5C26A

Crystal structure of syk in complex with compound 1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
274
structure length
272
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/inhibitor
molecule keywords Tyrosine-protein kinase SYK
publication title Imidazotriazines: Spleen Tyrosine Kinase (Syk) Inhibitors Identified by Free-Energy Perturbation (FEP).
pubmed doi rcsb
source organism Homo sapiens
total genus 93
structure length 272
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5c26A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5c26A01
3AC8A 3NNWA 3LFEA 4J95A 4LGDA 5AIRA 3SW4A 3VW8A 3GCUA 4C3PA 2X9EA 4TW9A 3VS6A 2RSVA 4I5PA 4OBPA 3VUDA 3F7WA 1YXUA 3UPXA 4NW6A 4FSYA 1GJOA 4KKEA 4EH7A 5CF6A 4A07A 4A7CA 3E8CA 4FNYA 2P4IA 2WMBA 3U6IA 4I22A 3L1SA 3Q9YA 4XG2A 4EKKA 3FZTA 5HNBA 2YDIA 2V7OA 5EDPA 2ZVAA 4B0GA 4C61A 4HJOA 3MB6A 4L67A 3NAXA 3ROYA 2ZDUA 4CMOA 2WMSA 4EQMA 3D5WA 4RC3A 5FWKK 2O8YA 2CN8A 4GT5A 3QRKA 4J71A 1IEPA 4MTAA 4V05A 4WKQA 5AR3A 5HCYA 3UNZA 1P4OA 5LVNA 3KMMA 4IB3A 4YLLA 2C6LA 3QCQA 1VYWA 3FUPA 2BFYA 3ORMA 4QYYA 1OIQA 1O6KA 1CKJA 4I6BA 3BYSA 5AUXA 3FI8A 3TZ7A 4FIEA 4L9IA 2YLEA 3FY0A 4UB7A 3QUDA 5EQPA 4QMQA 4IAIA 2XEZA 4KBKA 5KX8A 3OUNB 4F7SA 3FMDA 3UG1A 4MQ1A 2ACXA 4RVKA 2ZM1A 3OF0A 5H3QA 3S4QA 1XBAA 4GKHA 5IH6A 4MH7A 4OAVB 2DUVA 3FLYA 2XM9A 3PP1A 4USFA 3OCBA 5IMEA 5J9ZA 2ETMA 1CMKE 4IBMA 2X6DA 4J97A 4K9YA 4OTIA 5AAEA 5IH5A 2HXLA 4JJRA 2UZLA 4ANQA 2WIPA 2ZDTA 4NFMA 4BGQA 3DQXA 4PDYA 2JEDA 3H3CA 3A99A 1JVPP 2UW0A 4APCA 3MA3A 4OAUC 3WI6A 3BU5A 2BPMA 2GSFA 2PTKA 2QR8A 4KBAA 3O0GA 5FTGA 5C4KA 3HYHA 2QODA 2Z7LA 3MV5A 2RL5A 3H10A 4I94A 4XV1A 3V6RA 2XNMA 4ZS0A 2UZOA 3GU5A 5ANIA 2JAVA 3I7CA 4I4EA 4UMRA 5GZAA 4D9TA 4IVDA 4DYMA 2GFCA 2X2LA 3FZSA 4LM5A 5I4NA 5K0XA 1ZOEA 2X0GA 3PZEA 3ZBXA 2Y6OA 5KBQA 3VBQA 1OKWA 1T45A 4CZYB 4FKQA 3ULZA 5FG8A 2OXYA 3QRUA 3L9NA 2WTIA 4FNWA 3R28A 5CZIA 4FYOA 2CCIA 1STCE 4ITHA 4XRJA 5E1SA 5T68A 2PMLX 1FMKA 4AT4A 2PPQA 4MAOA 4BIDA 4BDDA 4FKUA 2J90A 2UVYA 4YLKA 2GDOA 1K9AA 5IQGA 3DPKA 4QMLA 4B7TA 3IKAA 3M1SA 3Q9WA 3PRFA 1PXNA 2QKWB 5ANOA 3TV7A 4E93A 3Q32A 3P7BA 1L8TA 2G15A 2X2MA 5DLSA 3TEIA 3DLSA 4JBVA 1PXMA 4FBXA 3ZO2A 5C8NA 1KWPA 4Y8DA 3MW1A 2XH5A 3KRXA 5HZNA 4NM5A 5IUIA 4ACHA 5LMBA 3GC8A 4JOAA 5HLPA 3EQDA 1YDTE 2WAJA 4DTBA 4EK4A 3EL8A 3CQWA 4R1VA 4L68A 2VO3A 4KBCA 2C1AA 3HDNA 3HDMA 3D7ZA 3CKXA 4Y83A 3OZ6A 4FTTA 4FTKA 3QWKA 5EYCA 5DNRA 4C37A 3IQ7A 2OFUA 3TM0A 4L3LA 4I6FA 4U6RA 5AEPA 5T6KA 2IW6A 5BVDA 3RHKA 1UVRA 3FY2A 5BVOA 4MWIA 4TNDA 1JKLA 3S00A 4O2PA 1TQMA 2JIUA 2RFSA 1YI4A 4Y5HA 3VO3A 5T3QA 4AA0A 3HEGA 5JQ8A 4CYJA 5EI2A 1MRYA 3TJCA 2X8EA 1ZYJA 4ANBA 4RIXA 3FDNA 1CKPA 3FSKA 3W1FA 5HNGA 2ITWA 3OT8A 3Q60A 5IA1A 3SG8A 1PKGA 5AX3A 1Q41A 2PZIA 3PVUA 3KREA 3FLQA 4WUAA 4YSMA 2B7AA 4AW0A 3C9WA 3DZQA 4BY9E 1XQZA 4YUQA 3QD2B 2J0MB 2YJSA 4FA2A 3ROCA 4W4WA 5C27A 3D9VA 4HNFA 3OD6X 2QHNA 3NLBA 3LIJA 3QALE 3ZONA 4EK5A 2WO6A 3LFDA 2PL0A 4H39A 5GJDA 4WBBB 2WEVA 4U9AA 2W1FA 2QO7A 3DDQA 3R63A 4YSJA 3ENHA 2YIYA 3R22A 3PFQA 3R73A 4K6ZA 4BYJA 3V5WA 3F2AA 3FXWA 3DAKA 1H1WA 4FT3A 5EKOA 1W0XC 4ENXA 1JOWB 5HCZA 1YWVA 2RF9A 5HX8A 2KULA 4XV9A 2R3PA 3EQHA 3NPCA 4JDHA 4GUBA 4D4VA 3DB8A 3FMLA 4QTAA 4U81A 1OPJA 1R1WA 5EYKA 3ALOA 1XKKA 3VJOA 1JLUE 4NIFB 4YURA 3QC4A 4QMMA 1ZYDA 4FV6A 2UW8A 5HG9A 4HVIA 4WD5A 4BCJA 3U6HA 3HV4A 4H3PA 4FTAA 2YHVA 5LMKA 4ZSEA 3PP0A 4IB5A 3SHEA 1JNKA 4BDJA 5CSXA 5CAPA 1PYXA 2GCDA 3LM5A 4YJPA 3HECA 4ZJJA 2KTYA 1OKYA 5IH4A 5J5TA 1OZ1A 5M08A 1E1VA 1OUKA 3VS2A 5EOBA 3MDYA 2BIKB 2BMCA 2C68A 2GNGA 2WMVA 3OXTA 4GT3A 1GIHA 3MI9A 4YTIA 4DBNA 4Y72A 1Q61A 2QOKA 5DYJA 5J9YA 1SVHA 2EU9A 4FV2A 1GNGA 5ETAA 3SRVA 1GOLA 4TWNA 4M67A 2PVLA 1NVQA 3BE9A 2BZIB 4DGGA 2X4FA 5L6WL 5JQ5A 1H24A 4OTRA 3QX2A 5AV1A 3LAUA 3W16A 1H1RA 1LP4A 3TZMA 5KKRC 2FUMA 4U40A 1U59A 4YZMA 4DEIA 4DEGA 3DAEA 3Q9XA 4M84A 5EQYA 4IFCA 3QQHA 4IMYA 5AUYA 4PNIA 4EH2A 3UOLA 5HEZA 3ZMMA 2WTDA 1VEBA 1OMWA 2VTOA 2XNBA 3DK7A 1JBPE 4FV5A 2I7QA 4O7RA 5D7VA 3VBTA 3DNDA 3LE6A 4RFYA 2PHKA 5L3AA 2WHBA 4FV7A 1Q3DA 2YM4A 3FKOA 4KNBA 4QOXA 3G90X 4JIAA 1NVSA 4O82A 3ZFMA 4AX8A 3AXWA 1DI9A 3MFSA 3CE3A 3FLWA 1DAWA 1V0PA 2A19B 4YU2A 4DINA 2A2AA 3Q2MA 2VTLA 4J52A 4NTTA 4EH8A 3V5TA 4HPUE 4F7NA 3F5XA 1OIRA 1H8FA 3EH9A 4ALWA 3ANRA 3CS9A 4LMUA 2PSQA 4MBJA 1RDQE 1U54A 4BZOA 4KWPA 3NW7A 4H05A 4BCGA 4X2NA 1JSUA 3VQUA 1J3HA 1O6YA 4RX7A 4RQVA 4UALA 2CKPA 4E3CA 2R3HA 4FKJA 2RIOA 1VYZA 2W4OA 4R7HA 1KE9A 2OF4A 4DGMA 3UZTA 4AN9A 2GQRA 3QGYA 3ZCLA 2G01A 4F7JA 5J1VA 2XKEA 4AZFA 4MBIA 4X6RA 3KY2A 2P2IA 5FP6A 4ERWA 3PJCA 1LPUA 2XCKA 3QKMA 2W1HA 4GT4A 4O0SA 3WZEA 2GNIA 4PNKA 3L8VA 2QD9A 2QU6A 4G3EA 4JRNA 4XG3A 3P5KA 2G2FA 1KV2A 2ESMA 3OS3A 3Q4ZA 4B6LA 4FSTA 2EXMA 4ALUA 2VWIA 2R3FA 3EN5A 2YZLA 1ZMVA 4U80A 2GTNA 4G3FA 5C8MA 3ORPA 1SNUA 2IZRA 3RNIA 4UYNA 4BCQA 3AC4A 2YIQA 4NEUA 3UOKA 3DU8A 2YCSA 2JKOA 3PJ3A 3DOGA 3FYJX 4QT1A 4YZ9A 1U4DA 2YFXA 3E93A 1A9UA 2QG5A 4NKSA 4FKIA 4GK4A 2BRMA 2BDWA 2C0OA 3DAJA 4DFNA 2ERZE 4FKRA 5LJJA 4FOBA 4JDKA 3HV6A 5GNKA 4WRGA 2EXEA 3DJ5A 3QGWA 4KA3A 4BI0A 4U5JA 3PE1A 3SW7A 2HWOA 2QHMA 3QBNA 1WAKA 4Z3VA 3G9NA 3SG9A 5F4NA 3G15A 5HLNA 4NM3A 4TYGA 4GFOA 3LFNA 3OG7A 4A9YA 4XG4A 3HX4A 3PPJA 2A4LA 2PZ5A 3QYZA 1OGUA 2YM5A 3QTIA 5G6VA 3VS5A 5I0BA 5FUTA 4CMUA 3OP5A 3BWFA 4CNHA 4EQUA 2WQBA 3G6GA 3R1QA 4ZAUA 1J91A 1YI6A 2VGOA 4RWKA 3CP9A 5DR6A 1UU9A 3CY2A 1ZMUA 4FKVA 3IGGA 4AW2A 5CSWA 1GIJA 4XHKB 2JDOA 4FTCA 5GINE 4F9BA 4C59A 2J0LA 4F08A 4C33A 4FTUA 2X8IA 4ZJIA 4C4FA 1ZYLA 3KXMA 2IZSA 3KL8A 2XJ1A 3PWDA 5JZNA 3KK8A 4USEA 2VTAA 3EQPA 5LQFA 3GFEA 1WVYA 5I9ZA 3BELA 5E90A 2QO2A 3OWKA 4BCPA 4I5HA 4CLIA 4K0YA 5CNNA 3IOKA 5FEEA 4GU6A 2ONLA 4C3FA 4JG7A 4NJ3A 1BMKA 2EB2A 5ANDA 3RWPA 2BKZA 3VS0A 2YM7A 4IVAA 4FMQA 4G16A 3TJDA 4A4XA 2YM6A 3TV4A 2YIWA 2I1MA 2WIHA 4QMXA 1M2QA 4FIIA 3JY9A 5B7VA 2GQGA 5DT3A 4X2KA 4HGSA 2J50A 3D5UA 3MYGA 3G6HA 4G34A 1BX6A 2J0KA 3HMIA 4XYFA 5HKMA 3UC4A 5EOLA 1P2AA 3FWQA 3ODYX 3TUCA 2RG5A 4DFBA 3BEGA 4B4LA 2VWWA 3I6WA 3QLFA 4R3PA 5HCXA 2X2KA 3W2SA 1JSVA 3KEXA 3A7HA 2PMIA 4IJ9A 4J99A 3SAYA 3ZSHA 3ZRLA 2JGZA 3TIYA 4RWIA 5DE2A 2PMNX 5HLWA 3EYGA 2XB7A 2R64A 5BUJA 4DEEA 3NWWA 4CZUA 5JFSA 4IWDA 4L3PA 4MF1A 4AGWA 4AXAA 4JS8A 4J53A 2QOCA 3UTOA 3ZM4A 3IOPA 3Q4CA 4MK0A 4XBUA 1QMZA 4RX8A 4F1TA 4DA5A 1Y57A 2PZPA 5HO8A 2XCHA 3H9FA 3SKCA 2HELA 1WBTA 4EOIA 2JC6A 3NRMA 4LL0A 1XH8A 4J96A 3B2WA 3NCGA 4KAOA 4EHVA 2XKFA 4M68A 1F0QA 3GQIA 4ENYA 3IS5A 3NUXA 4EUTA 1BL6A 3TDWA 4IAKA 4PDOA 2PZYA 2GHGA 4MHAA 2P55A 3U51A 4HCUA 1FVRA 2C3KA 2O5KA 4FV9A 5EI8A 4EORA 3S3IA 2OKRA 4U7ZA 2AYPA 3EZVA 4N0SA 1OL2A 1GZOA 2QQ7A 5E8UA 3MH0A 5L2SA 3PIXA 2HAKA 3C13A 2FA2A 4QNYA 4E8AA 5CSVA 3WBLA 2BR1A 1H08A 3OWJA 2JAMA 1J7UA 3LFQA 4IX6A 4GRBA 4BCHA 2R7IA 3MY0A 3I60A 4HOKA 4G9CA 4Q5EA 3TNWA 3E62A 4RIOA 5GJFA 4BF2A 4C4GA 3GU6A 2I0HA 4W4XA 2GHLA 3DY7A 5KMJA 3OHTA 3NS9A 4EH3A 2X39A 4P90A 5JGAA 4DFLA 4IX5A 5DN3A 4F6WA 5A14A 5I9UA 3QU0A 3DB6A 2YM8A 3LXKA 4MD8E 3F3TA 2C47A 3RAWA 2C4GA 2ZJWA 1YOMA 4X3FA 4AGDA 3FPMA 4D55A 4JI9A 2P2HA 3RK7A 2UV2A 3E7OA 2UZNA 3ORIA 4Y95A 3AMYA 3EYHA 4FT5A 4FTQA 4QP6A 5AP3A 2GNLA 5ACKA 4DEHA 3LQ3A 2XNEA 5KMNA 4E4XA 3CIKA 1OKZA 3HUCA 5EG3A 2BAKA 5FD2A 3UZPA 3V8SA 4BRXA 2O0UA 4ZSGA 3PIYA 1Q8WA 2VTTA 1BLXA 2VO7A 2ZB0A 3LFCA 5AJQA 4XV2A 3UNKA 3CTHA 1YWRA 3HKOA 4E7WA 4O86A 3HRBA 3R8LA 4X6QC 5KMLA 4GV1A 3NUUA 3QQGA 4FZDB 4O96A 2QURA 3GCQA 2QOHA 3QD0A 4TZRA 3TKUA 2GFSA 4UV0A 3U9NA 3FMNA 3KCKA 5EFQA 4E6QA 3KKVA 4F0IA 3NYOA 3W2CA 5AR4A 4IIRA 5E8WA 4P7EA 5AV3A 1OBGA 3PG1A 2ZV2A 4GG5A 5HNIX 4NTSA 4AN3A 5F1ZA 4C02A 3FQHA 4CRSA 4OTFA 5GIPE 3PA5A 4RX9A 5CALA 4PL4A 4A9SA 4O22A 5D9HA 4CFVA 2C6OA 4XOZA 3QLGA 5L8KA 2C5NA 4QP4A 3R9RA 4QD6A 4YC3A 4CKRA 4EOJA 2QOIA 3F69A 4FKOA 1W98A 5AM6A 4ANMA 4YNEA 1VZOA 1OM1A 1QL6A 4CLJA 5AR7A 4FKTA 4UMQA 2VUWA 2LAVA 3KB7A 2I40A 4JQEA 4O7VA 3CXWA 3FI4A 3RAHA 4PWNA 3SXSA 3GU8A 1B39A 3W55A 4C58A 1Q24A 4IX3A 4YHJA 2XRWA 4YBJA 3F9NA 3MY1A 3GOPA 3UNJA 5TR6A 2H6DA 4X3JA 2F7EE 4A9RA 4DEAA 1YW2A 4NJDA 3R7VA 4D5HA 3N9XA 3V8TA 3PE2A 3ZLYA 3EFKA 4EJNA 5E8XA 5KMIA 1WBOA 4N4SA 3CEKA 3L8SA 3HMOA 2VTMA 3MGYA 3ZSGA 4L7SA 3NR9A 2UUEA 2ZM3A 5E8YA 4FUYA 1MP8A 4I5MA 4XG6A 3UMXA 2WTWA 4WOVA 3Q96A 2VTHA 3MWUA 1R0EA 3QXOA 5BYYA 4EQCA 1OI9A 4MD7E 1FBNA 1IA9A 3GT8A 4D28A 3KVXA 5K9IA 1IAJA 1XO2B 4CKIA 4MWHA 1V0BA 4AN2A 3EFLA 3RZBA 3WF8A 4IE9A 3ENMA 5BUIA 3T9TA 3VVHA 3C4ZA 4RJ8A 2YABA 2YM3A 4IEBA 5FEDA 3OCSA 5H9BA 4ZZOA 2OIBA 3PVBA 5IUGA 3G5DA 5A6NA 2F4JA 2Z60A 3OFMA 1MQ4A 3QD4A 1YWNA 3BBWA 4AACA 4EZ3A 5KBRA 4I92A 2XK9A 2V0DA 2O2UA 4I24A 5EH0A 5F95A 2NPQA 4NCTA 5FEQA 1OIYA 4X7QA 5BVFA 4R7IA 3TZ8A 3KULA 1CM8A 4EOOA 5CENA 4ANLA 2R3QA 1YDRE 4V01A 3L8XA 4BCKA 5HO7A 2VTPA 3FSFA 1PXLA 4RIWA 3D83A 4F0GA 3UQFA 2B9HA 5B2LA 3QQKA 3QTRA 3A4OX 3MVLA 5ACBC 4D2VA 4ASXA 3NSZA 2XIXA 5HIEA 4QTBA 2W5HA 2BDFA 3BHUA 4BDHA 2ONLC 3ORNA 3HAVA 3WE4A 5LWMA 3LXPA 3QTSA 3Q4UA 5FXRA 5FQDC 4CFMA 4R1YA 4CG8A 2PE1A 3EJ1A 3IW7A 4DHFA 4HVSA 2C3JA 2F2CB 2RGPA 4FSZA 3ALNA 1Q8ZA 2WTKC 4J7BA 4RBLA 3CTJA 4WNKA 5E92A 3R9HA 4RRVA 4GYIA 3ZUVA 4O27B 3WILA 5HICA 5CI7A 1XR1A 3ZU7A 3I0OA 3P08A 3QFVA 4YR8A 4EOPA 2UZEA 3V8WA 5KKRB 5AUZA 4F99A 5DR2A 4PMPA 2DQ7X 4FV1A 4KKGA 2IW9A 4MNFA 5AA8A 5E9EA 1PHKA 2B1PA 2WNTA 3CD3A 2YERA 4DF3A 3OCTA 4F63A 3A60A 4FTJA 1J1CA 2R3KA 3NDMA 3QKLA 2HYYA 3BGPA 3Q53A 3RKBA 4RZVA 4CVAA 2Y8OA 3PXQA 2NRYA 2X4ZA 3TUBA 4M14A 1DS5A 3DTCA 5DPVA 4QP8A 4HNIA 3VHKA 4BCIA 2C30A 5C03A 3KCFA 4M12A 4RZWA 3CBLA 3UVRA 2YWPA 3QD3A 2X7OA 3WIKA 1M14A 5CF4A 3F5GA 3GU4A 4BCMA 5CAUA 4O6EA 3W33A 4E6DA 5A4CA 3BYMA 4QTDA 5CEPA 5I9WA 2B55A 3LOKA 2VWUA 4BDCA 4HYUA 3UYSA 5JN2A 4KD1A 4QQJA 4U43A 2JD5A 4L52A 3THBA 4BVUA 2ETKA 5L2TA 4QMNA 4O84A 5CVFA 2XNPA 1MUOA 3AD6A 3C4WA 3E7VA 1W7HA 4PMSA 4XUFA 3TI1A 3MPTA 3ERKA 4ACDA 5A46A 2G2HA 4XH6A 2RFDA 3AQVA 3BHVA 2HENA 4AW5A 4MXYA 4LRKA 2HZ0A 3C51A 1FMOE 3PVWA 1XJDA 2XF0A 4TWOA 1BKXA 5KMKA 4AP7A 4YBKA 2IVSA 4DT9A 2H34A 3TXOA 2XIYA 4MNEA 2J9MA 4QQ5A 5LVMA 4LV8A 4YHTA 4OT6A 4DGNA 3HVCA 1W8CA 3DV3A 4EK3A 3HMMA 4BKZA 4FSUA 2C3LA 3PVGA 3LHJA 3OBGA 4DE4A 3K5UA 4DEDA 2WQOA 4X3FC 5J8IA 3EZRA 2YITA 5IDPA 3ORLA 5LVPA 5HI2A 3BBTB 4FKLA 4TYHA 4WT6A 4HVGA 2R3RA 3NW6A 1PMEA 3GU7A 4BHNA 5L6OA 3G9LX 3CY3A 4O7ZA 3DFCB 3QX4A 4OLIA 3KXGA 1KE6A 3QAME 4E1ZA 4RVLA 2H9VA 3COMA 4F1OA 3CC6A 2XS0A 4W4YA 3CKWA 1O9UA 1OBDA 3E8NA 4G6OA 3NIEA 5HU3A 3COKA 3BGZA 3VUIA 4WO5A 3UJGA 3FI3A 3TV6A 2XBAA 1KUTA 3ATSA 4P5ZA 1ZAOA 4ITIA 3O8UA 1PXJA 4N70A 3N4UA 4ANOA 4YJSA 4C8BA 4JBQA 5BMSA 1WBWA 4RJ3A 4YC8A 3RP9A 4AZVA 5CSPA 5JZJA 3GNIB 4YJNA 2VX0A 5KO1A 3HMPA 1A48A 4BTJA 3F82A 3U9CA 4DTKA 2G2IA 4UY9A 4FSQA 4NWMA 4AA5A 5I9VA 3FC1X 4BI2A 2PE2A 2QU5A 3WF7A 5E4HA 4DFZE 3IGOA 3LVPA 4C38A 4EBVA 2X6EA 4XP3A 4NM0A 5C1QB 5L8LA 2GU8A 1P14A 4F9AA 3BLRA 1OKVA 2ITYA 4O0YA 4Z7GA 2QKRA 4FX3A 3KC3A 4IZ7A 4OTGA 4CV9A 4O7YA 3LLAA 4WG4A 3F5PA 4LFIA 4JXFA 4GCJA 4UZHA 1KSWA 3C4EA 2R3JA 4U97A 3WF9A 2Y4IC 3FLNC 3WZUA 2ITPA 4ITJA 1XH5A 3UIBA 3PSBA 2XK6A 3VBXA 5DMZA 5KHXA 3GBZA 3MH2A 5C01A 4FG9A 4MX9A 4ZS4A 2C0IA 2ZYBA 5AV0A 4CD0A 4YP8A 4GIHA 4FT0A 4RIXB 5TF9A 1IASA 2OICA 2YN8A 5ETIA 4I6HA 3TIZA 1UWJA 5L6PA 3MFUA 4FK6A 4AF3A 3POZA 5HVKA 2W5BA 4XBRA 1XHAA 4OBOA 4BBMA 1J1BA 2R3LA 4F9YA 3VS7A 2BKKA 4FSWA 2GTMA 5TT7A 3E3PA 3VC4A 2JKKA 2X9FA 2VWXA 3QTZA 3D2KA 4M69A 3E63A 2R5TA 4S33A 3NW5A 5HORA 4ACMA 4ID7A 2PUUA 3G51A 3ZDIA 5HD4A 1OL7A 2WQNA 4ZTSA 3PWYA 5AUWA 3R9DA 3NEWA 4FI1A 3M11A 3E64A 4JNWA 4AE9A 3JXWA 4GYGA 1PF8A 5H2UA 3L9PA 1P4FA 3UO4A 2C6MA 5BVKA 1ZARA 3V04A 1QPEA 4NUSA 4CXAA 2QC6A 2BAQA 2JITA 1KOAA 2E9VA 2WXVA 3AT2A 3FI2A 2UZBA 3OEZA 3Q6UA 4BTMA 3KN6A 2XEYA 3T3UA 3P23A 2R3GA 5CT0A 4PRJA 2JFLA 4CEGA 3OXZA 2BRNA 3F2RA 5CVGA 3C0HA 3ZEPA 3OROA 5IQEA 1YKRA 4ZTNA 4TY1A 3OC1A 3R02A 4HCVA 4ZJVA 2ITUA 2YDKA 4TWPA 1YOJA 2ITZA 4QNAA 3GC0A 3OTVA 5EM7A 4N57A 5M53A 5IEYA 2JDTA 3RVGA 3VWAA 2XK8A 2GNFA 5IF1A 4G2FA 3FZRA 1YXVA 3KRJA 5BPYA 2WMAA 3GB2A 2OH4A 2G1TA 4GJ2A 4IADA 4R3CA 4XLIA 2PUNA 3P7AA 3MSSA 4OUCA 5KUPA 1H0WA 2VTIA 4ASZA 3SRVB 2EB3A 4QYGA 5E8ZA 1U5RA 4CFWA 1TKIA 4L45A 4OTWA 4YTFA 3ZM9A 3O51A 1T46A 2WMXA 3M2WA 4B8LA 4KABA 4TL0A 3UOJA 4APPA 4D1XA 3HRCA 3C1XA 3VHEA 3EKKA 3TN8A 1OPLA 4YO4A 5C8KA 2W7XA 1APME 2OI4X 2VNWA 4YTCA 2C5XA 1CSNA 2OIDA 4PPAA 4ERKA 4IHPA 2Z2WA 3DQWA 3QZFA 3BV3A 3R71A 4IAAA 4RJ5A 5CAOA 4NYEA 5M06A 2JLDA 4DGOA 2OIQA 1E9HA 2Y0AA 3POOA 4FK3A 3MTFA 4NZWB 1FOTA 1LUFA 4CV8A 1OL6A 4RJ6A 5AP1A 3RJCA 2JKQA 2XJ0A 1UNLA 5E8SA 3K2LA 4FG7A 5CVHA 2EXCX 4QMVA 5K5NA 5E7RA 3GFWA 4I6QA 4Q9ZA 2RG6A 2XKDA 3RPSA 1SMHA 4AOIA 3W32A 5JRSA 3GEQA 4ZY6A 3FE3A 4QYHA 3R0TA 3IG7A 2FSOX 2CN5A 2ZMCA 3LZBA 3BKBA 4FF8A 4FV0A 5D41A 1U54B 4FODA 2J2IB 5M4FA 2A27A 3RM6A 1Y6BA 4GIIA 3PZHA 4ZSAA 2C0TA 3AG9A 4P5QA 5EW8A 4YHFA 4M13A 4BB4A 3RPYA 2C6TA 2Q0NA 2BTRA 1MRUA 3T8OA 3FKLA 1UNGA 4L6QA 4LOOA 2YJRA 4JQ7A 5ANGA 3DXPA 3HP5A 3ODZX 3NNXA 4H1JA 5DRBA 3TNQB 2Q0BA 1BYGA 4JQ8A 3SV0A 3O8PA 3BGQA 4GFMA 5M07A 2QOQA 4AQCA 2HCKA 2YEXA 3A4PA 5AWMA 4TXCA 3ORTA 3C7QA 2PVJA 5H8BA 4D4RA 4Z9LA 3EFJA 5M56A 4BYIA 2XA4A 2QLQA 5CY3A 2YLFA 5HHWA 3R6XA 3JVRA 2CJMA 4EK6A 3QYWA 3ORXA 2WTVA 2O3PA 3TDVA 1YHWA 3DT1A 1YXSA 2PZRA 4D9UA 4N6ZA 2PVKA 4QYFA 5DOSA 3UP7A 1E1XA 5EYDA 2REIA 3G0EA 2V55A 5J79A 3CGFA 3LJ2A 2HW7A 3V01A 5LWNA 3LKMA 3KRLA 5JFVA 3FMKA 3DK3A 4R8QA 3WZJA 2Q83A 3W2OA 4U79A 3PPKA 3DNEA 4YPSA 4W9WA 4FTOA 1I09A 3II5A 3JS2A 4WSQA 4DH5A 4B8MA 3FKNA 3RI1A 5JKGA 5M4IA 2CMWA 5AP5A 3TUDA 4J1RA 5FDXA 3DXQA 4KSPA 1LEZA 2O65A 4G31A 4O2ZA 3KFAA 4EOSA 4WBOA 2WZJA 2R2PA 1SYKA 4R5YA 2BAJA 2YIXA 3WYXA 1IA8A 3QZHA 1YQJA 2XK3A 3LCSA 3UC3A 4KS8A 4RX5A 3UBDA 3ZOSA 5AR2A 4DCEA 2HW6A 3TL8A 1SZMA 1BUHA 3Q3BA 3UYTA 1Q62A 3K5VA 5DEYA 3PY1A 4I23A 4TKSA 1ZLTA 1BI7A 1PMNA 1WCCA 5IG1A 5AFVA 2B52A 2XYUA 4JR7A 4IX4A 4II5A 4XS2A 4PMTA 3U4UA 3LMIA 2R0IA 3JPVA 3RBWA 5A4LA 4KUJA 1F3MC 5A4TA 4M66A 3R8VA 1X8BA 2XIKA 3RPVA 3I6UA 3W18A 2JFMA 5KCVA 1ZWSA 4BCFA 5FDPA 2C6EA 2CGWA 2HXQA 2XNOA 3OW3A 4GH2A 2OLCA 4I0RA 2BUJA 4MXZA 4TPTA 1K3AA 1U46A 5CEIA 1B38A 4L01A 3F6XA 4MQ2A 3H9RA 4PMMA 4AS0A 3BE2A 4FIHA 4KRCA 2J51A 4QYEA 3RAKA 3U4WA 4QPAA 2WTKB 3R8ZA 4CYIA 3CPBA 4L46A 3HV7A 3EN9A 4PF4A 4BWXA 3V5LA 5CU4A 1R78A 1IRKA 4IDTA 2FYSA 2PWLA 3B2TA 2CLXA 3IPHA 3FQSA 3DBEA 3NUNA 4JX3A 5EHYA 3W8QA 4JT3A 5HG7A 5IISA 3Q04A 3RINA 3R21A 4TYIA 3BQCA 2B9FA 5J1WA 5EQEA 2AC3A 1KE7A 2CSNA 2OK1A 4RMZA 5DT4A 3DKOA 3HNGA 2W1EA 4ZTHA 4AZSA 4BDBA 5D7AA 4F9CA 3H30A 4G17A 4EEVA 3EQBA 3E92A 1YDSE 2XKCA 3AD4A 5DVRA 5ETCA 3ZUTA 4UYAA 3AC1A 3CCNA 3GVUA 4MKCA 4C2VA 3ACKA 5HD7A 5L4QA 1JPAA 4HGEA 2WD1A 2UZDA 3VF8A 3ZC6A 3B8QA 5LMAA 4FEQA 2B4SB 3NAYA 1ATPE 5CLPA 1ZMWA 3MH3A 5LOHA 2ZOQA 4DG2E 5DIAA 1YHVA 3LQ5A 1FINA 3F3ZA 2W1DA 3EN6A 4FKPA 3CJFA 5FGKA 4YO6A 3PSCA 2B9IA 1RJBA 1PXPA 1ZYCA 4BIEA 2XVDA 3TZ9A 4QMOA 2W17A 4GVAA 2QOBA 3I7BA 1PYEA 5BX0A 2BRBA 4LI5A 4FTMA 1G8SA 3RK9A 2OG8A 2C6KA 5DBXA 4EK8A 4YZNA 4LGGA 3VRZA 3HZTA 5M09A 3CR0A 1OECA 4KIKA 4YZDA 3DBQA 4OR5A 2CLQA 2OJJA 3RCJA 1Q8TA 4XG8A 4FUXA 2CKOA 3DK6A 4IQ6A 5KE0A 5JH6A 3JUHA 5B0XA 3KRWA 3R2BA 3QQFA 2W9ZB 4HYSA 4I1ZA 4F4PA 3GI3A 2XBJA 3CTQA 3H0YA 4EH5A 3UQGA 2R3MA 1TQIA 5IKWA 3FHIA 3RCDA 2ZV9A 4FNZA 5ANEA 3VW6A 3SGCA 1W84A 2UZTA 4BDEA 5IU2A 4FV8A 4LOQA 3ANQA 5FLFA 4I93A 3PIZA 3V6SA 2IPXA 2CGXA 3MVMA 4X3FB 4G5JA 4IZAA 5EK7A 5LMKC 4W9XA 5K4JA 3R7IA 3KXNA 3NCZA 3A7JA 2OXXA 2WEIA 3LXLA 5ANKA 3ZRMA 4Z55A 2PMOX 5LVOA 5M4CA 4WNPA 4DCAA 4FZ6A 1REKA 1XBCA 4IZYA 4EL9A 1V1KA 2R4BA 4QMWA 4UXQA 1IR3A 3SX9A 1MQBA 2VZ6A 3PY0A 5J87A 4HGTA 5L2QA 1Y91A 5CU2A 3W8LA 5IA3A 4O0TA 3DJ7A 3AT3A 3VBWA 3PLAE 1NVRA 3C50A 4IDVA 3PJ2A 4ZY4A 2DS1A 5HVYA 3DFAA 1CTPE 4IM2A 4GW8A 4XG7A 1H28A 4JBOA 3VBVA 2IW8A 4QPMA 4FGBA 5ITAA 4FV4A 4AT5A 4RA5A 2CKEA 4FOCA 4EOMA 3VAPA 4DG3E 3VUGA 4PQNA 5GJGA 4U0IA 4CG9A 2RKUA 4IVCA 4HW7A 4BGGA 4JAJA 3WARA 3RPRA 2QNJA 3BRBA 5ETFA 1QPDA 2QOFA 2CCHA 5C4LA 2Y7JA 4X2JA 4G6LA 5CU6A 4RIYA 5H8GA 5BVNA 2ZV8A 4HYHA 4IAFA 3KF4A 5ANJA 4PTCA 4OW8A 3FHRA 4A9TA 3PDTA 1UU3A 2HY0A 4BZNA 2Y4IB 5DFPA 4M8TA 2E9PA 3RPOA 3ZLWA 1UU8A 4YMJA 4E6AA 3H9OA 4BKYA 2WQEA 5FXQA 3FMMA 4YJRA 5HTBA 3Q5ZA 4R78A 4ZEGA 3DS6A 3QHRA 4I3ZA 3LQ8A 1V0OA 3KVWA 2B54A 5CAQA 3O7LD 4MXAA 2ITXA 2PK9A 2E9OA 2VTQA 5IQBA 2QOOA 4AZTA 4WIHA 4ASDA 3HL7A 5E8VA 3LCTA 1SVGA 2QR7A 1HCLA 4TN6A 4QMTA 3ZH8A 2R3IA 3EL7A 1JKKA 1WVXA 3HUBA 3DBCA 3HRFA 3OW4A 4AWIA 4FTLA 4PP9A 1FQ1B 3JR1A 1H25A 5TKDA 3LJ1A 3QTUA 4XRLA 5H8EA 4DH7A 2WMWA 1Q5KA 3AMBA 4D1ZA 2JDRA 5AR5A 2WFYA 1ZZ2A 3KRRA 4G5PA 2HWPA 2W99B 3BWJA 4WNMA 3SD0A 4Y73A 5KMOA 2FVDA 1REJA 3MVHA 5KHWA 4UMUA 5FM2A 2H8HA 3CJGA 4O0XA 1PMUA 2WPAA 4C3RA 4R77A 4C4HA 3P0MA 3PXZA 5K4IA 5BUEA 4FV3A 5AV2A 1M7QA 4FSNA 2FH9A 2UW6A 4M0ZA 4IXPA 2PUPA 3BIZA 3FLZA 3BU3A 3QXPA 4XLVA 1M17A 2B0QA 3MB7A 4X21A 4DG0E 1JKSA 3IDBA 5DRDA 4RIWB 4LRJA 4PV0A 3ZC5A 5J9LA 4O6LA 4JBPA 1PXKA 3QUEA 4ZK5A 3CQUA 3R7OA 4DC2A 4BWPA 3Q2JA 2UW4A 5CWZA 4ZTRA 5J7BA 4DFXE 1K2PA 2CPKE 4ALVA 1ZXEA 2WOTA 2WELA 2JIIA 5HVJA 2XRUA 3BI6A 4EC9A 2X7FA 4U45A 4D2SA 5CEOA 3BX5A 2PYWA 4LL5A 1Q3WA 2P0CA 3BHYA 1NA7A 3NYXA 1G5SA 4RQKA 2IO6A 4RWLA 2XNGA 5FM3A 4C2WA 4GK2A 4DBXA 3BZ3A 3FPQA 4O91A 2YDJA 5AP6A 3R7EA 3PXRA 4RLKA 3MJ2A 5M55A 5CXHA 3TACA 2Z7SA 4USDA 2R3OA 2OZAA 5EM8A 1DAYA 4JG8A 1LR4A 4IJPA 2W06A 1YVJA 2ITQA 4KKHA 3T3VA 4F7LA 4F6SA 1CDKA 4IC8A 3V5QA 4V0GB 4DLJA 4CT2A 4CT1A 3P1AA 2NO3A 2VO6A 5E8TA 3NYVA 3TNPC 2WGJA 4PUZA 3E8EA 4ZMFA 1H1QA 1TVOA 2J4ZA 2W4JA 3K54A 5AP7A 3DBFA 2VWZA 4H3BA 4W8EA 2Z7RA 4RGJA 3EQIA 3AT4A 4Q5HA 4RFMA 5CTPA 5FTQA 1KOBA 3QF9A 4IFGA 1ZY5A 2JDSA 2C5VA 3IW4A 4AFEA 4GS6A 4RSSA 4ZTQA 3E87A 4O83A 2PE0A 2I0EA 5IA4A 3UIXA 3R8MA 3TKHA 3GGFA 2E2BA 5JGBA 1BI8A 3ZO1A 4Z16A 1PW2A 3O8TA 5JGDA 4FEUA 3VUHA 1CKIA 2XK4A 2BVAA 2FB8A 3D7TA 4ASEA 3GXLA 3QC9A 3UIMA 3RWQA 5CF5A 2VRXA 4G3GA 3A2CA 4HPTE 5IQCA 4UN0C 3UPZA 3R04A 4JRVA 3BYUA 4FL1A 1KV1A 2J5FA 1Z5MA 2ITNA 2DWBA 3QQJA 5M51A 5FBOA 3I5NA 5AR8A 5EHOA 2CKQA 4BDKA 5TO8A 5EW3A 5B2MA 2BCJA 4UXLA 3R7GA 2I0YA 2BROA 4AOTA 4ZZMA 1RQQA 3NNVA 3PG3A 4NT4A 3DTWA 3R9OA 5I9YA 3S1HA 3R83A 1ZYSA 4MNEB 4FKWA 5CX9A 4AGUA 4FG8A 1RW8A 2F7XE 3HA6A 3NUSA 4H36A 3V5PA 4TT7A 4O21A 5CU0A 4ORKA 5KZ0A 3BHHA 5JSMA 3Q4TA 3BV2A 2ZV7A 3VQHA 4UEUA 5JT2A 3FAAA 5IQHA 4HGLA 3LXNA 3ZO3A 4DAWA 5EM6A 4YLJA 3QQUA 5BQ0A 4TYHB 3RK5A 3BYOA 3ULIA 1ZOHA 3TTIA 4GKIA 1FVVA 2X7GA 4FT7A 3NUAA 3QCSA 4E4LA 3TTJA 4NW5A 5A4QA 2BHEA 3QRJA 2LGCA 4S32A 5CT7A 2Y6MA 4D2RA 2OJ9A 3NYNA 2HZNA 3ZSIA 5DI1A 4BC6A 3PJ1A 4B9DA 3O17A 3QRIA 2W05A 3DJ6A 3TKIA 4AA4A 5D12A 2VD5A 3FJQE 2JBOA 3G0FA 1XBBA 5FBNC 4DEBA 3COIA 1YOLA 4BGHA 2HZ4A 3F3UA 5FP5A 4AG8A 4RLLA 4AGCA 1FVTA 4D5KA 4L43A 4O0UA 2BRGA 4FL2A 4WG3A 1UV5A 2W9FB 4LRMA 4CCBA 4EUUA 2WMTA 4FZAB 4BDGA 1UWHA 2XIZA 2YISA 3FZPA 5JFXA 4XG9A 4R7BA 1XH4A 2I6LA 2ZB1A 3V3VA 2WMRA 5HGIA 5IMXA 1H00A 2PVYA 1O6LA 3AGLA 4PL3A 5FTOA 4FR4A 4A4LA 4EHEA 4F9WA 4C34A 4CFFA 3DZOA 3SOAA 4K11A 3GP0A 3MIYA 5CASA 4K18A 3CSVA 4NL0A 3TWJA 5IUHA 4YJOA 5G1XA 3R1NA 1IAHA 4RJ7A 3R8UA 2W4KA 5EDRA 2UW9A 3PYYA 3U87A 4BI1A 5HE3A 3ET7A 2PVHA 4YZCA 2UZWE 3SDJA 3W2QA 4BR3A 4DH3A 1ZY4A 4LV5A 3LW0A 4IWQA 2PU8A 4MD9E 3HA8A 1M52A 4DFUA 3NMUF 1OVEA 4U44A 3I81A 4ANSA 4C62A 4KIOA 4H3QA 3PPZA 4QMSA 5IEVA 3UP2A 4XP0A 2G9XA 2WU6A 3UO6A 2YWVA 4QTEA 5BVEA 5CYIA 2F7ZE 4M69B 3NUYA 4O1OA 5CXZA 4C57A 1YI3A 1XWSA 2VX1A 3P79A 3IECA 3A8WA 5HG8A 3VRYA 3KXXA 4FICA 3PLSA 3JVSA 1KE5A 3QRTA 3VJNA 3UZRA 3FYKX 1H4LA 4D4YA 4H58A 4DTAA 3OT3A 3NGAA 1UU7A 5K3YA 2W5AA 2GNJA 4QP2A 5D11A 4GMYA 4L42A 1SNXA 4AE6A 5IQAA 1JSTA 1ERKA 1Z57A 2C3IB 3HV3A 5BYLA 4YTHA 1EH4A 3ZZEA 3QCYA 4XEYA 2ITVA 3R9NA 4OBQA 2YACA 3ZZWA 3LLTA 2DYLA 4C7TA 1FPUA 2PY3A 2QVSE 1UNHA 3LFFA 3RMFA 5CEKA 4BCOA 4BHZA 2OO8X 2BTSA 4ACCA 1WMKA 3D14A 4FEVA 1AQ1A 3AC3A 3MN3A 5J7HA 3A8XA 4S30A 2ETRA 3L9LA 4BIBA 2NRUA 5L2WA 3IK3A 2OJIA 4X2FA 3FXZA 4TYEA 2PVNA 4D2PA 4ZY5A 5M4UA 3EQFA 4IACA 3LPBA 4LUDA 3IDPA 4Y46A 2EWAA 4EYJA 4ZLOA 1HOWA 3ZUUA 4IANA 1W83A 4JDJA 4CFUA 1Z9XA 3DDPA 4KINA 4QMUA 2BILB 4RG0A 3KGAA 4EKLA 4IAZA 3E8DA 4UMTA 3S2PA 5I9XA 5LCJA 4A06A 4GL9A 3VUTA 4U3YA 2CGVA 3KF7A 4NCTC 3EB0A 2W1ZA 2FSLX 4CFNA 3S0OA 2WTCA 3WIGA 3QA0A 4IW0A 4QMYA 2V22A 4E73A 4K33A 2JBPA 2OJGA 3AD5A 4I4FA 2VN9A 4E4MA 4EHGA 5IQFA 4NK9A 2GQSA 4C35A 3F66A 5LXMA 3TCPA 3O71A 4WSYA 3C5UA 3BCEA 5LVLA 3AOXA 3I0QA 3U8WA 4QTCA 5AUTA 3AGMA 4GEOA 4YJQA 4E26A 4CGAA 2XJ2A 2XZSA 4TYJA 4FZ7A 2VWVA 3W10A 2CNQA 3QTXA 1R0PA 4RPVA 5TE0A 3GOKA 4DH1A 1WBVA 2ZAZA 3HLLA 2BZHB 4FVRA 1U5QA 2GS2A 5AP2A 4NM7A 2QONA 3OTUA 4M3QA 3KXZA 4D0XA 3KN5A 4WG5A 2VWYA 4XX9A 1PXOA 5F20A 5GZ9A 5HE0A 3NNUA 4LQMA 3EIDA 3F5UA 1YHSA 3SA0A 1QPJA 4LMNA 5JRQA 1G8AA 4W4VA 4IH8A 5D1JA 2JIVA 4BFMA 1JWHA 4AT3A 4R6VA 4BCNA 5EYMA 3O23A 1JAMA 4ZTLA 4PP7A 4QQTA 2UW3A 3EQCA 2IVTA 4K77A 3BU6A 4E20A 4EWHA 3ETAA 4UX9A 4H1MA 3DCVA 3MA6A 1UKHA 3ITZA 5JEBA 3D15A 2GS6A 3UVQA 2BALA 4CZTA 2WQMA 4NKAA 4BBFA 2ITTA 4QQCA 5GZ8A 4A4OA 4MCVA 1OITA 3OUKA 4NH1A 4YJTA 3UO5A 4IB1A 1Q97A 2X8DA 3PXKA 3OXIA 3UOHA 3MJ1A 3EOCA 3PSDA 1W82A 4FC0A 4FKSA 3UODA 5HBJA 4O0RA 5HQ0A 5F94A 1M7NA 3OWLA 4UWYA 4QPSA 4XJ0A 5HOAA 3UMWA 4CTBA 3EMGA 3NVKI 4NIFA 4MF0A 3VIDA 3P4KA 2J0IA 5ICPA 3D4QA 1YXXA 4F0FA 3OOMA 4BBEA 4Y5QA 1URCA 4C4JA 5IEXA 3K3JA 4DGLC 3ZDUA 3P86A 2FGIA 3SQQA 3P7CA 1RE8A 2FSMX 3RNYA 4CSVA 3R1SA 4QP9A 3COHA 3PUPA 3D5VA 4RWJA 4CFXA 4EONA 4BDIA 4CQGA 4PDPA 2BZKB 5E1EA 1Q8YA 4V04A 2F57A 4OTDA 2ZMDA 5HESA 4D58A 4U8ZA 3EFWA 3GCSA 4R5SA 3R8PA 3E5AA 3PJ8A 4GK3A 4J98A 4ONAA 4PY1A 2XUUA 4I5CA 3FMHA 4UWBA 4RJ4A 4DFYA 4DITA 2YZAA 4HZSA 5L2IA 3KA0A 3G33A 3F61A 2GPHA 1L3RE 4YGAA 5A3XA 1AGWA 3WF5A 5CAVA 3BHTA 3DKGA 4M15A 5A4EA 3P78A 2UW7A 2IZUA 2PVMA 2FSTX 3JY0A 4MYGA 4OTHA 3RTPA 4AW1A 4C4EA 3ID6C 1PXIA 3EQRA 3LCKA 1OL5A 3MH1A 4FVPA 4BL1A 5DT0A 1QCFA 3DKCA 3R01A 4E6CA 2OJFE 1FGIA 3O2MA 2X81A 4TNBA 2WU7A 4FTRA 4FL3A 2C69A 3R1YA 4XNEA 3KU2A 4RT7A 4O38A 2VNYA 4O7NA 1H1PA 3BLHA 2PVFA 3ZLSA 5JMSA 4X2GA 4XV3A 3WZDA 2XYNA 3R30A 3S95A 4WNOA 4IM0A 3TG1A 4TTHB 3BPRA 5AUVA 4G9RA 3BYVA 3PXFA 3LMHA 1PRYA 1Q99A 2W0JA 3WE8A 5AM7A 5C9CA 4N6YA 2CDZA 3UDBA 3ACJA 2HIWA 5KZIA 4UMPA 4ZMEA 4FNXA 2V5QA 5HTIA 1QPCA 5DWRA 4JG6A 3K3IA 3D5XA 4RA4A 2XP2A 3ZEWA 4LUEA 3MBLA 1VJYA 2OBJA 3GUBA 4EH9A 3JYAA 1UKIA 5JFWA 5EM5A 4QP1A 4ZXTA 3FC2A 2VO0A 1OB3A 3IW5A 2C5YA 2ERKA 3WYYA 3AC5A 4U3ZA 3UVPA 2VTSA 2BDJA 2O64A 3H4JA 4OTQA 1GZ8A 5JK3A 1R3CA 2R3NA 4O7SA 5EW9A 3O96A 1M2RA 5HIDA 1GIIA 1OL1A 2YCFA 4ZOGA 4C36A 4JL9A 3HMNA 4I41A 1KE8A 1YXTA 3GENA 3VS4A 3G2FA 2BRHA 2IZTA 1ZRZA 5EDQA 5CZHA 3IONA 5BNJA 3OEFX 1LEWA 4EH4A 4D1SA 3V51A 3QA8A 4JR3A 2J7TA 5HU9A 3SC1A 5EI6A 5AX9A 2BHHA 3LMGA 3QHWA 2J0JA 4L00A 3QTWA 5AV4A 1URWA 3FEGA 4DT8A 4GJ3A 5TOZA 2YCQA 1VR2A 3DGKA 4FSMA 5DR9A 3SOCA 3VF9A 5HX6A 5IA0A 5IA2A 4G1WA 1H01A 3ZHPC 3QQLA 3CD8A 4KIKB 2IVUA 1GZNA 4FIGA 3ELJA 5CQUA 5CS6A 5HE1A 2WMQA 2O63A 3V5JA 3ZFXA 2OWBA 3QZGA 3R7UA 1M2PA 1TQPA 4OTPA 3VNTA 3ZO4A 4BZDA 3KK9A 3GC9A 5GHVA 4FKGA 4M0YA 4IAYA 5AAFA 4XMOA 3UQCA 4I0TA 1YRPA 3O50A 3PRIA 4EWQA 4PPBA 3LJ0A 3Q52A 4X0MA 3WF6A 4F70A 4E5BA 3N4TA 5CQWA 3ZTXA 1S9JA 2X1NA 2XMYA 3LFBA 2J5EA 2A0CX 4WHZA 4MVFA 4O1PA 2WTJA 3MTLA 5DG5A 3F88A 1A06A 3FL5A 4AAAA 1Q4LA 3GCVA 3U54A 1GY3A 5J5SA 4RVTA 4BTFA 4UZDA 4FIFA 1UA2A 2XK7A 3L8PA 3PTGA 4MXOA 4YZBA 5I3OA 3ZS5A 3LCOA 1JQHA 4KB8A 4LOPA 1FGKA 3DA6A 4J8NA 4P2KA 4CMTA 4PDSA 2HK5A 2JKMA 4JX7A 4EJ7A 3QUPA 3KQ7A 3C4CA 3VN9A 2QI8A 4IZ5A 4PTGA 5BVWA 3ZLXA 2OXDA 4LGHA 4E5WA 4EZ5A 4J8MA 4FEXA 2I0VA 2JDVA 3R00A 1Q8UA 5HG5A 4E5AX 3WOWA 3UIUA 4IM3A 3CQEA 4TRLA 4GUEA 3AMAA 2F49A 3Q9ZA 4U42A 4FEWA 3EKNA 4HCTA 4GSBA 4M97A 3Q6WA 4P4CA 4C0TA 4F09A 2GNHA 4NSTA 1H0VA 2C5OA 2Z7QA 3MY5A 4I20A 3RM7A 1WVWA 1OUYA 3ZBFA 3NVMB 3C0IA 4D2WA 3FQEA 2E9NA 4O0VA 5HE2A 3MVJA 4E4NA 4CKJA 2B9JA 4MBLA 4IB0A 4EOQA 3I5ZA 4CTCA 2OW3A 4HYIA 3QKKA 2C6IA 1ZZLA 5B2KA 3RGFA 4FTNA 5CSHA 1DI8A 2YCRA 4S2ZA 3MIAA 5IZFA 5IQDA 3KMUA 2OH0E 4NU1A 2PVRA 2QLUA 3MESA 3MPMA 2VAGA 4RC2A 4FZFB 3EQGA 2ITOA 3REPA 4AOJA 3U6JA 2VTRA 3ORZA 3UE4A 1H26A 4RIYB 5HIBA 5AA9A 3EN7A 3F3WA 5E91A 4WUNA 3FL4A 4I21A 4CQEA 1PMVA 2OZOA 5KNJA 4QRCA 5CEQA 2Z8CA 4FYNA 4GU9A 4FT9A 4L44A 2IN6A 4UWCA 2Z02A 3CGOA 3I79A 3N51A 2UZVA 4L53A 2VV9A 3DBDA 3SXFA 4XOYA 2W1CA 3VUKA 4BDAA 1GAGA 4IVBA 1WBNA 4EOKA 2XM8A 4O7WA 3W2RA 3QZIA 3MFRA 2ZM4A 3ATTA 4EH6A 2CNUA 3R2YA 4EI4A 1NT2A 4F65A 3QWJA 2XNNA 3NX8A 4JAIA 3TT0A 4FIJA 1J7LA 3D0EA 4KS7A 4ZLZA 1R39A 4HVDA 1WFCA 2VU3A 4ZTMA 5K5XA 4EZ7A 1WBPA 1P5EA 5I3RA 1H1SA 4PPCA 5D10A 2R9SA 3FMEA 5CNOA 5K0KA 3QCXA 2V62A 2WOUA 3OBJA 2C1BA 4Q2AA 5CEMA 3PY3A 4JLCA 4YNOA 1S9IA 2HZIA 5AIKA 1J7IA 1XH7A 5IQIA 2Y9QA 4KRDA 5CI6A 4ZSLA 3W2PA 4PX6A 5EHLA 4XCUA 1H27A 1F5QA 3GQLA 2YAKA 2NP8A 3WZKA 3GC7A 5A6OA 5HO6A 4BKJA 5LARA 1NW1A 2VWBA 2W96B 3UGCA 1XH6A 3BLQA 5L8JA 5J95A 3EWHA 2E9UA 3FBVA 4FSRA 3RAIA 2IWIA 3M42A 4BTKA 3CPCA 5DH3A 3QL8A 1SVEA 2QCSA 4AU8A 5IA5A 2CHLA 4F64A 4M7IA 2BFXA 3DLZA 3IW8A 1SM2A 5DA3A 5HTCA 2QG7A 4LYNA 1PKDA 4PL5A 4EHZA 5LCKA 1OIUA 4O0WA 4ZLYA 2PULA 4QP7A 3HAMA 2YAAA 4F1MA 4C4IA 3LFSA 4ZP5A 2GMXA 4K2RA 3VS1A 4BN1A 1G3NA 1I44A 3AC2A 4O7LA 2H96A 1BL7A 3D94A 3F7ZA 5F9EA 4D4SA 4CCUA 2SRCA 4GG7A 3TNHA 5I5ZA 3T9IA 2FO0A 2OF2A 5AUUA 4K1BA 4L8MA 5BMMA 3IW6A 4A9UA 4DH8A 3A7FA 3SVVA 1ND4A 2F2UA 2XIRA 4W8DA 5CU3A 3L9MA 2EUFB 2HY81 3OVVA 4F6UA 4R3RA 3NUPA 1PY5A 3OOGA 4PTEA 3KULB 1XH9A 1MRVA 4YJVA 4EOLA 2CGUA 2OGVA 2CNVA 4AZEA 3PA3A 3ZXTA 4JIKA 3E88A 1Y6AA 4FGRA 2OZAB 2UZUE 3KMWA 3LCDA 3TNIA 2QO9A 3B8RA 4G6NA 3FXXA 1WBSA 4ZSJA 3DXNA 3I4BA 3GCPA 4WRSA 4AFJA 4O7TA 2OFVA 3KXHA 2VTNA 2WKMA 4RVMA 4D2TA 4K8AA 4ZZNA 3C5IA 3A7IA 2BZJA 2F9GA 1DM2A 4MXCA 3C0GA 2A1AB 4YC6A 4DN5A 4RFZA 2Y4PA 4MEDA 3C4FA 2RFEA 3DKFA 4U41A 4ACGA 1GZKA 4OGRA 4IWPA 2C6DA 4I0SA 3OCGA 4L3JA 1NY3A 3FLSA 3ZRKA 2PUIA 2IJMA 5CANA 4FE2A 4GFGA 4O81A 2W1GA 2NNWB 3RHXA 4BWKA 3VBYA 3A61A 4Y85A 1NXKA 5AP0A 3IO7A 4IWOA 4KIQA 4KSQA 5C26A 2GHMA 5M44A 5GIOE 3SLSA 5A9UA 5AMNA 5BYZA 4G3CA 4YPDA 2AC5A 3HP2A 3D7TB 1IG1A 5DEWA 4XP2A 4ZIMA 3RALA 3VUMA 4CRLA 1ZOGA 3OY1A 4AZWA 3FV8A 3LFAA 4ARKA 3F3VA 5IDNA 2VX3A 3NZ0A 4L7FA 3EN4A 1JKTA 2UW5A 2YIRA 3MPAA 4MXXA 1Y8YA 4QO9A 4EC8A 4WA9A 3MFTA 3F2NA 3UG2A 2IVVA 3OMVA 3OWPA 3OY3A 4OT5A 2OU7A 3PXYA 2P33A 1B6CB 3A62A 4JVGA 4B99A 3R7YA 4BICA 3NIZA 5CF8A 5DGZA 2IG7A 4UBAA 5KMMA 1Y8GA 3FZOA 5FRIA 5EKNA 3BQRA 3C4XA 4S31A 5M57A 2VGPA 3O7LB 3LM0A 5AP4A 4TWCA 1AD5A 1WZYA 4QMPA 2GS7A 3HGKA 2V7AA 4FTIA 4Q9SA 2AUHA 4RC4A 4BDFA 4KIPA 4AUAA 4YJUA 3VULA 3A7GA 3ZXZA 5DHJA 1H07A 3Q5IA 4EBWA 4FVQA 2UVZA 2W1IA 4D0WA 2R0UA 2QOLA 2RFNA 3RZFA 3SXRA 3BEAA 4Z7HA 3FZ1A 4QMZA 5HBHA 3MS9A 4DLIA 5A54A 5IPJA 1HCKA 3U55A 2WB8A 4G3DA 4S34A 2EVAA 3I1AA 1OPKA 3N4VA 5AAGA 3EHAA 5AADA 2P3GX 4GVJA 1PJKA 2R7BA 3CLYA 5FXSA 4IC7A 3ZYAA 5HBEA 4EYMA 3ORKA 3P9JA 4ANNA 2B53A 3QTQA 2WMUA 2VTJA 3HV5A 2BIYA 4HVHA 2YA9A 2HOGA 3H0ZA 3PA4A 3E3BX 4LG4A 4V0GA 4QP3A 3ZFYA 4NFNA 3IDCA 4JDIA 2UVXA 2J6MA 3D2IA 4HZRA 3FMJA 2OSCA 3VS3A
chains in the Genus database with same CATH superfamily
3AC8A 3NNWA 3LFEA 4J95A 4LGDA 5AIRA 3SW4A 3VW8A 3GCUA 4C3PA 2X9EA 4TW9A 3VS6A 2RSVA 4I5PA 4OBPA 3VUDA 3F7WA 1YXUA 3UPXA 4NW6A 4FSYA 1GJOA 4KKEA 4EH7A 5CF6A 4A07A 4A7CA 2AEGA 3E8CA 4FNYA 2P4IA 2WMBA 3U6IA 4I22A 3L1SA 3Q9YA 4XG2A 4EKKA 3FZTA 5HNBA 2YDIA 2V7OA 5EDPA 2ZVAA 4B0GA 4C61A 4HJOA 3MB6A 4L67A 3NAXA 3ROYA 2ZDUA 4BTMA 2WMSA 4EQMA 3D5WA 4RC3A 5FWKK 2O8YA 2CN8A 4GT5A 3QRKA 4J71A 1IEPA 4MTAA 4V05A 4WKQA 5AR3A 5HCYA 3UNZA 1P4OA 5LVNA 3KMMA 4IB3A 4YLLA 2C6LA 3QCQA 1VYWA 3FUPA 2BFYA 3ORMA 4QYYA 2XALA 1OIQA 1O6KA 1CKJA 4I6BA 3BYSA 5AUXA 3FI8A 3TZ7A 4FIEA 4L9IA 2YLEA 3FY0A 4UB7A 3QUDA 5EQPA 4QMQA 4IAIA 2XEZA 4KBKA 5KX8A 3OUNB 4F7SA 3FMDA 3UG1A 4MQ1A 2ACXA 4RVKA 2ZM1A 3OF0A 5H3QA 3S4QA 1XBAA 4GKHA 5IH6A 4MH7A 4OAVB 2DUVA 3FLYA 2XM9A 3PP1A 4USFA 3OCBA 5IMEA 5J9ZA 2ETMA 1CMKE 4IBMA 2X6DA 4J97A 4K9YA 4OTIA 5AAEA 5IH5A 4AXEA 2HXLA 4JJRA 2UZLA 4ANQA 2WIPA 2ZDTA 4NFMA 4BGQA 3DQXA 4PDYA 2JEDA 3H3CA 3A99A 1JVPP 4LV7A 2UW0A 4APCA 3MA3A 4OAUC 3WI6A 3BU5A 2BPMA 2GSFA 2PTKA 2QR8A 4KBAA 3O0GA 5FTGA 5C4KA 3HYHA 2QODA 2Z7LA 3MV5A 2RL5A 3H10A 4I94A 4XV1A 3V6RA 2XNMA 4ZS0A 2UZOA 3GU5A 5ANIA 2JAVA 3I7CA 4I4EA 4UMRA 5GZAA 4D9TA 4IVDA 4DYMA 2GFCA 2X2LA 3FZSA 4LM5A 5I4NA 5K0XA 1ZOEA 2X0GA 3PZEA 3ZBXA 2Y6OA 5KBQA 3VBQA 1OKWA 1T45A 4CZYB 4FKQA 3ULZA 5FG8A 2OXYA 3QRUA 3L9NA 2WTIA 4FNWA 3R28A 5CZIA 4FYOA 2CCIA 1STCE 4ITHA 4XRJA 5E1SA 5T68A 2PMLX 1FMKA 4AT4A 2PPQA 4MAOA 4BIDA 4BDDA 4FKUA 2J90A 2UVYA 4YLKA 2GDOA 1K9AA 5IQGA 3DPKA 4QMLA 4B7TA 3IKAA 3M1SA 3Q9WA 3PRFA 1PXNA 2QKWB 5ANOA 3TV7A 4E93A 4AXDA 3Q32A 3P7BA 1L8TA 2G15A 2X2MA 5DLSA 3TEIA 3DLSA 4JBVA 1PXMA 4FBXA 3ZO2A 5C8NA 1KWPA 4Y8DA 3MW1A 2XH5A 3KRXA 5HZNA 4NM5A 5IUIA 4ACHA 5LMBA 3GC8A 4JOAA 5HLPA 3EQDA 1YDTE 2WAJA 4DTBA 4EK4A 3EL8A 3CQWA 4R1VA 4L68A 2VO3A 4KBCA 2C1AA 3HDNA 3HDMA 3D7ZA 3CKXA 4Y83A 3OZ6A 4FTTA 4FTKA 3QWKA 5EYCA 5DNRA 4C37A 3IQ7A 2OFUA 3TM0A 4L3LA 4I6FA 4U6RA 5AEPA 5T6KA 2IW6A 5BVDA 3RHKA 1TZDA 1UVRA 3FY2A 5BVOA 4MWIA 4TNDA 1JKLA 3S00A 4O2PA 1TQMA 2JIUA 2RFSA 3ML1A 1YI4A 4Y5HA 3VO3A 5T3QA 4AA0A 3HEGA 5JQ8A 4CYJA 5EI2A 1MRYA 3TJCA 2X8EA 1ZYJA 4ANBA 4RIXA 3FDNA 1CKPA 3FSKA 3W1FA 5HNGA 2ITWA 3OT8A 3Q60A 5IA1A 3SG8A 1G8KA 1PKGA 5AX3A 1Q41A 2PZIA 3PVUA 3KREA 3FLQA 4WUAA 4YSMA 2B7AA 4AW0A 3C9WA 3DZQA 4BY9E 1XQZA 4YUQA 3QD2B 2J0MB 2YJSA 4FA2A 4DHIB 3ROCA 4W4WA 5C27A 3D9VA 4HNFA 3OD6X 2QHNA 3NLBA 3LIJA 3QALE 3ZONA 4EK5A 1XMMA 2AQXA 2WO6A 3LFDA 2PL0A 4H39A 5GJDA 2XAMA 4WBBB 2WEVA 4U9AA 2W1FA 2QO7A 3DDQA 3R63A 4YSJA 3ENHA 2YIYA 3R22A 3PFQA 3R73A 4K6ZA 4BYJA 3V5WA 3F2AA 3FXWA 3DAKA 1H1WA 4FT3A 5EKOA 1W0XC 4ENXA 1JOWB 5HCZA 1YWVA 2RF9A 5HX8A 2KULA 4XV9A 2R3PA 3EQHA 3NPCA 4JDHA 4GUBA 4D4VA 3DB8A 3FMLA 4QTAA 4U81A 1OPJA 1R1WA 5EYKA 3ALOA 1XKKA 3VJOA 1JLUE 4NIFB 4YURA 3QC4A 4QMMA 1ZYDA 4FV6A 2UW8A 5HG9A 4HVIA 4WD5A 4BCJA 3U6HA 3HV4A 4H3PA 4FTAA 2YHVA 4O4DA 5LMKA 4ZSEA 3PP0A 4IB5A 3SHEA 1JNKA 4BDJA 5CSXA 5CAPA 1PYXA 2GCDA 3LM5A 4YJPA 3HECA 4ZJJA 2KTYA 1OKYA 5IH4A 5J5TA 1OZ1A 5M08A 1E1VA 1OUKA 3VS2A 5EOBA 3MDYA 2BIKB 2BMCA 2C68A 2GNGA 2WMVA 3OXTA 4GT3A 1GIHA 3MI9A 4YTIA 4DBNA 4Y72A 1Q61A 2QOKA 5DYJA 5J9YA 1SVHA 2EU9A 4FV2A 1GNGA 5ETAA 3SRVA 1GOLA 4TWNA 4M67A 2PVLA 1NVQA 3BE9A 2BZIB 4DGGA 2X4FA 5L6WL 5JQ5A 3UDTA 4DDIA 1H24A 4OTRA 3QX2A 5AV1A 3LAUA 3W16A 1H1RA 1LP4A 1W2CA 3TZMA 5KKRC 2FUMA 4U40A 1U59A 4YZMA 4DEIA 4DEGA 3DAEA 3Q9XA 4M84A 1W2FA 5EQYA 4IFCA 3QQHA 4IMYA 5AUYA 4PNIA 4EH2A 3UOLA 5HEZA 3ZMMA 2WTDA 4BJJA 1VEBA 1OMWA 2VTOA 2XNBA 3DK7A 1JBPE 4FV5A 2I7QA 4O7RA 5D7VA 3VBTA 3DNDA 3LE6A 4RFYA 2PHKA 5L3AA 2WHBA 4FV7A 1Q3DA 2YM4A 3FKOA 4KNBA 4QOXA 3G90X 4JIAA 1NVSA 4O82A 3ZFMA 4AX8A 3AXWA 1DI9A 3MFSA 3CE3A 3FLWA 1DAWA 1V0PA 2A19B 4YU2A 1XMLA 4DINA 2A2AA 3Q2MA 2VTLA 4J52A 4NTTA 4EH8A 3V5TA 4HPUE 4F7NA 3F5XA 1OIRA 1H8FA 3EH9A 4ALWA 3ANRA 3CS9A 4LMUA 2PSQA 4MBJA 1RDQE 1U54A 4BZOA 4KWPA 3NW7A 4H05A 4BCGA 4X2NA 1JSUA 3VQUA 1J3HA 1O6YA 4RX7A 4RQVA 4UALA 2CKPA 4E3CA 2R3HA 2A98A 4FKJA 2RIOA 1VYZA 2W4OA 4R7HA 1KE9A 2OF4A 4DGMA 3UZTA 4AN9A 2GQRA 3QGYA 3ZCLA 2G01A 4F7JA 5J1VA 2XKEA 4AZFA 4MBIA 4X6RA 3KY2A 2P2IA 5FP6A 4ERWA 3PJCA 1LPUA 2XCKA 3QKMA 2W1HA 4GT4A 4O0SA 3WZEA 2GNIA 4PNKA 3L8VA 2QD9A 2QU6A 4G3EA 4JRNA 4XG3A 3P5KA 2G2FA 1KV2A 2ESMA 3OS3A 3Q4ZA 4B6LA 4FSTA 2EXMA 1ST4A 4ALUA 2VWIA 2R3FA 3EN5A 2YZLA 1ZMVA 4U80A 2GTNA 4G3FA 5C8MA 3ORPA 1SNUA 2IZRA 3RNIA 4UYNA 4BCQA 3AC4A 2YIQA 4NEUA 3UOKA 3DU8A 2YCSA 2JKOA 3PJ3A 1VLRA 3DOGA 3FYJX 4QT1A 4YZ9A 1U4DA 2YFXA 3E93A 1A9UA 2QG5A 4NKSA 4FKIA 4GK4A 2BRMA 2BDWA 2C0OA 3DAJA 4DFNA 2ERZE 4FKRA 5LJJA 3NFGB 4FOBA 4JDKA 3HV6A 5GNKA 4WRGA 2EXEA 3DJ5A 3QGWA 4KA3A 4BI0A 4U5JA 3PE1A 3SW7A 2HWOA 2QHMA 3QBNA 1WAKA 4Z3VA 3G9NA 3SG9A 5F4NA 3G15A 5HLNA 4NM3A 4TYGA 4GFOA 3LFNA 3OG7A 4A9YA 4XG4A 3HX4A 3PPJA 2A4LA 2PZ5A 3QYZA 1OGUA 2YM5A 3QTIA 5G6VA 3VS5A 5I0BA 5FUTA 4CMUA 3OP5A 3BWFA 4CNHA 4EQUA 2WQBA 3G6GA 3R1QA 4ZAUA 1J91A 1YI6A 2VGOA 4RWKA 3CP9A 5DR6A 1UU9A 3CY2A 1ZMUA 4FKVA 3IGGA 4AW2A 5CSWA 1GIJA 4XHKB 2JDOA 4FTCA 5GINE 4F9BA 4C59A 2J0LA 4F08A 4C33A 4FTUA 2X8IA 4ZJIA 4C4FA 1ZYLA 3KXMA 2IZSA 3KL8A 2XJ1A 3PWDA 5JZNA 3KK8A 4USEA 2VTAA 3EQPA 5LQFA 3GFEA 1WVYA 5I9ZA 3BELA 5E90A 2QO2A 3OWKA 4BCPA 4I5HA 4CLIA 4K0YA 5CNNA 3IOKA 5FEEA 4GU6A 2ONLA 4C3FA 4JG7A 4NJ3A 1BMKA 2EB2A 5ANDA 3RWPA 2BKZA 3VS0A 2YM7A 4IVAA 4FMQA 4G16A 3TJDA 4A4XA 2YM6A 3TV4A 2YIWA 2I1MA 2WIHA 4QMXA 1M2QA 4FIIA 3JY9A 5B7VA 2GQGA 5DT3A 4X2KA 4HGSA 2J50A 3D5UA 3MYGA 3G6HA 4G34A 1BX6A 2J0KA 3HMIA 4XYFA 5HKMA 3UC4A 5EOLA 1P2AA 3FWQA 3ODYX 3TUCA 2RG5A 4DFBA 3BEGA 4B4LA 2VWWA 3I6WA 3QLFA 4R3PA 5HCXA 2X2KA 3W2SA 1JSVA 3KEXA 3A7HA 2PMIA 4IJ9A 4J99A 3SAYA 3ZSHA 3ZRLA 2JGZA 3TIYA 4RWIA 5DE2A 2PMNX 5HLWA 3EYGA 2XB7A 2R64A 5BUJA 4DEEA 3NWWA 4CZUA 5JFSA 4IWDA 4L3PA 4MF1A 4AGWA 4MUQA 4AXAA 4JS8A 4J53A 2QOCA 3UTOA 3ZM4A 3IOPA 3Q4CA 4MK0A 4XBUA 1QMZA 4RX8A 4F1TA 4DA5A 1Y57A 2PZPA 5HO8A 2XCHA 3H9FA 3SKCA 2HELA 1WBTA 4EOIA 2JC6A 3NRMA 4LL0A 1XH8A 4J96A 3B2WA 3NCGA 4KAOA 4EHVA 2XKFA 4M68A 1F0QA 3GQIA 4ENYA 3IS5A 3NUXA 4EUTA 1BL6A 3TDWA 4IAKA 4PDOA 2PZYA 2GHGA 4MHAA 2P55A 3U51A 4HCUA 1FVRA 2C3KA 2O5KA 4FV9A 5EI8A 4EORA 3S3IA 2OKRA 4U7ZA 2AYPA 3EZVA 4N0SA 1OL2A 1GZOA 2QQ7A 5E8UA 3MH0A 5L2SA 3PIXA 2HAKA 3C13A 2FA2A 4QNYA 4E8AA 5CSVA 3WBLA 2BR1A 1H08A 3OWJA 2JAMA 1J7UA 3LFQA 4IX6A 4GRBA 4BCHA 2R7IA 3MY0A 3I60A 4HOKA 4G9CA 4Q5EA 3TNWA 3E62A 4RIOA 5GJFA 4BF2A 4C4GA 3GU6A 2I0HA 4W4XA 2GHLA 3DY7A 5KMJA 3OHTA 3NS9A 4EH3A 2X39A 4P90A 5JGAA 4DFLA 4LDTA 4IX5A 5DN3A 4F6WA 5A14A 5I9UA 3QU0A 3DB6A 2YM8A 3LXKA 4MD8E 3F3TA 2C47A 3RAWA 2C4GA 2ZJWA 1YOMA 4X3FA 4AGDA 3FPMA 4D55A 4JI9A 2P2HA 3RK7A 2UV2A 3E7OA 2UZNA 3ORIA 4Y95A 3AMYA 3EYHA 4FT5A 4FTQA 4QP6A 5AP3A 2GNLA 5ACKA 4DEHA 3LQ3A 2XNEA 5KMNA 4E4XA 3CIKA 1OKZA 3HUCA 5EG3A 2BAKA 5FD2A 3UZPA 3V8SA 4BRXA 2O0UA 4ZSGA 3PIYA 1Q8WA 2VTTA 1BLXA 2VO7A 2ZB0A 3LFCA 5AJQA 4XV2A 3UNKA 3CTHA 1YWRA 3HKOA 4E7WA 4O86A 3HRBA 3R8LA 4X6QC 5KMLA 4GV1A 3NUUA 3QQGA 4FZDB 4O96A 2QURA 3GCQA 2QOHA 3QD0A 4TZRA 3TKUA 2GFSA 4UV0A 3U9NA 3FMNA 3KCKA 5EFQA 4E6QA 3KKVA 4F0IA 3NFFB 3NYOA 3W2CA 5AR4A 4IIRA 5E8WA 4P7EA 5AV3A 1OBGA 3PG1A 2ZV2A 4GG5A 5HNIX 4NTSA 4AN3A 5F1ZA 4C02A 4AXCA 3FQHA 4CRSA 4OTFA 5GIPE 3PA5A 4RX9A 5CALA 4PL4A 4A9SA 4O22A 5D9HA 4CFVA 2C6OA 4XOZA 3QLGA 4I6LA 5L8KA 2C5NA 4QP4A 3R9RA 4QD6A 4YC3A 4CKRA 4EOJA 2QOIA 3F69A 4FKOA 1W98A 5AM6A 4ANMA 4YNEA 1VZOA 1OM1A 1QL6A 2X0OA 4CLJA 5AR7A 4FKTA 4UMQA 2VUWA 2LAVA 3KB7A 2I40A 4JQEA 4O7VA 3CXWA 3FI4A 3RAHA 4PWNA 3SXSA 3GU8A 1B39A 3W55A 4C58A 1Q24A 4IX3A 4YHJA 2XRWA 4YBJA 3F9NA 3MY1A 3GOPA 3UNJA 5TR6A 2H6DA 4X3JA 2F7EE 4A9RA 4DEAA 1YW2A 4NJDA 3R7VA 4D5HA 3N9XA 3V8TA 3PE2A 3ZLYA 3EFKA 4EJNA 5E8XA 5KMIA 1WBOA 4N4SA 3CEKA 3L8SA 3HMOA 2VTMA 3MGYA 3ZSGA 4L7SA 3NR9A 2UUEA 2ZM3A 5E8YA 4FUYA 1MP8A 4I5MA 4XG6A 3UMXA 2WTWA 4WOVA 3Q96A 2VTHA 3MWUA 1R0EA 3QXOA 5BYYA 4EQCA 1OI9A 4MD7E 1FBNA 1IA9A 3GT8A 4D28A 3KVXA 5K9IA 1IAJA 1XO2B 4CKIA 4MWHA 1V0BA 4AN2A 3EFLA 3RZBA 3WF8A 4IE9A 3ENMA 5BUIA 3T9TA 3VVHA 3C4ZA 4RJ8A 2YABA 2YM3A 4IEBA 5FEDA 3OCSA 5H9BA 4ZZOA 2OIBA 3PVBA 5IUGA 3G5DA 5A6NA 2F4JA 2Z60A 3OFMA 1MQ4A 3QD4A 1YWNA 3BBWA 4AACA 4EZ3A 5KBRA 4I92A 2XK9A 2V0DA 2O2UA 4I24A 5EH0A 5F95A 2NPQA 4NCTA 5FEQA 1OIYA 4X7QA 5BVFA 4R7IA 3TZ8A 3KULA 1CM8A 4EOOA 5CENA 4ANLA 2R3QA 1YDRE 4V01A 3L8XA 4BCKA 5HO7A 2VTPA 3FSFA 1PXLA 4RIWA 3D83A 4F0GA 3UQFA 2B9HA 5B2LA 4DHZA 3QQKA 3QTRA 3A4OX 3MVLA 5ACBC 4D2VA 4ASXA 3NSZA 2XIXA 5HIEA 4QTBA 2W5HA 2BDFA 3BHUA 4BDHA 2ONLC 3ORNA 3HAVA 3WE4A 5LWMA 3LXPA 3QTSA 3Q4UA 5FXRA 5FQDC 4CFMA 4R1YA 4CG8A 2PE1A 3EJ1A 3IW7A 4DHFA 4HVSA 2C3JA 2F2CB 2RGPA 4FSZA 3ALNA 1Q8ZA 2WTKC 4J7BA 4RBLA 3CTJA 4WNKA 5E92A 3R9HA 4RRVA 4GYIA 3ZUVA 4FJVA 4O27B 3WILA 5HICA 5CI7A 1XR1A 3ZU7A 3I0OA 3P08A 1ST0A 3QFVA 4YR8A 4EOPA 2UZEA 3V8WA 4AQKA 5KKRB 5AUZA 4F99A 5DR2A 4PMPA 2DQ7X 4FV1A 4KKGA 2IW9A 4MNFA 5AA8A 5E9EA 1PHKA 2B1PA 2WNTA 3CD3A 2YERA 4DF3A 3OCTA 4F63A 3A60A 4FTJA 1J1CA 2R3KA 3NDMA 3QKLA 2HYYA 3BGPA 3Q53A 3RKBA 4RZVA 4CVAA 2Y8OA 3PXQA 2NRYA 2X4ZA 3TUBA 4M14A 1DS5A 3DTCA 5DPVA 4QP8A 4QDEA 4HNIA 3VHKA 4BCIA 1G8JA 2C30A 5C03A 3KCFA 4M12A 4RZWA 3CBLA 3UVRA 2YWPA 3QD3A 2X7OA 3WIKA 1M14A 5CF4A 3F5GA 3GU4A 4BCMA 5CAUA 4O6EA 3W33A 4E6DA 5A4CA 3BYMA 4QTDA 5CEPA 5I9WA 2B55A 3LOKA 2VWUA 4BDCA 4HYUA 3UYSA 5JN2A 4KD1A 4QQJA 4U43A 2JD5A 4L52A 3THBA 4BVUA 2ETKA 5L2TA 4QMNA 4O84A 5CVFA 2XNPA 1MUOA 3AD6A 3C4WA 3E7VA 1W7HA 4PMSA 4XUFA 3TI1A 3MPTA 3ERKA 4ACDA 5A46A 2G2HA 4XH6A 2RFDA 3AQVA 3BHVA 2HENA 4AW5A 4MXYA 4LRKA 2HZ0A 3C51A 1FMOE 3PVWA 1XJDA 2XF0A 2NYAA 4TWOA 1BKXA 3PFYA 5KMKA 4AP7A 4YBKA 2IVSA 4DT9A 2H34A 3TXOA 2XIYA 4MNEA 2J9MA 4QQ5A 5LVMA 4LV8A 4YHTA 4OT6A 4DGNA 3HVCA 1W8CA 3DV3A 4EK3A 3HMMA 4BKZA 4FSUA 2C3LA 3PVGA 3LHJA 3OBGA 4CMOA 3K5UA 4DE4A 4DEDA 1W2DA 2WQOA 4X3FC 5J8IA 3EZRA 2YITA 5IDPA 3ORLA 5LVPA 5HI2A 3BBTB 4FKLA 4TYHA 4WT6A 4HVGA 2R3RA 3NW6A 1PMEA 3GU7A 4BHNA 5L6OA 3G9LX 3CY3A 4O7ZA 3DFCB 3QX4A 4OLIA 3KXGA 1KE6A 3QAME 4E1ZA 4RVLA 2H9VA 3COMA 4F1OA 3CC6A 2XS0A 4W4YA 3CKWA 1O9UA 1OBDA 3E8NA 4G6OA 3NIEA 5HU3A 3COKA 3BGZA 3VUIA 3P5JC 4WO5A 3UJGA 3FI3A 3TV6A 2XBAA 1KUTA 3ATSA 4P5ZA 1ZAOA 4ITIA 2IEWA 3O8UA 1PXJA 4N70A 3N4UA 4ANOA 4YJSA 4C8BA 4JBQA 5BMSA 1WBWA 4RJ3A 4YC8A 3RP9A 4AZVA 5CSPA 5JZJA 3GNIB 4YJNA 2VX0A 5KO1A 3HMPA 1A48A 4BTJA 3F82A 3U9CA 4DTKA 2G2IA 4UY9A 4FSQA 4NWMA 4AA5A 5I9VA 3FC1X 4BI2A 2PE2A 2QU5A 3WF7A 5E4HA 4DFZE 3IGOA 3LVPA 4C38A 4EBVA 2X6EA 4XP3A 4NM0A 5C1QB 5L8LA 2GU8A 1P14A 4F9AA 3BLRA 1OKVA 2ITYA 4O0YA 4Z7GA 2QKRA 4FX3A 3KC3A 4IZ7A 4OTGA 4CV9A 4O7YA 3LLAA 4WG4A 3F5PA 4LFIA 4JXFA 4GCJA 4UZHA 1KSWA 3C4EA 2R3JA 4U97A 3WF9A 2Y4IC 3FLNC 3WZUA 2ITPA 4ITJA 1XH5A 3UIBA 3PSBA 2XK6A 3VBXA 5DMZA 5KHXA 3GBZA 3MH2A 5C01A 4FG9A 3AKJA 4MX9A 4ZS4A 2C0IA 2ZYBA 5AV0A 4CD0A 4YP8A 4GIHA 4FT0A 4RIXB 5TF9A 1IASA 2OICA 2YN8A 5ETIA 4I6HA 3TIZA 1UWJA 5L6PA 3MFUA 4FK6A 4AF3A 3POZA 5HVKA 2W5BA 4XBRA 1XHAA 4OBOA 4BBMA 1J1BA 2R3LA 4F9YA 3VS7A 2BKKA 4FSWA 2GTMA 5TT7A 3E3PA 3VC4A 2JKKA 2X9FA 2VWXA 3QTZA 3D2KA 4M69A 3E63A 2R5TA 4S33A 3NW5A 5HORA 4ACMA 4ID7A 2PUUA 3G51A 3ZDIA 5HD4A 1OL7A 2WQNA 4ZTSA 3PWYA 5AUWA 3R9DA 3NEWA 4FI1A 3M11A 3E64A 4JNWA 4AE9A 3JXWA 4GYGA 1PF8A 5H2UA 3L9PA 1P4FA 3UO4A 2C6MA 5BVKA 1ZARA 3V04A 1QPEA 4DDGA 4NUSA 4CXAA 2QC6A 2BAQA 2JITA 1KOAA 2E9VA 2WXVA 3AT2A 3FI2A 2UZBA 3OEZA 3Q6UA 4FRFA 3KN6A 2XEYA 3T3UA 3P23A 2R3GA 5CT0A 4PRJA 2JFLA 4CEGA 3OXZA 2BRNA 3F2RA 5CVGA 3C0HA 3ZEPA 3OROA 5IQEA 1YKRA 4ZTNA 4TY1A 3OC1A 3R02A 4HCVA 4ZJVA 2ITUA 2YDKA 4TWPA 1YOJA 2ITZA 4QNAA 3GC0A 3OTVA 5EM7A 4N57A 5M53A 5IEYA 2JDTA 3RVGA 3VWAA 2XK8A 2GNFA 5IF1A 4G2FA 3FZRA 1YXVA 3KRJA 5BPYA 2WMAA 3GB2A 2OH4A 2G1TA 4GJ2A 4IADA 4R3CA 4XLIA 2PUNA 3P7AA 3MSSA 4OUCA 5KUPA 1H0WA 2VTIA 4ASZA 3SRVB 2EB3A 4QYGA 5E8ZA 1U5RA 4CFWA 1TKIA 4L45A 4OTWA 4YTFA 3ZM9A 3O51A 1T46A 2WMXA 3M2WA 4B8LA 4KABA 4TL0A 3UOJA 4APPA 4D1XA 3HRCA 3C1XA 3VHEA 3EKKA 3TN8A 1OPLA 4YO4A 5C8KA 2W7XA 1APME 2OI4X 2VNWA 4YTCA 2C5XA 1CSNA 2OIDA 4PPAA 4ERKA 4IHPA 2Z2WA 3DQWA 3QZFA 3BV3A 3R71A 4IAAA 4RJ5A 5CAOA 4NYEA 5M06A 2JLDA 4DGOA 2OIQA 1E9HA 2Y0AA 3POOA 4FK3A 3MTFA 4NZWB 4BJJB 1FOTA 1LUFA 4CV8A 1OL6A 4RJ6A 5AP1A 3RJCA 2JKQA 2XJ0A 1UNLA 5E8SA 3K2LA 4FG7A 5CVHA 2EXCX 4QMVA 5K5NA 5E7RA 3GFWA 4I6QA 4Q9ZA 2RG6A 2XKDA 3RPSA 1SMHA 4AOIA 3W32A 5JRSA 3GEQA 4ZY6A 3FE3A 4QYHA 3R0TA 3IG7A 2FSOX 2CN5A 2ZMCA 3LZBA 3BKBA 4FF8A 4FV0A 5D41A 1U54B 4FODA 2J2IB 5M4FA 2A27A 3RM6A 1Y6BA 4GIIA 3PZHA 4ZSAA 2C0TA 3AG9A 4P5QA 4QDVA 5EW8A 4YHFA 4M13A 4BB4A 3RPYA 3UDSA 2C6TA 2Q0NA 2BTRA 1MRUA 3T8OA 3FKLA 1UNGA 4L6QA 4LOOA 2YJRA 4JQ7A 5ANGA 3DXPA 3HP5A 3ODZX 3NNXA 4H1JA 5DRBA 3TNQB 2Q0BA 1BYGA 4JQ8A 3SV0A 3O8PA 3BGQA 4GFMA 5M07A 2QOQA 4AQCA 4F78A 2HCKA 2YEXA 3A4PA 5AWMA 4TXCA 3ORTA 3C7QA 2PVJA 5H8BA 4D4RA 4Z9LA 3EFJA 5M56A 4BYIA 2XA4A 2QLQA 5CY3A 2YLFA 5HHWA 3R6XA 3JVRA 2CJMA 4EK6A 3QYWA 3ORXA 2WTVA 2O3PA 3TDVA 1YHWA 3DT1A 1YXSA 2PZRA 4D9UA 4N6ZA 2PVKA 4QYFA 5DOSA 3UP7A 1E1XA 5EYDA 2REIA 3G0EA 2V55A 5J79A 3CGFA 3LJ2A 2HW7A 3V01A 5LWNA 3LKMA 3KRLA 5JFVA 3FMKA 3DK3A 4R8QA 3WZJA 2Q83A 3W2OA 4U79A 3PPKA 3DNEA 4YPSA 4W9WA 4FTOA 1I09A 3II5A 3JS2A 4WSQA 4DH5A 4O4EA 4B8MA 3FKNA 3RI1A 5JKGA 5M4IA 2CMWA 5AP5A 3TUDA 4J1RA 5FDXA 3DXQA 4KSPA 1LEZA 2O65A 4G31A 4O2ZA 3KFAA 4EOSA 4WBOA 2WZJA 2R2PA 1SYKA 4R5YA 2BAJA 2YIXA 3WYXA 1IA8A 3QZHA 1YQJA 2XK3A 3LCSA 3TMOA 3UC3A 4KS8A 4RX5A 3UBDA 3ZOSA 5AR2A 4DCEA 2HW6A 3TL8A 1SZMA 1BUHA 3Q3BA 3UYTA 1Q62A 3K5VA 5DEYA 3PY1A 4I23A 4TKSA 1ZLTA 1BI7A 1PMNA 1WCCA 5IG1A 5AFVA 2B52A 2XYUA 4JR7A 4IX4A 4II5A 4XS2A 4PMTA 3U4UA 3LMIA 2R0IA 3JPVA 3RBWA 5A4LA 4KUJA 1F3MC 4O4BB 5A4TA 4M66A 3R8VA 1X8BA 2XIKA 3RPVA 3I6UA 3W18A 3VONA 2JFMA 5KCVA 1ZWSA 4BCFA 5FDPA 2C6EA 2CGWA 2HXQA 2XNOA 3OW3A 4GH2A 2OLCA 4I0RA 2BUJA 4MXZA 4TPTA 1K3AA