3QKKA

Spirochromane akt inhibitors
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
326
Chain Sequence
RVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITIMECVDSERRPHFPQFDYSASS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAC-alpha serine/threonine-protein kinase
publication title Discovery and SAR of spirochromane Akt inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 326
sequence length 335
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
A PF00433 Pkinase_C Protein kinase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3qkkA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3qkkA01
3F88A 2OXDA 3GC8A 3PWYA 3CD8A 4HGTA 2UV2A 4DTKA 2C3IB 5A4LA 2V7AA 4O7YA 3QCQA 3TACA 2BCJA 3QKKA 4DEBA 2QOQA 4QYFA 4RRVA 5HGIA 2J5EA 3VBWA 2W4KA 4RVTA 3BHYA 5J79A 4BVUA 2B9JA 4YJSA 4D9TA 1NVRA 3R9RA 3R9OA 4LUDA 4KBCA 3DDQA 5HKMA 3ZU7A 4GK4A 2W1GA 4FMQA 1A48A 5T3QA 4M67A 2V5QA 4EK3A 3MH1A 1K9AA 3VUGA 4QMTA 4EZ5A 4F1MA 3G90X 4EL9A 3IQ7A 3D5WA 4H3PA 5KMIA 2Z8CA 3S4QA 3R73A 2E2BA 3C51A 5DT4A 5CAPA 4UN0C 5DBXA 5IH6A 2IO6A 2XZSA 5DR9A 5HOAA 4AN9A 1XR1A 2CJMA 3C4XA 4D2SA 5IQCA 4ZTLA 4S30A 2VX3A 4R7IA 1M14A 4LQMA 1Y8YA 5ETAA 4K1BA 4ANQA 1JPAA 5ACKA 4B9DA 4EBWA 4XV3A 3MFUA 2RL5A 2YISA 2XIXA 4FV5A 2XMYA 3BIZA 3AD6A 4KBAA 5CU4A 5JGAA 4FVRA 3NYOA 5HG7A 2BFXA 5CXHA 2CGVA 1WAKA 3IG7A 3ZZEA 2AUHA 4RIYA 3UDBA 4FF8A 2VTHA 2YIXA 1QPJA 2UVZA 3R7UA 3EH9A 4LRMA 2QO7A 3NDMA 2HXQA 3P4KA 4I6HA 3AD5A 3NZ0A 4H3QA 3UZRA 4EHVA 4O2ZA 3UP2A 3Q60A 1J1CA 5B2MA 2BFYA 4FYOA 4CFXA 4GUEA 2O8YA 3DBFA 1YHSA 4XOYA 4PRJA 1FPUA 3T9TA 3HV3A 4O1PA 1U59A 4X6RA 4YLKA 4L3PA 4E93A 4F9CA 3NW6A 3F3VA 3TKIA 1H1QA 3R7OA 3WARA 4JDKA 4WKQA 3TNIA 4CKRA 2REIA 4FV6A 4NTTA 3LJ2A 4MTAA 5M4FA 3LCSA 4O38A 3PP0A 3F6XA 4IAZA 4CFVA 1WVYA 3GBZA 4XMOA 2HCKA 2FSLX 3W2CA 5A4QA 4HGEA 3QRUA 2WQNA 3CXWA 2VTTA 3N4TA 1J1BA 4YC6A 2IN6A 1PMUA 4KINA 3FLYA 3IECA 4Y83A 5GNKA 2EVAA 3FLQA 3SOCA 3WBLA 2UW6A 4BIBA 4O0SA 4RG0A 3TTJA 3AC2A 3QZIA 4YTHA 5EDRA 1QPEA 4X2GA 3R22A 4U0IA 4Z16A 3CJGA 3VQHA 3VBTA 3AXWA 2CDZA 3KULA 4ZTNA 4EH6A 3RAIA 3KULB 3FI3A 3BYVA 3FPMA 3PJCA 5F95A 5JZJA 4R77A 4IFGA 4RGJA 2QR7A 4DGLC 4ZY6A 4OBQA 4EKKA 2YIYA 5M08A 4ZTHA 4USEA 4AGWA 3R6XA 4LGGA 1RQQA 2I40A 4NM0A 4GK2A 1YI6A 4EUTA 5EG3A 4U81A 3VW6A 2UW0A 4TT7A 3ZSHA 4C8BA 1H01A 2OIDA 2X1NA 2WTVA 2YLFA 3O8UA 2X7FA 5EM6A 5FEEA 3R8PA 3MESA 4D2TA 4F7NA 4IB0A 4FUYA 4QMZA 4X3FC 4ASEA 5J9ZA 3BYMA 5KHWA 3HAVA 3RI1A 5E9EA 3FMNA 3Q4ZA 5ANOA 3LZBA 3I7CA 3MH0A 5L8LA 4C58A 4A4XA 5CZHA 3EFWA 3W55A 1Q4LA 5HLNA 5FLFA 3R71A 3KVWA 4Y5QA 5DFPA 2ITNA 3GQLA 2WMQA 4FNWA 5B2LA 4IAYA 3QTRA 4Q5EA 4Y5HA 3Q4CA 5DIAA 3UP7A 5JSMA 3CCNA 4CCUA 5K4JA 1B39A 3BGZA 5KMMA 1BKXA 3LE6A 4ALWA 4K77A 1OKVA 4OW8A 4AF3A 3HDNA 2UW4A 3EHAA 3RHXA 2J4ZA 3DNEA 2X8IA 5GJFA 2B9HA 4P2KA 3OWJA 5HNGA 1K2PA 1O6YA 2QR8A 4DE4A 3RCJA 4OUCA 1MRVA 3MJ1A 4UX9A 3CEKA 4J8MA 3F7WA 4O86A 3HNGA 3O7LD 4XNEA 5HORA 2XNBA 2JITA 3FQEA 4U9AA 4AA0A 4AGCA 4LRKA 3KFAA 2O63A 3OY3A 3R83A 4U7ZA 5F20A 2H96A 4CZUA 3LQ8A 5BYZA 4I23A 4LM5A 4USFA 2HXLA 2OJ9A 4YP8A 3V5JA 3PJ2A 3QTWA 3VBVA 3VS6A 4NYEA 1T46A 1YVJA 2ZM1A 5EW9A 2BDFA 3FDNA 3SG9A 3E7VA 2RF9A 2ZDUA 1P4OA 3FYKX 3PG1A 4CQEA 3H10A 4L6QA 4PPAA 4WA9A 1LR4A 5ANKA 3ZUUA 5BQ0A 1M17A 3BHUA 4GVJA 4JX3A 4DEDA 1OMWA 3SRVA 4G3GA 3ZLYA 3NCZA 3TDVA 1GIHA 3A4PA 3LCTA 2CN8A 4GV1A 2WTCA 1XHAA 2OICA 4ITIA 4MWHA 3MPTA 2W17A 2P0CA 3PA3A 5EHYA 3U51A 2XCKA 1PYEA 4JR3A 3QALE 5E8ZA 4UZHA 3EQCA 4NM3A 2IZUA 2B53A 2Z60A 2XRUA 2GPHA 1TQPA 1H0VA 3Q9YA 2OLCA 3DB8A 3OXZA 3ALNA 3LFBA 4XLVA 4BZDA 3ZBFA 5ANGA 1CMKE 4HVSA 3QC4A 4QMNA 3OBJA 2XYNA 2UW8A 2ZV2A 4WG5A 4F6UA 3UYTA 3OXTA 5TF9A 4AAAA 4IVBA 4L52A 2IW6A 5L6OA 2P3GX 5GIOE 3ETAA 4JG8A 3KRLA 4BKJA 5E91A 1HCKA 3MBLA 4R7BA 1OKYA 4FG8A 4O0XA 2XB7A 4X2NA 3VS2A 1L8TA 3MA3A 2QOBA 3UG1A 1P2AA 3Q5IA 4AOJA 3IW6A 2ITXA 3PIZA 4TYEA 3OHTA 5JRQA 4DLIA 2RKUA 1DM2A 2FVDA 3G9NA 3MY5A 4FNZA 1ZARA 2GNLA 4U41A 3RM7A 2WTJA 3DKFA 1VJYA 2UZLA 4O7RA 3HUCA 4FSYA 3QL8A 4QMVA 4X2KA 3DDPA 3MTLA 3ORIA 3QHRA 2Y4IB 2P4IA 3F5GA 3S2PA 3AMAA 2W5BA 5DR2A 3VQUA 4CKIA 4PDYA 2W9FB 3QWJA 5HD7A 3BLQA 2XK7A 4J98A 2UVXA 2YIQA 4F7LA 4F99A 5HQ0A 5CI6A 1JWHA 2B9FA 2EU9A 2J0LA 3GU6A 3KB7A 3RZBA 5IA1A 1J3HA 2AC3A 4FOBA 2BILB 2QQ7A 2F4JA 3SXSA 1ZLTA 4YUQA 4O7NA 3F5XA 4EC9A 5EDPA 4ACMA 3OCBA 5CASA 4ORKA 4GK3A 3LCOA 1EH4A 4XG9A 4ZTMA 4QT1A 5EI8A 1S9IA 2PVFA 3DPKA 3QQJA 4LGHA 4YU2A 3SVVA 3AC3A 4O27B 2JEDA 4IVDA 2HWPA 3MS9A 4EZ3A 2GSFA 3R63A 4IDVA 2ZVAA 4J99A 1WBWA 3Q32A 3JVSA 3IDCA 3L8PA 3U8WA 4FZDB 4FE2A 4G34A 2PK9A 2QNJA 4RIXB 3DB6A 3RMFA 4UMUA 3HX4A 3AGLA 5BVDA 4KKEA 2X8EA 4MQ2A 3THBA 2UVYA 2XS0A 4IM0A 2B55A 3NNXA 4CXAA 1JVPP 2PZ5A 2XEYA 1RE8A 2Y7JA 3L9LA 2YWPA 5J95A 4ENYA 3OG7A 2JAMA 4O96A 3NUXA 2QCSA 3AT4A 4FA2A 4L43A 3A99A 3LLAA 4UV0A 3Q2JA 5LMKC 2JKKA 3F2RA 4H36A 3V51A 4DFLA 5AR7A 1REJA 3G9LX 4LUEA 1KV1A 4IM2A 4D4RA 4C33A 3LJ1A 4KA3A 4DH8A 3DLSA 4D0XA 3QTQA 3F9NA 4FODA 4BTKA 4ZJVA 3KRXA 3V5TA 3ZXTA 1OPJA 3HV5A 4RVLA 3E7OA 4C2WA 2BIYA 4I41A 4FKPA 2PWLA 4J71A 3QU0A 4JQ8A 1ZYJA 1UU3A 3AD4A 1OM1A 3R00A 1V1KA 3QTSA 3AMYA 3BQRA 1WBNA 4XP3A 4BCOA 2HY0A 3B2TA 3QRIA 4JDIA 4NU1A 2QG7A 4UY9A 5HHWA 1CM8A 2XM9A 1FVVA 1OL7A 4UWCA 3WF5A 4DINA 2E9OA 4TYJA 5AV3A 1NVQA 2PZYA 2WKMA 1GIIA 2J51A 5AIKA 3Q6UA 4CZTA 3C13A 5J7BA 2YIWA 4ANOA 2VN9A 5D7AA 3SLSA 3PLSA 5FP5A 3T9IA 4B0GA 2OW3A 3E87A 5AADA 2C6IA 4G17A 1JKSA 1Q8UA 3LCKA 5BVKA 4EHEA 4OBOA 5M57A 4X3FA 4NT4A 4IZ5A 3WE8A 1XH6A 2HZ0A 4HGSA 1G3NA 3QD0A 4GIHA 1YW2A 2GS7A 3GI3A 4XV1A 3UIUA 3UIXA 5LXMA 2YLEA 2YDKA 2CGXA 1ZWSA 2BZIB 2FSOX 4BCNA 5IF1A 5IUGA 4FL3A 3C50A 4UWYA 4ZEGA 1R39A 3UOHA 3TXOA 2QKWB 5AR4A 3QGYA 4FG7A 3QD4A 4TKSA 4BICA 3A60A 3QFVA 2FO0A 3VJNA 2WMUA 4ZP5A 3PSBA 5E90A 4F0IA 2Y8OA 2C3LA 3VUMA 5CF4A 1OGUA 3NR9A 5BPYA 5M09A 4MVFA 2QOKA 5AIRA 4BDFA 1WCCA 2J0IA 3TT0A 4ZSJA 4FV9A 3QX4A 4MXXA 2Y6OA 4G9CA 5CANA 2IZRA 2GHGA 2QOLA 4JDJA 4HZRA 3IGOA 3UQGA 4B4LA 4RC4A 2ZM3A 5KUPA 5CEIA 1UKIA 2R3FA 4LL5A 1FINA 3DBEA 3ZLWA 4BDJA 3HYHA 4AW5A 4PP7A 4O7SA 5AMNA 3DQWA 3DTCA 4IBMA 1JKTA 2XP2A 5CT0A 3F3ZA 2YCQA 3ATSA 3VS0A 4M97A 3DK7A 3IS5A 4FSTA 3RNYA 5J1WA 5C4LA 2CKOA 4ZY5A 3NVMB 2XNEA 1ZMWA 1WVXA 3OEFX 4BFMA 4I0SA 4PQNA 1R78A 4U44A 4FV2A 3GU8A 3KMUA 4FNXA 3JY0A 2UZEA 2WXVA 3LFCA 2OIQA 2WQOA 4FIGA 4YJRA 2YJSA 3PG3A 3RZFA 3EQIA 4BI1A 3KCKA 2JD5A 4PL3A 3MPMA 4BWPA 4C4HA 5EM7A 4DGMA 2CNUA 2QURA 4FT0A 1P5EA 4L00A 4ASDA 4TYHA 2I6LA 4YJOA 5G1XA 1IAHA 2VAGA 1YXXA 4M0YA 3NUYA 2ZV7A 3OOMA 2C1BA 1U46A 1W0XC 1ZOEA 3PE2A 2JBOA 3JXWA 3TZ8A 4ANBA 1ND4A 3LKMA 4GMYA 4FGBA 4M69B 3HRBA 5FGKA 1Q97A 3OCSA 4GG7A 2X6DA 1MQBA 3TWJA 3UBDA 1H8FA 3D15A 2VWWA 3G33A 3NRMA 3RHKA 4GEOA 4IX3A 5IG1A 4DCEA 3H0ZA 4UMTA 5J5TA 2R3KA 1FGIA 4QP7A 2ZB0A 4Y73A 2BRGA 2FGIA 3D7TB 3BBTB 4O0RA 5EKNA 4YPSA 4RWKA 4QPSA 5I9XA 4ZTRA 4TL0A 3COMA 4H1JA 1BMKA 5HBHA 4PNKA 5L2SA 5M4UA 3ODZX 2R3PA 4FC0A 5J7HA 1JNKA 3EQRA 5CU6A 5EFQA 3GP0A 4U45A 3OROA 3EYHA 5DR6A 4BDAA 4C02A 5KMOA 4MXCA 4YZ9A 4OTFA 4Z7HA 4II5A 2R64A 3DZQA 3DJ6A 5JFVA 2QOFA 3UJGA 1UWJA 3OZ6A 3BE2A 4CT1A 4OR5A 3FV8A 3OMVA 1HCLA 1VEBA 3ALOA 4B6LA 3NPCA 4EKLA 2YABA 4KKGA 4FVQA 4GS6A 2VO3A 5ITAA 5EI6A 3A7GA 2ZMDA 3FMKA 3NYVA 3IKAA 4IEBA 4GH2A 2OZAB 1Z5MA 5E7RA 2OF4A 5GZ9A 3TZ9A 3RVGA 3R7YA 3ENMA 4FKRA 4RFMA 4CFUA 4RA4A 2IW8A 4IDTA 3EQBA 3W10A 4BB4A 3S0OA 3G5DA 1Z9XA 4YZBA 5DN3A 4EQUA 1SVGA 2FYSA 3FEGA 4QMLA 2C6DA 2HENA 3RP9A 2YDJA 5FM3A 3ORLA 4LI5A 2O65A 2OJJA 4XG2A 1Y6AA 3PZHA 4JAJA 4TWPA 1Q99A 3BGPA 4W4VA 5CS6A 1Q61A 4UALA 3UO4A 4OTGA 2YM3A 4EYMA 4DF3A 3POZA 4CFMA 3EL7A 4J97A 5LMKA 2HAKA 4R5SA 4MD8E 5M51A 3Q53A 2ITOA 2ZM4A 5CF5A 3WZDA 1RDQE 2CHLA 4TYGA 2G01A 2BZHB 5DLSA 4RA5A 4ERWA 3KMMA 5DYJA 5CU3A 2DS1A 5J5SA 2JFMA 1LUFA 5DRDA 2XNMA 2OXYA 4DFNA 4GW8A 4AW0A 2PUIA 4C7TA 1CTPE 2C0OA 3KRWA 3NNVA 4FTTA 2XKDA 2VZ6A 3BI6A 3GQIA 3LMIA 5FTOA 5IQHA 3P9JA 4F09A 1MUOA 3FY0A 1OVEA 1PW2A 3QUPA 4HYIA 4AW2A 4BY9E 5EM8A 5EYKA 4AS0A 2Z7QA 2V0DA 3A7HA 3E93A 4PPCA 3I60A 2EWAA 3EQHA 2BKKA 5E8UA 3GC0A 3VUHA 4X3JA 3JUHA 4X7QA 1WMKA 2OJIA 5FWKK 3NAXA 4C4EA 4YBJA 4ANNA 2CLXA 3GC7A 2GTMA 2PL0A 3OBGA 3SAYA 4YPDA 3FHRA 4CKJA 4DLJA 2V55A 1H25A 4RIWB 2BRMA 5ANJA 3UOKA 1RJBA 4Z55A 4Q9SA 3FMLA 5A3XA 3KN5A 5AA8A 2AC5A 3HRFA 3WF9A 4JL9A 4FTIA 1PXMA 3SDJA 4E5BA 5HU3A 2J90A 4RJ8A 3LLTA 3P0MA 4QNAA 4DBXA 4E8AA 3F3TA 1G8AA 1PYXA 4YGAA 5A14A 5HLPA 5CEPA 2VTPA 4IIRA 1WBOA 1DAYA 5EK7A 2HY81 3R21A 2UZBA 3BRBA 4R7HA 2C5XA 4G6LA 3RTPA 4BDBA 3AGMA 3TUDA 2HZIA 3V3VA 4YBKA 4BR3A 1OL1A 2HIWA 1YHVA 4HCTA 4RQVA 3FZRA 3GXLA 4U3ZA 3FLZA 3CTHA 4AU8A 3UPZA 3GOKA 5KBRA 4H39A 1XBBA 5E8YA 4DC2A 2BZKB 5IA0A 5DOSA 3ROYA 4YURA 2GDOA 3FY2A 2WD1A 4L7SA 3SXFA 2VTMA 1PXLA 1OI9A 3U87A 2E9VA 4E6CA 4EOJA 3ULIA 4AUAA 5DRBA 2Y9QA 3QUDA 4KABA 3D2KA 5I5ZA 5AUTA 3L8XA 4KS7A 5GHVA 3OT3A 3RGFA 3RPVA 1ZOHA 3DJ7A 4JRNA 4HYHA 3ZFYA 1W7HA 4F70A 2PHKA 2YHVA 3UPXA 2GNHA 3U6IA 3OP5A 4BBMA 3TZ7A 3LM0A 3F5PA 4RJ3A 4USDA 5LVMA 4F9WA 3PA4A 1XKKA 3TV7A 3V5PA 2YAKA 3KY2A 4Z7GA 3HV7A 3ZLSA 3QLGA 5HD4A 4QYEA 2XBJA 2C5YA 5FQDC 2G2FA 3ZMMA 4GKIA 3FXZA 4G6NA 4EOQA 4BBFA 3K54A 3HA6A 4N4SA 5CSWA 4I0TA 5AR3A 4YR8A 3C5UA 2QD9A 1H07A 2BRBA 1KE6A 3R02A 2W06A 1YRPA 2WFYA 2Z7SA 4YZMA 3WZEA 5KMKA 5D10A 4YZCA 3EQFA 3PY0A 2QU6A 4K33A 2X9FA 5BVOA 4WUNA 3LAUA 3ZO1A 5CLPA 5L2IA 2WTDA 1ZAOA 4CYIA 2XK6A 2GNGA 4LMNA 4D4YA 4UXQA 3KXZA 2ETKA 3R1NA 4I21A 4NKAA 4XCUA 4F64A 2RFEA 1ZYCA 3I0OA 3RBWA 3ZSGA 5L4QA 4FKQA 4BCPA 4JRVA 4ZY4A 1SMHA 4BGHA 4YHTA 3BQCA 3OCGA 3W2RA 4A4LA 1JSVA 4EOIA 5C8KA 4ANMA 4FTKA 4CSVA 4OAUC 1APME 4TYIA 4YNOA 1YKRA 4KSPA 1SZMA 2W4OA 3DNDA 4PF4A 2JDSA 4M3QA 4YO6A 5KZIA 4LOPA 2C5VA 5HO8A 4HVIA 1H00A 2Y0AA 4KNBA 3FWQA 2OBJA 3FZTA 1ZZLA 3DBDA 1JSTA 1Q5KA 3U4WA 1WVWA 3Q04A 5KNJA 4FSMA 4C59A 5CSPA 3OUKA 3LXLA 5FUTA 4DEGA 4DTAA 3LFQA 4I5PA 3KCFA 3TG1A 3I0QA 4FI1A 4G3CA 3DXPA 3F3UA 4FUXA 3BU5A 2GCDA 2OFVA 3LXKA 3TZMA 3UGCA 4HGLA 3ORZA 2Y4IC 3PXYA 1FMKA 5FXSA 4F7SA 3UOLA 5CAVA 5HEZA 5FDPA 2WIHA 3PXZA 2G15A 4HCUA 3QCYA 3R2YA 4LMUA 4RLKA 4CT2A 3HEGA 4W4YA 1AGWA 5E8XA 2B9IA 3ZUVA 5JFSA 1R1WA 3LW0A 4PDOA 4DN5A 1CKJA 1ATPE 1Q8YA 5AJQA 1YDSE 4RX8A 3R01A 5GZAA 3KL8A 5HCYA 3MW1A 3VC4A 1KUTA 4EH7A 4YLJA 3BPRA 3W8QA 3QQHA 2HYYA 1R0EA 4KWPA 3BE9A 3Q5ZA 3R7GA 5H9BA 4CFFA 3VJOA 4RJ7A 3P08A 5F4NA 4AWIA 3BLRA 3TM0A 4O6LA 2C5OA 2FH9A 5I4NA 2BAJA 4OTRA 3QBNA 2YEXA 4AE6A 3PUPA 4BDEA 4DGGA 4ASXA 3K5VA 1DI9A 4IZYA 1QL6A 2GQGA 3BYSA 3GU5A 4IXPA 4RMZA 3KXXA 4EI4A 3MN3A 3AC5A 2HK5A 3R2BA 3K3JA 4ACCA 1H27A 4IX5A 3Q4TA 3CSVA 3L9NA 1QPCA 4BWKA 4Y95A 4BDIA 2W1EA 2X6EA 1W82A 2ETRA 5C8MA 4EYJA 2PPQA 3CIKA 5KZ0A 4V04A 2BVAA 3K5UA 5L8KA 4ACGA 4KB8A 3BBWA 4IVCA 1SVEA 2WAJA 4I5HA 5DEWA 3VUKA 5IA3A 3COKA 4I6QA 4DBNA 3SV0A 1OPKA 3GUBA 4S31A 1TKIA 3QAME 3TDWA 2UZDA 3QGWA 3GT8A 3PY3A 2GNIA 3FMEA 4R6VA 3ACKA 2JBPA 3R9HA 3UNKA 4FIHA 2WO6A 3DFAA 4QMWA 3WYXA 3FE3A 3KRJA 5DG5A 4X21A 4JAIA 3SG8A 5CENA 4K2RA 4D0WA 4XBRA 3MVMA 1IR3A 3C0HA 1U54B 3ZS5A 3QX2A 2X81A 5AV1A 5EW3A 3R1YA 4G16A 3EJ1A 3RM6A 5IISA 3UQCA 1KV2A 1XH4A 1PKDA 2C0TA 5D11A 1KOAA 2BAQA 2RFSA 3SOAA 3ZRKA 5C26A 5BYYA 3K2LA 3LMHA 2JC6A 4PX6A 3A7JA 4QO9A 3CTQA 2LAVA 4JIAA 3PXQA 4NKSA 4ZS4A 2X4FA 4ZZNA 2P33A 2WMVA 4KKHA 3H4JA 4J7BA 1WBPA 2UUEA 2B4SB 2FA2A 3OWPA 4XBUA 3V5WA 2ITYA 1YDTE 4X2JA 5H8BA 3PSDA 5CNOA 4IB5A 5HBEA 3A7IA 2PVKA 3EN9A 5HCZA 4AE9A 2PZIA 4LRJA 4AZWA 4NL0A 4TZRA 4TN6A 1UU9A 1W84A 3CKXA 1I44A 2VTNA 4FVPA 2W0JA 2AYPA 3EZVA 2PE1A 1R0PA 4FSQA 4W8EA 4RJ4A 4BN1A 5HX6A 2V62A 2H6DA 1WZYA 3P7BA 2WGJA 3NS9A 3EIDA 4WNOA 5FTQA 5K3YA 5B7VA 5JKGA 2W99B 5HG5A 4FT5A 5IUHA 3W2QA 4PMPA 5ETIA 2OFUA 4K11A 5T6KA 5M56A 5DGZA 3IOKA 2BMCA 1ZYSA 5EQYA 4CNHA 2OK1A 3LPBA 5JZNA 3QQUA 4M13A 5AP0A 2FSTX 5LVPA 3L8VA 1ZZ2A 2WIPA 5JQ5A 3P5KA 3SHEA 4BYJA 4EHGA 5AR2A 4L9IA 2YZLA 4FEWA 3R8UA 5ACBC 4FOCA 4DA5A 4L53A 5FXQA 4AT5A 5J87A 2X8DA 1PY5A 2OKRA 5AAGA 2BALA 4ZOGA 3TIYA 4WG4A 3RINA 4QMQA 3OWKA 3F2AA 5KO1A 3WYYA 5BYLA 2OJGA 4EJ7A 2RSVA 3NLBA 5L2TA 2QLQA 5LMAA 4PMSA 4ZJIA 5K5NA 2GQSA 4A07A 4CLJA 3R8VA 5JEBA 3RALA 4LV5A 3IW7A 4FKWA 4BIDA 3CR0A 4FKJA 4S34A 3ZHPC 4A9RA 4BHNA 3EN5A 4EK5A 3O50A 2VX1A 4BCHA 2OI4X 4TWOA 3DU8A 3HGKA 2VTOA 3Q9WA 4IAKA 2OWBA 3ZC5A 5M55A 1KE7A 2HZNA 3G0EA 4IAFA 2F7XE 2PULA 3ZH8A 2FB8A 3ZM4A 4XG7A 4DH7A 5L3AA 3MYGA 5CI7A 4FYNA 4PV0A 4O0TA 3RPOA 2C3KA 3I4BA 3D5VA 3PXKA 4NW5A 1SYKA 3KEXA 4Y46A 2R7BA 5CWZA 4H05A 5TO8A 4UYNA 4W8DA 2J6MA 2BTSA 3LJ0A 3PVGA 5I9ZA 4GJ2A 5C27A 4LYNA 4ZMEA 2BKZA 5HNIX 4XJ0A 5BVNA 5DHJA 5DMZA 4FX3A 4KS8A 4NEUA 4P5ZA 1A9UA 3Q9XA 4FT9A 5A46A 4JG7A 4QYHA 1UNGA 4X0MA 4AZFA 4DT9A 4JLCA 4FTUA 4GL9A 2OU7A 5BX0A 2XNOA 1ZMUA 2J0JA 3LIJA 3NNUA 3NUPA 4YTCA 4U97A 4E5AX 3KXHA 1SNUA 3DFCB 3VUIA 4ACDA 4BYIA 5E8TA 5EYDA 2C6OA 4C35A 3BHVA 4MXZA 4G3DA 5CYIA 5ANDA 3A8XA 5BUEA 3CGOA 4ZXTA 2A1AB 5G6VA 5CEQA 5JGDA 2IVSA 2YM8A 3TNPC 4GFMA 5AP7A 2W1IA 2I1MA 4Q5HA 4JXFA 3JS2A 3DTWA 4K6ZA 3ZRLA 3ROCA 1KSWA 3W32A 5IMXA 3IDBA 3ORTA 4XV9A 5CT7A 4JI9A 4EK4A 4I22A 4KIPA 2XK8A 3KXGA 3LMGA 1ZY5A 3ORPA 4IM3A 4C62A 3TL8A 4DEAA 3VRYA 3RAHA 2V22A 1DAWA 2RG6A 3NNWA 2QOOA 3OF0A 4IVAA 4J53A 3V01A 4BCIA 4BKZA 4UYAA 2ZDTA 4E6DA 4RZVA 5EOLA 3JY9A 4YC8A 3D0EA 4K0YA 4RIXA 3V6SA 2F49A 2WMAA 4BCGA 5DVRA 1F3MC 1M2QA 4XS2A 1QPDA 1ZXEA 4RPVA 1XBAA 5AV4A 1OB3A 4S33A 4DCAA 2IG7A 1VYZA 3PZEA 3O8TA 5ANIA 4TXCA 2EXCX 2VWIA 3C1XA 3MV5A 2XIZA 2R3QA 3ITZA 2VWUA 4MBLA 4XEYA 3OEZA 4KSQA 4QPAA 3U55A 5F94A 3CQWA 4ZIMA 1MRUA 4MNFA 3WOWA 4CV8A 1YXUA 2R3JA 4Y85A 2CKQA 3FKOA 4Z3VA 3TUCA 3BLHA 4YHJA 2Q0NA 2QVSE 5A9UA 4RVMA 1OITA 3UMWA 4W9XA 4TRLA 5KMNA 2J7TA 4M8TA 2XF0A 3LQ5A 4UEUA 2Y4PA 4FKVA 4BL1A 5FD2A 4L68A 4ZS0A 3VBYA 4CMOA 4A4OA 2QOHA 4RX7A 2YCFA 5TKDA 3FQSA 4CYJA 4DH1A 4O0YA 3VWAA 2PVNA 4U80A 1Q24A 5IQIA 3VS5A 1AD5A 3FSFA 4AOTA 4F1OA 2F57A 4D1SA 3PJ3A 4F1TA 4C36A 1DS5A 1OL5A 2QI8A 2YITA 4FV0A 2J0MB 4L45A 4RIOA 3GFWA 5I9UA 2YWVA 5HIBA 1F0QA 3NAYA 4JS8A 3NW7A 5I9YA 1J91A 2XH5A 4MF0A 5AFVA 4ZSLA 3EN6A 4RC3A 1UU7A 4WSYA 4QP4A 3TV4A 3ODYX 4JX7A 3CTJA 4E20A 4WBBB 4FSUA 5LVLA 3EQPA 4G31A 4GCJA 2O3PA 4U5JA 1FBNA 4FEUA 2BRHA 3RAWA 4IAAA 1U5RA 4NM5A 4CVAA 2C30A 3CJFA 5CTPA 3I5NA 2W1HA 5CQUA 4A9UA 3MH2A 1E9HA 4ZLYA 3EL8A 1MP8A 3ZDUA 2QG5A 3QWKA 5HE1A 4C4IA 1H28A 3GCVA 4YJVA 1JKLA 3DT1A 3ZCLA 5HX8A 3TJDA 3DXQA 2XNGA 3II5A 3QYWA 2A0CX 5AUVA 5A6NA 4OTQA 3K3IA 4BCKA 4IC7A 5HVKA 4YZNA 2DWBA 4NIFB 2XJ0A 4E1ZA 4NTSA 4W4XA 2PY3A 4XYFA 4CFWA 1OIQA 2B52A 5LJJA 5EHOA 2ERZE 4FV7A 4PTEA 4EH3A 1A06A 2CGUA 4IB3A 1UVRA 3Q52A 5HLWA 1FQ1B 4XUFA 4RWLA 1I09A 3SX9A 5KKRB 1Q3WA 1SM2A 2VUWA 3D14A 3FL4A 3PXRA 4G5JA 3VBXA 4MBJA 2W1FA 3GU7A 4CG9A 3DKOA 1URWA 4R3PA 4AFEA 1KWPA 4CQGA 4YTIA 4BTFA 2IVTA 3DK3A 1M52A 2G2IA 4C34A 5E1EA 2R0IA 3PXFA 4XG3A 3RWPA 5AP4A 1P14A 2W1CA 3MIYA 4F9YA 4ZLOA 2OH4A 4N0SA 3H9FA 4KRDA 4R3RA 1GY3A 2PUUA 2VNYA 2VTIA 3FI8A 2JIUA 3BEGA 4IANA 4EC8A 1IA9A 5FP6A 3F69A 2UZUE 4QP8A 2OSCA 1FGKA 2Y6MA 1OKWA 5KHXA 4YNEA 2R0UA 3FMDA 2BPMA 2JKMA 4I6FA 5AP3A 4YTFA 3AG9A 4AW1A 4DG0E 2PU8A 3FZSA 4M69A 2OJFE 1PMEA 3UVQA 3KREA 4FZ7A 3V8TA 5FXRA 3NUUA 4WNPA 5GINE 4JT3A 4K18A 4NZWB 2OIBA 1CSNA 3LXPA 5L6WL 3W2PA 4BC6A 1NY3A 3ZRMA 2VTLA 2YCSA 3ENHA 5M44A 1HOWA 5IZFA 3TV6A 5IQAA 4MCVA 3D7TA 4RC2A 4G3EA 4F6SA 3ID6C 2WQEA 3R8LA 4HJOA 3W16A 4DHFA 3R30A 4B99A 4DYMA 3CKWA 4FG9A 2GHLA 3N4UA 3P86A 4YHFA 1CDKA 4EOOA 1KE5A 4EH4A 3I5ZA 3E5AA 3KK8A 2RIOA 3OC1A 3QZGA 3TNWA 2XRWA 2YIRA 2ACXA 2GHMA 4A7CA 2YAAA 3EQDA 5EYCA 3ZDIA 3MPAA 4B7TA 4QQCA 3H9OA 4CRSA 4RX5A 4EJNA 3OW3A 4WRGA 1PMVA 4MQ1A 3BKBA 3A4OX 1BLXA 3E63A 3ACJA 4GU9A 4FV3A 5E8SA 4DFZE 2ONLC 5JK3A 1UNHA 4HVHA 5AR5A 5J9LA 3ZC6A 1O6LA 1TQMA 4KIQA 5CSVA 3R8ZA 1ZRZA 4DFUA 3ZLXA 2PVHA 2ITZA 2W5AA 2XIRA 5AP5A 3I7BA 4AN2A 3MVHA 4WHZA 2OZAA 2DQ7X 5K4IA 4C4GA 4UMRA 4TPTA 3PYYA 2W9ZB 2I0EA 2BROA 3S1HA 2JGZA 4I1ZA 3UODA 4I94A 4L7FA 4XP0A 4WO5A 2UZWE 4R3CA 4ZLZA 1L3RE 3NWWA 1H1RA 3FKNA 3R8MA 4JDHA 4EWQA 5D1JA 4AQCA 4QMUA 2JFLA 4K8AA 4BBEA 4OT5A 3VVHA 3SGCA 5CEOA 4I92A 2XKCA 4APCA 1BL7A 4EH8A 3DQXA 3D83A 4V01A 3MH3A 5L8JA 4DH3A 2ZMCA 1GNGA 3QD2B 2X39A 3UTOA 3R04A 3DAEA 3DBQA 4ZZOA 4EONA 4I5MA 3ZM9A 5CVFA 3ZO4A 3LHJA 4YO4A 3VHEA 5CU2A 4HPTE 5CAQA 3ZFXA 1Y91A 1YOLA 4U8ZA 4GVAA 2CLQA 5DH3A 3AT3A 3P79A 1OUYA 3DZOA 3VUTA 1ZMVA 3MFRA 3JPVA 4KUJA 1OIUA 2WMSA 1CKIA 1BL6A 3BV2A 4IX4A 4QQJA 4O0WA 3GOPA 4TWNA 4PP9A 4RZWA 2X2LA 3ZFMA 1YXVA 2I0VA 2IPXA 4D2VA 4FGRA 3R28A 3NUAA 3FXXA 2I0YA 3NIZA 4RT7A 3EOCA 3C9WA 3KRRA 3UYSA 4FT7A 3H30A 4NSTA 1CKPA 2HELA 4RIWA 2C6LA 1W98A 2CPKE 1H4LA 3GENA 3NW5A 4XHKB 3VS3A 1UWHA 4WNMA 4WG3A 4S2ZA 4YLLA 2WTIA 4JQEA 3P7AA 4HW7A 3L9PA 4DTBA 3F7ZA 2I0HA 5DE2A 5IH4A 1WBVA 5HO6A 1YXSA 4FK3A 4AX8A 4R78A 3L1SA 4GRBA 3TNHA 3Q6WA 2C4GA 1GIJA 4CMUA 1B6CB 4L3JA 3ERKA 4XV2A 3WZUA 4C61A 2YJRA 5JRSA 5LWNA 2UZVA 3ZOSA 2UW9A 3O96A 5H2UA 4L8MA 4XRLA 3EZRA 4WSQA 2CMWA 1RW8A 2GTNA 4O21A 4B8LA 4E6AA 3BEAA 3NUNA 4L01A 3V5QA 3EMGA 3F61A 5HIEA 2E9PA 4HVGA 4AT3A 1V0OA 1XH7A 2R7IA 2UW3A 3OD6X 4Q9ZA 1JBPE 3ZYAA 4M66A 3OFMA 4GKHA 3ORNA 2RG5A 4YZDA 1Q62A 5HE3A 3UIBA 4QP3A 4F7JA 3HV6A 5M4IA 4RJ6A 2GNJA 3G2FA 1J7LA 4QMMA 3C7QA 5AV2A 2WMBA 3E3PA 5JH6A 3GCPA 5AEPA 4NFMA 3QF9A 1JKKA 4H1MA 3VS7A 3KXMA 4DFXE 3V04A 2R5TA 2NO3A 4HCVA 3AMBA 3EB0A 3OXIA 4Q2AA 3A62A 2R3MA 5HICA 2IW9A 4F0GA 3MIAA 4IJPA 5CZIA 1BX6A 3V8WA 4AA4A 5L2WA 1SNXA 5M53A 3HAMA 2C3JA 4FV1A 4A06A 3D94A 3KC3A 3MVJA 3OUNB 4CTCA 5CXZA 1XBCA 4R5YA 3I6WA 3HECA 4GJ3A 3QQGA 3CY2A 2A4LA 5FBOA 3MB6A 2ZAZA 4CGAA 2NPQA 4IZ7A 4LL0A 5K0KA 5AAFA 3EWHA 2XKFA 2Q83A 3BHTA 2XUUA 3C4ZA 1H24A 1Z57A 1FOTA 4M15A 2IZTA 3VO3A 3BYUA 5TR6A 3UNZA 3CPCA 4CTBA 5FRIA 4EOSA 3F82A 3P78A 3PY1A 1YI3A 2UZNA 3NCGA 3WIGA 5AUZA 4FKLA 4E4XA 4ERKA 4ZAUA 2OG8A 4BKYA 2BDJA 3DLZA 5A4TA 3ET7A 3M1SA 1WBSA 5IQGA 2IJMA 2QO2A 3BU6A 3PIYA 4FZ6A 2PVMA 3GGFA 3O71A 5AP6A 4DAWA 2Z2WA 5JQ8A 3PP1A 2O64A 2BTRA 2QKRA 3CP9A 4L67A 4NW6A 1PJKA 4QPMA 3UC4A 3HMPA 3CQUA 4XRJA 2R3NA 5HE2A 3QUEA 3W1FA 5B2KA 3QKLA 3EFJA 4EWHA 3PPZA 4AZEA 4WOVA 3PRFA 2CCIA 4PMMA 3WF7A 4YJPA 4MXOA 4C3RA 4QMOA 5JFXA 4ACHA 5M4CA 3DOGA 3E88A 3VUDA 5JGBA 4MXYA 3JR1A 3ELJA 4JVGA 2WNTA 3C4CA 3T3UA 2DYLA 3PWDA 4FSZA 2SRCA 5FEQA 5TOZA 5HO7A 5F1ZA 2B0QA 3PIXA 4QP1A 3DAKA 3POOA 4DFYA 4U40A 2IZSA 4M7IA 3WIKA 1PXJA 5E1SA 4PL5A 3U54A 3KF4A 4PY1A 2YM7A 4QNYA 3O23A 2VO6A 4QTAA 3PA5A 2R3OA 5AX3A 2X9EA 3LXNA 2F7EE 5IDPA 4BHZA 3RK7A 2PMOX 5HCXA 4NFNA 2ONLA 4CLIA 4UMPA 3FL5A 3O8PA 3ATTA 4FTCA 3KMWA 4BIEA 3OOGA 3FKLA 1BI8A 1NA7A 3LM5A 2PVRA 3PPJA 3QZFA 4F9BA 1Q8ZA 1YWNA 4GSBA 1GZOA 2WHBA 4YSMA 4O2PA 4ZTSA 2ZB1A 3GU4A 2XM8A 3OCTA 4U43A 3O51A 3PVWA 4C38A 3N51A 1QCFA 1JQHA 1Q3DA 4FNYA 5FDXA 3RCDA 5LVNA 2F9GA 4YJNA 4O7VA 3B2WA 2ITUA 4P90A 4OAVB 3UZPA 5C03A 2P2HA 1YWRA 4KRCA 3R1SA 4EQCA 4FTLA 3D5UA 2BHEA 3SA0A 2WOUA 4ASZA 2W7XA 3MI9A 4W4WA 2XVDA 5I9VA 2ITVA 2NP8A 5FTGA 3TNQB 1JLUE 2JDRA 2EB2A 2XCHA 4GUBA 4AOIA 3Q3BA 5GIPE 4CG8A 1UNLA 4FKSA 2WQMA 3V5LA 3EKKA 4D2PA 4EEVA 4IWOA 2XBAA 4FL2A 4PTCA 1YQJA 1GOLA 4FKOA 4O1OA 1FVRA 2X2KA 5AV0A 4RVKA 5CVHA 2NNWB 3HL7A 5DNRA 2UW7A 4X2FA 2GFSA 4P7EA 4PPBA 4RIYB 4WT6A 5LWMA 3H9RA 4RWJA 4N57A 2R3GA 3EYGA 2PVLA 1UKHA 3ORKA 1VZOA 3ANRA 4LOQA 4O82A 4EHZA 5EQPA 3I6UA 4PMTA 3KF7A 4PL4A 4F0FA 2VWZA 5KCVA 1XJDA 5BUIA 3I81A 1OBGA 5AM7A 2OO8X 4IX6A 2Z02A 3LFAA 5D9HA 4RX9A 3ZONA 3IK3A 5IQEA 3UC3A 2BAKA 3MWUA 3UMXA 2QOCA 4EH9A 4D4SA 4IMYA 1JSUA 1H1SA 2EB3A 2C6MA 2JIVA 3CPBA 3MVLA 3O7LB 4CMTA 5IUIA 2KULA 3I1AA 4GG5A 2R3IA 4O22A 3HV4A 1JOWB 2PTKA 4IH8A 5KMJA 5CAUA 4WBOA 4JG6A 1H08A 4RLLA 4ID7A 1V0BA 4V0GA 3BZ3A 4BDCA 1U54A 4I20A 3R7VA 3W33A 5E92A 2VU3A 4V0GB 3NYXA 4GFGA 3ZZWA 4EBVA 3ZXZA 1Y6BA 2EXEA 3PE1A 1GJOA 4OBPA 4EORA 1E1XA 2X7GA 4IQ6A 5LCJA 5J1VA 4FIIA 2VWXA 5HG8A 3O0GA 3OS3A 4O0UA 1H26A 2VGOA 4U3YA 3S95A 4FTRA 4D4VA 5K9IA 2CKEA 2VO7A 1KE8A 3EFKA 4FICA 4ARKA 3BGQA 4ALVA 3UG2A 3LFFA 4BI2A 5H3QA 1JAMA 3W2SA 1E1VA 4FZAB 3V6RA 2JAVA 3SQQA 2YZAA 3H3CA 4GT3A 3IO7A 4I0RA 4FTOA 1Y57A 4OGRA 3WILA 5EOBA 4FEXA 3L9MA 5EDQA 3W8LA 4D1ZA 3C4WA 4Y8DA 4PDPA 5JT2A 5IEVA 2JKQA 3CD3A 4OTIA 5M06A 4M68A 2CCHA 2QHNA 5AM6A 4NCTC 2R9SA 5HI2A 4AZSA 3NUSA 4BWXA 4FKGA 2C5NA 3C5IA 5CALA 4IWPA 5GZ8A 4HPUE 4FSWA 5DI1A 5H8GA 2ZYBA 1BYGA 4MH7A 4B8MA 3HLLA 3VNTA 4CFNA 4YMJA 5KKRC 2GQRA 4O7WA 2VNWA 3TIZA 5CEMA 2WEVA 2Z7LA 1LP4A 3CC6A 5E8VA 3LFEA 2J9MA 3LCDA 1YI4A 1K3AA 3QQKA 4J52A 3G0FA 3TI1A 5IPJA 3NGAA 4O91A 3UVRA 4CD0A 3HMOA 2IWIA 5LOHA 5ANEA 4FIJA 4BDDA 3HMMA 2GMXA 4E3CA 2H9VA 3NEWA 5FG8A 5K0XA 4D58A 3FI4A 3VBQA 2A19B 1IRKA 3FYJX 1KE9A 4PTGA 5IMEA 3Q9ZA 4HNIA 4HYSA 4BCQA 2J5FA 4E5WA 4FIFA 4BCMA 4XH6A 3A61A 5CSXA 2P2IA 1P4FA 4OLIA 5CF8A 3VF8A 4O7TA 3FBVA 2PMNX 1M2RA 2YM5A 5LVOA 4DFBA 3EN7A 2ITTA 3EFLA 1NVSA 3VRZA 4GT5A 4O81A 4QTCA 4QP6A 1OL6A 2C6EA 3E64A 3IW5A 4J1RA 3T8OA 4C37A 3L8SA 5I3RA 3IW4A 4IFCA 3OT8A 4QQ5A 3ZUTA 5CEKA 3AC4A 4FTJA 4AN3A 3GEQA 4MKCA 3NYNA 3FZOA 3TJCA 3E8EA 1Q41A 3SRVB 4FSRA 3FLSA 4AG8A 5FEDA 4J95A 3GCUA 4FT3A 2QC6A 3NSZA 1PHKA 5IA2A 1LEZA 3G15A 3E8DA 2PZRA 2ITQA 3WZKA 3ZEWA 4IWQA 1ZY4A 3F66A 1U4DA 2LGCA 4ZZMA 4DGNA 5IA5A 2B1PA 5CAOA 5HTIA 1LPUA 4QMYA 3DAJA 5GJDA 2W1DA 5AUWA 3GC9A 3QC9A 2C6TA 5HVYA 3DV3A 4FTNA 4HYUA 3ZTXA 3CLYA 3DKCA 2RGPA 2E9NA 3VHKA 3WZJA 2VGPA 3IONA 4FV4A 4I4EA 3Q4UA 4ITHA 3FJQE 3CE3A 4NUSA 4AGUA 2VV9A 1FMOE 2VTJA 4OTDA 5AP1A 1WBTA 3ZBXA 5D12A 3JVRA 5AAEA 1OIYA 5AX9A 2HWOA 4M14A 1NW1A 2F2CB 1VYWA 2GU8A 2UW5A 4ONAA 3RK5A 4UB7A 1H1WA 4QP9A 5ETCA 4H58A 3KK9A 3R7IA 3HMIA 1M7QA 4EZ7A 4RFYA 2OGVA 1YXTA 4FL1A 3KXNA 4ZSEA 3BWJA 3PJ8A 2XA4A 5AA9A 4L44A 4UWBA 5CNNA 3SXRA 3WI6A 4KIOA 4OTPA 4C57A 4CRLA 3GCQA 4GIIA 1M7NA 4TTHB 3TKHA 4XOZA 4AFJA 2I7QA 5A6OA 5HNBA 4NWMA 5C9CA 3C0IA 4ZK5A 4AACA 4FIEA 4IWDA 2VWYA 5IQBA 3IDPA 5C8NA 2VWVA 3N9XA 3F2NA 3LFNA 5JFWA 2W1ZA 3QHWA 3VS1A 3D7ZA 3RNIA 5C01A 3VS4A 3QLFA 2XKEA 4KAOA 3BCEA 3VN9A 3T3VA 4J8NA 4IACA 3SC1A 2RFDA 4RWIA 2WZJA 4E26A 2BDWA 5IQDA 3NVKI 3FSKA 4ZSGA 3QTUA 4YJUA 3A2CA 1OPLA 2O5KA 2VWBA 3G6GA 4E4NA 3IOPA 4PWNA 4R1YA 4E7WA 5CX9A 5BUJA 3ANQA 1SVHA 1IEPA 4IC8A 3U6JA 3MA6A 4I93A 4ZJJA 1XQZA 1PXPA 3UE4A 4BTJA 4D55A 3R0TA 1YDRE 2J0KA 3FC2A 3KQ7A 4L42A 4D5HA 3PVBA 2XK4A 3G51A 2WQBA 4QYYA 5DEYA 2QHMA 3QQFA 5HTCA 5IA4A 2J50A 3O2MA 4KD1A 4WIHA 3QTXA 4J96A 3TUBA 2ITPA 3FXWA 1GAGA 4MEDA 4G2FA 3CS9A 3ZSIA 4MHAA 3C4FA 3LVPA 4JBVA 2WTKC 4DEIA 5HESA 3KU2A 2XJ1A 1URCA 2QU5A 3DA6A 4S32A 2Q0BA 2BRNA 1O9UA 2X4ZA 3FMHA 4DG2E 3NMUF 3DKGA 2EXMA 2WMWA 3UIMA 3OTUA 5HBJA 3E3BX 4HZSA 2DUVA 1NXKA 2YM4A 2C47A 4ANLA 3GFEA 5EYMA 4CCBA 3EN4A 5IEYA 4EH5A 2QONA 2GFCA 3FUPA 3N4VA 4JIKA 4O6EA 3AOXA 5HG9A 1ZYDA 4IE9A 4IW0A 5HE0A 4YSJA 3HMNA 4RSSA 2VX0A 4YC3A 3REPA 4QMPA 2QLUA 2WMXA 4O0VA 3RPSA 4ANSA 4IADA 2VTSA 3QYZA 4I5CA 2XEZA 1H0WA 3OTVA 1G8SA 4AZVA 4APPA 4E4LA 2GNFA 3FI2A 5AUUA 3C4EA 3CBLA 2V7OA 3R7EA 3FC1X 1UA2A 1J7UA 2X2MA 3HP5A 4NCTA 3RK9A 4CV9A 4NIFA 5C4KA 5AWMA 5HTBA 4MWIA 3W2OA 4JBPA 1XH8A 2E9UA 2HZ4A 3DK6A 3DS6A 3ORMA 3V8SA 3QD3A 4JQ7A 4L3LA 3PLAE 3BU3A 2YM6A 2XK9A 3MY0A 4LOOA 4NJ3A 3ULZA 4EK8A 4F63A 4X3FB 5J8IA 3B8QA 4DT8A 2J2IB 4UBAA 3PSCA 2BUJA 2H8HA 3GB2A 1TQIA 4M12A 4XG4A 4AZTA 4BZNA 1ZYLA 3BELA 4IZAA 3RWQA 5A54A 2PUPA 1XH5A 3VAPA 4FBXA 4UMQA 1PMNA 4WRSA 5JN2A 4C0TA 2VRXA 1U5QA 2JIIA 3TKUA 4G3FA 3FLWA 4D5KA 3A7FA 4AA5A 3QTIA 3KN6A 4JNWA 4LV8A 3W18A 2C68A 2PMLX 4OTWA 4BRXA 5EHLA 5E8WA 1OBDA 5TT7A 5LMBA 5IDNA 4X6QC 5LCKA 4R8QA 4FTAA 4WNKA 3MFSA 1IA8A 2OF2A 3OWLA 4FKIA 4C3PA 4DEEA 2FSMX 1H1PA 1Y8GA 3B8RA 3HUBA 2ZOQA 4FK6A 4LG4A 2A27A 2ITWA 4P5QA 5IEXA 4EOLA 4GU6A 4G9RA 4D1XA 1YOMA 3QXPA 3DY7A 3MDYA 5EH0A 2P55A 3ZO3A 1UV5A 5HVJA 5LQFA 3MY1A 4BDHA 2Z7RA 4XX9A 3HA8A 1OKZA 2HOGA 4JBOA 2BR1A 4HVDA 4YJQA 1OIRA 3PVUA 4IJ9A 3C0GA 5D41A 3UNJA 2C6KA 3G6HA 2JDTA 2WTWA 3QQLA 3QZHA 2PE0A 1F5QA 3BYOA 3P7CA 4TY1A 5CSHA 4F65A 3ZEPA 2O0UA 5ETFA 5F9EA 5EM5A 5FBNC 4FTMA 4C2VA 1PRYA 1Q8TA 3HKOA 5IKWA 1BI7A 3H0YA 5AP2A 5L6PA 4FV8A 2YCRA 3RAKA 4P4CA 4R1VA 3QA0A 5IU2A 4I3ZA 3CY3A 5M07A 4YJTA 1GZ8A 1REKA 2WPAA 1MRYA 3QA8A 4KBKA 3VULA 4DEHA 4EH2A 3LOKA 3D9VA 4EOKA 4F08A 1GZKA 3GNIB 1M2PA 3Q2MA 2GS6A 4TYHB 4AT4A 2XNPA 4KIKA 3MB7A 3OVVA 4MX9A 4D28A 5I3OA 5IH5A 4OT6A 2RFNA 2UZOA 5T68A 4KIKB 4ZMFA 3RKBA 5C1QB 2VO0A 1GZNA 2HW7A 2QO9A 3AC1A 4FSNA 3U6HA 4GYIA 1IASA 2JDOA 5DPVA 3RPYA 2CNVA 2PE2A 3PTGA 4BGQA 4PUZA 3R1QA 5IQFA 3BV3A 2VTRA 4MF1A 4EOMA 3A8WA 5HU9A 2CGWA 3QCSA 2OXXA 4QOXA 4QMSA 2WMRA 3RPRA 3P23A 3SD0A 4AXAA 3HP2A 4UXLA 3UO6A 4O84A 3PFQA 4O7ZA 2EUFB 4FTQA 2WEIA 2YDIA 5K5XA 1V0PA 5EI2A 5HZNA 2IVUA 3WF6A 3BWFA 5EQEA 4MD9E 4QQTA 1XO2B 4A9YA 5I9WA 3FMMA 4ZTQA 3SW7A 4M0ZA 3P1AA 2NRUA 5CQWA 1PXOA 3FAAA 3MFTA 3S00A 4D2RA 4CZYB 3S3IA 1LEWA 5KMLA 1FVTA 4BDGA 1VR2A 1YHWA 1PF8A 3SKCA 2CNQA 3FZ1A 5CF6A 2XIKA 3COIA 4BDKA 2ERKA 4ALUA 3TCPA 4HNFA 4CEGA 3VW8A 1W83A 5DWRA 3NX8A 3AT2A 4IHPA 3Q96A 4C4FA 5A4EA 4QMXA 4RBLA 4C4JA 3DJ5A 5KX8A 3PDTA 3CQEA 3ZO2A 3U9CA 4EUUA 3LQ3A 4FEVA 3D5XA 4BGGA 5FM2A 3IGGA 4ENXA 2CKPA 2F2UA 4BTMA 2W96B 5EW8A 3KKVA 1B38A 3KA0A 4XP2A 3WE4A 4D2WA 4PDSA 5KE0A 4E4MA 2PMIA 3FPQA 3E8NA 5KBQA 2JDVA 4DGOA 2UZTA 2XJ2A 2JKOA 2O2UA 1TVOA 3M42A 2H34A 4IB1A 1PKGA 2PVJA 1BUHA 2HW6A 2W05A 2G9XA 3BHHA 1W8CA 5DT0A 5LARA 3IW8A 2PSQA 4LFIA 2XK3A 4MXAA 4WD5A 2WMTA 4F6WA 3LFDA 5I0BA 5GJGA 1Q8WA 2YACA 2C1AA 4L46A 2GS2A 4XG8A 2C0IA 4E73A 1STCE 3M11A 3QRJA 4U42A 3TEIA 3U4UA 3UQFA 5DA3A 3EKNA 2A2AA 4OTHA 1XH9A 5AR8A 2WTKB 3UOJA 4BCFA 1NT2A 4O7LA 5DT3A 3AQVA 1OUKA 2PVYA 3QCXA 3NIEA 4GYGA 3QRKA 4MYGA 4AGDA 4QTEA 3CGFA 4MNEA 2QOIA 4MBIA 4N6YA 4PNIA 2R3HA 4QRCA 3DCVA 3DXNA 2ETMA 2YFXA 2ZJWA 4M84A 4MNEB 3WF8A 1PXKA 2VTAA 3D2IA 3HVCA 3O17A 4IAIA 4Y72A 3HRCA 3KVXA 5J9YA 5AUYA 3QTZA 4C3FA 5CY3A 4O83A 3BX5A 2CSNA 4V05A 4QP2A 3PPKA 4FEQA 1T45A 3AC8A 5A4CA 3QXOA 3FQHA 4MD7E 5AUXA 2BIKB 3SW4A 3JYAA 5E4HA 2KTYA 3MJ2A 1PXNA 4I6BA 3QRTA 5B0XA 4I24A 3D4QA 4DITA 5EKOA 3MTFA 3UVPA 2WOTA 1QMZA 3KGAA 3R9NA 2W4JA 2R4BA 4E6QA 4AP7A 3FHIA 3ORXA 2WB8A 4DH5A 2CN5A 1KOBA 2OH0E 2IVVA 2PUNA 1UU8A 4WUAA 4G6OA 5JMSA 4G1WA 2YERA 3GVUA 4JJRA 3COHA 3E62A 4K9YA 1DI8A 1OZ1A 1O6KA 3DBCA 5H8EA 4EQMA 3HDMA 3MGYA 2OZOA 4G5PA 4GFOA 3FLNC 3OW4A 2G1TA 4NH1A 2XIYA 4ZSAA 1IAJA 5TE0A 5HIDA 4QYGA 2BHHA 1J7IA 3EQGA 2FUMA 1ZOGA 3VF9A 1XWSA 3E92A 4JBQA 4XG6A 1S9JA 4H3BA 5BNJA 1PXIA 5BMSA 1WFCA 4N6ZA 4LGDA 2VD5A 4RJ5A 2B54A 4XLIA 4MAOA 4U79A 1R3CA 2WU6A 3TTIA 3TN8A 3U9NA 2ZV8A 3F3WA 1MQ4A 4A9SA 1ERKA 5CVGA 2C69A 2R3RA 2R2PA 3FMJA 3QKMA 5D7VA 4D9UA 2PZPA 4TWCA 2XNNA 3PRIA 3I79A 3UZTA 4MK0A 2BZJA 4FKUA 1YWVA 3M2WA 3IPHA 3VIDA 4JR7A 2ESMA 1AQ1A 4NK9A 3E8CA 4TNBA 4GT4A 1X8BA 2X0GA 2B7AA 1OECA 2WU7A 4JOAA 4BZOA 2XYUA 2QODA 4TW9A 2W5HA 4W9WA 2R3LA 3HZTA 1OL2A 3PJ1A 4FKTA 4HOKA 4Z9LA 4BI0A 3DGKA 4BF2A 2X7OA 5ICPA 4UZDA 2ZV9A 4N70A 2YN8A 5BVWA 2F7ZE 3F5UA 4RFZA 4EK6A 3RJCA 5BMMA 2YA9A 4TNDA 4FR4A 5CU0A 5L2QA 3UO5A 4QTBA 2PYWA 4RQKA 3GCSA 3R9DA 4NM7A 2JLDA 4F9AA 3MSSA 4NJDA 4FZFB 4QD6A 2VTQA 4U6RA 3FZPA 4DG3E 1G5SA 3LFSA 4ITJA 1YOJA 4I4FA 4A9TA 5BVEA 3OY1A 4QTDA 4BCJA 4EOPA 2WELA 5BVFA 2NRYA 4F4PA 2G2HA 1IG1A
chains in the Genus database with same CATH superfamily
3F88A 4DHZA 2OXDA 3GC8A 3PWYA 3CD8A 4HGTA 2UV2A 4DTKA 2C3IB 5A4LA 2V7AA 4O7YA 3QCQA 3TACA 2BCJA 3QKKA 4DEBA 2QOQA 4QYFA 4RRVA 5HGIA 2J5EA 3VBWA 2W4KA 4RVTA 3BHYA 5J79A 4BVUA 2B9JA 4YJSA 4D9TA 1NVRA 3R9RA 3R9OA 4LUDA 4KBCA 3DDQA 5HKMA 3ZU7A 4GK4A 2W1GA 4FMQA 1A48A 5T3QA 4M67A 2V5QA 4EK3A 3MH1A 1K9AA 3VUGA 4QMTA 4EZ5A 4F1MA 3G90X 4EL9A 3IQ7A 3D5WA 4H3PA 5KMIA 2Z8CA 3S4QA 3R73A 2E2BA 3C51A 5DT4A 5CAPA 4UN0C 5DBXA 5IH6A 2IO6A 2XZSA 5DR9A 5HOAA 4AN9A 1XR1A 2CJMA 3C4XA 4D2SA 5IQCA 4ZTLA 4S30A 2VX3A 4R7IA 1M14A 4LQMA 1Y8YA 5ETAA 4K1BA 4ANQA 1JPAA 5ACKA 4B9DA 4EBWA 4XV3A 3MFUA 2RL5A 2YISA 2XIXA 4FV5A 2XMYA 3BIZA 3AD6A 4KBAA 5CU4A 5JGAA 4FVRA 3NYOA 5HG7A 2BFXA 5CXHA 2CGVA 1WAKA 3IG7A 3ZZEA 2AUHA 4RIYA 3UDBA 4FF8A 2VTHA 2YIXA 1QPJA 2UVZA 3R7UA 3EH9A 4LRMA 4DDGA 2QO7A 3NDMA 2HXQA 3P4KA 4I6HA 3AD5A 3NZ0A 4H3QA 3UZRA 4EHVA 4O2ZA 3UP2A 3Q60A 1J1CA 5B2MA 2BFYA 4FYOA 4CFXA 4GUEA 2O8YA 3DBFA 1YHSA 4XOYA 4PRJA 4AXFA 1FPUA 3T9TA 3HV3A 4O1PA 1U59A 4X6RA 4YLKA 4L3PA 4E93A 4F9CA 3NW6A 3F3VA 3TKIA 1H1QA 3R7OA 3WARA 4JDKA 4WKQA 3TNIA 4CKRA 2REIA 4FV6A 4NTTA 3LJ2A 4MTAA 5M4FA 3LCSA 4O38A 3PP0A 3F6XA 4IAZA 4CFVA 1WVYA 3GBZA 4XMOA 2HCKA 2FSLX 3W2CA 5A4QA 4HGEA 4F78A 3QRUA 2WQNA 3CXWA 2VTTA 3N4TA 1J1BA 4YC6A 2IN6A 1PMUA 4KINA 3FLYA 3IECA 4Y83A 5GNKA 2EVAA 3FLQA 3SOCA 3WBLA 2UW6A 4BIBA 4O0SA 4RG0A 3TTJA 3AC2A 3QZIA 4YTHA 5EDRA 1QPEA 4X2GA 3R22A 4U0IA 4Z16A 3CJGA 3VQHA 3VBTA 3AXWA 2CDZA 3KULA 4ZTNA 4EH6A 3RAIA 3KULB 3FI3A 3BYVA 3FPMA 3PJCA 5F95A 5JZJA 4R77A 4IFGA 4RGJA 2QR7A 4DGLC 4ZY6A 4OBQA 4EKKA 2YIYA 5M08A 4ZTHA 4USEA 4AGWA 3R6XA 4LGGA 1RQQA 2I40A 4NM0A 4GK2A 1YI6A 4EUTA 5EG3A 4U81A 3VW6A 2UW0A 4TT7A 3ZSHA 4C8BA 1H01A 2OIDA 2X1NA 2WTVA 2YLFA 3O8UA 2X7FA 5EM6A 5FEEA 3R8PA 3MESA 4D2TA 4F7NA 4IB0A 4FUYA 4QMZA 4X3FC 4ASEA 5J9ZA 3BYMA 5KHWA 3HAVA 3RI1A 5E9EA 3FMNA 3Q4ZA 5ANOA 1W2DA 3LZBA 3I7CA 3MH0A 5L8LA 4C58A 4A4XA 5CZHA 3EFWA 3W55A 1Q4LA 5HLNA 5FLFA 3R71A 3KVWA 4Y5QA 5DFPA 2ITNA 3GQLA 2WMQA 4FNWA 5B2LA 4IAYA 3QTRA 4Q5EA 4Y5HA 3Q4CA 5DIAA 3UP7A 5JSMA 3CCNA 4CCUA 5K4JA 1B39A 3BGZA 5KMMA 1BKXA 3LE6A 4ALWA 4K77A 1OKVA 4OW8A 4AF3A 3HDNA 2UW4A 3EHAA 3RHXA 2J4ZA 3DNEA 2X8IA 5GJFA 2B9HA 3TMOA 4P2KA 3OWJA 5HNGA 1K2PA 1O6YA 2QR8A 4DE4A 3RCJA 4OUCA 1ST4A 1MRVA 3MJ1A 4UX9A 3CEKA 4J8MA 3F7WA 4O86A 3HNGA 3O7LD 4XNEA 5HORA 2XNBA 2JITA 3FQEA 4U9AA 4AA0A 4AGCA 4LRKA 3KFAA 2O63A 3OY3A 3R83A 4U7ZA 5F20A 2H96A 4CZUA 3LQ8A 5BYZA 4I23A 4LM5A 4USFA 2AEGA 2HXLA 2OJ9A 4YP8A 3V5JA 3PJ2A 3QTWA 3VBVA 3VS6A 4NYEA 1T46A 1YVJA 2ZM1A 2AQXA 2BDFA 5EW9A 3FDNA 3SG9A 3E7VA 2RF9A 2ZDUA 1P4OA 3FYKX 3PG1A 4CQEA 3H10A 4L6QA 4PPAA 4WA9A 1LR4A 5ANKA 3ZUUA 5BQ0A 1M17A 3BHUA 4GVJA 4JX3A 4DEDA 1OMWA 3SRVA 4G3GA 3ZLYA 3NCZA 3TDVA 1GIHA 3A4PA 3LCTA 2CN8A 4GV1A 2WTCA 1XHAA 2OICA 4ITIA 4MWHA 3MPTA 2W17A 2P0CA 3PA3A 5EHYA 3U51A 2XCKA 1PYEA 4JR3A 3QALE 5E8ZA 4UZHA 3EQCA 4NM3A 2IZUA 2B53A 2Z60A 2XRUA 5BV3A 2GPHA 1TQPA 1H0VA 3Q9YA 2OLCA 3DB8A 3OXZA 3ALNA 3LFBA 4XLVA 4BZDA 3ZBFA 5ANGA 1CMKE 4HVSA 3QC4A 4QMNA 3OBJA 2XYNA 2UW8A 2ZV2A 4WG5A 4F6UA 3UYTA 3OXTA 5TF9A 4AAAA 4IVBA 4L52A 2IW6A 5L6OA 2P3GX 5GIOE 3ETAA 4JG8A 3KRLA 4BKJA 5E91A 1HCKA 3MBLA 4R7BA 1OKYA 4FG8A 4O0XA 2XB7A 4X2NA 3VS2A 1L8TA 3MA3A 2QOBA 3UG1A 1P2AA 3Q5IA 4AOJA 3IW6A 2ITXA 3PIZA 4TYEA 3OHTA 5JRQA 4DLIA 2RKUA 1DM2A 2FVDA 3G9NA 3MY5A 4FNZA 1ZARA 2GNLA 4O4FA 4U41A 2WTJA 3RM7A 3DKFA 1VJYA 2UZLA 4O7RA 3HUCA 4FSYA 3QL8A 4QMVA 4X2KA 3DDPA 3MTLA 3ORIA 3QHRA 2Y4IB 2P4IA 3F5GA 3S2PA 3AMAA 2W5BA 5DR2A 3VQUA 4CKIA 4PDYA 2W9FB 3QWJA 5HD7A 3BLQA 4DDIA 2XK7A 4J98A 2UVXA 2YIQA 4F7LA 4F99A 5HQ0A 5CI6A 1JWHA 2B9FA 2EU9A 2J0LA 3GU6A 3KB7A 3RZBA 5IA1A 1J3HA 2AC3A 4FOBA 2BILB 2QQ7A 2F4JA 3SXSA 1ZLTA 4YUQA 4O7NA 3F5XA 4EC9A 5EDPA 4ACMA 3OCBA 5CASA 4ORKA 4GK3A 3LCOA 1EH4A 4XG9A 4ZTMA 4QT1A 5EI8A 1S9IA 2PVFA 3DPKA 3QQJA 4LGHA 4YU2A 3SVVA 3AC3A 4O27B 2JEDA 4IVDA 2HWPA 3MS9A 4EZ3A 2GSFA 3R63A 4IDVA 2ZVAA 4J99A 1WBWA 3Q32A 3JVSA 3IDCA 3L8PA 3U8WA 4FZDB 4FE2A 4G34A 2PK9A 2QNJA 4RIXB 3DB6A 3RMFA 4UMUA 3HX4A 3AGLA 5BVDA 4KKEA 2X8EA 4MQ2A 3THBA 2UVYA 2XS0A 4IM0A 2B55A 3NNXA 4CXAA 1JVPP 2PZ5A 2XEYA 1RE8A 2Y7JA 3L9LA 2YWPA 5J95A 4ENYA 3OG7A 2JAMA 2ZFYA 4O96A 3NUXA 2QCSA 3AT4A 4FA2A 4L43A 3A99A 3LLAA 4UV0A 3Q2JA 5LMKC 2JKKA 3F2RA 4H36A 3V51A 4DFLA 5AR7A 3ML1A 1REJA 3G9LX 4LUEA 1KV1A 4IM2A 4D4RA 4C33A 3LJ1A 4KA3A 4DH8A 3DLSA 4D0XA 3QTQA 3F9NA 4FODA 4BTKA 4ZJVA 1XMMA 3KRXA 3V5TA 3ZXTA 1OPJA 3HV5A 4RVLA 3E7OA 4C2WA 2BIYA 4I41A 4FKPA 2PWLA 4J71A 3QU0A 4JQ8A 1ZYJA 1UU3A 3AD4A 1OM1A 3R00A 1V1KA 3QTSA 3AMYA 3BQRA 1WBNA 4XP3A 4BCOA 2HY0A 3B2TA 3QRIA 4JDIA 4NU1A 2QG7A 4UY9A 5HHWA 1CM8A 2XM9A 1FVVA 1OL7A 4UWCA 3WF5A 4DINA 2E9OA 4TYJA 5AV3A 1NVQA 2PZYA 2WKMA 1GIIA 2J51A 5AIKA 3Q6UA 4CZTA 3C13A 5J7BA 2YIWA 4ANOA 2VN9A 5D7AA 3SLSA 3PLSA 5FP5A 3T9IA 4B0GA 2OW3A 3E87A 5AADA 2C6IA 4G17A 1JKSA 1Q8UA 3LCKA 5BVKA 4EHEA 4OBOA 5M57A 4X3FA 4NT4A 4IZ5A 3WE8A 1XH6A 2HZ0A 4HGSA 1G3NA 3QD0A 4GIHA 1YW2A 2GS7A 3GI3A 4XV1A 3UIUA 3UIXA 5LXMA 2YLEA 2YDKA 2CGXA 1ZWSA 2BZIB 2FSOX 4BCNA 5IF1A 5IUGA 4FL3A 3C50A 4UWYA 4ZEGA 1R39A 3UOHA 3TXOA 2QKWB 5AR4A 3QGYA 4FG7A 3QD4A 4TKSA 4BICA 3A60A 3QFVA 2FO0A 3VJNA 2WMUA 4ZP5A 3PSBA 5E90A 4FRFA 4F0IA 2Y8OA 2C3LA 3VUMA 5CF4A 1OGUA 3NR9A 5BPYA 5M09A 4MVFA 2QOKA 5AIRA 4BDFA 1WCCA 2J0IA 3TT0A 3UDSA 4ZSJA 4FV9A 3QX4A 4MXXA 2Y6OA 4G9CA 5CANA 2IZRA 2GHGA 2QOLA 4JDJA 4HZRA 3IGOA 3UQGA 4B4LA 4RC4A 2ZM3A 5KUPA 5CEIA 4AAYA 1UKIA 2R3FA 4LL5A 1FINA 3DBEA 2X0QA 3ZLWA 3HYHA 4AW5A 4BDJA 4PP7A 4O7SA 5AMNA 3DQWA 3DTCA 4IBMA 1JKTA 2XP2A 5CT0A 3F3ZA 2YCQA 3ATSA 3VS0A 4M97A 3DK7A 3IS5A 4FSTA 3RNYA 5J1WA 5C4LA 2CKOA 4ZY5A 3NVMB 2XNEA 1ZMWA 1WVXA 3OEFX 4BFMA 4I0SA 4PQNA 1R78A 4U44A 4FV2A 3GU8A 3KMUA 4FNXA 3JY0A 2UZEA 2WXVA 3LFCA 2OIQA 2WQOA 4FIGA 4YJRA 2YJSA 3PG3A 3RZFA 3EQIA 4BI1A 3KCKA 2JD5A 4PL3A 3MPMA 4BWPA 4C4HA 5EM7A 4DGMA 2CNUA 2QURA 4FT0A 1P5EA 4L00A 4ASDA 4TYHA 2I6LA 4YJOA 5G1XA 1IAHA 2VAGA 1YXXA 4M0YA 3NUYA 2ZV7A 3OOMA 2C1BA 1U46A 1W0XC 1ZOEA 3PE2A 2JBOA 3JXWA 3TZ8A 4ANBA 1ND4A 3LKMA 4GMYA 4FGBA 4M69B 3HRBA 5FGKA 1Q97A 3OCSA 4GG7A 2X6DA 1MQBA 3TWJA 4LDTA 3UBDA 1H8FA 3D15A 2VWWA 3G33A 3NRMA 3RHKA 4GEOA 4IX3A 5IG1A 4DCEA 3H0ZA 4UMTA 5J5TA 2R3KA 1FGIA 4QP7A 2ZB0A 4Y73A 3UDZA 2BRGA 2FGIA 3D7TB 3BBTB 4O0RA 5EKNA 4YPSA 4RWKA 4QPSA 5I9XA 4ZTRA 4TL0A 3COMA 4H1JA 1BMKA 5HBHA 4PNKA 5L2SA 5M4UA 3ODZX 2R3PA 4FC0A 5J7HA 1JNKA 3EQRA 5CU6A 5EFQA 3GP0A 4U45A 3OROA 3EYHA 5DR6A 4BDAA 4C02A 5KMOA 4MXCA 4YZ9A 4AQKA 4OTFA 4Z7HA 4II5A 2R64A 3DZQA 3DJ6A 5JFVA 2QOFA 3UJGA 1UWJA 3OZ6A 3BE2A 4CT1A 4OR5A 3FV8A 3OMVA 1HCLA 1VEBA 3ALOA 4B6LA 3NPCA 4EKLA 2YABA 4KKGA 4FVQA 4GS6A 2VO3A 5ITAA 5EI6A 3A7GA 2ZMDA 3FMKA 3NYVA 3IKAA 4IEBA 4GH2A 2OZAB 1Z5MA 5E7RA 2OF4A 5GZ9A 3TZ9A 3RVGA 3R7YA 3ENMA 4FKRA 4RFMA 4CFUA 4RA4A 2IW8A 4IDTA 3EQBA 3W10A 4BB4A 3S0OA 3G5DA 1Z9XA 4YZBA 5DN3A 4EQUA 1SVGA 2FYSA 3FEGA 4QMLA 2C6DA 2HENA 3RP9A 2YDJA 5FM3A 3ORLA 4LI5A 2O65A 2OJJA 4XG2A 1Y6AA 3PZHA 4JAJA 4TWPA 1Q99A 3BGPA 4W4VA 4O4DA 1Q61A 4UALA 5CS6A 4OTGA 2YM3A 3UO4A 4EYMA 4DF3A 3POZA 4CFMA 3EL7A 4J97A 5LMKA 2HAKA 4R5SA 4MD8E 5M51A 3Q53A 2ITOA 2ZM4A 5CF5A 3WZDA 1RDQE 2CHLA 4TYGA 2G01A 2BZHB 5DLSA 4RA5A 4ERWA 3KMMA 5DYJA 5CU3A 2DS1A 5J5SA 2JFMA 1LUFA 5DRDA 2XNMA 2OXYA 4DFNA 4GW8A 4AW0A 2PUIA 4C7TA 1CTPE 2C0OA 3KRWA 3NNVA 4FTTA 2XKDA 2VZ6A 3BI6A 3GQIA 3LMIA 5FTOA 5IQHA 3P9JA 4F09A 1MUOA 3FY0A 1OVEA 1PW2A 3QUPA 4HYIA 4AW2A 4BY9E 5EM8A 5EYKA 4AS0A 2Z7QA 2V0DA 3A7HA 3E93A 4PPCA 3I60A 2EWAA 3EQHA 2BKKA 5E8UA 3GC0A 3VUHA 4X3JA 3JUHA 4X7QA 1WMKA 2OJIA 5FWKK 3NAXA 4C4EA 4YBJA 4ANNA 2CLXA 3GC7A 2GTMA 2PL0A 3OBGA 3SAYA 4YPDA 3FHRA 4CKJA 4DLJA 2V55A 1H25A 4RIWB 2BRMA 5ANJA 3UOKA 1RJBA 4Z55A 4Q9SA 3FMLA 5A3XA 3KN5A 5AA8A 2AC5A 3HRFA 3WF9A 4JL9A 4FTIA 1PXMA 3SDJA 4E5BA 5HU3A 2J90A 4RJ8A 3LLTA 3P0MA 4QNAA 4DBXA 4E8AA 3F3TA 1G8AA 1PYXA 4YGAA 5A14A 5HLPA 5CEPA 2VTPA 4IIRA 1WBOA 1DAYA 5EK7A 2HY81 3R21A 2UZBA 3BRBA 4R7HA 2C5XA 4G6LA 3RTPA 4BDBA 3AGMA 3TUDA 2HZIA 3V3VA 4YBKA 4BR3A 1OL1A 2HIWA 1YHVA 4HCTA 4RQVA 3FZRA 3GXLA 4U3ZA 3FLZA 3CTHA 4AU8A 3UPZA 3GOKA 5KBRA 4H39A 1XBBA 5E8YA 4DC2A 2BZKB 5IA0A 5DOSA 3ROYA 4YURA 2GDOA 3FY2A 2WD1A 4L7SA 3SXFA 2VTMA 1PXLA 1OI9A 3U87A 2E9VA 4E6CA 4EOJA 3ULIA 4AUAA 5DRBA 2Y9QA 3QUDA 4KABA 3D2KA 5I5ZA 5AUTA 3L8XA 4KS7A 5GHVA 3OT3A 3RGFA 3RPVA 1ZOHA 3DJ7A 4JRNA 1OGYA 4HYHA 3ZFYA 1W7HA 4F70A 2PHKA 2YHVA 3UPXA 2GNHA 3U6IA 3OP5A 4BBMA 3TZ7A 3LM0A 3F5PA 4RJ3A 4USDA 5LVMA 4F9WA 3PA4A 1XKKA 3TV7A 3V5PA 2YAKA 3KY2A 4Z7GA 3HV7A 3ZLSA 3QLGA 5HD4A 4QYEA 2XBJA 2C5YA 5FQDC 2G2FA 3ZMMA 4GKIA 3FXZA 4G6NA 4EOQA 4BBFA 3K54A 3HA6A 4N4SA 5CSWA 4I0TA 5AR3A 4YR8A 3C5UA 2QD9A 1H07A 2BRBA 1KE6A 3R02A 2W06A 1YRPA 2WFYA 2Z7SA 4YZMA 3WZEA 5KMKA 5D10A 4YZCA 3EQFA 3PY0A 2QU6A 4K33A 2X9FA 5BVOA 4WUNA 3LAUA 3ZO1A 5CLPA 5L2IA 2WTDA 1ZAOA 1XMLA 4CYIA 2XK6A 2GNGA 4LMNA 4D4YA 4UXQA 3KXZA 2ETKA 3R1NA 4I21A 4NKAA 4XCUA 4F64A 2RFEA 1ZYCA 3I0OA 3RBWA 3ZSGA 5L4QA 4FKQA 4BCPA 4JRVA 4ZY4A 3KIOC 1SMHA 4BGHA 4YHTA 3BQCA 3OCGA 3W2RA 4A4LA 1JSVA 4EOIA 5C8KA 4ANMA 4FTKA 4CSVA 4OAUC 1APME 4TYIA 4YNOA 1YKRA 4KSPA 1SZMA 2W4OA 3DNDA 4PF4A 2JDSA 4M3QA 4YO6A 5KZIA 4LOPA 2C5VA 5HO8A 4HVIA 1H00A 2Y0AA 4KNBA 4MUQA 3FWQA 2OBJA 3FZTA 1ZZLA 3DBDA 1JSTA 1Q5KA 3U4WA 1WVWA 3Q04A 5KNJA 4FSMA 4C59A 5CSPA 3OUKA 3LXLA 5FUTA 4DEGA 4DTAA 3LFQA 4I5PA 3KCFA 3TG1A 3I0QA 4FI1A 4G3CA 3DXPA 3F3UA 4FUXA 3BU5A 2GCDA 2OFVA 3LXKA 3TZMA 3UGCA 4HGLA 3ORZA 2Y4IC 3PXYA 1FMKA 5FXSA 4F7SA 3UOLA 5CAVA 5HEZA 5FDPA 2WIHA 3PXZA 2G15A 4HCUA 3QCYA 3R2YA 4LMUA 4RLKA 4CT2A 3HEGA 4W4YA 1AGWA 5E8XA 2B9IA 3ZUVA 5JFSA 1R1WA 3LW0A 4PDOA 4DN5A 1CKJA 1ATPE 1Q8YA 5AJQA 1YDSE 4RX8A 3R01A 5GZAA 3KL8A 3NFFB 5HCYA 3MW1A 3VC4A 1KUTA 2XAOA 4EH7A 4YLJA 3BPRA 3W8QA 3QQHA 2HYYA 1R0EA 4KWPA 3BE9A 3Q5ZA 3R7GA 5H9BA 4CFFA 3VJOA 4RJ7A 3P08A 5F4NA 4AWIA 3BLRA 3TM0A 4O6LA 2C5OA 2FH9A 5I4NA 2BAJA 4OTRA 3QBNA 2YEXA 4AE6A 3PUPA 4BDEA 4DGGA 4ASXA 3W0RA 3K5VA 1DI9A 4IZYA 1QL6A 2GQGA 3BYSA 3GU5A 4IXPA 4RMZA 3KXXA 4EI4A 3MN3A 3AC5A 2HK5A 3R2BA 3K3JA 4ACCA 1H27A 4IX5A 3Q4TA 3CSVA 3L9NA 1QPCA 4BWKA 4Y95A 4BDIA 2W1EA 2X6EA 1W82A 2ETRA 5C8MA 4EYJA 2PPQA 3CIKA 5KZ0A 4V04A 2BVAA 3K5UA 3W0QA 5L8KA 4ACGA 4KB8A 3BBWA 4IVCA 1SVEA 2WAJA 4I5HA 5DEWA 3VUKA 5IA3A 3COKA 4I6QA 4DBNA 3SV0A 1OPKA 3GUBA 4S31A 1TKIA 3QAME 3AKLA 3TDWA 2UZDA 3QGWA 3GT8A 3PY3A 2GNIA 3FMEA 4R6VA 3ACKA 2JBPA 3R9HA 3UNKA 4FIHA 2WO6A 3DFAA 4QMWA 3WYXA 3FE3A 3KRJA 5DG5A 4X21A 4JAIA 3SG8A 5CENA 4K2RA 4D0WA 4XBRA 3MVMA 1IR3A 3C0HA 1U54B 3ZS5A 3QX2A 2X81A 5AV1A 5EW3A 3R1YA 4G16A 3EJ1A 3RM6A 5IISA 3UQCA 1KV2A 1XH4A 1PKDA 2C0TA 5D11A 1KOAA 2BAQA 2RFSA 3SOAA 3ZRKA 5C26A 5BYYA 3K2LA 3LMHA 2JC6A 4PX6A 3A7JA 4QO9A 3CTQA 2LAVA 4JIAA 3PXQA 4NKSA 4ZS4A 2X4FA 4ZZNA 2P33A 2WMVA 4KKHA 3H4JA 4J7BA 1WBPA 2UUEA 2B4SB 2FA2A 3OWPA 4XBUA 3V5WA 2ITYA 1YDTE 4X2JA 5H8BA 3PSDA 5CNOA 4IB5A 5HBEA 3A7IA 2PVKA 3EN9A 5HCZA 4AE9A 2PZIA 4LRJA 4AZWA 4NL0A 4TZRA 4TN6A 4DHJA 1UU9A 1W84A 3CKXA 1I44A 2VTNA 4FVPA 2W0JA 2AYPA 3EZVA 2PE1A 1R0PA 4FSQA 4W8EA 4RJ4A 4BN1A 5HX6A 2V62A 2H6DA 1WZYA 3P7BA 2WGJA 3NS9A 3EIDA 4WNOA 5FTQA 5K3YA 5B7VA 5JKGA 2W99B 5HG5A 4FT5A 5IUHA 3W2QA 4PMPA 5ETIA 2OFUA 4K11A 5T6KA 5M56A 5DGZA 3IOKA 2BMCA 1ZYSA 5EQYA 4CNHA 2OK1A 3LPBA 5JZNA 3QQUA 4M13A 5AP0A 3W0OA 2FSTX 5LVPA 3L8VA 1ZZ2A 2WIPA 5JQ5A 3P5KA 3SHEA 4BYJA 4EHGA 5AR2A 4L9IA 2YZLA 4FEWA 3R8UA 5ACBC 4FOCA 4DA5A 4L53A 5FXQA 4AT5A 5J87A 2X8DA 1PY5A 2OKRA 5AAGA 2BALA 4ZOGA 3TIYA 4WG4A 3RINA 4QMQA 3OWKA 3F2AA 5KO1A 3WYYA 5BYLA 2OJGA 4EJ7A 2RSVA 3NLBA 5L2TA 2QLQA 5LMAA 4PMSA 4ZJIA 5K5NA 2GQSA 4A07A 4CLJA 3R8VA 5JEBA 3RALA 4LV5A 3IW7A 4FKWA 4BIDA 3CR0A 4FKJA 4S34A 3ZHPC 4A9RA 4BHNA 3EN5A 4EK5A 3O50A 2VX1A 4BCHA 2OI4X 4TWOA 3DU8A 3HGKA 2VTOA 3Q9WA 4IAKA 2OWBA 3ZC5A 5M55A 1KE7A 3TYKA 3BLAA 2HZNA 3G0EA 4IAFA 2F7XE 2PULA 3ZH8A 2FB8A 3ZM4A 4XG7A 4DH7A 5L3AA 3MYGA 5CI7A 4FYNA 4PV0A 4O0TA 3RPOA 2C3KA 3I4BA 3D5VA 3PXKA 4NW5A 1SYKA 3KEXA 4Y46A 2R7BA 5CWZA 4H05A 5TO8A 4UYNA 4W8DA 2J6MA 2BTSA 3LJ0A 3PVGA 5I9ZA 4GJ2A 5C27A 4LYNA 4ZMEA 2BKZA 5HNIX 4XJ0A 5BVNA 5DHJA 5DMZA 4FX3A 4KS8A 4NEUA 4P5ZA 1A9UA 3Q9XA 4FT9A 5A46A 4JG7A 4QYHA 1UNGA 4X0MA 4AZFA 4DT9A 4JLCA 4FTUA 4GL9A 2OU7A 5BX0A 2XNOA 1ZMUA 2J0JA 3LIJA 3NNUA 3NUPA 4YTCA 4U97A 4E5AX 3KXHA 1SNUA 3DFCB 3VUIA 4ACDA 4BYIA 5E8TA 5EYDA 2C6OA 4C35A 3BHVA 4MXZA 4G3DA 5CYIA 5ANDA 3A8XA 5BUEA 3CGOA 4ZXTA 2A1AB 5G6VA 5CEQA 5JGDA 2IVSA 2YM8A 3TNPC 4GFMA 5AP7A 2W1IA 2I1MA 4Q5HA 4JXFA 3JS2A 3DTWA 4K6ZA 3ZRLA 3ROCA 1KSWA 3W32A 5IMXA 3IDBA 3ORTA 4XV9A 5CT7A 4JI9A 4EK4A 4I22A 4KIPA 2XK8A 3KXGA 3LMGA 1ZY5A 3ORPA 4IM3A 4C62A 3TL8A 4DEAA 3VRYA 3RAHA 2V22A 1DAWA 2RG6A 3NNWA 2QOOA 3OF0A 4IVAA 4J53A 3V01A 4BCIA 4BKZA 4UYAA 2ZDTA 4E6DA 4RZVA 5EOLA 3JY9A 4YC8A 3D0EA 4K0YA 4RIXA 3V6SA 2F49A 2WMAA 4BCGA 5DVRA 1F3MC 1M2QA 4XS2A 1QPDA 1ZXEA 4RPVA 1XBAA 5AV4A 1OB3A 4S33A 4DCAA 2IG7A 1VYZA 3PZEA 3O8TA 5ANIA 4TXCA 2EXCX 2VWIA 3C1XA 3MV5A 3VONA 2XIZA 2R3QA 3ITZA 2VWUA 4MBLA 4XEYA 3OEZA 4KSQA 4QPAA 3U55A 5F94A 3CQWA 4ZIMA 1MRUA 4MNFA 3WOWA 4CV8A 1YXUA 2R3JA 4Y85A 2CKQA 3FKOA 4Z3VA 3TUCA 3BLHA 4YHJA 2Q0NA 2QVSE 5A9UA 4RVMA 1OITA 3UMWA 4W9XA 4TRLA 5KMNA 2J7TA 4M8TA 2XF0A 3LQ5A 4UEUA 2Y4PA 4FKVA 4BL1A 5FD2A 4L68A 4ZS0A 3VBYA 4CMOA 4A4OA 2QOHA 4AXEA 4RX7A 2YCFA 5TKDA 3FQSA 4CYJA 4DH1A 4O0YA 3VWAA 2PVNA 4U80A 1Q24A 5IQIA 3VS5A 1AD5A 3FSFA 4AOTA 4F1OA 2F57A 4D1SA 3PJ3A 4F1TA 4C36A 1DS5A 1OL5A 2QI8A 2YITA 4FV0A 2J0MB 4L45A 4RIOA 3GFWA 5I9UA 2YWVA 3O5AA 5HIBA 1F0QA 3NAYA 4JS8A 3NW7A 5I9YA 1J91A 2XH5A 4MF0A 5AFVA 4ZSLA 3EN6A 4RC3A 1UU7A 4WSYA 4QP4A 3TV4A 3ODYX 4JX7A 3CTJA 4E20A 4WBBB 4FSUA 5LVLA 3EQPA 4G31A 4GCJA 2O3PA