MTFA 4L3PA 1PKGA 2B9JA 2OF2A 1PF8A 3F5XA 3FMJA 4LQMA 3KREA 3DKFA 3MVLA 4FV4A 3WILA 4GVAA 5AR3A 5L2QA 3QXOA 2CLQA 5C4KA 4DN5A 4WSQA 2JKKA 2X4ZA 4EOLA 4DA5A 5DT4A 2ESMA 2CCHA 3H3CA 5M4IA 1YHWA 2C47A 2X39A 1X8BA 4J1RA 2GHLA 5HNIX 4EOMA 2C30A 2P55A 3COIA 3KVWA 3LAUA 2J0LA 3NAYA 2OZAA 1H1WA 3D0EA 4A9TA 4CZUA 3TM0A 3AXWA 4XG4A 5DE2A 2XEYA 2WTCA 4KBAA 4AN9A 3EFKA 2R3HA 2PE2A 3R1YA 4MBLA 3NUYA 2QOOA 3PXQA 1A9UA 3BV2A 5TR6A 5A14A 2X6DA 4H1MA 3N9XA 4DFNA 4FKGA 4C3FA 4S30A 4X3JA 4ZSLA 4BCIA 2QVSE 4RRVA 3LJ2A 1SVHA 4BGHA 3RP9A 2YM8A 3U9NA 3WI6A 3PZEA 3UOLA 3KGAA 2Z02A 4USFA 2W1EA 2YAKA 3FC1X 4KIKB 4BKYA 5E8SA 4DEAA 4YO4A 3TUCA 3R2BA 4K9YA 3GFEA 4B0GA 2GMXA 3JXWA 4GT3A 3ALNA 4L52A 5EYMA 3RHXA 1OL2A 5EQYA 4LM5A 4DG3E 4FKUA 1XH4A 5EM7A 1YXUA 3BEAA 5HCZA 4D0WA 1URWA 2PE1A 1GJOA 4RLLA 1J91A 4DG2E 2CGUA 3UTOA 3WIGA 1BL6A 2WEIA 3D9VA 4P5ZA 4FG9A 2C0TA 2FYSA 5L8JA 3C4XA 1UNHA 3LFFA 1BI7A 4DT8A 3A4PA 1U5QA 3QQUA 3VS7A 4EYMA 2X7FA 4GYGA 2WTDA 4XV9A 3TV6A 4AZFA 3PVWA 5AEPA 2QG7A 3C0HA 1PMEA 4R7IA 2V55A 3GT8A 3O71A 3ZCLA 3F2RA 2YWVA 2FSTX 3LHJA 3F69A 3BWFA 4I0TA 2YJSA 4S31A 2VWXA 3HP5A 4IC8A 2CKOA 3AC5A 3Q6WA 3RVGA 3EZRA 3OY1A 1T46A 3M42A 3EN6A 4FL1A 1Y8YA 2PMNX 4FVRA 4HCVA 1PMVA 3NW7A 2I40A 5GINE 5HU9A 5BUJA 2VWIA 4IZYA 3AC2A 3DA6A 4F99A 5IH5A 4OLIA 1XH5A 4HPTE 4JAIA 2WELA 3NAXA 2QODA 3R7IA 4IC7A 4WUAA 4RLKA 2BRGA 4FE2A 3BX5A 3HV4A 4IX3A 4J8NA 2XZSA 3OROA 1ZOHA 2W99B 3DK7A 3FZOA 3I0QA 4NU1A 3TZ7A 5IQGA 5B2LA 1Q99A 1BUHA 5HE3A 4MK0A 1SVEA 4OUCA 2VGPA 4L7SA 4G17A 2VU3A 3QLGA 3DS6A 3BRBA 3ODYX 4RQVA 3LLTA 3LCDA 1BMKA 3VUMA 1QPCA 3I60A 5CSXA 3D5XA 4WRGA 3KCFA 4F9CA 4AFJA 5EYDA 2C5YA 3QD3A 3UMXA 4ASZA 4QP7A 3OMVA 4IWDA 4EYJA 3A7HA 5CEKA 4FNZA 4FEVA 2B53A 3R7VA 2ZB0A 1JLUE 4KNBA 2BKKA 5EQEA 1B38A 4EORA 3VJNA 4O96A 4ANBA 4CKJA 4DFXE 3CR0A 4BI0A 1FOTA 3FEGA 4AUAA 1YOLA 4A9RA 3L8PA 1MQBA 3L8SA 5GIOE 3W10A 5FXSA 3VBWA 3LFEA 3FKNA 3ALOA 3K3IA 4YJQA 5F1ZA 4BDKA 4TL0A 5FDPA 5HIEA 2HCKA 3D5VA 2NNWB 3Q2JA 4EH5A 5CNOA 3IQ7A 5FXRA 3SG8A 3Q60A 1PKDA 4ASEA 2NRUA 4ZTRA 5LVLA 3JVSA 5FGKA 2X8IA 4ID7A 5J5SA 1LR4A 1QPJA 1ZZ2A 5JGDA 1L3RE 3EFJA 3N4TA 3IECA 3U51A 4F1TA 5AUWA 4AN2A 4IVDA 4C3RA 2WQNA 2R7IA 4BBMA 4G6LA 1W82A 5ICPA 4AN3A 4AW0A 3LJ0A 4DC2A 2UZBA 5E91A 3BGPA 5CVHA 1ZWSA 4PY1A 2BRNA 3O17A 4R3RA 2HWPA 3QTSA 2O2UA 4NW5A 2B7AA 4UZDA 5JH6A 3PG3A 5HBHA 3GQIA 1F5QA 4YMJA 3QL8A 4C4GA 1WBNA 1Q8UA 1CKIA 4OTQA 4XG7A 4BTFA 4DBXA 3R9DA 3LJ1A 5CU3A 2ITPA 2XRUA 2C6LA 2BILB 3LCTA 4D4YA 1YXTA 4DEIA 5ETCA 1KV1A 3R9RA 4MH7A 2R3MA 3IK3A 4II5A 3GU5A 4QMLA 3THBA 3OP5A 4O83A 3QQLA 5LMKC 3R21A 3VIDA 3OOGA 1O9UA 2G2FA 2H9VA 3DLSA 2QKRA 4IEBA 3SV0A 3TT0A 5IUHA 2OO8X 3DY7A 3PP1A 2PVYA 4KKHA 4HGLA 3QF9A 4MXOA 3OW3A 4PTCA 4U5JA 5AM6A 3SLSA 3RAHA 3P5KA 4MEDA 1U46A 3CCNA 4V0GB 4OTPA 5M51A 2WO6A 1OUKA 2BRHA 3ZHPC 5LVPA 4O82A 3NIEA 4N70A 3KKVA 4BYIA 3ULZA 3IW7A 4AX8A 4UMTA 1H27A 5AA9A 2XJ0A 2PL0A 4DCEA 4QMMA 4ZZOA 4U8ZA 2C0IA 3VQHA 4O7SA 5EI2A 2JITA 3EYHA 5AFVA 4FTIA 5CYIA 3RWQA 1XH7A 3SXFA 4X2KA 5E8VA 4G6OA 2OGVA 2XB7A 1BL7A 2H6DA 4AT5A 5KE0A 4M66A 4YHTA 5EHYA 4BDDA 4CG9A 1REKA 1NVSA 2J0IA 2R3PA 5HX6A 3PPKA 4C02A 3DB6A 4BBFA 4MBIA 4CMOA 1H0WA 4GK3A 3IS5A 4AU8A 3II5A 1DS5A 3PVUA 2HXLA 2BPMA 4B7TA 1VEBA 4I20A 4LV8A 3RPSA 3GNIB 4R5YA 4EHEA 4I5PA 2ZYBA 3SXSA 2GS6A 3L8VA 5IA0A 4PP9A 5B2KA 3SG9A 3FMHA 4TRLA 4RMZA 4BCPA 2P3GX 3PJ2A 2IVTA 3ANRA 4IAKA 5H3QA 3IW4A 2J5FA 4D4RA 4F9YA 1YWNA 3NIZA 3PP0A 2XIRA 3DCVA 3P86A 4IWOA 4NYEA 4G3EA 3ZO4A 5L2IA 5LMAA 3I79A 4LRJA 2OICA 4OAUC 3KXZA 4X21A 3PPZA 2YM6A 4RBLA 5FRIA 3FZRA 3QQFA 4YLKA 2V7OA 2Z2WA 2CJMA 3RK7A 2GU8A 3F7ZA 4A07A 4FKRA 1ZAOA 3MN3A 1PXLA 1CKPA 4EQUA 1O6YA 2E9NA 4FSNA 4YJTA 4YJVA 2VUWA 3S0OA 3KCKA 2QC6A 5HCXA 1VZOA 3BU6A 2EU9A 4IJ9A 4P2KA 5J9YA 1IRKA 3BQRA 4U44A 5LWMA 3EZVA 4O0RA 4RT7A 1H1RA 3G9NA 1ZARA 4UY9A 3BYUA 4BI1A 4EH2A 2ZMCA 3OWJA 4BCOA 4FV7A 2RG6A 2PUIA 4LOPA 3R30A 5A4LA 1L8TA 5H8EA 2F2CB 3UO4A 1Q3WA 3HECA 4IBMA 2OJ9A 2OFUA 3ZBXA 4ANNA 3BGQA 4O84A 4R3PA 5DH3A 2XK6A 2PVLA 4BTKA 1UNGA 2LGCA 1YI6A 3QFVA 2HW6A 2XKCA 3EN9A 5A9UA 5DMZA 3VVHA 1ZOGA 3GCSA 3NYVA 3ZS5A 5GJGA 4ACDA 5BVNA 4LRMA 3VC4A 2ACXA 3E3PA 4APPA 3PLSA 4DLJA 3UPZA 3VUTA 3C50A 5CI7A 2EB2A 4MYGA 4CFFA 4HVIA 1YXVA 2OIQA 3HLLA 3I5NA 3BPRA 4UXQA 5TE0A 3CBLA 3MH1A 2GFCA 4CCBA 4EH4A 5BPYA 2WB8A 2VV9A 2Y6MA 2BDWA 3BHTA 3QQKA 4G34A 2BRMA 2OI4X 4BCJA 1ZLTA 4QTCA 3FL4A 5EH0A 2QI8A 5AP4A 3WOWA 4EC8A 5HKMA 4MKCA 3LM0A 2KTYA 5A4TA 3JYAA 3FLWA 5I5ZA 3MFTA 1OL1A 3DU8A 5FEDA 1TQPA 4E6DA 5CX9A 4LUEA 4CFUA 3LFCA 2UW6A 4A9UA 3TXOA 3FWQA 5FM3A 4ZEGA 1XO2B 3PXKA 3MTLA 4MWHA 4FSQA 3QHRA 4OT5A 4RG0A 4RVKA 4CT1A 4ZSGA 4EOOA 1I44A 4EI4A 3UC3A 2ZV9A 3FZPA 5AUYA 5EKNA 3DAJA 4CFWA 3DXNA 2HOGA 4DEBA 1FVTA 1LPUA 1APME 3C4FA 1JKSA 3Q96A 5DG5A 3MH0A 3DJ7A 4A4OA 3VS6A 2OZOA 4NW6A 5AX3A 3NYOA 4I1ZA 3RNYA 5KO1A 5BQ0A 2OBJA 5DNRA 5EG3A 3W1FA 4BIBA 4I6BA 4CFXA 4XJ0A 2Y6OA 5C03A 3SOAA 4RIWB 4CRSA 1XBAA 4XOZA 3HDMA 1WVWA 1XBCA 3C9WA 5DN3A 2VO3A 5M57A 5FD2A 3BE9A 4PPCA 4EZ3A 5IMEA 4LFIA 3TNHA 4XLIA 3U4UA 4C4FA 2JDOA 4ZTSA 4ZJVA 4M12A 1YDSE 4N6ZA 5ETFA 4USEA 5JT2A 4JDJA 2PSQA 1M7NA 1TVOA 2XM9A 3EFLA 3GC9A 4WOVA 5AV0A 3G33A 2W5AA 4D55A 3E87A 5DI1A 4KB8A 3UOKA 4BCFA 1OM1A 4RVTA 3NNVA 4IZAA 5BYZA 4GU6A 4CTBA 5CI6A 3FYJX 4YTIA 4BHNA 4DE4A 2PVHA 2CN8A 4F6WA 4CCUA 4XUFA 3P4KA 4RZWA 3ZXTA 3R8ZA 3NUNA 3C4EA 4CZTA 3LPBA 5GHVA 3PA3A 5HTBA 3P0MA 5IDNA 3F3TA 3R1SA 2GHGA 3R63A 4FICA 3HMOA 4JBVA 1Z57A 5HG9A 4X0MA 3SA0A 2I0EA 4X6RA 3VS4A 5AA8A 3MPAA 2CLXA 3WF7A 4NUSA 2B54A 3VW8A 4O2PA 3FBVA 4BKZA 4D9UA 4RA4A 5CTPA 4QMXA 3PSBA 4WRSA 2WKMA 3RPRA 5CQUA 4DEDA 3GC0A 4JNWA 4Y95A 3WF5A 4XCUA 4OT6A 2P2HA 3CLYA 3OW4A 4I24A 4U9AA 2QO2A 1GOLA 4CG8A 2IG7A 3VBTA 5I9WA 4WG5A 2BR1A 1CMKE 4FTMA 3HRCA 3U6JA 1WZYA 2ZMDA 2DYLA 4JG7A 2X1NA 3ZO2A 4B99A 3DTWA 3MY5A 2C1BA 3NYNA 5E9EA 2W9FB 3MDYA 4AA4A 5E8UA 3SC1A 2ERZE 3L9MA 3UYTA 2GQRA 4O81A 5J9LA 2UW3A 4RIXA 4IHPA 2Q0NA 3PJ3A 4L45A 4TXCA 3EOCA 3MB6A 5JFVA 4QPAA 5CSWA 4F64A 4BF2A 4O6LA 3CKWA 4AZEA 4OTRA 2QHMA 3BGZA 1WMKA 2R3RA 3DDPA 3OCSA 3QC4A 3QQGA 4FT5A 4I6FA 4RSSA 2XNMA 4ASXA 5IH6A 4BIEA 2R3GA 4LGGA 5B7VA 4DFLA 1IEPA 4PNIA 3HMPA 2VGOA 3R01A 3RALA 4NKSA 5CEQA 2LAVA 5CF5A 1G8SA 2J0KA 5ANEA 4G3CA 4O7VA 2B9IA 3ZXZA 4V01A 4HYUA 4E4LA 2DUVA 4TY1A 3RCJA 3VULA 5K5XA 4D2RA 5KMLA 3F82A 3FI3A 3MPTA 3QZGA 4IXPA 4LOOA 4GIIA 4U41A 4B9DA 2XEZA 3RAWA 4BWPA 5L2TA 1UKIA 4FKLA 5E1SA 3COHA 3D2IA 1K2PA 3V8TA 5T6KA 4CQEA 4RC3A 3AC3A 5KX8A 4DCAA 1M2PA 1XHAA 2ZM4A 3CTHA 3FQHA 4A4XA 5FWKK 3M11A 3C13A 1J1BA 3C5UA 3EN5A 4K18A 3M1SA 1BI8A 3GVUA 4O21A 4HJOA 4YBKA 3G15A 4XX9A 3FQSA 1PW2A 5C1QB 4Y5HA 4AG8A 2WIHA 3OS3A 4O7YA 2OKRA 2YN8A 5TF9A 1IR3A 2Q0BA 4MTAA 2EXMA 3T3UA 1OIRA 1YVJA 3I0OA 4JIAA 4BR3A 4R3CA 3TZ8A 4AW2A 5CAVA 2VN9A 4ZAUA 5HBJA 2WTVA 3FMLA 2QOCA 1PYXA 3QALE 3SGCA 2RIOA 4EOIA 3KVXA 3I6WA 2IN6A 4QTAA 3HV5A 1LUFA 5IA3A 2W1CA 3VS2A 4FZ6A 2P4IA 1PYEA 3IW8A 2V0DA 3PRFA 5CNNA 5LJJA 4FIIA 3FLYA 2PPQA 5AP1A 2E9VA 4OTFA 1JKKA 3HUCA 3QZIA 4XRJA 5AR5A 4RQKA 1R3CA 3W16A 4NCTA 5KZIA 1P14A 4M69A 4QYYA 1J1CA 2XA4A 3QZHA 4EOQA 4KKGA 4DF3A 1CSNA 4J97A 2UVYA 3GOKA 3QCYA 4WO5A 4RIYA 4G3GA 3VWAA 3FMEA 3D7TA 1GIJA 2CGVA 3AMAA 2C6OA 2W05A 4RJ3A 2DQ7X 4QYHA 3AD5A 3CY3A 2W5HA 3UIMA 3ETAA 4YSJA 4ZS4A 2XUUA 2C6DA 3R71A 4PX6A 2X9EA 4YZBA 4ZLOA 3N4VA 3F88A 2UVZA 4PMTA 4RWKA 1Q61A 2ITOA 4RWLA 4UB7A 4QD6A 4ASDA 4XP3A 5DIAA 4OW8A 4AZVA 4ACHA 5JRQA 2W96B 3FL5A 4GFOA 5CF6A 1OL6A 4L68A 2JIUA 4Y46A 3QTQA 3IO7A 5E8YA 4L00A 5EW3A 3Q4ZA 4GJ3A 5IQHA 4NJDA 3QTUA 4DT9A 2CHLA 3OXTA 1SNUA 1VJYA 4U0IA 3D83A 4DEEA 3MJ2A 4JVGA 3AQVA 4M67A 3ENMA 4X3FA 3ZRKA 4EL9A 1K9AA 4DGGA 2OF4A 2XYUA 3LQ8A 3AC8A 4NSTA 4BDHA 1GZNA 4X7QA 3DKOA 4XOYA 5TKDA 4D5HA 4PTEA 4U79A 4HYHA 4ZLZA 4QQCA 4FSMA 3ACKA 3VUIA 2JFMA 3VBYA 3ZLSA 2C6IA 2WMQA 4JS8A 5EOBA 4GK4A 3TKUA 3U6HA 2OIBA 3A61A 3DGKA 2BALA 4JR7A 3BV3A 4NM3A 1UKHA 1OBDA 2B4SB 2HIWA 5EKOA 4EONA 3PWDA 3R00A 5EHLA 2YIYA 4ZY6A 3NVKI 2R3FA 3ZM4A 1PXPA 2UVXA 2PWLA 4HZSA 3HMIA 3V51A 5LVNA 2VWWA 3NUXA 4O1OA 3W32A 4FZAB 4IW0A 5H9BA 4XV1A 3GP0A 1JPAA 3H4JA 3OT8A 3UGCA 4ACGA 3EQRA 5DPVA 4EH9A 3P08A 2OXXA 4FI1A 5EFQA 5CT0A 1JAMA 5H2UA 2J0MB 5C26A 3HA6A 2C69A 3QD4A 3EJ1A 1RE8A 2CGXA 4C4JA 2R7BA 4RFYA 3TWJA 1RDQE 3QRKA 3GXLA 4A7CA 5I9XA 3BELA 2Z7QA 3WE4A 2C6MA 2WZJA 2JIVA 5DYJA 3O51A 5AR7A 5LOHA 3LKMA 3ZTXA 5E8ZA 3PSCA 4RJ8A 3IG7A 4AZTA 2JKMA 3QLFA 4E73A 4O0VA 4CTCA 5F94A 3BZ3A 2WTIA 4QMPA 3ZUTA 5KNJA 4I92A 5CQWA 5IQFA 4ZIMA 5C27A 5BVWA 1OPKA 4JRNA 5TO8A 1JKTA 4WBOA 4C57A 3A7JA 2JD5A 4Z7GA 5L4QA 4E5BA 3C1XA 3KXHA 3QZFA 3PFQA 4DITA 4X2GA 3KMWA 5KMJA 4AF3A 3ZEWA 3DT1A 5BVOA 3H0ZA 4IM2A 4IZ7A 2JKOA 1DM2A 4P5QA 4ZSJA 2VRXA 4LMNA 3WZDA 3CJFA 2QOLA 4YTCA 1XKKA 4TT7A 4JG8A 3GUBA 1WFCA 1ZY4A 3RHKA 3P23A 5J9ZA 3UE4A 5KHWA 1V0OA 3EFWA 2PZIA 3DNDA 3QD2B 3ZZEA 4BTJA 4E4MA 4CLJA 4D1XA 3UNKA 3HAVA 4O7RA 2GNFA 5FP5A 1E1XA 4E6QA 4PDPA 3HDNA 4AZWA 3WF9A 1HCLA 3CJGA 2WOTA 4D1ZA 4TNBA 4QP4A 2J51A 4FTOA 1CTPE 4DGOA 3DXQA 3ZONA 4W4YA 2HY81 2WTWA 3OCBA 2XIZA 2VTNA 2GNLA 2JDVA 2Y8OA 4WNMA 2WTKC 3VHKA 3ORTA 2B9HA 4KD1A 4KINA 4I94A 5T3QA 3LXKA 4R7HA 2C5OA 2WXVA 3SRVB 3MPMA 4TYHA 4EK6A 4XS2A 1ND4A 3DZOA 4NIFA 2CNQA 3E92A 4ITHA 4FT7A 4QMYA 3VBQA 1PXKA 3KULA 1H0VA 3IKAA 4BZDA 1P4OA 4TW9A 3OFMA 4FF8A 4G6NA 1OKWA 1IA9A 3P7CA 2ITWA 4FKPA 4HCTA 5DRBA 3S1HA 5FEEA 3QRTA 4HGTA 4C62A 4FOBA 4ZXTA 3I6UA 4O0SA 3PJ8A 3Q04A 4EC9A 1FMKA 4NEUA 4NL0A 4EZ5A 2RKUA 5J5TA 4D5KA 1JBPE 3TIYA 4L7FA 3F66A 2P33A 3QKMA 3VUGA 3H0YA 3HV3A 3QQHA 5KZ0A 1YRPA 3ENHA 3I7CA 3MGYA 3VRZA 1GNGA 1YDTE 4J98A 4QQJA 3UOJA 3R8UA 4V04A 3HNGA 4N57A 5FDXA 1Q8TA 2QR7A 1PXIA 4R1YA 2BFXA 3ODZX 4X2NA 2C3IB 2RGPA 4FNYA 2BVAA 3S3IA 4NT4A 1W7HA 3KXMA 4BWXA 4YPDA 2QO7A 3RKBA 2YDKA 4I4FA 2WTKB 4BL1A 5H8GA 2E2BA 4RJ5A 4FOCA 2OW3A 3W2PA 5IF1A 2YM4A 4FK3A 4O0YA 5C8KA 2R3NA 3FXXA 3R9NA 2YDJA 3MFUA 3SKCA 5D7AA 4CEGA 1IG1A 5HIBA 4H1JA 5FG8A 4CV8A 5BUIA 4PRJA 4MHAA 2RFEA 4RWIA 5TT7A 2ITNA 4EQMA 3SVVA 3NNUA 3V5JA 3KRLA 4LOQA 4YNEA 2FSMX 1XWSA 4YP8A 1Z9XA 2C6KA 4FIEA 3R9OA 4EOJA 5M4UA 4MF0A 3CTJA 3UP7A 1GIIA 4HCUA 3UDBA 1JVPP 3I5ZA 4U3YA 3EN7A 4ZJJA 5L2WA 5D7VA 4HYIA 5CY3A 2VO6A 5DRDA 2YCSA 1ZZLA 1UU8A 4IANA 5EI6A 4P4CA 4E3CA 3RCDA 3W2OA 3OY3A 3LW0A 3VQUA 3CQWA 3QTRA 3HRFA 2IPXA 2O5KA 4BYJA 3TJCA 3N51A 4WNOA 1Q24A 3UNJA 2XKFA 3FZ1A 4ZTNA 3NCGA 2BZKB 3K5VA 4FVPA 5ANKA 4LV5A 3BLRA 2WQOA 3DJ5A 3BHUA 5IEXA 4WA9A 4YU2A 5DLSA 5CVFA 2UW9A 3PIXA 1Q62A 1KE5A 3K2LA 4UMPA 3W18A 2WMWA 4FEQA 4IIRA 4GG7A 4DTBA 3WZEA 4M97A 5AUUA 3E8EA 5HLNA 1ZYLA 4FV1A 2W1HA 4RJ4A 5ANOA 2QLQA 4M0ZA 4EHVA 5L3AA 4NM7A 3BYOA 4BDFA 4L43A 3EQBA 3H9FA 4K6ZA 5IA5A 5M55A 2IW6A 1SYKA 3DTCA 1R39A 5AUXA 5HI2A 3F2AA 2BIYA 3R22A 5FTOA 4F0GA 2C6TA 5JK3A 4YTFA 4IB3A 5A3XA 3OXIA 3OTUA 4MXYA 2R0UA 4KA3A 2PTKA 2HZ0A 3GCQA 3PXRA 4WSYA 2SRCA 3EHAA 5FBNC 2HK5A 4A06A 1U4DA 1U54B 3VAPA 3VRYA 3C5IA 4ITJA 4K1BA 4K8AA 4NWMA 5FEQA 3MSSA 4FV6A 2XNPA 4USDA 5DR2A 4QMNA 1WBVA 4J96A 5AMNA 5AADA 2Z7RA 2PVRA 3ZO3A 4YJRA 4O7TA 2HYYA 5A6OA 3GU7A 3MBLA 4D2VA 4EJNA 3F61A 2I0VA 5AP7A 2GS7A 4L3LA 3H9OA 5CZHA 4FTQA 3RM7A 1O6LA 5J87A 3RZFA 3ORIA 5CU0A 3LZBA 4MNEB 3H10A 5L6PA 2UW7A 3JS2A 4DYMA 4M13A 1PXMA 2A4LA 4C2VA 4FZ7A 5FM2A 2V62A 3LMHA 3A62A 3W8LA 4MD8E 2BHHA 4FL3A 4XH6A 2WU6A 3HMMA 5IQBA 2ETRA 2YIWA 3LFDA 3G5DA 2RSVA 2Z7LA 4LL0A 4JDKA 4ZY4A 5CEPA 1XH9A 3NSZA 2C1AA 1IA8A
chains in the Genus database with same CATH superfamily
5CU2A 4C33A 2R3LA 4KIPA 4DH7A 4OTGA 3UDZA 3BYVA 3FKLA 4AW5A 4UYAA 4LDTA 3I7BA 3F3WA 5CF4A 2OG8A 3T3VA 2PZYA 2WD1A 3W0RA 5D41A 5HX8A 4GVJA 2C5VA 5J7HA 1BX6A 2ETKA 3NDMA 2EXCX 2HAKA 4YBJA 3DXPA 2R5TA 3UO5A 2VTSA 2ETMA 3G9LX 3P1AA 3PIZA 3A8WA 3ZC5A 1EH4A 4PUZA 4QPSA 4QPMA 2IVUA 4F7JA 3U55A 3C7QA 4L67A 4ZSAA 2W17A 4OR5A 1XMMA 5E90A 5HVYA 4DHFA 2XNNA 3FLZA 4DBNA 5M4CA 1OKYA 1YWVA 5ANJA 3ROCA 2QONA 5E8WA 5EDPA 4YLLA 3PXYA 1GIHA 4AP7A 2YHVA 4I5CA 5ITAA 2I0HA 2WGJA 1H25A 4YNOA 4IX5A 3FMKA 4M15A 2P0CA 3UC4A 4IVAA 5I9VA 3RPOA 4C37A 2I0YA 2GNIA 3RI1A 2XF0A 3W2SA 4GH2A 3R04A 1GAGA 4O7WA 4CMUA 4PPAA 1IAJA 4E4NA 4XG8A 2XKEA 1P4FA 4AGCA 5AP6A 5DOSA 5HE0A 4JJRA 4FTLA 1FVRA 4ZTQA 2XNGA 2ZM1A 3V01A 2X0GA 3QTXA 5DR9A 3KK8A 4AXDA 3CD8A 3ZDIA 3BU3A 2QLUA 2YIQA 4FIFA 4K0YA 2B0QA 4QDVA 3ZH8A 4JIKA 3MFRA 4ANSA 3FI2A 3ZSHA 2VTJA 4TKSA 5LVOA 4BCKA 4CVAA 5EI8A 1F3MC 4XG6A 1BLXA 4OTDA 3V6SA 3ZOSA 3LFSA 3MW1A 4C61A 1YXXA 3KA0A 1AQ1A 3DBQA 3L9LA 4QP8A 3FDNA 5IQCA 5HHWA 5JRSA 3MB7A 3DAEA 4PL3A 3HP2A 4B6LA 4C59A 2ITVA 4NTSA 4EKKA 4F63A 3MV5A 3PY1A 2J90A 5AAFA 2WMAA 2HZ4A 2PMIA 4FSUA 3LXLA 2ZV2A 5FTQA 3EIDA 5HIDA 4JDHA 2IZRA 3HVCA 3T9IA 4CNHA 4KIKA 5FUTA 1KE9A 3GU4A 2UZLA 3CGFA 3PYYA 4J53A 4DTKA 3QX2A 2OK1A 4BDJA 4FJVA 2OLCA 3Q53A 1MRVA 3UQGA 4IZ5A 4UZHA 3MESA 3FMNA 2QU6A 4NJ3A 4QOXA 3G0FA 4FEXA 2ITXA 2V7AA 2WPAA 4MF1A 3FV8A 4Z3VA 1OL7A 4MD7E 3P5JC 4DFYA 3KRRA 3ACJA 5E7RA 3G6HA 4FC0A 2X8EA 4O22A 5IQDA 3D15A 2VWVA 3DZQA 1ZYDA 1YHSA 5M53A 4ZTMA 1AD5A 3R83A 2OSCA 3TKHA 3ZRLA 4IDVA 2X7GA 4TYJA 4XBRA 5L6OA 4KSQA 4L44A 3VS1A 3ZLWA 3NCZA 3ZU7A 3QA0A 4OTHA 4NH1A 4YJPA 3FI4A 3TNPC 3R7UA 5HESA 4LYNA 5E4HA 4IB1A 2OH4A 2BTSA 4BTMA 3TN8A 3KRXA 1DAWA 3MA6A 3WF6A 3A4OX 4Z55A 4CRLA 2BAKA 3EQFA 5HG8A 2JDTA 1NY3A 3ANQA 2EB3A 3WYXA 1WBSA 3UZTA 2UW4A 3QQJA 3QD0A 4TNDA 2CMWA 5HVJA 3CS9A 3QGYA 3BHYA 1MQ4A 4RC2A 4D2TA 4L01A 4B4LA 5M44A 3WF8A 3SX9A 3OWKA 2IJMA 1UU9A 4AQKA 4FBXA 3OCGA 3WARA 2O65A 4O4CA 5FLFA 4F1MA 3QC9A 3U9CA 3BEGA 3EH9A 5K9IA 2ZJWA 3UNZA 1PXNA 2UZOA 4FKQA 5DT3A 5KUPA 4ALWA 1DI9A 1REJA 3E5AA 2QOBA 3LE6A 4XMOA 3O2MA 5AX9A 4BIDA 1KSWA 3UIXA 4R77A 3ITZA 4QEBA 3DFAA 3E7VA 3G2FA 5AUVA 3KB7A 2PULA 1BYGA 4D2SA 4GKIA 2XMYA 1TZDA 4FA2A 4UBAA 4IX6A 2ZB1A 4H39A 2PUNA 4O7ZA 3EYGA 5HO7A 3PRIA 4GCJA 2XAOA 4ZK5A 3UODA 4ZMEA 3GCUA 3WZKA 3L9NA 2PVJA 1H07A 2XKDA 4D9TA 5E8XA 5FTGA 1XH8A 4QP1A 3ZFMA 5AV2A 4QMOA 3AT4A 3PJCA 1CDKA 4PL5A 5HCYA 1JSVA 1OKVA 4MXZA 4FZDB 3CY2A 3B2WA 3GGFA 3NUPA 3EN4A 4P90A 4W4XA 4X6QC 3OTVA 3PUPA 1ST0A 2BDJA 4M14A 3HL7A 4QMUA 4RZVA 2QNJA 2FB8A 3RBWA 4IAAA 4HYSA 3FPQA 5HD7A 4GEOA 3ROYA 5IKWA 1DI8A 5TOZA 2GTMA 4I21A 3POZA 1BKXA 3C0IA 1JSTA 3A8XA 3QTIA 1W84A 4MWIA 3T8OA 4FV0A 1Q3DA 2W9ZB 3MJ1A 3SAYA 3W2QA 1R78A 1W2FA 4FSWA 4AE9A 1NT2A 3FI8A 4XV3A 3AKLA 1YW2A 3ZM9A 2XK7A 3N4UA 5LWNA 1Q8YA 4CKIA 1FGKA 5LCKA 3PTGA 3AD6A 3R2YA 2HXQA 4G3DA 1U54A 4JOAA 4QMSA 5DEYA 5JGBA 3R1QA 3KL8A 4YGAA 4MXAA 1OIYA 3TACA 3WIKA 3UQCA 5KKRC 2CGWA 4QYEA 5D10A 5EW9A 3VO3A 3HEGA 4YJUA 3VS0A 3ET7A 3CKXA 3SQQA 4TWPA 3NNXA 3ORMA 2RFNA 3TCPA 4C58A 3E88A 4GUBA 2BMCA 4FX3A 4XP0A 5I9UA 1TQMA 3EMGA 1SNXA 2C3LA 5I3OA 4DH1A 3EB0A 2OZAB 3UPXA 5CAUA 3FJQE 4AA0A 3REPA 3TTJA 4BDIA 4J52A 4I6LA 4MNEA 3QAME 2GSFA 4O91A 2ZAZA 2O63A 3OF0A 1NVQA 1H08A 4WBBB 4I3ZA 3O8TA 2IVSA 3TMOA 3VF9A 1PHKA 4RVLA 3ZMMA 5IEVA 3VBXA 1FVVA 3KXNA 3VUDA 5A4CA 5HO8A 4TWNA 2J6MA 4YZNA 2NPQA 5BX0A 4O1PA 3R9HA 4DLIA 5CF8A 5JKGA 2UZDA 3AOXA 2QOFA 4J99A 4IM3A 4KAOA 3V5PA 4E26A 4ZY5A 2CNVA 1P2AA 4J95A 4GL9A 4FT0A 4BHZA 4EWQA 4HVSA 4F6SA 2C5NA 4FTTA 5F20A 4AFEA 2YCRA 2W1ZA 4JX3A 4EJ7A 3TTIA 3OEFX 4QTEA 2PVFA 5D11A 3V8WA 2WMXA 4CD0A 5AP0A 1LP4A 4TYGA 2J9MA 3PXZA 4V0GA 4AT4A 5JMSA 2PK9A 4A9SA 4RGJA 1WBWA 4UWYA 3ZFYA 5KKRB 3BYSA 4FKIA 5E8TA 3BBTB 1ATPE 1FMOE 4FYOA 4O0UA 1KV2A 4O7NA 2YZAA 3OOMA 3WBLA 3FY0A 3DDQA 4GT5A 1R0PA 1XJDA 2WMTA 2WU7A 3FLNC 3KK9A 3V6RA 2CPKE 3DKGA 5I9YA 3NYXA 2IVVA 4FT9A 2ZDTA 5EW8A 4DEHA 1H28A 1YDRE 3QRJA 1MUOA 4G31A 4WNPA 1H00A 2GHMA 2UW8A 4IADA 4L3JA 4B8MA 2W4JA 2WTJA 3VNTA 5IDPA 2Y4PA 3R6XA 4FSZA 3ZO1A 1Y6AA 4FMQA 4QP9A 2ITYA 3DB8A 1ZYCA 4G2FA 5JZNA 2GTNA 2W5BA 3P7AA 3PJ1A 4HVDA 1XH6A 3BIZA 3LOKA 1PJKA 2Z7SA 3E63A 4FUYA 3KFAA 2W06A 1NVRA 5FQDC 1OMWA 4ALUA 5LMKA 1KOAA 4Y8DA 5DEWA 1H01A 3UG1A 3CD3A 1VYZA 3O96A 4G5JA 3TEIA 5JFSA 4F09A 2YIXA 4IWPA 4PMSA 3RJCA 5IU2A 4ENYA 4IAIA 2XBJA 3UQFA 4HZRA 1M2RA 4PNKA 1PXJA 5J79A 3TIZA 3B8RA 2RL5A 5L8KA 4W9WA 2P2IA 1DAYA 5CSVA 3AKJA 2A0CX 2NO3A 5K4JA 5FXQA 4F08A 4JG6A 5GZ8A 3DV3A 3QYWA 4FODA 4EKLA 4FG7A 4MCVA 2C3JA 4J7BA 3TNIA 4UWBA 1J3HA 4YURA 1W2DA 5IQIA 4U42A 4RFZA 4A4LA 5JSMA 3JPVA 4OBOA 3O0GA 2JEDA 4CFVA 3LCOA 2BZIB 2NRYA 5BMSA 4S33A 2HY0A 3P78A 3EL8A 2X81A 2B55A 3ULIA 1STCE 5IUIA 3VF8A 2ZM3A 2F4JA 3BU5A 1U59A 3DJ6A 3W55A 3W2RA 5CU6A 3G51A 4O0XA 5CS6A 4N6YA 4KS8A 2A2AA 4FKTA 2RFSA 1B39A 3R8LA 3RM6A 2RG5A 4FSRA 5HG7A 4GV1A 4ERKA 4PDYA 4XG3A 4F7LA 1FQ1B 3NWWA 3R1NA 4IX4A 3QGWA 2VX0A 3COMA 4G5PA 2UZVA 4ZOGA 2WIPA 4FKWA 1VYWA 3HAMA 2VWBA 3ATTA 4FSYA 4BI2A 3BQCA 1XR1A 3ORKA 4MQ2A 3C4ZA 3GC8A 5CU4A 3RWPA 3R28A 4FUXA 2XIXA 4JMQA 3O23A 4JI9A 4YO6A 4I22A 3NUSA 4FTCA 2PHKA 3ZUUA 2X4FA 4ARKA 4I41A 4AW1A 4EHZA 5M07A 3GI3A 5AV3A 1KUTA 4IB5A 1H1SA 3ZEPA 3UOHA 3U54A 4CT2A 2H34A 5A46A 1J7IA 3MS9A 4UMUA 5C4LA 4MBJA 4ZSEA 2JDSA 2CKQA 5EQPA 4R78A 3RINA 4GFMA 1ZOEA 4ANOA 1CKJA 4I0RA 3PXFA 3LXPA 2YITA 4F1OA 5IPJA 4YZMA 4UX9A 4G16A 2W1IA 4GU9A 5LVMA 5BYLA 1M52A 2H96A 2X2MA 3IW6A 2FGIA 4BN1A 4C35A 3GB2A 4EUTA 4JDIA 4UALA 4AWIA 4AZSA 3FLQA 5AIKA 4AOTA 2JAMA 2YACA 3HKOA 4FG8A 4FIGA 2VTOA 3BHVA 2GQGA 3C0GA 1NA7A 4C4HA 1JOWB 3RNIA 2ZVAA 3F3VA 4QP3A 4IAFA 1OVEA 4YHJA 5CENA 4CLIA 2W0JA 5CT7A 3FYKX 1H24A 4Q5EA 2UZUE 2VTLA 3MIYA 4BGQA 5CVGA 3BLQA 4N4SA 2UZWE 3IOKA 4LMUA 1M2QA 3F5PA 3BWJA 5JZJA 5EK7A 2H8HA 3MVMA 1Y91A 4WKQA 2ERKA 3KQ7A 3Q9ZA 1MRYA 1U5RA 4FRFA 4LUDA 4EK4A 3D94A 5D1JA 5DHJA 1R1WA 2HELA 4FV8A 1JSUA 1KE7A 4JX7A 4BCHA 2J2IB 3QCXA 4AOJA 2PMLX 2PZRA 3HX4A 4AA5A 4PDOA 4U97A 5FBOA 2QOQA 4AGWA 2UUEA 4RIWA 3A7FA 4S2ZA 4JL9A 2OH0E 3G0EA 5HGIA 3NLBA 3ZRMA 1OGYA 4JT3A 4C3PA 1IASA 3L8XA 4RA5A 4UV0A 5D12A 3VS3A 2YLEA 3FY2A 4UEUA 4V05A 4BVUA 3ID6C 3EQCA 5JFWA 3V8SA 3A99A 2OJGA 3M2WA 2PY3A 2A1AB 4L46A 4C34A 1ZMWA 3TI1A 2IZTA 4C0TA 2AUHA 2CN5A 2Z60A 2VTQA 5C01A 1OITA 2F49A 2XS0A 3JVRA 3CP9A 3SXRA 5HEZA 4YHFA 4IAZA 5J1WA 4HNFA 2WQEA 5JN2A 4DTAA 3EQDA 1OPJA 2XIYA 3D14A 3DQXA 3QCSA 3NUUA 4UWCA 3S2PA 1QPEA 5G1XA 4FTJA 4PL4A 2YABA 4W9XA 4EHGA 2ZFYA 2ONLC 3BCEA 4KUJA 3GOPA 3RK5A 4BCQA 3O7LD 3QUDA 5ETIA 3EQHA 3PA4A 2BKZA 2PUUA 4YJSA 4CFNA 2YWPA 2BRBA 3LQ3A 3GQLA 3UJGA 3JUHA 3NW5A 4BCGA 1ERKA 2REIA 1J7UA 1XBBA 5ANGA 4GSBA 3OT3A 4JXFA 2QOIA 3R8PA 3RTPA 2BHEA 2PMOX 1E1VA 2UW0A 5AR2A 3SD0A 4JQ8A 4PF4A 4NTTA 3L9PA 4E20A 2XCHA 4KKEA 4YC8A 5GIPE 5EYKA 3CEKA 2J5EA 4GIHA 5EM6A 3NX8A 4MNFA 4BDEA 5HTCA 4MX9A 1B6CB 4EQCA 3L1SA 3PE1A 3ORPA 3D7ZA 2CNUA 1R0EA 4EEVA 4NM5A 1TQIA 2IO6A 3VJOA 3FSKA 3FMDA 3QX4A 4IDTA 5AJQA 3CQEA 2OIDA 2BZJA 4CKRA 2XP2A 4F9BA 2YAAA 4RX5A 4UN0C 5IH4A 4NZWB 4R1VA 4XEYA 1S9IA 4AACA 5LQFA 1WVYA 5HZNA 5JEBA 3GENA 4ZZNA 2YIRA 4IB0A 5CALA 1Y57A 1OPLA 4Q5HA 1YI3A 3RMFA 4W4VA 4QRCA 2XCKA 1PMUA 2FVDA 2OJJA 1A06A 4JBOA 2G1TA 2HENA 2R64A 2XH5A 3DPKA 3KF4A 3NS9A 4M7IA 3KIOC 4Y5QA 2QD9A 2XALA 3KEXA 3QBNA 3LMGA 5EOLA 4LL5A 2HWOA 3E7OA 3FUPA 1Q41A 4PV0A 5CSHA 1G3NA 4F7NA 5CXZA 4C2WA 3FC2A 3EQGA 4LI5A 1WBTA 4XP2A 5EDQA 3V5QA 5KMMA 3K3JA 4R7BA 1SZMA 3JY9A 3QKKA 1GZKA 4WUNA 3ORZA 4IVCA 4OTIA 5GJFA 3DK3A 4XBUA 3ZSIA 2WMBA 3ZYAA 4K11A 2VTIA 4Z7HA 3Q3BA 4DAWA 2QOKA 3LQ5A 3TZMA 4ACCA 4MD9E 5A4EA 5M06A 3UZRA 4FEUA 3G90X 4RX8A 3RPVA 1FINA 1H26A 5CLPA 3MIAA 2YM7A 4S34A 4W4WA 5GZ9A 1YHVA 3E8DA 5DVRA 2G9XA 4IACA 4GRBA 3AC1A 4D28A 3QXPA 3AT3A 1URCA 5AP2A 4JQEA 1KOBA 1YXSA 4ACMA 2ZOQA 2QU5A 3IPHA 3PPJA 3UYSA 1NXKA 1PY5A 4RX9A 5KMOA 3DOGA 3I1AA 4RVMA 3GCVA 5AP5A 4BWKA 4I0SA 2AC5A 3IONA 4TWOA 4WD5A 3LCKA 3H9RA 3CXWA 1V0PA 2VTPA 3AMBA 5ANIA 4KIQA 4QMVA 1TKIA 2E9UA 5LCJA 4AOIA 2JGZA 2O64A 4H36A 2AEGA 2XVDA 3DBFA 4PDSA 2RF9A 3V3VA 3O50A 2XJ2A 1V1KA 4MXCA 5CAPA 2CSNA 4I5MA 5J95A 1P5EA 3B2TA 3TDWA 3GU6A 4IQ6A 4C7TA 4ZMFA 1OI9A 1ZMUA 2PVMA 1OBGA 4W8DA 3AG9A 4U43A 3CSVA 4YC3A 4MAOA 2G15A 3MA3A 5AM7A 4D2WA 3PVGA 3TNWA 4PMPA 3F3ZA 2O0UA 4E1ZA 2C3KA 1FPUA 3S95A 4F65A 2WMVA 5HBEA 1OUYA 3MWUA 4QMTA 5I0BA 4IFCA 5AUZA 4D4VA 4O4EA 3UVPA 1OB3A 3GCPA 4IE9A 4AAAA 4L8MA 1UV5A 2X2KA 5DBXA 2V22A 4KWPA 4BZOA 2W1GA 2EXEA 4G9CA 4YJNA 5HD4A 4MVFA 2O3PA 3Q5IA 5G6VA 1Y6BA 4ZP5A 2PE0A 4LGHA 3DKCA 3PSDA 4F6UA 2WHBA 5EM5A 3OHTA 2YM3A 1E9HA 4XYFA 2V5QA 3DBDA 2AC3A 5J7BA 5KMIA 4G1WA 3JR1A 4DFBA 4D1SA 3U8WA 2YDIA 1MP8A 5CEOA 4WIHA 5HNGA 1H4LA 4FGBA 1Q4LA 5HTIA 4OAVB 4BGGA 3OBJA 2A19B 2GCDA 5IEYA 4QO9A 3O5AA 3KMUA 3OUKA 4Y85A 2Y0AA 4E6AA 5I3RA 4I23A 3FAAA 1WCCA 4CYJA 3K5UA 2BIKB 2X6EA 5BYYA 3ZUVA 3HYHA 3MVHA 3V04A 1OGUA 3PY3A 3RZBA 4BFMA 4F9AA 4GKHA 2Y7JA 4U3ZA 1YWRA 4QP2A 2IZUA 4AQCA 2JIIA 2GPHA 3TNQB 3FHIA 5BNJA 4DDIA 5DWRA 3MI9A 1W83A 1JWHA 2B52A 1UWHA 3E93A 5K0KA 4AGUA 3FXZA 3LM5A 3QUPA 2B9FA 5GNKA 4EOKA 1ZXEA 2Q83A 3NW6A 4TYIA 4FNWA 2BAQA 3F7WA 3U6IA 4OBPA 2R3OA 2UZEA 4X2JA 3KRJA 3ORLA 1O6KA 4I6HA 4JBQA 2YFXA 4H3PA 4O2ZA 4IJPA 1YKRA 2YZLA 2JKQA 1G8KA 1YQJA 4S32A 4YPSA 4AT3A 2FUMA 1OKZA 3CE3A 3ERKA 2J0JA 3CGOA 3MYGA 4FV2A 4GJ2A 3VBVA 3NEWA 4E6CA 5L2SA 2ZV7A 4XV2A 5IG1A 2XBAA 3IGGA 3KMMA 2VTMA 4E5WA 3CC6A 1Q8ZA 2OXDA 5IUGA 5JQ8A 4FKOA 3LFNA 3NZ0A 5DFPA 5BVKA 4QQ5A 4QT1A 4FGRA 1KE8A 5ANDA 3R7GA 4HNIA 5C9CA 5KBQA 5HOAA 4BJJA 3GC7A 4RIXB 2XJ1A 3FLSA 3EQIA 4P7EA 5AR8A 3OXZA 3QTZA 3QTWA 4U7ZA 3NGAA 1W0XC 2R3KA 3QCQA 4BDGA 2GQSA 2XNBA 4F0IA 4EH3A 5K0XA 5CAQA 4L53A 4E7WA 2VTHA 4IFGA 1JNKA 2FSOX 2UV2A 3OVVA 4BKJA 3IDPA 4QTDA 2QR8A 3CPBA 3F5GA 2R9SA 2ITUA 3KC3A 3ZLYA 4FK6A 4OGRA 3SW7A 4E4XA 4GT4A 1OZ1A 4KBCA 3PIYA 4NKAA 3H30A 2G01A 4FEWA 4HGSA 3PVBA 4I5HA 4NCTC 3R73A 2A27A 4DH8A 2CCIA 1UNLA 2IW8A 3NR9A 3E8NA 4DEGA 3LLAA 4H3QA 4IMYA 3F5UA 4GFGA 4GS6A 3IDBA 1QL6A 4YZCA 5EHOA 4M8TA 3OZ6A 4BCNA 4CSVA 3BYMA 3F3UA 4KRCA 4R8QA 4QMQA 1NW1A 2X9FA 3QRUA 3W33A 2C0OA 3I4BA 4KS7A 4EK3A 3UP2A 3Q32A 4D4SA 3VS5A 1Q8WA 3BE2A 3HZTA 2ITTA 4QYFA 4Y83A 3ZBFA 5HLWA 5DGZA 5M4FA 2W7XA 4ZTHA 2VX3A 2E9OA 1CM8A 2Y9QA 4BDCA 2VTRA 3LIJA 4GMYA 4E93A 4I4EA 5CANA 3SRVA 4TTHB 4EUUA 3PDTA 4A9YA 5M09A 3WYYA 5HVKA 2VTTA 5ACKA 3CQUA 2UZTA 4EOPA 5CZIA 5AP3A 2WQBA 1WAKA 2WMSA 3UDTA 2VWYA 1RQQA 5CEMA 4H58A 3LFAA 1W8CA 4N0SA 4X3FC 3SHEA 1LEZA 1WBPA 2QKWB 5AAGA 4RJ7A 4B8LA 4YR8A 2CKPA 4FIJA 2X7OA 3PWYA 4YTHA 1ZYJA 4M0YA 2FA2A 2JBPA 5F95A 4NFMA 2VNYA 2VWUA 3Q2MA 1HOWA 4CXAA 1KE6A 5M08A 2X8DA 3LCSA 3HGKA 2Y4IC 3LXNA 3VUHA 2YA9A 4M69B 4E5AX 2ONLA 3A60A 5T68A 4ANMA 3D2KA 5KBRA 3TDVA 4RIYB 4FV3A 3QUEA 3D7TB 4U80A 4C4IA 4XRLA 2WAJA 3Q9WA 5AAEA 4TPTA 4KIOA 4H3BA 5KMKA 3TUBA 5K5NA 4DINA 3D5WA 4RWJA 5KMNA 2VO0A 5B2MA 2BROA 4RJ6A 5IMXA 3BBWA 3EQPA 3TL8A 5JQ5A 2F7EE 4DH5A 3A7GA 3G6GA 4Y73A 4L9IA 4U40A 2F7ZE 4YUQA 3DNEA 4IVBA 3RAIA 5JGAA 4I93A 3CPCA 2XYNA 1RW8A 4O38A 4M3QA 3PZHA 2ZV8A 3BI6A 3QHWA 4GW8A 5I4NA 2GS2A 3F6XA 4YJOA 3KN5A 4FTRA 4QQTA 1KWPA 2IF8A 4RX7A 3R8VA 2QURA 5AUTA 1UU3A 2XRWA 3OG7A 3QYZA 4X3FB 4PMMA 3VN9A 1J7LA 3NVMB 2IW9A 4LV7A 3EKKA 4FKSA 3KU2A 3PFYA 5DR6A 2JFLA 3AC4A 2WMRA 4WG4A 2UZNA 3SDJA 2OU7A 3PY0A 2W1DA 4J71A 5ETAA 3U4WA 3UDSA 1FBNA 3ZFXA 3QWJA 3ZC6A 4ZS0A 2Y4IB 3HUBA 1JQHA 2VNWA 4J8MA 3AMYA 4RIOA 1IAHA 2EUFB 1S9JA 5IISA 4F7SA 2J4ZA 4WNKA 4YSMA 4QMZA 4D58A 4FNXA 4XNEA 4Z16A 5C8NA 4UYNA 3VUKA 3TKIA 3COKA 2XK9A 3R02A 4FKVA 3FZSA 3FZTA 4L6QA 3ZSGA 1QPDA 4ERWA 2WNTA 2XK4A 3D5UA 4U81A 3O7LB 4GUEA 3BHHA 4Y72A 3Q4CA 2E9PA 5E92A 3TJDA 2VZ6A 4Q9ZA 3I81A 4BC6A 2WQMA 5GJDA 2PZ5A 4AS0A 2VWZA 4FYNA 5CXHA 2OJIA 4XG2A 2FH9A 4CGAA 3GEQA 3HMNA 4FL2A 4YC6A 4BICA 4YZ9A 1VR2A 3GFWA 5M56A 1WBOA 5D9HA 2C5XA 3QRIA 4QNYA 2R0IA 4HVHA 3NNWA 2C4GA 2X2LA 2OXYA 5GZAA 5K4IA 4DGNA 3KXGA 2CDZA 3O8UA 2EWAA 2YM5A 4GK2A 3V5LA 3ZDUA 4KABA 2PUPA 4R5SA 2VO7A 4ANLA 3TUDA 4XLVA 5HO6A 4AGDA 5EM8A 3T9TA 3TG1A 2I7QA 3MVJA 4EK8A 4RPVA 2WFYA 3RPYA 2QHNA 4R6VA 4FT3A 3PLAE 2QO9A 1GZOA 4BY9E 3NRMA 3OCTA 4C38A 5CSPA 2JC6A 3W0OA 2F7XE 5E1EA 2FO0A 4M84A 3Q52A 4YLJA 4ZJIA 4GYIA 3BLHA 2HZNA 4BB4A 2I1MA 4Q9SA 1Y8GA 3OUNB 4EBVA 5HU3A 4O0TA 3Q4UA 2C68A 3TV7A 4HPUE 5J1VA 3EKNA 5L8LA 5KCVA 3WZJA 2WEVA 1Q97A 2W4KA 1Q5KA 4BDAA 1SVGA 5CASA 4FTKA 1SM2A 2JBOA 2BCJA 2IEWA 3A2CA 2XNEA 4OBQA 2GDOA 3W8QA 1XQZA 4WG3A 3UG2A 1LEWA 3PA5A 4EOSA 1OL5A 3ATSA 5A6NA 4BRXA 3AD4A 3FE3A 2XIKA 4EWHA 4ZZMA 1FGIA 4RC4A 4W8EA 5LMBA 4Z9LA 3C4CA 3BKBA 4F9WA 3R7EA 4C36A 1HCKA 3FQEA 2J50A 3FHRA 3V5TA 3W2CA 4CV9A 2GNJA 2YJRA 3KF7A 3WZUA 1G8AA 3UIBA 3OBGA 3TZ9A 4TYHB 4CYIA 4DH3A 4C8BA 4NIFB 3IDCA 4F4PA 2YISA 2VAGA 2X0OA 1PRYA 3KULB 3OEZA 4CMTA 2OJFE 5B0XA 4G9RA 4ORKA 2PVNA 4FTAA 4RFMA 4MXXA 3WE8A 4EBWA 5JFXA 2PYWA 5AWMA 4O7LA 5I9ZA 2YLFA 1SMHA 3AGLA 3F9NA 3R0TA 4APCA 4D0XA 4QMWA 4CQGA 5IA2A 2R3QA 3VW6A 2BZHB 4U45A 1QMZA 2R3IA 3P79A 5HICA 3NUAA 2R2PA 1H1PA 2EVAA 3EL7A 4BZNA 4NFNA 2VTAA 2ZDUA 2AQXA 3KN6A 2PZPA 5BMMA 4YZDA 3U87A 5A4QA 5IA1A 3B8QA 5HLPA 3UZPA 4M68A 2NYAA 3DBEA 4PP7A 3ORXA 2QG5A 2F9GA 2XNOA 3QA8A 3R7OA 5K3YA 1OIUA 3ORNA 2I6LA 2GNGA 5HORA 4ANQA 1UVRA 4XHKB 4IM0A 3RK9A 4NK9A 4BBEA 4E8AA 4U6RA 2DWBA 1H8FA 3MFSA 3LMIA 1M7QA 3F2NA 2QOHA 3HV6A 4LRKA 3NFFB 4EK5A 1Z5MA 4D2PA 2HZIA 3ELJA 3PE2A 4K2RA 1K3AA 3C4WA 3DQWA 1YI4A 4QYGA 2BUJA 1T45A 1UA2A 3R8MA 4LGDA 4CFMA 5BVFA 3RAKA 1YOMA 1UWJA 1MRUA 4TWCA 2ITQA 5EDRA 5AR4A 5F4NA 4ALVA 3LFQA 4PQNA 3O8PA 3UIUA 4JR3A 3V5WA 4IAYA 2UW5A 4FTUA 2BAJA 4FV5A 4WHZA 5BVEA 4EH6A 1RJBA 3NPCA 2VX1A 4O27B 2YEXA 5FP6A 4DGLC