5C26A

Crystal structure of syk in complex with compound 1
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
274
structure length
272
Chain Sequence
VYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase SYK
publication title Imidazotriazines: Spleen Tyrosine Kinase (Syk) Inhibitors Identified by Free-Energy Perturbation (FEP).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/inhibitor
total genus 93
structure length 272
sequence length 274
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 5c26A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 5c26A01
4ITIA 3ANQA 4EH3A 4RC2A 3RJCA 4C02A 4EYMA 3PVBA 3FHIA 5HLPA 3VN9A 3V01A 5AR3A 3KMWA 4H3PA 2HAKA 4IVDA 4ANBA 5CI6A 4XG4A 4RWLA 4IHPA 4BIDA 4NIFA 4MH7A 1GZOA 2HCKA 3NPCA 5D7AA 2P3GX 4LOQA 4KBCA 3L1SA 1P2AA 3CIKA 4FC0A 4QMNA 4I6HA 4BGQA 3F3UA 3DKOA 4AA5A 4A9UA 2BTRA 4DT9A 4UB7A 4ZJVA 4H1JA 2F49A 2PZYA 4U42A 3R1SA 3V6SA 3R00A 4FNYA 4BBEA 4FNXA 2WMSA 3RBWA 3ZEWA 4JDIA 3EQCA 4KRCA 3DTCA 1X8BA 3TNIA 4E5BA 4EOPA 4Y46A 2XZSA 3MA3A 4ZY6A 2VTHA 3HRCA 4DH3A 5HG5A 4IWOA 5FTQA 2E9OA 5CEQA 3ZUUA 4NM5A 3AMBA 3POZA 4FTNA 4NK9A 5HE1A 1PXIA 4B99A 3E87A 4KS7A 1DS5A 3SA0A 1H4LA 3DJ7A 3GNIB 3LJ1A 4BKJA 4I6FA 4JX7A 4EH8A 3QUDA 2PSQA 2XK7A 3C0GA 4G17A 3MJ1A 4KBAA 2HXQA 4N6YA 1BI7A 3D4QA 5HI2A 3T9TA 2BALA 2FYSA 3OY3A 3QTUA 4QYFA 3KK9A 3V04A 4ENYA 5BYLA 3AT3A 4JRNA 2IWIA 2WTDA 4U79A 2B1PA 4QMWA 1HOWA 2B9HA 3ZCLA 5J9ZA 5EM5A 4AQCA 3DDQA 2FSTX 3GU6A 2BRMA 4FT3A 4O0WA 1KE9A 4O2ZA 2YM4A 3ENHA 3QX2A 5DOSA 4D2TA 1NVRA 2VGPA 3FI4A 4NKSA 4M97A 3ZLXA 2VGOA 1W83A 3KCKA 3Q3BA 2E2BA 3VRYA 2RG5A 3GQLA 2XKCA 1OKWA 4R3CA 3TV4A 3H10A 3ZRMA 5IDPA 4OTFA 4F7SA 1U46A 3MH1A 2J5EA 1Y6BA 4RZVA 4YTFA 3VNTA 2YAKA 1FGIA 3GCVA 3O7LB 4H36A 2IW8A 2QKRA 3K3IA 4KSQA 1UKHA 4F70A 2R0IA 1VEBA 3Q52A 5AEPA 2DUVA 3E3PA 3Q04A 1Q62A 2WTCA 1G8SA 4IAAA 3WIGA 4WKQA 2NO3A 1O6KA 1R3CA 4OTGA 5DR2A 1BL6A 5HNIX 3DNDA 5AUYA 3L9LA 3EN5A 5BUEA 4JBOA 2G9XA 1PW2A 2NP8A 2PU8A 2V55A 3K5VA 1GIIA 3LCOA 3D15A 4HZRA 4ZLYA 4FR4A 4HGSA 4MCVA 4GL9A 5IA4A 3QX4A 2WU7A 4FTTA 4LRMA 4EBWA 3BV3A 3K5UA 4ENXA 4X3FB 1SZMA 3ZRLA 4I94A 3SRVB 3DKFA 2J0MB 2PWLA 1OL5A 1ZZLA 2GNHA 2PVJA 3EKNA 3MH0A 4HVDA 3FV8A 1E1XA 2WPAA 3PTGA 4I0TA 2HY0A 4NJ3A 3UZTA 1OPJA 3E3BX 1Y57A 1UV5A 2W9ZB 3HLLA 3WI6A 4HW7A 5HTCA 4JG6A 3NNXA 4V0GA 1M7QA 2YJSA 4QPAA 4EONA 5EYMA 5A4CA 4D0WA 3G90X 4F64A 1IR3A 2O65A 3R0TA 5AA8A 3ZC6A 4EZ5A 3PXFA 3OXTA 4WRGA 4D0XA 4FGRA 1E9HA 5CVHA 5LVMA 2Y8OA 4QP2A 3ZUVA 4FG9A 1JSUA 5HESA 5LQFA 3EH9A 3GB2A 3QRIA 4BBFA 2QKWB 5C4LA 3LZBA 2ZJWA 4KRDA 5HGIA 4JBPA 3LFFA 4NM3A 1R39A 4M3QA 2BRHA 5ANOA 5A3XA 3A7GA 3QUEA 4XBRA 4IFGA 3H4JA 3ULZA 2OFVA 3AT2A 3DOGA 1Q61A 2QU5A 4L3PA 4O0RA 2VUWA 3DZQA 4QQJA 1OBGA 2CLQA 2FH9A 4O27B 3W10A 1QL6A 1YXUA 2GHLA 3AD6A 4FK3A 3TCPA 3W8LA 3BU5A 4BCQA 4RFYA 5DR9A 4JBVA 2GNLA 4M0ZA 2RKUA 2F7XE 3NCGA 2WB8A 3CEKA 5KNJA 3TKHA 4FIGA 2R7IA 4YNEA 2W06A 3ZZWA 1JKLA 2C3JA 2FUMA 2PE2A 2OI4X 2YCQA 3A8WA 3OY1A 3PRIA 4V05A 5CVFA 3FZ1A 4RX8A 4BDKA 2GNGA 2BRGA 4C3FA 4CRSA 4GYIA 5HO6A 1Q24A 2WGJA 3SVVA 3D5XA 5FXRA 3R21A 3IKAA 3C7QA 5M57A 4BCIA 5DN3A 3JVRA 3Q60A 4DFLA 3G9LX 1Y6AA 4I22A 3K2LA 4D28A 3R8VA 4R3PA 3UP7A 3Q4TA 2BKZA 4B7TA 4PDYA 2B54A 4IZ7A 4F7JA 4C2VA 3NWWA 3HMPA 4RA4A 4F6WA 1JLUE 3VF9A 4E4XA 3RALA 4U81A 1MQBA 3QGYA 1FOTA 3HGKA 3GCQA 2XRUA 3QQLA 2VTQA 5I3OA 2OLCA 4B8LA 3QL8A 4RJ6A 4E7WA 3AG9A 4L9IA 2JIIA 1ZYSA 2VZ6A 5GJFA 3NAXA 5BUIA 2YISA 4YTHA 3VS3A 2VTNA 3SOCA 4IE9A 4HPTE 2FSMX 4ZS0A 3MFTA 5EFQA 1VYWA 3G6GA 5T68A 5EI8A 5C1QB 4ONAA 3TIYA 4CLIA 5AP6A 3TZ9A 1BMKA 3BHYA 4BF2A 4QMYA 3SAYA 4AT3A 3MWUA 4A7CA 3EIDA 4BI0A 4FG8A 4TT7A 4ZZOA 5AUTA 1OKZA 3U6HA 3CGOA 4O7NA 3WF6A 4IM0A 3DKGA 3BQRA 2C0OA 3VW6A 5ANEA 2QOOA 3E64A 4AT5A 5F4NA 4ZJIA 4TYJA 5AFVA 1P4FA 1T45A 3CLYA 3L9PA 4DH8A 2JBOA 3FMMA 5HO8A 5CF6A 2QR8A 3CQWA 1UKIA 4W4VA 2B9IA 3E7OA 2XM9A 3NZ0A 4JI9A 3SHEA 3FQHA 4KS8A 2YM7A 3RCDA 4GEOA 3QD2B 4R78A 3UZRA 5JRQA 2X39A 4HPUE 5A6OA 2WMUA 3D5VA 3Q5ZA 4D2SA 3VAPA 2CPKE 3MY1A 4DEDA 4EK4A 5FTGA 3BHTA 4L3JA 1H1WA 3I79A 4QP3A 4GUEA 1QPCA 4XLVA 4CMTA 5D12A 4EEVA 1GZKA 4G16A 3EN6A 5LVNA 4Y8DA 4G31A 4GW8A 4MNEB 3ODYX 4GJ2A 4U5JA 3QBNA 3ZFMA 2BRNA 3OP5A 1CTPE 4GK4A 4OTPA 3EOCA 2WQBA 5IQDA 1OPLA 2HXLA 4NH1A 2O8YA 2I40A 3QKLA 4BHNA 3S3IA 4EL9A 4HVGA 4U43A 2IVTA 4ITHA 3QQJA 3TDVA 5LWNA 1MRUA 1UNHA 1JNKA 3ZO2A 1R78A 4E4MA 4EI4A 4KIKB 4ERWA 3COKA 5IQCA 3BYMA 3CC6A 3COHA 4BCKA 4BZNA 5JN2A 5IA0A 3W2SA 3OCGA 4I4FA 5ETAA 3QQUA 3FI8A 5HE0A 3IW8A 2WNTA 4FF8A 5TE0A 1J7UA 4YZ9A 5EYCA 1ZLTA 4TWCA 2W4KA 3ZBXA 4QMZA 4FZ7A 4PNKA 2R0UA 3NVKI 3PA3A 4NSTA 3OFMA 1BYGA 2C68A 3BZ3A 2YN8A 4M15A 2VWBA 2PY3A 5GJDA 3UO4A 2LGCA 1FBNA 1J1CA 3F82A 3KRJA 1FQ1B 3A7JA 3D9VA 3PJ2A 3TKUA 3ZSGA 1FMKA 5KBRA 2XK4A 3EHAA 4JR7A 3BE2A 4Z3VA 5AA9A 3F66A 3MIAA 3R6XA 3WF9A 3NVMB 4XG6A 5DRBA 3UNZA 3OBJA 3PE1A 3PE2A 3CD8A 4DTKA 4NFMA 4CV9A 2BZKB 2VO6A 5EW9A 2BVAA 3D0EA 4ZTNA 5K3YA 5KZ0A 5GIPE 4XG2A 3SXFA 1H1PA 2ERKA 2QOLA 2LAVA 3QA0A 2QOHA 3BGPA 2R4BA 4OT5A 3SV0A 2HY81 3BHHA 5AIKA 5IMEA 5LWMA 2VX1A 3AC2A 3MY5A 2W5AA 2WU6A 3VJNA 4LMUA 4OTDA 3PY1A 4D9TA 4RFZA 5BVFA 4RMZA 5HLWA 1ZARA 4WA9A 1CSNA 3IQ7A 3E5AA 3ZM4A 5J7BA 4IBMA 1KE6A 3G15A 3ZMMA 4EK6A 1KOBA 4XX9A 3E8NA 3AC1A 4RLLA 5LMBA 1RDQE 4EOQA 1DI8A 3UIXA 3FHRA 3OBGA 3JS2A 4FZDB 4RA5A 4TPTA 5HVKA 5CQWA 2NRYA 2V5QA 1ZMWA 4FL3A 1Q41A 4RIWA 3U4WA 4AAAA 4RVLA 5M08A 4M8TA 3AT4A 3KN6A 4NTTA 4AW5A 2NNWB 4G5PA 4FV1A 2QD9A 4TYIA 3PPZA 2PVYA 3HZTA 4FIEA 3QTIA 3PIZA 4KINA 1Q99A 1RE8A 2J0LA 1YWNA 4FT0A 4D5HA 2CNQA 1A06A 3BEAA 4ASXA 5AX3A 2XK6A 3R9HA 1S9JA 2GNJA 3OW3A 3CSVA 4JXFA 2CNUA 3F7WA 2J7TA 2GQGA 5AUZA 3VUTA 4FYNA 4WT6A 2BAJA 4TYGA 5H3QA 4ANLA 4U41A 2CGVA 3KVWA 4NCTA 3DY7A 2OZOA 1YI3A 4G6OA 3OHTA 5L8KA 4FSNA 4DE4A 2WIPA 3HV5A 5HBJA 1MUOA 2AYPA 1G3NA 1UNLA 3EL8A 3KRWA 2VTOA 4MQ2A 4YC8A 3ZU7A 4LGHA 4ACDA 3SLSA 3KMMA 3TDWA 2BZJA 1PY5A 1MQ4A 4IB1A 4YU2A 4X2NA 4DEBA 4R7BA 5JEBA 2EB2A 2SRCA 1XH4A 4FKVA 3SQQA 1W98A 4CCBA 2X2KA 1AD5A 3FSKA 1U54A 1URCA 3R7OA 5KMMA 2X6EA 4YR8A 3JR1A 3V8WA 3IOPA 2EXCX 4RJ7A 3L8VA 4FZAB 3WZDA 2QOIA 3FI2A 3MFRA 2RGPA 4BYJA 4XBUA 4RJ4A 2J5FA 1LP4A 4RWIA 5D41A 3R8LA 5C26A 2ITTA 1Q4LA 2BZIB 4B8MA 3QWJA 4MVFA 5A9UA 4YTIA 2PYWA 3Q4UA 5L4QA 2P2IA 4MWIA 3QRTA 3Q2JA 3NNWA 3KQ7A 5IU2A 2ITZA 3HP2A 4LL5A 5BVEA 1OIRA 3AC3A 3V8TA 3UQFA 4X2JA 1Q8WA 3Q9XA 2Y4IC 1PHKA 2R3RA 3UYTA 2C30A 5M09A 4PMMA 3MFSA 4YC3A 5DNRA 4NM7A 3BX5A 1LEZA 1DM2A 1W7HA 2QU6A 2XUUA 4YC6A 2VN9A 1CM8A 3I60A 5CNOA 3ZUTA 5IH5A 5KHXA 2C6IA 1XH8A 1SMHA 1ATPE 5AP7A 3IW6A 4TY1A 2YIRA 4FSYA 2J0KA 4YZBA 2WZJA 3FMLA 2JD5A 4XOZA 3ZM9A 3GI3A 4ZSGA 3QYZA 4MXXA 5DIAA 4GT3A 2ITUA 3R73A 3UIUA 4MF0A 4K33A 2HZ4A 1OIUA 2GS2A 4MD9E 2ONLA 4TNDA 2X8DA 2CKPA 4ANNA 4RQKA 5C9CA 2XBJA 5EW3A 2VTJA 2WTWA 2OIDA 3OTVA 3W2CA 4WNPA 3UP2A 3R9NA 1XJDA 5I5ZA 3MESA 4CG9A 2XBAA 4HOKA 4CMUA 5HQ0A 4DTAA 4AZWA 3AD4A 4I4EA 5EG3A 2QCSA 3RI1A 3IW5A 3C9WA 5CSPA 4AW1A 3P86A 5I4NA 3RTPA 4M68A 4FZ6A 3OT3A 3QGWA 4EWQA 4MXOA 3QZIA 4K8AA 2VTTA 2E9NA 2R3GA 1UU7A 1W82A 5IEYA 2W1DA 2JDRA 4YMJA 5AV2A 3C50A 5B0XA 3LJ2A 3U8WA 3KRRA 5IDNA 2ITYA 2JKKA 2WTJA 3PVUA 3QRKA 3GCUA 3O17A 5HBEA 1L8TA 5HCYA 1DAYA 4RIYB 5AP5A 5EH0A 4BGGA 4QQTA 2PL0A 5KMNA 1J91A 2OWBA 5HCXA 3DAEA 4FOBA 4IX3A 4KABA 4DN5A 5J9YA 4APPA 5CQUA 3FPQA 5L8LA 4FIIA 2GCDA 1H28A 3UO5A 4FSWA 4YNOA 2UW7A 4Z7HA 3CBLA 4FYOA 1OKVA 3F61A 3MVLA 4UEUA 4D5KA 3KXGA 4D58A 5LOHA 4U44A 2H34A 4G6NA 5JGBA 5DT4A 2VTAA 4EK5A 4K1BA 2OICA 4G6LA 2C5VA 1YI6A 2WFYA 4YLLA 3OW4A 4GFOA 3I4BA 1H1QA 2OZAB 3NNUA 5HTIA 3R7YA 5FD2A 5EI6A 3NUYA 3E8DA 3OUKA 3SW4A 4E20A 2WMRA 3QU0A 4II5A 4MXYA 4JDHA 3WZUA 1AQ1A 1TQPA 2R64A 4QMVA 5CASA 3DJ6A 1U5RA 3GU5A 4UYAA 5FXSA 1SVGA 4MNFA 2I0VA 3Q9YA 2OIBA 3NUAA 2W1HA 1Y91A 4PP7A 3DZOA 3O51A 5HTBA 1V0PA 1QCFA 4JQ8A 3OCTA 2C0TA 3H9OA 5CENA 5H9BA 3QFVA 2OH0E 2F2CB 2QC6A 3CD3A 3O71A 4MKCA 5M56A 4F08A 3FLQA 5IG1A 3NUUA 2QONA 2ESMA 2QO9A 3CGFA 4UWCA 2XIZA 1PMEA 2V0DA 3F5GA 4IM3A 4QO9A 3ATTA 1I09A 3FY0A 4CEGA 4ZP5A 2J9MA 4FTJA 1J1BA 3DK6A 4O83A 4FEXA 4D4VA 3F5XA 2VD5A 2W5HA 3P7AA 3ID6C 3UE4A 1GZ8A 3W55A 3ETAA 2WMBA 4GJ3A 4XRJA 3ZLWA 2EXMA 5HD4A 5AAFA 4C59A 1SM2A 4DGGA 3CQEA 3DXQA 1SYKA 4UZDA 4DFZE 3THBA 3I5NA 1ZOHA 4UV0A 3A8XA 4E4LA 5FQDC 4FKRA 3KC3A 1UU8A 3MTLA 4RC3A 1WAKA 3KULB 4M66A 4X3FA 4F99A 4PTEA 5CU3A 4KNBA 4C4JA 2WMQA 3SRVA 3TT0A 3F3WA 3DU8A 4P2KA 4RBLA 3UG1A 3DGKA 3W18A 5C27A 5GNKA 3ORKA 4KIPA 3EZVA 4AE9A 4B6LA 4F0IA 3LQ5A 3FC2A 3PWDA 4BDCA 4TKSA 5K9IA 2W1ZA 4M69B 4BWPA 2A0CX 4J96A 2PTKA 5DHJA 2HIWA 4L44A 3QLGA 4JBQA 4ZY4A 5I9UA 3D14A 2RF9A 3UODA 2BDJA 4LFIA 5DBXA 4FIFA 4LOPA 4DA5A 5AR2A 4ANSA 4QPMA 4TZRA 4I5HA 4KKGA 3DB8A 4X2GA 5E92A 4UMPA 1LPUA 4IZAA 3N9XA 3HRFA 4IJPA 3BLHA 3MPMA 1E1VA 3TNWA 3UZPA 3BQCA 5GZ8A 4YBJA 2BZHB 4GG7A 4CQEA 4E3CA 4H05A 1OGUA 4UYNA 1NW1A 3TXOA 3JYAA 2XNOA 2Z7LA 4FV7A 2QODA 4J7BA 2C0IA 1OUKA 3ORXA 4JT3A 3W16A 4KIOA 2I0EA 2HZ0A 3B2TA 1QPJA 1GAGA 4ZLOA 3NUSA 5AAEA 1OIQA 4S34A 4U80A 5AMNA 3AXWA 3RKBA 3AMAA 3F5UA 5FLFA 1YDRE 3VS4A 3C51A 3QQGA 3ZS5A 2X4FA 1IEPA 3FE3A 4NFNA 4K18A 5DE2A 2QO2A 4G3GA 3TTIA 3HV4A 1NVSA 5AR7A 3UVRA 1ZOEA 5HZNA 3AGMA 4DH5A 5IA5A 3D94A 3FZSA 3MB7A 4BDIA 4E6QA 3NR9A 4QTDA 4WO5A 5CAVA 5C4KA 4GH2A 4AN9A 4PMTA 4E5WA 3UOJA 4BCNA 1G8AA 3PXZA 1CDKA 1LUFA 1ZZ2A 3QTRA 4IB5A 4BGHA 3NGAA 1YWVA 2JDSA 3BEGA 1SNUA 2WQMA 3OWLA 4FVQA 2Y4IB 2WO6A 5CAQA 2XB7A 4DEAA 4CFXA 3HV7A 2PHKA 2W1FA 4ZTSA 4H58A 1KSWA 2GFSA 3D5UA 4AZVA 3T8OA 4G5JA 4FKSA 4WNOA 2G2FA 4L43A 1P14A 2WQOA 3FC1X 1PXMA 2ZV2A 3DTWA 5E91A 3RK9A 3RPVA 3TTJA 4A9SA 4AN2A 3GCPA 4CYIA 1R0EA 3ORTA 2R3IA 4QQCA 4P5ZA 4GKIA 2NRUA 5E8YA 5AX9A 2PULA 3EQDA 3BV2A 4HGEA 2IVVA 3UDBA 3UIBA 3RCJA 2W0JA 5HIEA 3EQFA 4FBXA 4XCUA 3SG9A 3MS9A 1H08A 3II5A 2ITWA 4RZWA 4BBMA 4CZTA 4TYHB 1F0QA 5HKMA 2JAMA 4AZSA 2PK9A 4I3ZA 4LUEA 2C6DA 5CF5A 3QRJA 5M4UA 4YJOA 4PDSA 4I93A 5DEYA 3JUHA 3I0QA 4LGGA 1Q8ZA 3PPKA 3F7ZA 2A4LA 4EOJA 3FLWA 5AR5A 1PKGA 2X0GA 1YI4A 4Y73A 4EHEA 4HYUA 3NIEA 2X7OA 1TVOA 5CX9A 5GINE 5KX8A 1B38A 4O1OA 5EKOA 3G5DA 3V5PA 3H3CA 4FV3A 4JG8A 3TNQB 3A61A 3GC0A 4GYGA 4EHGA 1CKPA 4WG5A 3FQEA 5HBHA 5JQ5A 3OT8A 4HGTA 4IADA 2R2PA 3FSFA 3IECA 3A2CA 2YM3A 4NKAA 3GFWA 1REKA 4WHZA 3PJ3A 2XKDA 2C5XA 3FZPA 4O0VA 4ARKA 3QQKA 2WMAA 3FXZA 3SD0A 1XH9A 5JSMA 1G5SA 1TQIA 4FSMA 2PUIA 3NDMA 4XV9A 4BDBA 2X8IA 4UMTA 2UZVA 5D1JA 3FY2A 3D2IA 5HNGA 4MNEA 4ZS4A 2YM5A 4WD5A 5CI7A 5ANIA 3RAKA 5DT3A 5E8WA 3TWJA 1ND4A 2X7GA 5AV1A 1JKSA 4LRJA 4O91A 5J5TA 2Y9QA 3UMWA 2VTSA 5IQHA 4NEUA 3PXQA 5AAGA 3BHVA 5T6KA 4CKRA 3PXRA 5C8KA 4CGAA 2ZB1A 4IC7A 3ZLSA 4DTBA 4X7QA 3GU8A 4OTIA 4PRJA 3PXYA 4KIKA 3DPKA 4G9CA 3PFQA 4QMXA 4FT7A 3TZ8A 3IONA 3RK5A 3VUGA 1NXKA 4MXAA 4UZHA 4EKKA 4HVIA 4BZDA 4XG8A 3LFDA 4E6AA 5AP4A 5CU6A 4YHJA 2YLEA 4GUBA 2YCSA 3BYSA 2X81A 3WE4A 5GZ9A 1YKRA 4CFVA 2BCJA 2I6LA 4J52A 4BCGA 4PL5A 3QYWA 4IZYA 3DQXA 5AM6A 3MBLA 4AXAA 2ZB0A 4YLJA 2F57A 4F6UA 4V04A 3LFEA 5E8SA 5JKGA 3FMNA 4YLKA 2Y0AA 3CTJA 4GV1A 4RWKA 3RPRA 3HUCA 4YJVA 3TL8A 1YOMA 3G0FA 2VWUA 2QI8A 3QUPA 3RINA 4E4NA 4FTKA 1MP8A 5FDXA 4XP2A 2IZSA 4O0TA 1P4OA 4RIXB 2WXVA 4IVBA 4EOLA 3I6UA 4EKLA 4EQMA 4ZTLA 3W2OA 2WELA 1OL6A 3D7ZA 3BYOA 2CGUA 4XG9A 3COMA 4APCA 4D1XA 4JX3A 4O7RA 4O6EA 3P1AA 3EQPA 2OW3A 4DHFA 5AR4A 3DLSA 3PRFA 1Q8YA 4ACCA 4Q9SA 4D2WA 1GNGA 4FSRA 4EJNA 3KXXA 1U5QA 4BWXA 4WOVA 3MPAA 5KMIA 4HCTA 1BX6A 4FTOA 2FGIA 3F2RA 3EQHA 3NYVA 3OD6X 4O7VA 4FV5A 3CPCA 1PMVA 4FEWA 4U9AA 2O5KA 1URWA 3CKXA 2XNMA 4DLIA 2B53A 3E62A 4ERKA 4J97A 3ZZEA 4AGDA 2CGWA 4JL9A 2O0UA 1GZNA 2BDFA 2Z8CA 3AD5A 4PP9A 4YO6A 4ZJJA 3PY0A 2H6DA 2W99B 1FVTA 4EZ3A 3QAME 1H1RA 2WQEA 4KKEA 5J87A 5BX0A 3ENMA 3W2QA 4EUTA 2C3LA 4OBPA 3W32A 4W8EA 3BKBA 5H2UA 4OW8A 5C03A 3UNJA 2FVDA 5HG9A 4C4HA 4GKHA 3VVHA 2RIOA 3E88A 3FAAA 2UVXA 3HYHA 4E1ZA 2PMIA 4HJOA 4GCJA 3KA0A 3CXWA 3QXPA 2A2AA 2HWPA 1XH5A 3VO3A 4FKTA 2IN6A 4ASEA 3C4CA 5AWMA 4E93A 3W33A 3FXXA 3R2YA 2W7XA 3UC3A 3TM0A 1JKKA 2R3HA 1PMNA 4UY9A 4WBOA 5KZIA 3VRZA 1TKIA 4BCPA 3QTQA 5CEOA 3I1AA 4IEBA 4CFNA 2EVAA 4FL2A 5HOAA 1H8FA 3GBZA 3MI9A 4QP4A 4BWKA 4JDJA 5DGZA 2A27A 4C61A 4UMQA 5GHVA 1XWSA 2X9EA 1YOLA 3Q4CA 1ZYDA 2W1CA 3NX8A 4I24A 4FTIA 3EZRA 4R6VA 3ZFXA 2B9JA 4YJNA 4BCOA 2GTNA 3U54A 3ZEPA 3OEFX 4BC6A 2W1GA 4X0MA 4A4LA 4I5CA 4QYHA 3BE9A 3NW7A 5TT7A 4NIFB 2X9FA 5F1ZA 3VHKA 4YTCA 3UBDA 1WBOA 3FYJX 2ZMDA 3WF8A 4BZOA 2C3IB 3CKWA 5IEXA 2VNYA 2VWIA 5IEVA 2V7OA 4RJ5A 2Y6OA 1APME 4F1TA 2IZUA 1V0BA 2XF0A 3UTOA 1K2PA 1XBCA 1IG1A 4IB3A 5IKWA 1XBBA 5D9HA 4ALWA 3BLRA 4QP1A 3A7FA 2WMXA 4QMSA 5HO7A 4I5PA 3NS9A 5AM7A 3M42A 2UZDA 3R63A 4WBBB 2XH5A 4BDGA 2CSNA 3F6XA 1Z5MA 4F7LA 3HAMA 3MYGA 5HU9A 4RVKA 5CNNA 3QCQA 3BHUA 1OM1A 3QCSA 3QTXA 2ZYBA 3CS9A 4FICA 2VTLA 3BWJA 2C6LA 3ELJA 3GEQA 4TXCA 4IAZA 3VULA 5CTPA 3UQGA 4ZTHA 3FKNA 5DPVA 2XCKA 3BYVA 5HVJA 4FKPA 2BUJA 2REIA 3KXHA 4M14A 2EU9A 2BRBA 3QZFA 3VW8A 3QQHA 3DXPA 4IVCA 4ZAUA 4AA0A 4YZMA 3PSDA 3R8MA 2DS1A 4ZTQA 3LMIA 1OZ1A 2ZV8A 1WBVA 2HENA 4XYFA 5KMLA 2GHGA 4U0IA 5HCZA 5LMKC 4C4EA 5M55A 5AR8A 4KSPA 5CEKA 2YDJA 5K0KA 2ZAZA 2CKEA 4G1WA 5I9ZA 3F2AA 3EN4A 3UVQA 3C5UA 5EM8A 3BBWA 4UXQA 4N57A 4X2FA 4BDDA 4A06A 3HV6A 4CVAA 1IA9A 3PDTA 4RRVA 3G9NA 2OSCA 5E90A 4XJ0A 2JIVA 3KF7A 2YAAA 2OJGA 3BU6A 5M4IA 5M51A 4GK2A 1PYEA 2B7AA 3C4FA 1OI9A 3D5WA 3OF0A 3ORLA 3QHWA 4ZZMA 3KCFA 4AOIA 2OFUA 5LMAA 5CEPA 2QHMA 1I44A 5M07A 3PUPA 2R3LA 4TL0A 5HICA 1KWPA 2OXDA 2YLFA 4Y83A 4JQ7A 4RIYA 1YOJA 1YXTA 2PVFA 3D2KA 4D2VA 4HVSA 3DT1A 2XIYA 3QXOA 3OMVA 3DB6A 3IS5A 4JVGA 5IUGA 4I21A 4AN3A 2PMLX 4RX7A 2CNVA 4CNHA 5EKNA 3TUDA 3NUNA 5AP2A 4ASZA 1A48A 3RAHA 3O23A 4IW0A 2WKMA 4GU6A 4IM2A 4N0SA 4S30A 4EH9A 5BUJA 4FGBA 2OZAA 3PZHA 3W8QA 4U8ZA 2YWPA 4L67A 3LM0A 3VS7A 4R3RA 3Q4ZA 4C38A 1KUTA 3F3ZA 1WVWA 5L6WL 3Q53A 4C33A 5I9VA 3VS0A 3FZTA 2CGXA 3DK3A 4RSSA 1RW8A 3TKIA 5CS6A 2R3OA 4AG8A 4K77A 5D10A 3I5ZA 3GUBA 5AV3A 2IO6A 1IAHA 3R7UA 4YZDA 3ZO1A 4IQ6A 5E8UA 3RZBA 4E5AX 1IA8A 1H07A 2EWAA 3ALOA 4D4RA 2ITXA 4CKJA 1KV1A 2I0HA 3LW0A 4G3DA 4YP8A 5I3RA 4F1MA 2W17A 4XS2A 3FPMA 2V22A 3S2PA 2JFLA 2J0JA 4JNWA 1UU3A 5KO1A 1PXPA 2XJ2A 4R1YA 4QRCA 3MDYA 4DEGA 5ACBC 5AP1A 2PVMA 5IH4A 2QR7A 3M2WA 2PZRA 4FOCA 5HE2A 4I23A 3GVUA 4YSMA 4JAIA 2FSOX 2PMNX 3HMMA 3OXZA 3NW5A 3K3JA 3V5WA 3WZEA 3H0YA 2EUFB 2J90A 1YXSA 1JAMA 3IO7A 2G2IA 5IUIA 4IX5A 4R5YA 5HIBA 1LEWA 2B52A 4A9TA 2ZMCA 5CXZA 4OTWA 3EFWA 3O0GA 2O2UA 4A9RA 3SXRA 4ZTRA 4F9YA 2UUEA 4PDOA 4BDAA 4YJTA 3KULA 3OROA 1Z9XA 2WMWA 4I92A 4CD0A 4EUUA 1M52A 3GC7A 4M12A 3PJ1A 2YERA 3ZO4A 2UZNA 4O21A 2BAQA 4WUNA 2UZOA 4YJRA 2ITVA 4FNWA 4M69A 3QQFA 4QYEA 2EXEA 1GIHA 3Q6WA 4FTRA 2HELA 3CY3A 1GJOA 3OEZA 3QALE 4W9WA 3LFCA 4ITJA 5ANDA 4ZLZA 4F4PA 4E6DA 4RVTA 5AV4A 2C6OA 4NW5A 2YA9A 4UMUA 5CAPA 4IWDA 5L2WA 4DBXA 2H96A 4FVRA 3VS2A 5LVOA 3E8CA 3EQRA 5HLNA 4QTAA 3C4XA 1VR2A 1OL2A 4LRKA 2F7ZE 4CT1A 2R7BA 4TTHB 4RGJA 2YWVA 4DH1A 5IA2A 4EHZA 2G15A 3PA4A 2XP2A 3HKOA 4FKLA 3R01A 3SC1A 3GOKA 5LCKA 4EJ7A 1PYXA 2CMWA 3GENA 5DH3A 4QP6A 4UBAA 5L2IA 4L3LA 2PE1A 4RT7A 5HX8A 2XJ1A 5CSHA 2RFEA 5HVYA 1XHAA 1Y8YA 4J98A 5E1SA 4YJQA 4ASDA 3IDCA 3JVSA 4QOXA 4WSQA 3ZXZA 4DFXE 3E93A 2AC5A 1OL7A 1IRKA 2I0YA 4CT2A 3FLNC 1UNGA 2GQRA 5JFVA 1BLXA 1UWHA 1M14A 2W05A 3DCVA 4C4GA 4PX6A 4R1VA 4X6RA 4CTCA 2W4JA 3GCSA 3LFNA 3RMFA 3U6JA 1XBAA 1U59A 4KBKA 2NPQA 2YIWA 5AV0A 3MTFA 3FLZA 1SVHA 1MRYA 4BB4A 3TUBA 4IH8A 5E8XA 1H26A 3BLQA 3RNYA 4GIIA 3LMGA 3KKVA 3HNGA 5CU0A 3LVPA 4L00A 3U55A 2QOBA 3P7CA 3VBYA 2PPQA 5TOZA 4GT5A 4QT1A 2WMVA 2PUUA 2A1AB 4JLCA 5HIDA 4F7NA 2C5NA 4MX9A 4C36A 4CLJA 1XQZA 4CSVA 5E1EA 1ZAOA 4R7HA 4C0TA 2WAJA 3ORIA 4E8AA 5JT2A 3HMOA 4O6LA 3E63A 2J6MA 4BI2A 3NLBA 1PMUA 4CRLA 4C4FA 4O7SA 2WMTA 4TWNA 4L68A 5E8TA 5FEQA 4I1ZA 2EB3A 3FI3A 5K5XA 2GFCA 3D7TB 3NYOA 5HD7A 3CCNA 4BVUA 4UWBA 1ZOGA 3F3VA 3IOKA 4TYHA 3HRBA 4DGNA 4XV2A 4O7LA 2C1BA 2JGZA 4FVPA 4FKJA 4BFMA 3P23A 2IW6A 1KOAA 5DT0A 3NRMA 3LE6A 3P79A 4N4SA 4L53A 2R3JA 1AGWA 1Q5KA 3R1QA 3CPBA 5GIOE 4YUQA 2BFXA 4K11A 3KEXA 1OITA 3NUXA 3O8UA 4EC9A 3QKKA 3TV7A 3DK7A 3FLSA 1PKDA 2A19B 1VYZA 5FXQA 3QHRA 4YBKA 5FEEA 4IXPA 3MJ2A 2R3FA 3WIKA 2IPXA 3BWFA 4FODA 3RNIA 4YJUA 4NJDA 5DMZA 2R5TA 1RJBA 2WTVA 3I0OA 3MIYA 5FDPA 4WG4A 4Y72A 2IVSA 5D11A 4FTCA 3AC8A 1WZYA 4A4OA 4D1SA 1JOWB 1UU9A 1A9UA 4I41A 3QZGA 3N4VA 2ZDTA 3M1SA 4MF1A 2BIKB 5CSVA 5M44A 2GNFA 4O7TA 5H8BA 1DAWA 4AP7A 4P7EA 3R2BA 2XNBA 5JZNA 4C62A 5JFSA 2OO8X 1H25A 4S32A 4HYIA 4IIRA 4MYGA 1WMKA 3OWPA 4QMMA 3WYYA 5ETFA 3LFAA 2DQ7X 3LCKA 5EQYA 3C5IA 5TO8A 2CJMA 3NNVA 3I7BA 3VHEA 3WOWA 3Q5IA 4LV8A 2Q0BA 3QC9A 3LXLA 4C7TA 5C8MA 4S31A 2H8HA 5GJGA 3UPZA 3JPVA 1OKYA 4NM0A 5AUUA 5I9XA 5DR6A 2R3QA 4AW2A 1IAJA 3R22A 4MTAA 1R0PA 2QOFA 2WOUA 4O2PA 3VS5A 3F69A 2CCIA 4PMSA 1RQQA 2ITNA 2PZPA 3PSCA 4FSZA 3V6RA 2PUPA 3ERKA 3G0EA 3LCDA 3OZ6A 1WBTA 2QO7A 4XV3A 4ZEGA 2O64A 4UMRA 5A4LA 5BVDA 1CKIA 3H9FA 1XR1A 4FKWA 1M2QA 2YCRA 5DRDA 2ITQA 2VX3A 3POOA 2WTKC 5K0XA 2I7QA 5AIRA 2IW9A 4ID7A 3O7LD 3MVJA 5GZAA 5AP0A 3FZOA 3LQ8A 4L01A 4X2KA 4BHZA 4RFMA 1S9IA 2GPHA 3FMHA 1W8CA 4LYNA 3B8QA 4ANQA 2B55A 2XVDA 3IDBA 1YHWA 5KE0A 5BVOA 2WEVA 4U6RA 2GU8A 2I1MA 2ITOA 3N51A 5FUTA 4KKHA 4NT4A 5I9YA 2ETRA 2GNIA 4BYIA 4MEDA 2UW4A 2WTIA 5HG7A 4RX5A 2YABA 4EHVA 2GQSA 5C8NA 4RIXA 4IMYA 4WG3A 2P4IA 3VUKA 1Q8UA 1PF8A 4TRLA 3NAYA 3ZXTA 3TJCA 5EOBA 3NIZA 4CQGA 3R7IA 4EQCA 4O22A 5AJQA 4DG0E 2VO7A 5LJJA 2Z7SA 4YSJA 1QMZA 2GDOA 2QOQA 3UC4A 5DEWA 4BTJA 4XG7A 3NMUF 1ERKA 3A4PA 3KXZA 2JDTA 3MH2A 4CCUA 1OL1A 2UV2A 4J8NA 4NTSA 4AT4A 3G6HA 3L9MA 4M67A 4DC2A 3U9NA 4QMOA 3QTSA 1STCE 3QTZA 1V0OA 2XYUA 3C4ZA 3FMEA 3LXNA 4U40A 4ZK5A 4EH6A 4EH2A 5BVKA 2XM8A 3EKKA 4UALA 1NY3A 2JC6A 4TW9A 4XHKB 1U4DA 5IQAA 5CY3A 4LL0A 1BI8A 3C4EA 3A99A 1VZOA 4FTLA 2OF4A 5BNJA 3EWHA 4O96A 4RJ3A 3TIZA 3E8EA 3LAUA 3DLZA 1Q8TA 2UVYA 4ZIMA 4TN6A 4FK6A 3KFAA 2PZ5A 3RPOA 3JXWA 5IZFA 3DAKA 2YIXA 3PYYA 5JGAA 3A7IA 4ANOA 3HX4A 2OIQA 4S33A 3VBXA 3WF5A 3ZSHA 1FVRA 3CJGA 3W2PA 3HA8A 4FEQA 4USDA 3VQHA 4C58A 4XLIA 3EFJA 3PA5A 4FKOA 3MVHA 3KRXA 4JOAA 4HNIA 2HZNA 3H30A 4FTQA 1H0WA 4OTHA 5B7VA 3FKLA 3TUCA 3IG7A 5AUXA 5LARA 4NUSA 4QMPA 3L8XA 5CT7A 4GVAA 3M11A 4CZYB 4F9BA 3G51A 2QOCA 3PP0A 3P08A 4JIAA 4IVAA 3MVMA 2B4SB 3I6WA 4FTAA 3PZEA 3Q96A 1V1KA 2OJIA 4CV8A 5KBQA 1NA7A 2VO3A 3DXNA 4R5SA 4I5MA 2B9FA 4LG4A 5A4QA 3S0OA 5IMXA 2CN5A 3UOHA 3GOPA 3V5LA 3ZFYA 2JEDA 4DT8A 5FBOA 2ETKA 1ZY4A 2R3NA 2VU3A 4NWMA 3WZJA 2XNGA 4Y95A 2YM8A 5J1WA 5BPYA 3Q32A 3K54A 5CT0A 1PRYA 2BROA 3DBDA 5KCVA 4UWYA 2G1TA 4C35A 5J9LA 3G33A 1ZRZA 4L45A 1PXOA 5A54A 3ZYAA 3L9NA 4YO4A 5CLPA 4YHFA 3MGYA 4ACGA 4FKUA 4A9YA 3QD4A 3PPJA 3R04A 2OK1A 4RC4A 4F1OA 2P0CA 2QG5A 4GK3A 3UOLA 5AADA 4FUYA 4AWIA 5ICPA 3DV3A 3LKMA 2UW9A 4MXZA 3R83A 3PJCA 3DQWA 5L6OA 4DCEA 2V62A 4MD7E 5IPJA 4ZMFA 3FLYA 4AGCA 1P5EA 5J95A 2YZAA 4HCUA 4BY9E 3QD0A 3UQCA 5E7RA 5CF8A 3HP5A 4O0YA 2VWVA 3R9RA 3PIYA 4KA3A 4FL1A 3GQIA 4MWHA 4D2RA 3ALNA 4JIKA 3ZBFA 3DS6A 2QLQA 2XRWA 4BDHA 4O0XA 4O0UA 3FUPA 2OBJA 5K4JA 3HV3A 4AGUA 1GY3A 5EDQA 1FMOE 5DA3A 2XIKA 3C1XA 4YPDA 4OGRA 3NW6A 3MA6A 2HW7A 4DG3E 2VAGA 4TYEA 5DLSA 1B6CB 3C4WA 1TQMA 2JBPA 3QTWA 3IK3A 4EOOA 2KTYA 2C6EA 2C5YA 4TWOA 5AUVA 2OJFE 2UZBA 3ANRA 2OH4A 4AFEA 3S1HA 2BHEA 2R3MA 1PXLA 1DI9A 2E9PA 4O7WA 1YVJA 2BPMA 4EK3A 4BIEA 2Q0NA 5JMSA 4O86A 3ZDIA 4ZZNA 4FIJA 4MBJA 3ROCA 3RWQA 4AUAA 3OUNB 3ORNA 2ETMA 5ANGA 5IQBA 5IQIA 3LPBA 4MQ1A 4RG0A 3P7BA 1KV2A 4CYJA 1YWRA 2PVLA 3OVVA 5FWKK 4A07A 4AACA 3NUPA 4QPSA 3ACJA 3KL8A 3WARA 4IJ9A 5I9WA 4JDKA 4WSYA 5C01A 5F9EA 4OLIA 5FP6A 5KMOA 2XIRA 3GT8A 4M0YA 3FZRA 4W4YA 4G2FA 2VTRA 3EL7A 4XRLA 3DBEA 3VBWA 1YXVA 2ZM1A 3EMGA 3LHJA 1L3RE 4BTMA 3U9CA 3CP9A 3VBVA 3OOMA 4N6ZA 2X1NA 4U3ZA 3LLTA 2E9UA 4ACMA 4EOKA 4ANMA 2ZV9A 2G2HA 4EOSA 5M53A 3MPTA 3LJ0A 4G34A 4I6BA 2OF2A 4IAFA 4QTEA 2R3PA 4XOYA 4DFBA 2PVKA 2X7FA 3PXKA 4FKGA 3PY3A 4BCFA 2RSVA 2WTKB 4FKIA 5FGKA 1H24A 3UVPA 3UO6A 4J1RA 2O63A 4FV4A 3MN3A 2VWYA 4QNAA 4D55A 5M06A 2XKEA 5B2LA 4Z9LA 4KUJA 3VS1A 4D4SA 5A6NA 4BI1A 3DFAA 4G3FA 3R30A 3F3TA 3MSSA 3P4KA 4CKIA 3CQUA 4CZUA 3R28A 3QA8A 4D4YA 1YDSE 2FA2A 2GMXA 3GGFA 3BCEA 4F0GA 2W1EA 2ZM3A 3A4OX 3HDNA 3QWKA 1XH6A 5CU4A 4AS0A 4G3CA 4PPAA 4RPVA 3BU3A 4H39A 5CZHA 4EOMA 4C34A 3SW7A 4GIHA 1YHSA 4I0SA 4NL0A 3GU7A 5EQEA 4BR3A 3ZH8A 3GU4A 3WILA 5EW8A 3NYNA 2BFYA 4LMNA 1ZMUA 2RG6A 3ZLYA 5HEZA 1K3AA 5H8GA 2JDVA 3EN7A 4AF3A 1HCKA 3MW1A 4AZEA 5BVWA 4C3RA 1OUYA 2QLUA 2PVRA 2HYYA 3AC4A 3E7VA 2VV9A 3TEIA 3IDPA 1J7IA 4DF3A 1OMWA 5EM7A 4BKZA 5J1VA 3DNEA 3P9JA 3RK7A 2XNNA 2UZEA 5EYKA 2UW8A 1B39A 5A4TA 4ZSJA 1JBPE 5L2QA 4LQMA 5FG8A 1WBNA 3WBLA 2IZTA 3U51A 2CLXA 3AC5A 2UVZA 4FKQA 2BMCA 3PWYA 4PL3A 5IISA 4GU9A 3FWQA 2JDOA 3FMJA 3R71A 3U4UA 3ZDUA 4F09A 3RAIA 3IW4A 1OB3A 5IQGA 2BTSA 5J7HA 4LOOA 5J5SA 4XH6A 4EYJA 2JKOA 2UZTA 4M13A 2WEIA 4RWJA 4FSQA 4XUFA 2OU7A 3BGQA 4FTMA 3KMUA 3BGZA 4C3PA 4EH5A 5DG5A 3NEWA 2OJJA 3G2FA 2W96B 4RQVA 5K4IA 2OXYA 3ATSA 4L7SA 2RFDA 4I0RA 3LIJA 4QP8A 1KE8A 2Z2WA 3B2WA 1J3HA 5A46A 5HG8A 2X6DA 5CANA 3V5JA 1ZXEA 3KRLA 2IVUA 4K2RA 1GIJA 2PVHA 5CYIA 5FEDA 3UGCA 4AOJA 4YGAA 1R1WA 5J8IA 3LFQA 2F9GA 4OBOA 4D9UA 2YDIA 2H9VA 4EORA 4DAWA 3RWPA 4UX9A 2Z7RA 2HWOA 2FSLX 3MV5A 2RFNA 2GS7A 3HVCA 4PY1A 1ZYCA 4XEYA 4L8MA 2XS0A 4L46A 2W1IA 5G6VA 1O9UA 3VQUA 2YCFA 3QRUA 3PSBA 5L2SA 3SXSA 4DBNA 3IPHA 4DGOA 5LVPA 4O7ZA 3ORMA 4OUCA 2QQ7A 4DEHA 5L2TA 1UWJA 3RZFA 4IAKA 3RHKA 2VX0A 5CF4A 2ZM4A 3FQSA 3IGOA 5KMJA 2F2UA 5AUWA 5DVRA 4HGLA 4FNZA 3OG7A 4BDFA 4E26A 3DA6A 4FEUA 4YJPA 4BDJA 1NT2A 5E4HA 2IJMA 4YZNA 4HZSA 3R9OA 4IDVA 3VJOA 2KULA 2YFXA 2C6MA 3Q6UA 5B2MA 3UG2A 3VUHA 3N4UA 1F3MC 2WQNA 2GS6A 4DCAA 1PJKA 2BAKA 4PL4A 1FGKA 3DBQA 4FTUA 5A4EA 2P2HA 4PMPA 3VWAA 4DFUA 1VJYA 3EFLA 4ZSEA 2OG8A 4CFFA 1YHVA 1OVEA 3FL5A 4F65A 5KKRC 2P55A 5LCJA 5FM2A 2J2IB 1JWHA 3S95A 2ACXA 4H3BA 4GRBA 4NZWB 1XH7A 3VBTA 4P5QA 5DFPA 1ZMVA 4FT5A 2X2MA 1JSTA 2DYLA 2QHNA 2CKQA 3FL4A 2R9SA 4OBQA 4QNYA 4DFNA 4GMYA 5L3AA 4BKYA 1JKTA 3CTHA 3R8PA 5CAUA 2C4GA 2QURA 3LFSA 4BN1A 4CTBA 4PPBA 4IDTA 4L52A 2BKKA 5IQEA 4U3YA 5EI2A 3RVGA 4FG7A 3KVXA 2XK9A 2QOKA 4XMOA 3D7TA 5LMKA 1OIYA 1JVPP 2AUHA 4CFMA 2YIQA 3KB7A 4Q2AA 4AZTA 4QMQA 3DBCA 3ULIA 4B9DA 3VS6A 2PE0A 3PLAE 3BELA 4J53A 3A7HA 4I6QA 4Q9ZA 4IACA 2VTMA 3FMKA 4O1PA 5CEIA 5IUHA 3PLSA 2W4OA 3LCTA 4RX9A 3VBQA 4FUXA 1J7LA 4O81A 3MH3A 4Y5QA 1K9AA 2QNJA 2YIYA 3ET7A 3O2MA 4ZOGA 4IX4A 4Q5EA 4EH4A 1CMKE 5L8JA 2E9VA 3RAWA 1SVEA 3QCXA 4WRSA 1H1SA 3T3VA 4NU1A 3FKOA 2PUNA 4GFMA 3PP1A 2C1AA 4W8DA 4RIOA 3GC9A 5CZIA 3ZONA 2W5BA 3ZRKA 3QF9A 2J50A 2VWXA 2XNEA 3QLFA 3SOAA 5E8ZA 3EQIA 1Z57A 3O96A 3CR0A 4D2PA 5BMSA 4JJRA 4KB8A 4DGLC 3ZO3A 4ORKA 4V0GB 5CEMA 3CY2A 4FT9A 4IFCA 4QQ5A 2XCHA 1NVQA 2JITA 4DEIA 3W2RA 1ZYJA 4O7YA 4KWPA 1WCCA 5A14A 4QP7A 3TJDA 3HDMA 4OR5A 2FO0A 3TV6A 4HYSA 5J79A 4LV5A 4J99A 3DBFA 3MY0A 4FV9A 1Q97A 3UNKA 4OTRA 1JSVA 3SDJA 3TZMA 4GVJA 4F0FA 4F9WA 5BVNA 3KF4A 2C6TA 2Q83A 2XKFA 5AP3A 4FX3A 2WIHA 3OS3A 3MFUA 5CSWA 3AQVA 3TNPC 2XEYA 4QTCA 2ZVAA 2WOTA 5FM3A 3HEGA 4JRVA 4MD8E 1JPAA 4NCTC 3R8UA 4X3JA 4CMOA 5G1XA 5JZJA 2YZLA 4FV6A 4BCHA 5CALA 4XP0A 5CAOA 4F9CA 4GS6A 3RM6A 1YDTE 4PTGA 4ZMEA 2VWWA 4DINA 4JR3A 4F9AA 4XP3A 4DLJA 1H00A 4NYEA 2GSFA 5ANJA 2XK3A 3FJQE 3TG1A 3BYUA 3OWJA 3FBVA 4EH7A 5KUPA 5DI1A 1F5QA 4G9RA 3ZSIA 2BHHA 4EQUA 4YJSA 5BMMA 3JY9A 4GG5A 3LOKA 3DFCB 3VUDA 5EQPA 3V8SA 3HMIA 5DYJA 4S2ZA 2V7AA 4USFA 1XKKA 2UW3A 4PTCA 3T9IA 4U97A 3D83A 5FRIA 3R1YA 3ZHPC 2OGVA 5CVGA 1KE5A 2DWBA 4CFUA 3EYGA 4XG3A 2B0QA 2PVNA 3DDPA 4ZXTA 3HAVA 2Y6MA 1W0XC 3F5PA 4X6QC 2Z02A 4JAJA 4C37A 1HCLA 3F88A 2AC3A 2W9FB 3AMYA 3VUIA 3OOGA 3U6IA 4BL1A 4X21A 5M4FA 4FE2A 4CXAA 5ETIA 3BRBA 3PG1A 2CCHA 3OCBA 4QYYA 5JRSA 4FV2A 4L42A 4G3EA 3AGLA 4PV0A 1WBPA 1O6YA 3V5TA 4PDPA 3PIXA 3R7VA 3AOXA 2X4ZA 2UW0A 2VO0A 2ERZE 3V5QA 4DG2E 2JFMA 1BL7A 1YRPA 3LM5A 4O38A 5F20A 4PPCA 4NW6A 4ZSLA 3RP9A 5CXHA 2XNPA 4ALUA 1YQJA 3C13A 3R7GA 2X8EA 4PQNA 5EHYA 5HX6A 1LR4A 4GFGA 3HECA 4FMQA 4P90A 4PF4A 2QG7A 1O6LA 3HA6A 4LUDA 4YHTA 2IZRA 1QPEA 2ZV7A 3OXIA 4RJ8A 5E8VA 3WZKA 5DWRA 1OPKA 5LXMA 1UA2A 2XIXA 2BIYA 3VIDA 4C8BA 4EC8A 3PVWA 3QC4A 4M84A 4PNIA 3F2NA 3CTQA 4ALVA 2HZIA 3CE3A 2WD1A 3R1NA 5I0BA 4O0SA 4FSUA 5ACKA 1H27A 2IG7A 4DITA 3TZ7A 2BDWA 2ONLC 1FVVA 3A60A 3TNHA 3UIMA 2HOGA 4HVHA 3ZC5A 2OJ9A 3Q2MA 1ZY5A 4W9XA 4O84A 5F94A 4YURA 4DH7A 4Y85A 2JLDA 2X2LA 5EYDA 2XYNA 1WVYA 3VUMA 5EM6A 4W4WA 3H0ZA 3QZHA 2JAVA 5CU2A 1JQHA 1PXKA 3L8SA 4AA4A 5KMKA 4LGDA 1REJA 2VWZA 1BUHA 3PG3A 4MXCA 4AE6A 3R7EA 1QPDA 4M7IA 3UYSA 4D1ZA 5HNBA 5JGDA 4FEVA 4ZTMA 5F95A 2OKRA 4IX6A 1IASA 4BTFA 1YXXA 2WHBA 4FA2A 4Y5HA 1M2PA 2BILB 4FV0A 4XNEA 4QD6A 2VTPA 5HE3A 1Q3DA 2XA4A 3W1FA 4B0GA 2CHLA 3PJ8A 4BRXA 2UZWE 4MAOA 4IC8A 3WYXA 4QP9A 1ZYLA 3WF7A 5KKRB 3LXKA 3LMHA 4H1MA 4WIHA 3QKMA 5TF9A 3EJ1A 5CSXA 5H8EA 4DFYA 1Y8GA 3OC1A 4QTBA 1WVXA 4BCMA 2YDKA 4DGMA 3ACKA 4C57A 5IA1A 5TR6A 4Z55A 4IZ5A 3BPRA 3ZOSA 5FBNC 2XJ0A 4BTKA 4U45A 4IAYA 2YM6A 5IF1A 2VRXA 1UVRA 3QD3A 3GP0A 2Z7QA 4AU8A 2RFSA 2YITA 4TWPA 1Q3WA 4UXLA 4JG7A 3UPXA 5ANKA 3O8TA 4ACHA 3FEGA 5TKDA 3RGFA 4CFWA 5ITAA 3OCSA 3ODZX 3N4TA 3FDNA 4P4CA 1PXNA 2CDZA 2J51A 4MK0A 5FTOA 3P5KA 3KREA 1M2RA 5EOLA 4MHAA 4KD1A 1M7NA 1MRVA 3TI1A 2PZIA 3UJGA 4BCJA 3PVGA 4I20A 2O3PA 4C2WA 4DEEA 4KAOA 3R8ZA 3ORZA 3NCZA 2FB8A 4ZSAA 5L6PA 5EDRA 4R8QA 3DAJA 4AGWA 4WUAA 4HNFA 5BQ0A 1M17A 3F9NA 4V01A 4N70A 4J95A 3COIA 1YW2A 2BR1A 4YZCA 5IH6A 4E6CA 2J0IA 3EYHA 3KK8A 3I81A 4DYMA 4H3QA 4JQEA 1GOLA 3GXLA 4WNMA 4LI5A 4J71A 4BICA 4EWHA 4QMTA 4EBVA 4FI1A 1BKXA 3IGGA 2RL5A 3EN9A 3H9RA 5ETCA 5HHWA 3SX9A 4E73A 4AFJA 3C0IA 5IA3A 4IAIA 1H01A 4TNBA 5EDPA 5HU3A 3O50A 3UOKA 3DJ5A 5JH6A 2XEZA 1H0VA 4GSBA 1OBDA 5EHOA 3EFKA 5B2KA 4AOTA 4U7ZA 2PMOX 4RIWB 4OTQA 5BYYA 4Z16A 2XK8A 3T3UA 3O8PA 3ORPA 3SG8A 1KE7A 5HORA 2Y4PA 3OWKA 3C0HA 4FIHA 2VNWA 4HCVA 4X3FC 3IW7A 3VF8A 4MBLA 3I7CA 3FXWA 3ZTXA 3NYXA 2J4ZA 3GFEA 3RHXA 2R3KA 4YPSA 2UW5A 4QMUA 4JS8A 4BDEA 2F7EE 4ZY5A 4Z7GA 5JQ8A 5BYZA 3SGCA 3Q9WA 2HW6A 3R9DA 4LM5A 3NSZA 3HUBA 4L6QA 2XMYA 3TACA 1WBWA 2P33A 3KU2A 3R02A 4IWQA 3FYKX 2C69A 3FMDA 1CKJA 5K5NA 2YHVA 4UN0C 1OECA 5D7VA 1T46A 4A4XA 4RVMA 5JFWA 3A62A 3V51A 4AZFA 4OT6A 2OXXA 3BI6A 1SNXA 3Q9ZA 3U87A 2YEXA 2Y7JA 3EB0A 4EZ7A 3ROYA 1XO2B 4IWPA 1FINA 4MBIA 3P0MA 4WNKA 1WFCA 4C4IA 2ITPA 1U54B 5LVLA 3KGAA 1ZWSA 4W4XA 3LLAA 4OAVB 3ITZA 4QMLA 2C3KA 2C6KA 3DKCA 3KXNA 5M4CA 3OTUA 3HL7A 4R7IA 2JKMA 2Z60A 3LQ3A 1EH4A 2CN8A 5JFXA 3L8PA 4FSTA 4PUZA 4K9YA 4EK8A 5E9EA 2YACA 4J8MA 3MB6A 3RM7A 3SKCA 2C5OA 2YJRA 2HK5A 2ZDUA 3JY0A 4QYGA 3RPSA 5IQFA 3UMXA 4AW0A 3E92A 3WE8A 3GC8A 4BIBA 2JKQA 3HMNA 5KHWA 2GTMA 4IB0A 1WBSA 2JIUA 3KXMA 4GT4A 4K6ZA 2UZUE 3LXPA 4IANA 5CWZA 2VTIA 3VC4A 4XV1A 3BBTB 3REPA 2QVSE 3CJFA 3KY2A 4EOIA 3S00A 4RLKA 3EQBA 4FZFB 3B8RA 1FPUA 5JK3A 4Q5HA 3RPYA 2F4JA 5EK7A 4L7FA 3V3VA 3P78A 1W84A 4O82A 5T3QA 3TN8A 2CKOA 5FP5A 3QCYA 2GHMA 4USEA 3LFBA 4HYHA 4K0YA 1PXJA 4F6SA 2ZOQA 4CG8A 3BIZA 4FV8A 3S4QA 2UW6A 3LCSA 4R77A 2G01A 4PWNA 4KIQA 3EQGA 4OAUC 4F63A 2C47A 2UZLA 5EHLA 4B4LA 3KN5A 4AX8A
chains in the Genus database with same CATH superfamily
4ITIA 3ANQA 4EH3A 4RC2A 3RJCA 4C02A 4EYMA 3PVBA 3FHIA 5HLPA 3VN9A 3V01A 5AR3A 3KMWA 4H3PA 2HAKA 4IVDA 4ANBA 5CI6A 4XG4A 4RWLA 4IHPA 4BIDA 2XALA 4NIFA 4MH7A 1GZOA 2HCKA 3NPCA 5D7AA 2P3GX 4LOQA 4KBCA 3L1SA 1P2AA 3CIKA 4FC0A 4QMNA 4I6HA 4BGQA 3F3UA 3DKOA 4AA5A 4A9UA 2BTRA 4DT9A 4UB7A 4ZJVA 4H1JA 2F49A 2PZYA 4U42A 3R1SA 3V6SA 3R00A 4FNYA 4BBEA 4FNXA 2WMSA 3RBWA 3ZEWA 4JDIA 3EQCA 4KRCA 3DTCA 1X8BA 3TNIA 4E5BA 4EOPA 4Y46A 2XZSA 3MA3A 4ZY6A 2VTHA 3HRCA 4DH3A 5HG5A 4IWOA 5FTQA 2E9OA 5CEQA 3ZUUA 4NM5A 3AMBA 3POZA 4FTNA 4NK9A 5HE1A 1PXIA 4B99A 3E87A 4KS7A 1DS5A 3SA0A 1H4LA 3DJ7A 3GNIB 3LJ1A 4BKJA 4I6FA 4JX7A 4EH8A 3QUDA 2PSQA 2XK7A 3C0GA 4G17A 3MJ1A 4KBAA 2HXQA 4N6YA 1BI7A 3D4QA 5HI2A 3T9TA 2BALA 2FYSA 3OY3A 3QTUA 4QYFA 3KK9A 3V04A 4ENYA 5BYLA 3AT3A 4JRNA 2IWIA 2WTDA 4U79A 2B1PA 4QMWA 1HOWA 2B9HA 3ZCLA 5J9ZA 5EM5A 4AQCA 3DDQA 2FSTX 3GU6A 2BRMA 4FT3A 4O0WA 1KE9A 4O2ZA 2YM4A 3ENHA 3QX2A 5DOSA 4D2TA 1NVRA 2VGPA 3FI4A 4NKSA 4M97A 3ZLXA 2VGOA 1W83A 3KCKA 3Q3BA 2E2BA 3VRYA 2RG5A 3GQLA 2XKCA 1OKWA 4R3CA 3TV4A 3H10A 3ZRMA 5IDPA 4OTFA 4F7SA 1U46A 3MH1A 2J5EA 1Y6BA 4RZVA 4YTFA 3VNTA 2YAKA 1FGIA 3GCVA 3O7LB 4H36A 2IW8A 2QKRA 3K3IA 4KSQA 1UKHA 4F70A 2R0IA 1VEBA 3Q52A 5AEPA 2DUVA 3E3PA 3Q04A 1Q62A 2WTCA 1G8SA 4IAAA 3WIGA 4WKQA 2NO3A 1O6KA 1R3CA 4OTGA 5DR2A 1BL6A 5HNIX 3DNDA 5AUYA 3L9LA 3EN5A 5BUEA 4JBOA 2G9XA 1PW2A 2NP8A 2PU8A 2V55A 3K5VA 2X0OA 1GIIA 3LCOA 3D15A 4HZRA 4ZLYA 4FR4A 4HGSA 4MCVA 4GL9A 5IA4A 3QX4A 2WU7A 4FTTA 4LRMA 4EBWA 3BV3A 3K5UA 3W0OA 4ENXA 4X3FB 1SZMA 3ZRLA 4I94A 3SRVB 3DKFA 2J0MB 1TFFA 2PWLA 1OL5A 1ZZLA 2GNHA 2PVJA 3EKNA 3MH0A 4HVDA 3FV8A 1E1XA 2WPAA 3PTGA 4I0TA 2HY0A 4NJ3A 3UZTA 1OPJA 3E3BX 1Y57A 1UV5A 2W9ZB 3HLLA 3WI6A 4HW7A 5HTCA 3KIOC 4JG6A 3NNXA 4V0GA 1M7QA 2YJSA 4QPAA 4EONA 5EYMA 5A4CA 4D0WA 3G90X 4F64A 1IR3A 2O65A 3R0TA 5AA8A 3ZC6A 4EZ5A 3PXFA 3OXTA 4WRGA 4D0XA 4FGRA 1E9HA 5CVHA 5LVMA 2Y8OA 4QP2A 3ZUVA 4FG9A 1JSUA 5HESA 5LQFA 3EH9A 3GB2A 3QRIA 4BBFA 2QKWB 3TMOA 3LZBA 5C4LA 2ZJWA 4KRDA 5HGIA 4JBPA 3LFFA 4NM3A 1R39A 4M3QA 2BRHA 4DDIA 5ANOA 5A3XA 3A7GA 3QUEA 4XBRA 4IFGA 3H4JA 3ULZA 2OFVA 3AT2A 3DOGA 1Q61A 2QU5A 4L3PA 4O0RA 2VUWA 3DZQA 4QQJA 1OBGA 2CLQA 2FH9A 4O27B 3W10A 1QL6A 1YXUA 2GHLA 3AD6A 4FK3A 3TCPA 3W8LA 3BU5A 4BCQA 4RFYA 5DR9A 4JBVA 2GNLA 4M0ZA 2RKUA 2F7XE 3NCGA 2WB8A 3CEKA 5KNJA 3TKHA 4FIGA 2R7IA 4YNEA 2W06A 3ZZWA 1JKLA 2C3JA 2FUMA 2PE2A 2OI4X 2YCQA 3A8WA 3OY1A 3PRIA 4V05A 5CVFA 3FZ1A 4RX8A 4BDKA 2GNGA 2BRGA 4C3FA 4CRSA 4GYIA 5HO6A 1Q24A 2WGJA 3SVVA 3D5XA 5FXRA 2XAOA 3R21A 3IKAA 3C7QA 5M57A 4BCIA 5DN3A 3JVRA 3Q60A 4DFLA 3G9LX 1Y6AA 3AKKA 4I22A 3K2LA 4D28A 3R8VA 4R3PA 3UP7A 3Q4TA 2BKZA 4B7TA 4PDYA 2B54A 4IZ7A 4F7JA 4C2VA 3NWWA 3HMPA 4RA4A 4F6WA 1JLUE 3VF9A 4E4XA 4MUQA 3RALA 4U81A 1MQBA 3QGYA 1FOTA 3HGKA 3GCQA 2XRUA 3QQLA 2VTQA 5I3OA 2OLCA 4B8LA 3QL8A 4RJ6A 4E7WA 3AG9A 4L9IA 2JIIA 4F78A 1ZYSA 2VZ6A 5GJFA 3NAXA 5BUIA 2YISA 4YTHA 3W0PA 3VS3A 2VTNA 3SOCA 4IE9A 4HPTE 2FSMX 4ZS0A 3MFTA 5EFQA 1VYWA 3G6GA 5T68A 5EI8A 5C1QB 4ONAA 3TIYA 4CLIA 5AP6A 3TZ9A 1BMKA 3BHYA 4BF2A 4QMYA 3SAYA 4AT3A 3MWUA 4A7CA 3EIDA 4BI0A 4FG8A 4TT7A 4ZZOA 5AUTA 1OKZA 3U6HA 3CGOA 4O7NA 3WF6A 4IM0A 3DKGA 3BQRA 2C0OA 3VW6A 5ANEA 2QOOA 3P5JC 3E64A 4AT5A 5F4NA 4ZJIA 4TYJA 5AFVA 1P4FA 1T45A 3CLYA 3L9PA 4DH8A 2JBOA 3FMMA 5HO8A 5CF6A 2QR8A 3CQWA 1UKIA 4W4VA 2B9IA 3E7OA 2XM9A 3NZ0A 4JI9A 3SHEA 3FQHA 4KS8A 2YM7A 3RCDA 4GEOA 3QD2B 4R78A 3UZRA 5JRQA 2X39A 4HPUE 5A6OA 2WMUA 3D5VA 3Q5ZA 4D2SA 3VAPA 2CPKE 3MY1A 4DEDA 4EK4A 5FTGA 3BHTA 4L3JA 1H1WA 3I79A 4QP3A 4GUEA 1QPCA 4XLVA 4CMTA 5D12A 4EEVA 1GZKA 4G16A 3EN6A 5LVNA 4Y8DA 4G31A 4GW8A 4MNEB 3ODYX 4GJ2A 4U5JA 3QBNA 3ZFMA 2BRNA 3OP5A 1CTPE 4GK4A 4OTPA 3EOCA 2WQBA 5IQDA 1OPLA 2HXLA 4NH1A 2O8YA 2I40A 3QKLA 4BHNA 3S3IA 4EL9A 4HVGA 4U43A 2IVTA 4ITHA 3QQJA 3TDVA 5LWNA 1MRUA 1UNHA 1JNKA 3ZO2A 1R78A 4E4MA 4EI4A 4KIKB 4ERWA 3COKA 5IQCA 3BYMA 3CC6A 3COHA 4BCKA 4BZNA 5JN2A 5IA0A 3W2SA 3OCGA 4I4FA 5ETAA 3QQUA 2AEGA 3FI8A 5HE0A 3IW8A 2WNTA 4FF8A 5TE0A 1J7UA 4YZ9A 5EYCA 1ZLTA 4TWCA 2W4KA 3ZBXA 4QMZA 4FZ7A 3UDZA 4PNKA 2R0UA 3NVKI 3PA3A 2XAMA 4NSTA 3OFMA 1BYGA 2C68A 3BZ3A 2YN8A 4M15A 2VWBA 2PY3A 5GJDA 3UO4A 2LGCA 1FBNA 4AXEA 1J1CA 3F82A 3KRJA 1FQ1B 3A7JA 3D9VA 3PJ2A 3TKUA 3ZSGA 1FMKA 5KBRA 4DDGA 2XK4A 3EHAA 4JR7A 3BE2A 4Z3VA 5AA9A 3F66A 3MIAA 3R6XA 3WF9A 3NVMB 4XG6A 5DRBA 3UNZA 3OBJA 3PE1A 3PE2A 3CD8A 4DTKA 4NFMA 4CV9A 2BZKB 2VO6A 5EW9A 2BVAA 3D0EA 4ZTNA 5K3YA 5KZ0A 5GIPE 4XG2A 3SXFA 1H1PA 2ERKA 2QOLA 2LAVA 3QA0A 2QOHA 3BGPA 2R4BA 4OT5A 3SV0A 2HY81 3BHHA 5AIKA 5IMEA 5LWMA 2VX1A 3AC2A 3MY5A 2W5AA 2WU6A 3VJNA 4LMUA 4OTDA 3PY1A 4D9TA 4RFZA 5BVFA 4RMZA 5HLWA 1ZARA 4WA9A 1CSNA 3IQ7A 3E5AA 3ZM4A 5J7BA 4IBMA 1KE6A 3G15A 3ZMMA 4EK6A 1KOBA 4XX9A 3E8NA 3AC1A 4RLLA 5LMBA 1RDQE 4EOQA 1DI8A 3UIXA 3FHRA 4DHJA 3OBGA 3JS2A 4FZDB 4RA5A 4TPTA 5HVKA 5CQWA 2NRYA 2V5QA 1ZMWA 4FL3A 1Q41A 4RIWA 3U4WA 4AAAA 4RVLA 5M08A 4M8TA 3AT4A 3KN6A 4NTTA 4AW5A 2NNWB 4G5PA 4FV1A 2QD9A 4TYIA 3PPZA 2PVYA 3HZTA 4FIEA 3QTIA 3PIZA 4KINA 1Q99A 1RE8A 2J0LA 1YWNA 4FT0A 4D5HA 2CNQA 1A06A 2X0PA 3BEAA 4ASXA 5AX3A 2XK6A 3R9HA 1S9JA 2GNJA 3OW3A 3CSVA 4JXFA 2CNUA 3F7WA 2J7TA 2GQGA 5AUZA 3VUTA 4FYNA 4WT6A 2BAJA 4TYGA 5H3QA 4ANLA 4U41A 2CGVA 3KVWA 4NCTA 3DY7A 2OZOA 1YI3A 4G6OA 3OHTA 5L8KA 4FSNA 4DE4A 2WIPA 5BV3A 3HV5A 5HBJA 1MUOA 2AYPA 1G3NA 1UNLA 3EL8A 3KRWA 2VTOA 4MQ2A 4YC8A 3ZU7A 4LGHA 4ACDA 3SLSA 3KMMA 3TDWA 2BZJA 1PY5A 1MQ4A 4IB1A 4YU2A 4X2NA 4DEBA 4R7BA 5JEBA 2EB2A 2SRCA 1XH4A 4FKVA 3SQQA 1W98A 4CCBA 2X2KA 1AD5A 3FSKA 1U54A 1URCA 3R7OA 5KMMA 2X6EA 4YR8A 3JR1A 3V8WA 3IOPA 2EXCX 4RJ7A 3L8VA 4FZAB 3WZDA 2QOIA 3FI2A 3MFRA 2RGPA 4BYJA 4XBUA 4RJ4A 2J5FA 1LP4A 4RWIA 5D41A 3R8LA 5C26A 2ITTA 1Q4LA 2BZIB 4B8MA 3QWJA 4MVFA 5A9UA 4YTIA 2PYWA 3Q4UA 5L4QA 2P2IA 4MWIA 3QRTA 3Q2JA 3NNWA 3KQ7A 5IU2A 2ITZA 3HP2A 4LL5A 5BVEA 1OIRA 3AC3A 3V8TA 3UQFA 4X2JA 1Q8WA 3Q9XA 2Y4IC 1PHKA 2R3RA 3UYTA 2C30A 5M09A 4PMMA 3MFSA 4YC3A 5DNRA 4NM7A 3BX5A 1LEZA 1DM2A 1W7HA 2QU6A 2XUUA 4YC6A 2VN9A 1CM8A 3I60A 5CNOA 3ZUTA 5IH5A 5KHXA 2C6IA 1XH8A 1SMHA 1ATPE 5AP7A 3IW6A 4TY1A 2YIRA 3NFFB 4FSYA 2J0KA 4YZBA 2WZJA 3FMLA 2JD5A 4XOZA 3ZM9A 3GI3A 4ZSGA 3QYZA 4MXXA 5DIAA 4GT3A 2ITUA 3W0NA 3R73A 3UIUA 4MF0A 4K33A 2HZ4A 1OIUA 2GS2A 4MD9E 2ONLA 4TNDA 2X8DA 2CKPA 4ANNA 4RQKA 5C9CA 2XBJA 5EW3A 2VTJA 2WTWA 2OIDA 3OTVA 3W2CA 4WNPA 3UP2A 3R9NA 1XJDA 5I5ZA 3MESA 4CG9A 2XBAA 4HOKA 4CMUA 5HQ0A 4DTAA 4AZWA 3AD4A 4I4EA 5EG3A 2QCSA 3RI1A 3IW5A 3C9WA 5CSPA 4AW1A 3P86A 5I4NA 3RTPA 4M68A 4FZ6A 3OT3A 3QGWA 4EWQA 4MXOA 3QZIA 4K8AA 2VTTA 2E9NA 2R3GA 1UU7A 1W82A 5IEYA 2W1DA 2JDRA 4YMJA 5AV2A 3C50A 5B0XA 3LJ2A 3U8WA 3KRRA 5IDNA 2ITYA 2JKKA 2WTJA 3PVUA 3QRKA 3GCUA 3O17A 5HBEA 1L8TA 5HCYA 1DAYA 4RIYB 5AP5A 5EH0A 4BGGA 4QQTA 2PL0A 5KMNA 1J91A 2OWBA 4FRFA 3DAEA 4FOBA 4IX3A 4KABA 5HCXA 4DN5A 4APPA 5CQUA 3FPQA 5J9YA 4FIIA 5L8LA 2GCDA 1H28A 3UO5A 4FSWA 4YNOA 2UW7A 4Z7HA 3CBLA 4FYOA 1OKVA 3F61A 3MVLA 4UEUA 4D5KA 3KXGA 4D58A 5LOHA 4U44A 2H34A 4G6NA 5JGBA 5DT4A 2VTAA 4EK5A 4K1BA 4O4EA 2OICA 4G6LA 2C5VA 1YI6A 2WFYA 4YLLA 3OW4A 4GFOA 3I4BA 1H1QA 2OZAB 3NNUA 5HTIA 3R7YA 5FD2A 5EI6A 3NUYA 3E8DA 3OUKA 3SW4A 4E20A 2WMRA 3QU0A 4II5A 2ZFYA 4MXYA 4JDHA 3WZUA 1AQ1A 1TQPA 2R64A 4QMVA 5CASA 3DJ6A 1U5RA 3GU5A 4UYAA 5FXSA 1SVGA 4MNFA 2I0VA 3Q9YA 2OIBA 3NUAA 2W1HA 1Y91A 4PP7A 3DZOA 3O51A 5HTBA 1V0PA 1QCFA 4JQ8A 3OCTA 2C0TA 3H9OA 5CENA 5H9BA 3QFVA 3UDTA 2OH0E 2F2CB 2QC6A 3CD3A 3O71A 4MKCA 5M56A 4F08A 3FLQA 5IG1A 3NUUA 2QONA 2ESMA 2QO9A 3CGFA 4UWCA 2XIZA 1PMEA 2V0DA 3F5GA 4IM3A 4QO9A 3BL7A 3ATTA 1I09A 3FY0A 4CEGA 4ZP5A 2J9MA 4FTJA 1J1BA 3DK6A 3W0SA 4O83A 4FEXA 4D4VA 3F5XA 2VD5A 2W5HA 3P7AA 3ID6C 3UE4A 1GZ8A 3W55A 3ETAA 2WMBA 4GJ3A 4XRJA 3ZLWA 2EXMA 5HD4A 5AAFA 4C59A 1SM2A 4DGGA 3CQEA 3DXQA 1SYKA 4UZDA 4DFZE 3THBA 3I5NA 1ZOHA 4UV0A 3A8XA 4E4LA 5FQDC 4FKRA 3KC3A 1UU8A 3MTLA 4RC3A 1WAKA 3KULB 4M66A 4X3FA 4F99A 4PTEA 5CU3A 4KNBA 4C4JA 2WMQA 3SRVA 3TT0A 3F3WA 3DU8A 4P2KA 4RBLA 3UG1A 3DGKA 3W18A 5C27A 5GNKA 3ORKA 4KIPA 3EZVA 4AE9A 4B6LA 4F0IA 3LQ5A 3FC2A 3PWDA 4BDCA 4TKSA 5K9IA 2W1ZA 4M69B 4BWPA 2A0CX 4J96A 2PTKA 5DHJA 2HIWA 4L44A 3QLGA 4JBQA 4ZY4A 5I9UA 3D14A 2RF9A 3UODA 2BDJA 4LFIA 5DBXA 4FIFA 4LOPA 4DA5A 5AR2A 4ANSA 4QPMA 4TZRA 4I5HA 4KKGA 3DB8A 4X2GA 5E92A 4UMPA 1LPUA 4IZAA 4QDVA 3N9XA 3HRFA 4IJPA 3BLHA 3MPMA 1E1VA 3TNWA 3UZPA 3BQCA 5GZ8A 4YBJA 2BZHB 4GG7A 4CQEA 4E3CA 4H05A 1OGUA 4UYNA 1NW1A 3TXOA 3JYAA 2XNOA 2Z7LA 4FV7A 2QODA 4J7BA 2C0IA 1OUKA 3ORXA 4JT3A 3W16A 4KIOA 2I0EA 2HZ0A 3B2TA 1QPJA 1GAGA 4ZLOA 3NUSA 5AAEA 1OIQA 4S34A 4U80A 5AMNA 4I6LA 3AXWA 3RKBA 3AMAA 3F5UA 5FLFA 1YDRE 3VS4A 3C51A 3QQGA 3ZS5A 2X4FA 1IEPA 3FE3A 4NFNA 4K18A 5DE2A 2QO2A 4G3GA 3TTIA 3HV4A 1NVSA 5AR7A 3UVRA 1ZOEA 5HZNA 3AGMA 4DH5A 5IA5A 3D94A 3FZSA 3MB7A 4BDIA 4E6QA 3NR9A 4QTDA 4WO5A 5CAVA 5C4KA 4GH2A 4AN9A 4PMTA 4E5WA 3UOJA 4BCNA 1G8AA 3PXZA 1CDKA 1LUFA 1ZZ2A 3QTRA 4IB5A 4BGHA 3NGAA 1YWVA 2JDSA 3BEGA 1SNUA 2WQMA 3OWLA 4FVQA 2Y4IB 2WO6A 5CAQA 2XB7A 4DEAA 4CFXA 3PUFC 3HV7A 2PHKA 2W1FA 4ZTSA 4H58A 1KSWA 2GFSA 3D5UA 4AZVA 3T8OA 4G5JA 4FKSA 4WNOA 2G2FA 4L43A 1P14A 2WQOA 3FC1X 1PXMA 2ZV2A 3DTWA 5E91A 3RK9A 3RPVA 3TTJA 4A9SA 4AN2A 3GCPA 4CYIA 1R0EA 3ORTA 2R3IA 4QQCA 4P5ZA 4GKIA 2NRUA 5E8YA 5AX9A 2PULA 3EQDA 3BV2A 4HGEA 2IVVA 3UDBA 3UIBA 3RCJA 2W0JA 5HIEA 3EQFA 4FBXA 4XCUA 3SG9A 3VONA 3MS9A 1H08A 3II5A 2ITWA 4RZWA 4BBMA 4CZTA 4TYHB 1F0QA 5HKMA 2JAMA 4AZSA 2PK9A 4I3ZA 4LUEA 2C6DA 5CF5A 3QRJA 5M4UA 4YJOA 4PDSA 4I93A 5DEYA 3JUHA 3I0QA 4LGGA 1Q8ZA 3PPKA 3F7ZA 2A4LA 4EOJA 3FLWA 5AR5A 1PKGA 2X0GA 1YI4A 4Y73A 4EHEA 4HYUA 3NIEA 2X7OA 1TVOA 5CX9A 5GINE 5KX8A 1B38A 4O1OA 5EKOA 3G5DA 3V5PA 3H3CA 4FV3A 4JG8A 3TNQB 2XANA 3A61A 3GC0A 4GYGA 4EHGA 1CKPA 4WG5A 3FQEA 5HBHA 5JQ5A 3AKJA 3OT8A 4HGTA 4IADA 2R2PA 3FSFA 3IECA 3A2CA 2YM3A 4NKAA 3GFWA 1REKA 4WHZA 3PJ3A 2XKDA 2C5XA 3FZPA 4O0VA 4ARKA 3QQKA 2WMAA 3FXZA 4AQKA 3SD0A 1XH9A 5JSMA 1G5SA 1TQIA 4FSMA 2PUIA 3NDMA 4XV9A 4BDBA 2X8IA 4UMTA 2UZVA 5D1JA 3FY2A 3D2IA 5HNGA 4MNEA 4ZS4A 2YM5A 4WD5A 5CI7A 5ANIA 3RAKA 5DT3A 5E8WA 3TWJA 1ND4A 2X7GA 5AV1A 1JKSA 4LRJA 4O91A 5J5TA 2Y9QA 3UMWA 2VTSA 5IQHA 4NEUA 3PXQA 5AAGA 3BHVA 5T6KA 4CKRA 3PXRA 5C8KA 4CGAA 2ZB1A 4IC7A 3ZLSA 4DTBA 4X7QA 3GU8A 4OTIA 4PRJA 3PXYA 4KIKA 3DPKA 4JMQA 4G9CA 3PFQA 4QMXA 4FT7A 3TZ8A 3IONA 3RK5A 3VUGA 1NXKA 4MXAA 4UZHA 4EKKA 4HVIA 4BZDA 4XG8A 3LFDA 4E6AA 5AP4A 5CU6A 4YHJA 2YLEA 4GUBA 2YCSA 3BYSA 4AXFA 2X81A 3WE4A 5GZ9A 1YKRA 4CFVA 2BCJA 2I6LA 4J52A 4BCGA 4PL5A 3QYWA 4IZYA 3DQXA 5AM6A 3MBLA 4AXAA 2ZB0A 4YLJA 2F57A 4F6UA 4V04A 3LFEA 5E8SA 5JKGA 3FMNA 4YLKA 2Y0AA 3CTJA 4GV1A 4RWKA 3RPRA 3HUCA 4YJVA 3TL8A 1YOMA 3G0FA 2VWUA 2QI8A 3QUPA 3RINA 4E4NA 4FTKA 1MP8A 5FDXA 4XP2A 2IZSA 4O0TA 1P4OA 4RIXB 2WXVA 4IVBA 4EOLA 3I6UA 4EKLA 4EQMA 4ZTLA 3W2OA 2WELA 1OL6A 3D7ZA 4BJJB 3BYOA 2CGUA 4XG9A 3COMA 4APCA 4D1XA 4JX3A 4O7RA 4O6EA 3P1AA 3EQPA 3AKLA 2OW3A 4DHFA 5AR4A 3DLSA 3PRFA 1Q8YA 4ACCA 4Q9SA 4D2WA 1GNGA 4FSRA 4EJNA 3KXXA 4LV7A 1U5QA 4BWXA 4WOVA 3MPAA 5KMIA 4HCTA 1BX6A 4FTOA 2FGIA 3F2RA 3EQHA 3NYVA 3OD6X 4O7VA 4FV5A 3CPCA 1PMVA 4FEWA 4U9AA 2O5KA 1URWA 3CKXA 2XNMA 4DLIA 2B53A 3E62A 4ERKA 4J97A 3ZZEA 4AGDA 2CGWA 1W2CA 4JL9A 2O0UA 1GZNA 2BDFA 3AD5A 2Z8CA 4PP9A 4YO6A 4ZJJA 3PY0A 2H6DA 2W99B 1FVTA 4EZ3A 3QAME 1H1RA 2WQEA 4KKEA 5J87A 5BX0A 3ENMA 3W2QA 4EUTA 2C3LA 4OBPA 3W32A 4W8EA 3BKBA 5H2UA 4OW8A 5C03A 3UNJA 2FVDA 5HG9A 4C4HA 4GKHA 3VVHA 2RIOA 3E88A 3FAAA 2UVXA 3HYHA 4E1ZA 2PMIA 4HJOA 4GCJA 3KA0A 3CXWA 3QXPA 2A2AA 2HWPA 1XH5A 3VO3A 4FKTA 2IN6A 4ASEA 3C4CA 5AWMA 4E93A 3W33A 3FXXA 3R2YA 2W7XA 3UC3A 3TM0A 1JKKA 2R3HA 1PMNA 4UY9A 4WBOA 5KZIA 3VRZA 1TKIA 4BCPA 3QTQA 5CEOA 3I1AA 4IEBA 4CFNA 2EVAA 4QDEA 4FL2A 5HOAA 1H8FA 3GBZA 3MI9A 4QP4A 4BWKA 4JDJA 5DGZA 2A27A 4C61A 4UMQA 5GHVA 1XWSA 2X9EA 1YOLA 3Q4CA 1ZYDA 2W1CA 3NX8A 4I24A 4FTIA 3EZRA 4R6VA 3ZFXA 2B9JA 4YJNA 4BCOA 2GTNA 3U54A 3ZEPA 3OEFX 4BC6A 2W1GA 4X0MA 4A4LA 4I5CA 4QYHA 3BE9A 3NW7A 5TT7A 4NIFB 2X9FA 5F1ZA 3VHKA 4YTCA 3UBDA 1WBOA 3FYJX 2ZMDA 3WF8A 4BZOA 2C3IB 3CKWA 5IEXA 2VNYA 2VWIA 5IEVA 2V7OA 4RJ5A 2Y6OA 1APME 4F1TA 2IZUA 1V0BA 2XF0A 3UTOA 1K2PA 1XBCA 1IG1A 4IB3A 5IKWA 1XBBA 5D9HA 4ALWA 3BLRA 4QP1A 3A7FA 2WMXA 4QMSA 3BLAA 5HO7A 4I5PA 3NS9A 5AM7A 3M42A 2UZDA 3R63A 4WBBB 2XH5A 4BDGA 2CSNA 3F6XA 1Z5MA 4F7LA 3HAMA 3MYGA 5HU9A 4RVKA 5CNNA 3QCQA 3BHUA 1OM1A 3QCSA 3QTXA 2ZYBA 3CS9A 4FICA 2VTLA 3BWJA 2C6LA 3ELJA 3GEQA 4AXDA 4TXCA 4IAZA 3VULA 5CTPA 3UQGA 4ZTHA 3FKNA 5DPVA 1W2DA 2XCKA 3BYVA 5HVJA 4FKPA 2BUJA 2REIA 3KXHA 4M14A 2EU9A 2BRBA 3QZFA 3VW8A 3QQHA 3DXPA 4IVCA 4ZAUA 1OGYA 4AA0A 4YZMA 3PSDA 3R8MA 2DS1A 4ZTQA 1XMLA 3LMIA 1OZ1A 2ZV8A 1WBVA 2HENA 4XYFA 5KMLA 2GHGA 4U0IA 5HCZA 5LMKC 4C4EA 5M55A 5AR8A 4KSPA 5CEKA 2YDJA 4LDTA 5K0KA 2ZAZA 1VLRA 2CKEA 4G1WA 5I9ZA 3F2AA 3EN4A 3UVQA 3C5UA 5EM8A 3BBWA 4UXQA 4N57A 4X2FA 4BDDA 4A06A 3HV6A 4CVAA 1IA9A 3PDTA 4RRVA 3G9NA 4DHIB 2OSCA 5E90A 4XJ0A 2JIVA 3KF7A 2YAAA 2OJGA 3BU6A 5M4IA 5M51A 4GK2A 1PYEA 2B7AA 3C4FA 1OI9A 3D5WA 3OF0A 3ORLA 3QHWA 4ZZMA 3KCFA 4AOIA 2OFUA 5LMAA 5CEPA 2QHMA 1I44A 5M07A 3PUPA 2R3LA 4TL0A 5HICA 1KWPA 2OXDA 2YLFA 4Y83A 4JQ7A 4RIYA 1YOJA 1YXTA 2PVFA 3D2KA 4D2VA 4HVSA 3DT1A 2XIYA 3QXOA 3OMVA 3DB6A 3IS5A 4JVGA 2AQXA 5IUGA 4I21A 4AN3A 2PMLX 4RX7A 2CNVA 4CNHA 5EKNA 3TUDA 3NUNA 5AP2A 4ASZA 1A48A 3RAHA 3O23A 4IW0A 2WKMA 4GU6A 4IM2A 4N0SA 4S30A 4EH9A 5BUJA 4FGBA 2OZAA 3PZHA 3W8QA 4U8ZA 2YWPA 4L67A 3LM0A 3VS7A 4R3RA 3Q4ZA 4C38A 1KUTA 3F3ZA 1WVWA 5L6WL 3Q53A 4C33A 5I9VA 3VS0A 3FZTA 2CGXA 3DK3A 4RSSA 1RW8A 3TKIA 5CS6A 2R3OA 4AG8A 4K77A 5D10A 3I5ZA 3GUBA 5AV3A 2IO6A 1IAHA 3R7UA 4YZDA 3ZO1A 4IQ6A 5E8UA 3RZBA 4E5AX 1IA8A 1H07A 2EWAA 3ALOA 4D4RA 2ITXA 4CKJA 1KV1A 2I0HA 3LW0A 4G3DA 4YP8A 5I3RA 4F1MA 2W17A 4XS2A 3FPMA