2IVTA

Crystal structure of phosphorylated ret tyrosine kinase domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
313
structure length
288
Chain Sequence
GPLSLSVDAFKIPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVRALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR RET PRECURSO
publication title Structure and chemical inhibition of the RET tyrosine kinase domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 288
sequence length 313
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ivtA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ivtA01
2Z60A 4IWPA 2RG5A 4IZ7A 4FTTA 4JOAA 4XV9A 4C33A 3GCQA 1CKPA 1XO2B 2QKWB 3FMJA 2XIRA 4IE9A 5E8WA 2JIIA 3ZZWA 4CXAA 1ZYLA 4FNWA 4GT5A 2OJ9A 4S2ZA 2BAJA 4UMTA 4NJDA 3KULB 2GTNA 5FP6A 2WD1A 3LJ1A 1O6YA 4YZ9A 4NEUA 1G8SA 3MH1A 4LGHA 4J8NA 4RGJA 5FXRA 4FEVA 3FI2A 3BV3A 4GFMA 4M12A 3TUCA 4EUUA 2BKZA 2UW7A 1OMWA 2I0VA 4IM0A 3EOCA 3NW7A 4IJ9A 3THBA 4CQGA 4YC8A 5HVKA 4B9DA 2BZIB 5AIKA 4OTPA 4X7QA 4L9IA 1ZY4A 1PXLA 5IQAA 3ZRLA 5JRQA 2CCHA 3F69A 2WTCA 2WQMA 2XH5A 1GY3A 2ITVA 3EFLA 3LQ5A 3MH2A 1O6KA 3VWAA 4E3CA 5CAOA 5JFVA 1YWNA 3WF6A 4E6QA 4FKGA 4G9RA 2R64A 2WU7A 4MD7E 3G6HA 3KF4A 4IDTA 4F1MA 3EQBA 3FY2A 5CU2A 2I0HA 2V7AA 3SQQA 3OBJA 4G9CA 3HMMA 5IA3A 3R7OA 3FZSA 2OIQA 3NYVA 3HVCA 2DYLA 2J0IA 4IAZA 1YQJA 2R3RA 3FLWA 3OS3A 2B9JA 3OVVA 2ITXA 4JBOA 2QO2A 2IZUA 2QU6A 3JY9A 2ITTA 4IFCA 3FL5A 2R7BA 4QMUA 3BGPA 4BIDA 4C3PA 3PJ2A 3F82A 4E1ZA 4U6RA 1JLUE 3G9NA 2UZOA 3O17A 4LFIA 3M2WA 3R30A 5FDXA 3QRIA 3TNWA 1OI9A 3BHTA 5M44A 3DY7A 4OTGA 2PVKA 5J9LA 4CYIA 5FM3A 5LWMA 3I7CA 5M4CA 4GIHA 1KWPA 2W5HA 3GU5A 3OCTA 2A2AA 2YM7A 4QMWA 5AM7A 5A4LA 2BRHA 2ZB0A 3Q2JA 3QTUA 3T3VA 5LJJA 4E4XA 3Q6WA 4Y5QA 3MW1A 4YURA 1PY5A 4F64A 2IW8A 4EOQA 2OWBA 3NDMA 1H08A 3K3IA 3MVJA 3L9LA 1YDRE 3R22A 2GS2A 4IJPA 4HVHA 3S0OA 1Q3DA 2R3JA 5LVNA 3SXRA 4O2PA 3RVGA 5F94A 4AG8A 3LM0A 5EKNA 5HTCA 4EH6A 4G31A 4XG7A 2BTSA 5FQDC 3LKMA 2F2UA 2C0OA 4V0GA 4C2WA 2OF2A 1UKIA 4EONA 3FJQE 4MEDA 4JQ7A 4TWNA 2OJGA 2OJJA 1G5SA 3V5PA 4ZY5A 2HW6A 4DEBA 4N57A 4BYIA 4UX9A 2PVRA 3QX4A 3AD6A 4D4SA 2O2UA 4RWLA 4L00A 4BCFA 3VS3A 4TTHB 2PUIA 4KKEA 4CFVA 3TUDA 4XG2A 4DEHA 4R6VA 4MWHA 1M17A 2JDOA 3GNIB 3R00A 5BVWA 4L43A 4C02A 4MXOA 2J0LA 2F57A 3G6GA 5DWRA 3UO4A 3WZJA 4YJQA 1UNHA 4Y46A 4AT3A 3DKCA 1XR1A 3F2NA 4E4MA 4X3FA 4XX9A 3W8QA 4EOJA 5B7VA 5CANA 1WVYA 4OTHA 3R7EA 3I0OA 3NYNA 5IDPA 2H8HA 1UU3A 3MPTA 5AP3A 3R8PA 3NUAA 1H0VA 1OL1A 5GJGA 3A2CA 3COMA 3IOPA 4PDSA 4M0ZA 5CSVA 5HESA 3FE3A 3ZH8A 4L3JA 2WTDA 3EJ1A 4DG2E 4YUQA 5JMSA 3F3VA 5CVFA 1JKLA 5EHYA 4FT5A 4QQTA 5A46A 5HI2A 4RIOA 4UB7A 2WQEA 3QTZA 2NPQA 2X81A 4KS7A 4FSYA 3D7ZA 4FKWA 4QP4A 5DN3A 2VN9A 5DRDA 5CXZA 5HU9A 4GT3A 4WT6A 5DOSA 2PK9A 5HVYA 4ZY4A 3ZZEA 3FLSA 4GFOA 4ZAUA 3FV8A 4L3LA 3RM6A 3MB6A 1H01A 4D4YA 2EXEA 2W96B 3Q96A 3TNIA 5FUTA 3R28A 5CSXA 1J1CA 4TYHB 1PF8A 3CLYA 3I7BA 4MYGA 4RFMA 3EQPA 5J5SA 4P4CA 3VQUA 2JDRA 4WO5A 4MNEB 4D1SA 2XYNA 4LI5A 3TNQB 4EUTA 3PG3A 3RJCA 3VNTA 1ZZLA 5HNBA 2E9OA 3IECA 4U3YA 3C9WA 4ZOGA 3GGFA 5EYCA 5ETAA 2WU6A 3GEQA 4DA5A 4FSTA 4USEA 3TZ9A 3WF5A 2WMUA 4R77A 4YZDA 1J7IA 4JQEA 3FLYA 4O2ZA 3OT3A 4PL5A 2OGVA 4O0VA 2Y7JA 3OHTA 4QQJA 2YISA 5J7HA 5JN2A 2IVVA 3DXPA 4FV8A 2CN8A 2PZ5A 4ENXA 2PVJA 2F7ZE 4N0SA 3DNEA 4OW8A 4QQ5A 4RA5A 5CT7A 4C58A 5A14A 4QO9A 4M13A 4O0RA 2OZOA 3FPQA 2VWWA 1OECA 3OFMA 4OGRA 3UPZA 4O7SA 4RJ6A 5AAFA 4DCEA 5IQEA 2BALA 1J3HA 4BR3A 4JIKA 3UG2A 1XWSA 3O71A 3Q4CA 3RZFA 4C37A 3ZSGA 1WBPA 3H0YA 2WEIA 2GPHA 2XNNA 3NWWA 4KBKA 3ZFYA 2PU8A 2P3GX 4F7NA 4AZTA 4BBMA 4ZTSA 4E4LA 3QQUA 4HYHA 1SNUA 1VR2A 5DMZA 2XIZA 3R1SA 1DI8A 2UV2A 2RL5A 2UZEA 3EHAA 4PWNA 5ETIA 4AF3A 3ALOA 3NNWA 5ACBC 4YMJA 4M69A 1GIIA 4JVGA 4Z7HA 3D5VA 5J1VA 2VO0A 4JG7A 3TIZA 2UZVA 2CGXA 4UXLA 5F4NA 3W2SA 4BIEA 3UQCA 4XLIA 2X1NA 3M1SA 4I94A 4FL3A 4Q2AA 3PA3A 3A8WA 4QP6A 4YC3A 3MS9A 4BBEA 1ZAOA 3R9OA 3MA3A 3PPJA 5A4QA 3E88A 2G01A 3FXXA 4IVDA 2BAKA 3GC8A 3UG1A 2JGZA 3O50A 4YZNA 1YOLA 3ZO2A 1O9UA 4KABA 4F7SA 4F9WA 2WTKB 4AX8A 3MY1A 3PE1A 1ERKA 3TDVA 1XHAA 2R3KA 4DEGA 3IGGA 3R1NA 1Q5KA 4RWJA 4S33A 1ZARA 1NY3A 4N6ZA 4EOIA 2I7QA 1SVGA 3VW6A 3PE2A 4CEGA 1IRKA 3BZ3A 4IANA 3WZKA 3VS6A 1PHKA 2GQRA 3NCGA 3R04A 4H3QA 3HUCA 3JVRA 2FB8A 3RK5A 1OBGA 1FPUA 3KMMA 3UMXA 4QMNA 1R78A 4RFZA 3UIXA 2HYYA 5AR4A 2VTIA 4EH5A 4KBAA 4FKLA 2XKFA 5ETFA 2C6IA 2FSOX 2O5KA 2HWPA 5FG8A 5L6OA 4J52A 5AADA 4JBQA 3OW4A 4EHVA 3W2RA 5LOHA 4GT4A 5AV1A 3DDQA 4FBXA 4F0IA 5CEKA 1W8CA 5HCZA 4YNOA 4L67A 4CCUA 2HZ4A 3VHKA 5KMKA 2W1CA 3VUTA 3C0HA 3BQRA 4YJOA 3BLQA 3UYSA 2X39A 3OWJA 3UZPA 4BCMA 4HGEA 4YHFA 2FSMX 3HMPA 2V62A 2CKPA 2VWIA 4L6QA 5I3RA 5I9VA 3SRVA 3AQVA 5FM2A 2VTQA 4UWCA 4Z16A 2A1AB 4KS8A 3RI1A 3KU2A 4G2FA 1LPUA 2JKMA 4QMPA 4ZTQA 3B8RA 4QYGA 3VF8A 5G1XA 2BRMA 3ZU7A 4G16A 4EH2A 4GKIA 2WXVA 4DGNA 3T3UA 3KC3A 3ACJA 3D9VA 3FI4A 2P0CA 3QQJA 4M97A 3KRXA 3RPOA 4RIWB 3BRBA 4PPBA 2EUFB 2I1MA 3QCYA 2O65A 4ZTLA 5BYYA 3U55A 4RLKA 4TRLA 5EM7A 3ZRKA 1OIUA 2VO6A 4KKGA 4O1OA 1WCCA 2WMWA 4AGWA 4ZJVA 3TJCA 1FBNA 5IEYA 2XJ0A 3MN3A 3NS9A 2OO8X 2C6OA 2QCSA 3TKUA 5IQHA 2W1HA 4O7VA 1SZMA 1ZOGA 2XEYA 4XEYA 5HNGA 1MQBA 4LQMA 4F0GA 3QUEA 2PVFA 3EQIA 3RINA 4K33A 4P5ZA 4F9YA 3UC3A 2IN6A 2UZNA 2VGPA 3UNJA 1OUYA 4FSNA 5BNJA 4L52A 3D4QA 1UU9A 2W05A 3LCSA 3QQKA 2YN8A 3R7UA 3COKA 3HV7A 3ZO3A 4MVFA 4MK0A 5LVLA 4X6QC 5HTIA 4YC6A 3DNDA 5FTQA 3PUPA 4I6QA 4HGTA 4GU6A 4G5PA 4QMQA 4MQ1A 3GI3A 2VTPA 3PP0A 2IWIA 1YOJA 4PNIA 2Z7RA 3DOGA 4O0UA 1XJDA 4N70A 5I4NA 3CPBA 3NW5A 2YLEA 3EFJA 4YNEA 3OW3A 1M2RA 2IZTA 2XB7A 3AMYA 4MQ2A 1MRUA 1OUKA 1OKWA 2R2PA 2YCRA 4IZYA 4O0TA 4AA0A 3UGCA 3QGWA 1IA8A 1URCA 4KIKB 3HMOA 5GIPE 4DINA 3NIZA 3EZVA 3VBTA 3LJ2A 4A4OA 3F2AA 4HPUE 3NEWA 2JAVA 3PJ1A 4OTFA 5KO1A 1JAMA 5GHVA 3ZFXA 3QKLA 5DRBA 3ORTA 5GZ8A 5EW9A 1UWJA 3EMGA 3FXWA 2VWUA 2XNMA 1M14A 4BYJA 4C61A 4CCBA 4KUJA 4FGBA 4E7WA 3KEXA 4GU9A 1WVWA 4QP8A 4D2TA 3MFSA 5CI7A 2G1TA 1R3CA 3T8OA 5KMJA 1YWRA 3ERKA 1B38A 4PDPA 4HVIA 1OIQA 4K2RA 3VS0A 2PTKA 5DFPA 2Z02A 3KB7A 2GFSA 3E7VA 3TCPA 3VS5A 4J71A 2VX3A 5AP1A 4KIPA 1Q4LA 5EDQA 3PPZA 5JQ5A 4WNOA 3HA6A 4E4NA 2WMXA 3BLHA 3FQEA 4JBVA 4M69B 3N4TA 1OL6A 2B55A 3FXZA 3Q4TA 5CAVA 2ITQA 2R4BA 2XIKA 1BMKA 2IG7A 3DBFA 4FTIA 1YXXA 3ZUUA 2WQOA 1NA7A 3QZGA 4GG5A 4MBLA 4EHZA 2I6LA 4WBBB 1PXKA 2QR8A 5ETCA 3TT0A 5BUEA 3DLZA 1OVEA 5M57A 3FLZA 5CU0A 5HX8A 3Q9WA 2B1PA 1V0BA 2OFVA 3H0ZA 2JIVA 3TNPC 4LG4A 2J2IB 1KE9A 4YR8A 2A4LA 4L53A 4G6NA 3H4JA 5E92A 3I6WA 1Q8YA 1M7QA 3FDNA 4W4WA 1IG1A 5AR8A 4C35A 2UZUE 3DZQA 4QTEA 2OH4A 4FTAA 5HHWA 3TZMA 2JDVA 2OZAA 3MVHA 1PXPA 4FKPA 4JX7A 3RAKA 4I41A 4DTKA 3ZM4A 1JKSA 3RAHA 3E63A 5GZAA 5HLWA 3DJ7A 4ZLOA 5IA1A 2IVSA 3ET7A 4IH8A 2HY0A 1KE6A 2GFCA 2XNOA 3SC1A 3NUSA 4GG7A 3RAWA 4I22A 4FSQA 5JK3A 5AM6A 5A6NA 2RGPA 3CXWA 4X6RA 5BVDA 2J51A 1TKIA 2VTJA 1OIRA 2Y4IC 1YXUA 4FYOA 4NM7A 4PP7A 5IA2A 1G3NA 1Y8GA 4R3RA 4YTFA 3CQUA 2WTKC 3E8CA 2XCHA 4C4IA 4FUXA 5TF9A 4B6LA 5J9ZA 2P2IA 4ASZA 1BKXA 2VTSA 3EYGA 3VJNA 1PYXA 2QLUA 4LMNA 1F0QA 2X8IA 3N9XA 4P5QA 4W9WA 5CWZA 2GNFA 4IX4A 5F95A 3S00A 1KE7A 1GAGA 2ZM4A 3MVMA 3L8SA 4AZWA 4DH3A 4PX6A 4H36A 3SRVB 4AZFA 4PF4A 5CSWA 4AGCA 4FMQA 2LGCA 4U97A 2BIYA 5D12A 1R1WA 3TV7A 4TWOA 3KXNA 4I92A 4NZWB 4F9AA 1W0XC 3QXOA 3QUPA 3F5PA 3AGLA 4UZHA 5H8EA 2ZVAA 2HENA 3NYOA 4USDA 5AUUA 3CD8A 3EL7A 1J7LA 2YWPA 2J5FA 4TPTA 5J87A 5IUHA 4E26A 4UV0A 1NVQA 4G17A 2JIUA 2R0UA 5DHJA 2C6TA 3QZIA 3RBWA 3HDNA 2ITUA 3LFBA 1CKJA 2FYSA 3KXHA 4PY1A 2HCKA 2XUUA 4XP0A 3W2CA 4FTUA 4V04A 2C3LA 1P14A 5L2IA 2B9IA 2R9SA 3EYHA 2Y0AA 2ESMA 4GW8A 2R3FA 5BVOA 3QL8A 5FBOA 2QLQA 3TN8A 2J0KA 3BIZA 3R8VA 3IDCA 5J9YA 3D7TB 4E6DA 1SVEA 3AOXA 4QMSA 2HELA 2OKRA 3BU3A 4S32A 5E8YA 4RX7A 5A4EA 3KCKA 2CKOA 3AT2A 4LRKA 2BDFA 3NUXA 4FE2A 4BKZA 4ZSEA 5HBHA 1PXMA 4JR3A 5E8TA 2PVHA 3O8TA 1JQHA 3H9FA 3TXOA 1SNXA 1YDSE 4BL1A 3ORZA 4TT7A 5DI1A 4BCJA 4IX3A 1IA9A 1V0OA 2ITZA 2VWXA 4U80A 4HVSA 2QC6A 4XLVA 3SXSA 3UMWA 4ACCA 3RM7A 4O6LA 4DGOA 3MVLA 4LRJA 3VC4A 4DG0E 4YJVA 2OXXA 1WBNA 1K2PA 3HRBA 3PDTA 3FEGA 1LEWA 3ORLA 4WUAA 2GS6A 4AP7A 1G8AA 5AUXA 1OITA 3DAJA 2PZRA 2J6MA 3WZUA 4FC0A 3VUHA 3GB2A 5FGKA 2B54A 4BHNA 4GMYA 3ATTA 5E8UA 4BDDA 1QPEA 4EQUA 3R7VA 4BGHA 4ZJIA 1FINA 4Y85A 5K0KA 4RA4A 3VJOA 5M4IA 4QP3A 5IG1A 3D94A 3LCTA 3AMAA 5BMSA 4AGDA 3HUBA 2EXMA 5EFQA 5HE2A 5E8VA 4DH7A 4JG6A 2BTRA 3CGOA 5D10A 4ANSA 4BB4A 3EQGA 3K2LA 2OLCA 5FP5A 3IOKA 2VAGA 5EHOA 5CZHA 2XNBA 3PIXA 4N4SA 3UIUA 3PJCA 3SW7A 5L8KA 3LHJA 3ORNA 3BBWA 2X2LA 3HP2A 3KXXA 4O1PA 5BMMA 2RFSA 3O2MA 4TYIA 2UW8A 3VRZA 4K9YA 2UZLA 5CY3A 3U87A 1Q99A 4EZ5A 5KX8A 3E3PA 3R63A 5EM5A 5IA0A 3F7WA 3FKNA 4G5JA 5CYIA 4A4XA 4NKSA 4ANBA 5I5ZA 4FIJA 4DT8A 3K3JA 3P86A 5EYKA 5LMKA 1JBPE 3VW8A 3CIKA 4L68A 4WNPA 4FV0A 3ZDUA 3GC0A 4EK5A 3LOKA 3W18A 3GC7A 4FSWA 4E8AA 1PRYA 3GFWA 4H05A 4F08A 5KBRA 2W1FA 3MFUA 3NW6A 3MB7A 3QD2B 2C6LA 1H24A 4XMOA 2GDOA 2CLQA 3IONA 3W2PA 3QZHA 3C51A 1W7HA 5I0BA 2JITA 2WKMA 4DEIA 5AX9A 4MWIA 3CY2A 3AMBA 1U54A 2QHMA 1B6CB 3EN4A 2A19B 1XH6A 3MI9A 3MTLA 3EH9A 4RBLA 2P55A 3FQHA 3PP1A 3P1AA 4FV1A 5HO7A 2HXQA 3FZPA 3N4VA 4RRVA 4XCUA 5C01A 4QTCA 4U42A 3AC5A 4CYJA 3JYAA 2OICA 1STCE 5F20A 2A0CX 2GNHA 3W1FA 4BCPA 4PNKA 3U4WA 4AGUA 4Y5HA 2O3PA 2C0IA 1RDQE 4APPA 4BDAA 4QP7A 4XOZA 4ZTHA 2HAKA 4YU2A 4G3GA 4JNWA 1LEZA 3MH3A 4FKTA 5ITAA 1Y6AA 4FTLA 4JDKA 4R8QA 3KKVA 3NVMB 4PUZA 3R83A 3E92A 3I81A 5EOLA 4EOPA 2ZM3A 5D41A 1YOMA 5BUJA 3QRUA 5LWNA 4FEUA 4FZ6A 4C34A 3LCKA 4W9XA 1KV1A 2ONLA 2CMWA 4ACHA 2YIYA 3DZOA 3FMNA 5HQ0A 5HKMA 1XH8A 3FMMA 3AC4A 4U81A 4X2JA 2VD5A 3VO3A 4FL1A 4MKCA 4AT4A 2PUPA 4FL2A 3VHEA 5C4LA 4FKRA 2HZIA 4R5SA 3OD6X 3OXZA 3F66A 3VBVA 4IADA 2JD5A 4O0XA 5H9BA 3Q9ZA 4LYNA 2F9GA 1YDTE 4RIYA 4UXQA 3BHUA 5EYMA 1OM1A 3WOWA 4GEOA 5IH6A 5BVKA 3LFDA 4AW0A 5DVRA 2AC5A 4E20A 4J8MA 3NSZA 4G3EA 5IA5A 4DF3A 2XNGA 2VRXA 5E1EA 4IWOA 4E93A 4D0WA 4UYNA 3HKOA 5EQEA 2Z7QA 1SM2A 3LIJA 1FQ1B 5DE2A 3BX5A 4CG9A 4BTJA 4LL0A 4M68A 4WUNA 3UP7A 2JFMA 4BDJA 3DT1A 5AMNA 2P4IA 3QWJA 4LOPA 4EYMA 2RG6A 1Q24A 3C5UA 1ND4A 4BCIA 4RG0A 2YDKA 2GQSA 5KHWA 4BC6A 4AXAA 1JSVA 4EOKA 4L46A 2VZ6A 4UBAA 2J7TA 3MV5A 4FIIA 4F70A 5F9EA 3KXMA 5KMOA 2OIDA 4JI9A 4OAUC 4EWHA 5TE0A 3PA5A 3ENHA 2UZWE 3HMIA 3Q5ZA 3BWJA 3C4XA 5T6KA 3RNIA 4RIXA 4CMOA 3F3UA 2C5OA 3UE4A 1P5EA 2XKDA 4GKHA 2VWZA 3ITZA 3W33A 3UNZA 2C30A 5LMBA 5IEXA 5GINE 4U9AA 5JZNA 3VUKA 1W82A 3SA0A 1W84A 2W5BA 4FV9A 4NWMA 4WOVA 3OCGA 3QD3A 4FV3A 2KTYA 4XV3A 4JBPA 4R3CA 3G0FA 3QXPA 2X8DA 3ZXTA 4OBOA 2W1EA 3Q9YA 1AQ1A 1WFCA 2R3GA 3NNUA 3QYWA 4A7CA 4E5AX 1JWHA 4FIFA 2J0JA 1CSNA 3LFNA 3QC4A 3KN5A 2YAKA 1GZKA 4F7LA 2X7OA 2VV9A 4O81A 4AN2A 4Z7GA 4DGLC 5FDPA 4FEWA 2X6EA 4FZDB 1JKTA 3IW8A 3OWKA 4XG8A 5L2TA 3EFWA 4E6AA 3EN6A 5DYJA 1BI8A 4E6CA 3DK3A 3TV4A 2X0GA 3GP0A 1OKVA 4FT0A 4FSZA 4CMUA 3PIYA 4HNFA 2W7XA 4Z9LA 3SLSA 2JAMA 3MYGA 4Y73A 3BELA 2C0TA 1RE8A 5DT4A 2FSTX 5HBEA 2AC3A 3JVSA 4I20A 3OBGA 4KSQA 4MF0A 4NM5A 4WG4A 5AR2A 2GNLA 5CEPA 4I0RA 4JS8A 4BTKA 5AAEA 4D1XA 2XF0A 3I60A 2R3PA 4CZYB 5IMXA 3PVWA 5CEQA 3VULA 4YGAA 2ACXA 2I0YA 4CKRA 4O7RA 2OIBA 3OOMA 2W4OA 3HX4A 4NYEA 4ZMEA 3R9RA 5LCKA 4RFYA 5I9UA 4O6EA 4ANQA 3BBTB 4AOIA 3R73A 2YCFA 3DFAA 3FSFA 5D7AA 2GU8A 4QP9A 3S95A 3KRWA 4HZRA 5JZJA 2O63A 2QOQA 2XA4A 1LUFA 5DEWA 2QOBA 4Z3VA 3HV5A 3II5A 3LXPA 5A3XA 2VTLA 3CTQA 2CKQA 2XK4A 4X0MA 5CU4A 5M08A 4XOYA 3MJ2A 4YHJA 5IU2A 3QA8A 1TQMA 3ORPA 3NIEA 3QUDA 2YDIA 3O7LD 5J5TA 2F7EE 3ORXA 4C4HA 3P7CA 4E5WA 1Z5MA 3WF7A 4EH3A 1Q8TA 5IQCA 4D1ZA 2WZJA 2VGOA 2QOOA 4F9CA 3D0EA 2YM5A 3ZUVA 3ETAA 2VNWA 4MHAA 3PIZA 3ZONA 4BDGA 3HAMA 1H1QA 5AUYA 3ZLWA 3L9NA 3PJ3A 2VNYA 4W4VA 4O22A 2PMIA 4ASEA 3JR1A 2XBJA 1K9AA 4PMTA 4YTHA 1W83A 3ZBFA 3DKFA 4IB5A 5B2KA 4C59A 5GIOE 2ZMDA 2BDWA 2C6DA 3BV2A 3MPMA 5I9XA 5IQGA 2R5TA 4QD6A 5AEPA 4BKJA 4C3FA 3S2PA 4H1JA 1UNGA 4XP2A 3OEFX 1TQIA 2JC6A 3DLSA 3KRLA 3MA6A 4I5CA 5DT0A 4BCKA 4DFXE 5A54A 3DTWA 3WYXA 3G15A 2X9EA 3DXNA 3GU7A 3A8XA 3NUNA 3POOA 3NGAA 2W1IA 4X2KA 2XK8A 1S9JA 3DCVA 4RSSA 4RVMA 3VUMA 4XBRA 1CTPE 4RC4A 1KV2A 5CSHA 3OXIA 4M67A 3JY0A 2UW9A 4FI1A 4QP1A 4YLKA 2REIA 3GQIA 4IEBA 1GZ8A 2WGJA 2UVXA 4KB8A 3MDYA 4M8TA 5K4IA 3GXLA 4P90A 4W4YA 2WTJA 4A06A 2YIXA 5JRSA 3DB6A 2ERKA 4ANMA 3EQFA 3F6XA 1ZLTA 4X2FA 3DKOA 3LXNA 3DAKA 3FC1X 1PJKA 4FG8A 5TR6A 4NFMA 4A07A 3V8SA 4BDHA 3CY3A 3L8PA 3JPVA 2Q83A 1YI4A 3TKIA 3DS6A 2DUVA 3C4ZA 2WNTA 3PVGA 4FT9A 4JIAA 2CDZA 4EL9A 4F1OA 4RIYB 4FODA 5HORA 5AUZA 4G1WA 3BYUA 2IVTA 2W5AA 3G5DA 5BVNA 2RF9A 2X7FA 2OSCA 4QP2A 4FG9A 4YBJA 3UODA 5IH5A 5CAUA 3MY0A 4CLIA 1QPJA 2EVAA 3BGZA 1APME 3QLGA 5T68A 5AWMA 3RAIA 3GOPA 3ZS5A 4F09A 2YM4A 1U4DA 5HE1A 3TI1A 1ZMVA 1H25A 4RJ4A 3C0GA 3EB0A 4Y8DA 4FEXA 3O8PA 4YTIA 3PY0A 1BUHA 1DS5A 4IAKA 3UIMA 4EK6A 2HIWA 3CR0A 3GVUA 4QTDA 3W2QA 3FZTA 3UIBA 5JFXA 2W0JA 3DPKA 1MRYA 3F3TA 1OL5A 1FGIA 4NCTC 4ZP5A 4OLIA 2EU9A 4OTRA 2BDJA 4DYMA 3HA8A 4PRJA 5T3QA 2FA2A 4RJ7A 4ALWA 1MP8A 5EHLA 1Y91A 3L9PA 1M52A 4ZS4A 4FOCA 5LARA 3ZC5A 2BHHA 4PP9A 4J7BA 4RIXB 4EQMA 3RPVA 5K9IA 4UN0C 4EK8A 4U7ZA 2BFXA 4I5MA 2GS7A 2PY3A 3R9HA 3DDPA 1L3RE 1WZYA 2HK5A 4WNKA 4DHFA 1TQPA 4CZUA 4F4PA 2CLXA 4BZOA 4C3RA 3F5UA 4HNIA 1U5QA 4CV9A 1GZNA 2R7IA 3FYJX 4FTCA 4V0GB 5KBQA 3MH0A 4PPCA 4OUCA 2BRGA 2XM9A 4LMUA 3K54A 3REPA 4C38A 1IAJA 4ZS0A 4FT3A 4KD1A 4LGDA 2BZKB 2PVMA 2JEDA 4NIFA 1PW2A 2R3OA 3V8TA 3CJGA 2BMCA 3P4KA 5CTPA 4DEDA 4DH8A 3TZ7A 3AD4A 4DH5A 4PDYA 4RPVA 3U8WA 2V55A 4ZK5A 2XNEA 4A9YA 4JQ8A 3KRJA 4PTCA 5IF1A 4EYJA 5M07A 2E2BA 4EK4A 2PUUA 3AT3A 2J5EA 3C4FA 5AFVA 4EH7A 3UPXA 2OBJA 5EQYA 2PWLA 3R1YA 5JGAA 2GMXA 4GJ3A 3FMEA 4O96A 5BVFA 4WG3A 4AU8A 4O7YA 5ICPA 4EQCA 3RWPA 4X3FB 1M2QA 5I3OA 1WVXA 2OJIA 5FD2A 4RJ3A 5HZNA 3CTJA 3OP5A 2XNPA 2BVAA 4FK6A 4IQ6A 3ROCA 3B8QA 4BI1A 1VYZA 3ZO1A 3Q4ZA 1F5QA 2B9FA 3L9MA 4HOKA 4NM0A 3OWLA 3ATSA 4CVAA 3Q6UA 4E73A 3VBXA 3DV3A 4BI0A 4K0YA 3GOKA 4Q9SA 3UO5A 2H6DA 4HZSA 3RNYA 2UZTA 3P7AA 4IHPA 4JR7A 4C62A 1Q41A 2V22A 3L8XA 4XJ0A 3O23A 1VYWA 4QYFA 4YJTA 4ASDA 2PVNA 2PMOX 1SVHA 3A4PA 5D1JA 3KK8A 4YZBA 4I4FA 4YPSA 5ANJA 4EOMA 2PL0A 4F6SA 1UU8A 4QMOA 1ZYCA 2ETMA 3TM0A 3DQXA 4O86A 3P0MA 3CC6A 3I5NA 3ZTXA 3LAUA 3FKLA 4ITJA 4MD9E 4A4LA 5C8KA 4IAAA 1Q3WA 3KL8A 4PV0A 4A9UA 5ANIA 2BCJA 3AXWA 3HEGA 3QU0A 4BVUA 3DGKA 4CFXA 3UNKA 3V51A 1GJOA 5HD4A 4D4VA 4AAAA 1VZOA 3Q5IA 1YI6A 4NK9A 2X7GA 3LZBA 3PRFA 5AIRA 4C7TA 4UMRA 3F7ZA 4FA2A 4N6YA 3U9CA 4C4EA 3RK9A 3OROA 4BKYA 4FZFB 4HYSA 4WRGA 4IX6A 4GS6A 2XCKA 3A7GA 4TXCA 5CI6A 5JFWA 4UMUA 1UV5A 4QRCA 5HEZA 2C3KA 1IAHA 1XH9A 3C4WA 3S3IA 3PY1A 4MXCA 3PLSA 3CJFA 3DB8A 2XS0A 3LLAA 2W99B 3RWQA 2C6MA 3MIYA 2WTVA 3E64A 2E9VA 4YJRA 1IEPA 4Q5HA 5TT7A 3CQEA 4MD8E 4NSTA 4TWCA 2C6EA 3D14A 4MXAA 5IQIA 5HOAA 4RWKA 2GNGA 1YVJA 3A60A 1OL7A 2Q0NA 3BYOA 5CF8A 1H1SA 4ZZOA 1TVOA 2UW5A 3QTXA 1H8FA 4ANNA 3UC4A 4TNBA 2ZDTA 3FPMA 4AZEA 4C57A 2CHLA 3KRRA 4PL3A 3T9TA 4FV5A 3RTPA 3C13A 2WTIA 3PSBA 5K0XA 3VQHA 3K5VA 3PZEA 4OBQA 2XMYA 5M51A 3OC1A 2XKEA 4FK3A 5FXSA 4IAYA 1VJYA 4XG4A 2W1GA 3C0IA 5M53A 3LPBA 2O0UA 4IC7A 4L7SA 4C0TA 1MQ4A 1F3MC 4ITHA 4IC8A 4KA3A 2R3LA 3LM5A 3QQHA 4I93A 2FUMA 4HVGA 1NXKA 3LFCA 4HCTA 4O84A 4BY9E 4EZ7A 3PXYA 4U8ZA 4YLLA 4ZTMA 1WBSA 2F2CB 2Z7LA 3I79A 3QA0A 3VS4A 4FYNA 4EJNA 4PQNA 2CGVA 3FUPA 3SG8A 1RJBA 4CT2A 4AACA 2J9MA 3U6IA 1IASA 3IW5A 3FZRA 2VO3A 3EN7A 4BBFA 1PMVA 4U41A 4FT7A 3WI6A 4I24A 3QRJA 4FKUA 3FBVA 1YHWA 2YJSA 2VTAA 3FKOA 5DBXA 4KWPA 2YCSA 4V05A 1ZMWA 5K4JA 1P4FA 3QTSA 3UYTA 2QI8A 2ZB1A 1QMZA 3Q32A 4QYYA 4YO4A 3DKGA 1H27A 4TYEA 4QPAA 4R78A 4R7HA 3TKHA 3NMUF 2EB3A 5IH4A 3PSCA 3ZM9A 3QD0A 1P4OA 3V6RA 3I1AA 4HYIA 3NYXA 2PVLA 5HGIA 4RQVA 4RX9A 2YM3A 2OXDA 4LRMA 4BDBA 4CTBA 1CKIA 1CDKA 2ITNA 1XH4A 1H28A 3HRFA 5BYLA 3V3VA 2C47A 4NT4A 1FVTA 5E4HA 2Y4PA 4IVCA 1Y8YA 1Q62A 4IMYA 2NO3A 3DK7A 4J95A 3UBDA 3DA6A 2E9NA 1PXOA 2PUNA 1A06A 4I6BA 5M06A 3CP9A 3KULA 2XVDA 3FHIA 5BYZA 3ULZA 3KCFA 3E8EA 3GBZA 5M09A 5J79A 2UVYA 1DI9A 4I3ZA 3BI6A 4OTIA 4G6OA 5D7VA 4ZZNA 5CXHA 3CGFA 4PMSA 2EWAA 3A7FA 4NIFB 2PZYA 5IUIA 4AE6A 3R8LA 4JX3A 3FMKA 2GNIA 3CE3A 4IX5A 1XQZA 5EG3A 3QCSA 3Q52A 3HLLA 3ODZX 3OCBA 4FF8A 4GFGA 4FKJA 3VUGA 4DTBA 5FBNC 4FSMA 2QD9A 4JRNA 3IGOA 4YJUA 3U51A 2BAQA 2WO6A 2ZV9A 5DIAA 2B4SB 5DLSA 5DH3A 3ZMMA 2YA9A 3SW4A 4ACGA 1J91A 2WQBA 2XIYA 4A9SA 3ZEPA 2WMTA 4A9RA 4FNZA 4ZJJA 2PZPA 4IFGA 1GIJA 2HXLA 1WBTA 2YJRA 4TYGA 5HVJA 1KUTA 5KCVA 1ZYSA 2F49A 3PPKA 2UW6A 2E9UA 3ODYX 4OBPA 4D2SA 3NUPA 4KINA 4NU1A 2BIKB 3TACA 5HTBA 4MAOA 1X8BA 2VTOA 4DLIA 2XK6A 3PRIA 4BWXA 4WNMA 4FVPA 3E8DA 3WZDA 4PL4A 1H4LA 1JKKA 4WA9A 1IR3A 4HGSA 4HPTE 4ZY6A 3MWUA 4G3DA 2CNVA 4XNEA 5ANEA 5JEBA 5TOZA 2C5YA 4V01A 3FHRA 3QRTA 5KMNA 4K8AA 3GU6A 4DN5A 1PXNA 4KAOA 3R7GA 4M0YA 2NNWB 1U59A 2EXCX 4HGLA 3D15A 2W4KA 4QMXA 4GJ2A 4X3FC 3OWPA 5JGDA 3VVHA 4XS2A 3FC2A 1H0WA 1XBAA 2VWYA 3KXGA 3RHKA 4Z55A 3FWQA 5EM6A 5KMLA 3D5WA 4WSQA 3ZBXA 4O7NA 2Q0BA 5DG5A 4D9UA 5ANOA 3IW6A 2XK3A 3MGYA 4ZLYA 3AG9A 2PE0A 4MNFA 2ITYA 1PMEA 4NW5A 4O7WA 3RPRA 2QHNA 5AV0A 3QALE 3EL8A 4NJ3A 3RK7A 4KIQA 2XJ2A 4EKKA 4AT5A 3KF7A 2BHEA 3ORKA 2PSQA 5A4TA 4MXXA 4CKIA 3F61A 4FOBA 2QVSE 4F1TA 4IAFA 1H26A 3NUYA 5CNOA 4O7LA 1ZMUA 2VWVA 2V0DA 4O7ZA 4ZSGA 4YJNA 2G9XA 2VTHA 1A48A 5LXMA 3BEAA 3C1XA 3EQHA 1JNKA 3PXQA 3F3WA 3OOGA 3E62A 4G3FA 2HW7A 3ZEWA 2CGUA 4CQEA 1JSTA 4PPAA 2CPKE 2G2FA 5M4UA 3R8ZA 3PTGA 4ZTRA 2WAJA 5E7RA 2ZMCA 4O0YA 4RT7A 2GHLA 3GCUA 3W8LA 4UMPA 4AQCA 2YHVA 4GUEA 3N51A 4WD5A 1PKGA 4BWKA 3PXRA 5JSMA 4CLJA 4LUDA 5J8IA 3PVBA 1OZ1A 2YIRA 4IZAA 4EOLA 5IQBA 3SV0A 4D58A 3OMVA 3PY3A 5DPVA 3S4QA 1K3AA 3T9IA 2OW3A 3POZA 3BEGA 3QLFA 2UW4A 2YERA 4M3QA 4FNXA 3R7IA 4XV1A 4WRSA 5G6VA 2WMVA 4BCGA 3G33A 4XH6A 4IM3A 5FTGA 3WE8A 1W98A 2ZV8A 1VEBA 3E3BX 4AZSA 4CFNA 2JKQA 5CF6A 5L4QA 2IZRA 3H3CA 4OT5A 5HE0A 5FEDA 3VS2A 4ORKA 2WTWA 2J0MB 2QODA 4RWIA 5DR6A 5AX3A 2H96A 2OG8A 4YZMA 2BRNA 4AW2A 4RX8A 4TYHA 1M2PA 2YDJA 3OCSA 5C4KA 5L3AA 3RPSA 3QWKA 4BDEA 4MNEA 3CPCA 2OZAB 2IW6A 5F1ZA 3RKBA 2PZIA 3QTRA 4FTOA 2QOLA 4HCUA 4PMMA 3CS9A 5A9UA 5KMIA 2WMBA 2OXYA 1SYKA 3F9NA 3OT8A 3PXKA 3KFAA 3BPRA 3TJDA 4QQCA 5HLPA 5AA8A 2GCDA 2WQNA 5AUWA 4RX5A 3EWHA 5C26A 4QTBA 1FMKA 1YWVA 4KBCA 2BZJA 5IMEA 4AZVA 3LFFA 4I0TA 1H1PA 2W4JA 3ALNA 3QCXA 4FUYA 2UUEA 3LCDA 4AOTA 1URWA 3NCZA 4F6UA 3E93A 4I1ZA 2QURA 3PZHA 4UEUA 3N4UA 5KKRB 1GOLA 1DAYA 2ITPA 2BUJA 2YLFA 1H1WA 3WILA 3TG1A 4YSMA 1KE8A 4AFEA 2QG5A 2WFYA 3ANQA 4C4GA 5JT2A 4NW6A 5KHXA 4C2VA 3F3ZA 5E91A 2B0QA 2C5XA 5AP5A 3DBCA 1HOWA 4IVBA 4ZTNA 3QTIA 3W32A 4JG8A 3O51A 4F99A 2ZOQA 2JKKA 3E87A 3BHYA 2HWOA 3DBQA 4U44A 4WBOA 3R8MA 3BCEA 4AWIA 2BKKA 5IQFA 3P23A 2YAAA 3IDBA 4FKIA 3TEIA 3IG7A 3UJGA 3EN9A 3GCSA 4G3CA 3Q2MA 3OY3A 3DK6A 2WEVA 4F6WA 4CG8A 1YHVA 4R7IA 3R8UA 4RVLA 1H1RA 1V0PA 1NVSA 4FX3A 3UOKA 4OAVB 4O91A 4O21A 1NT2A 2UZBA 3ANRA 3DQWA 1XBCA 2UW3A 3GCVA 4FTRA 5KUPA 2ETKA 3TDWA 2BZHB 4HJOA 5AP7A 3FI3A 4UWBA 5AR5A 4GK2A 3R2YA 4R3PA 5M55A 5ACKA 3FY0A 3RZBA 3MSSA 4CTCA 4D2PA 4XRJA 4NL0A 4QT1A 3R02A 5EKOA 4EORA 3WARA 4CRSA 2FGIA 2YM8A 4LM5A 5FLFA 5GJDA 3EQDA 4J98A 4U0IA 2ZJWA 3MBLA 3HP5A 1UNLA 4ALVA 4CNHA 1Q97A 2XJ1A 2HY81 4YSJA 3L8VA 3LMHA 2R3QA 3S1HA 3CEKA 2RKUA 4U40A 3MPAA 4FTNA 3NUUA 4XG6A 4J97A 3HAVA 3FLNC 4BRXA 3WIKA 1Z9XA 5AP0A 3W16A 2WOTA 2YACA 4ARKA 4BWPA 4JDHA 4ASXA 3LFSA 5HD7A 4XP3A 2QO7A 3PFQA 3HNGA 5JFSA 4ERKA 2B53A 4RLLA 3B2WA 2H9VA 3R2BA 4IM2A 5HX6A 2XP2A 2Y6OA 4ALUA 2Z7SA 5LVMA 4MX9A 1KOBA 4FEQA 5LCJA 4UWYA 4FV4A 4ANOA 3AC1A 4D2RA 5A4CA 4M84A 5CEMA 5HG7A 3V6SA 4FTJA 5H3QA 2YM6A 2OU7A 5AR7A 3WF8A 3D5XA 3VAPA 4XUFA 3CKWA 2YIWA 1AGWA 3H9RA 4IB0A 5B2MA 3OTVA 3R0TA 1UVRA 4LV5A 1M7NA 3QTWA 1FMOE 3RPYA 3FLQA 4K11A 1AD5A 2J90A 3ZYAA 2OFUA 3D83A 1QL6A 5EDPA 2X4ZA 3F5XA 1Q8UA 3NAXA 5HE3A 2Y9QA 1I09A 4YP8A 2CKEA 4QMZA 4BDFA 2QR7A 3RMFA 3W55A 3E7OA 2RIOA 3C5IA 5A6OA 3V01A 5L6PA 3EFKA 3TV6A 3G0EA 5GZ9A 5EK7A 4BF2A 1OPLA 3GU8A 3FAAA 4YBKA 4DH1A 3K5UA 5HO6A 5KZIA 5D11A 1JOWB 4QMTA 2QOIA 4AA4A 3ZC6A 4EC8A 2R3IA 3DFCB 3RP9A 3KA0A 3V5WA 3FYKX 1FOTA 3GU4A 1FVVA 4RIWA 3MY5A 4ZSLA 2IO6A 5I9ZA 2VTMA 4RJ8A 4BGQA 3AT4A 2B52A 3QF9A 1ZWSA 3G51A 3GT8A 3H10A 2ITOA 4FNYA 4H1MA 4IXPA 1P2AA 4TZRA 4U79A 5BX0A 5LQFA 3TIYA 3C50A 4FV6A 3BYSA 4M15A 3ZO4A 5E1SA 3VBYA 5LVOA 1WAKA 4LOQA 4DG3E 3PA4A 4I6HA 4K77A 3QGYA 3CCNA 2P33A 5EQPA 3LE6A 2SRCA 4GSBA 3LXKA 3PJ8A 4AA5A 4BIBA 4DAWA 3NLBA 4RMZA 3U6JA 3IS5A 4GYIA 4H58A 1U54B 3V5TA 4MBJA 3HMNA 2A27A 2YCQA 4M66A 4DGMA 4TNDA 3ORIA 4D5HA 4K18A 4JAIA 5L8JA 2PMLX 4DBXA 3R1QA 5HIDA 4FVRA 4CRLA 3ZLSA 3D5UA 3AC8A 4XV2A 5FTOA 3UVPA 4FG7A 2X2KA 5KZ0A 1R0PA 5K3YA 3SOCA 3LFAA 2CGWA 3C7QA 3QKMA 1QPDA 3RCDA 2Y8OA 5E8ZA 4IBMA 3FZ1A 4WKQA 2DWBA 3QQGA 5EI8A 2W9FB 4WIHA 5C8NA 4RJ5A 4TYJA 5CVHA 5HIBA 4JJRA 4LUEA 3LMIA 4YZCA 4C36A 5L2SA 3UTOA 2J4ZA 4J1RA 5JH6A 3TUBA 1REKA 4MF1A 3LQ8A 2QNJA 4R1YA 3V04A 5FEEA 1Y6BA 2NP8A 2O8YA 4YLJA 3IO7A 3W10A 3OXTA 3UQGA 2PE2A 4OR5A 2OF4A 1OIYA 4I6FA 1L8TA 5M4FA 1UU7A 3B2TA 3C4CA 4NTSA 4UMQA 5CAPA 4NH1A 4NM3A 3ZOSA 3CKXA 3G2FA 4KIKA 4BCHA 4F9BA 4Y83A 4CFWA 1RW8A 3E5AA 3AGMA 3GFEA 3QRKA 4MXYA 5IA4A 3F2RA 4OTDA 5DT3A 1O6LA 1BL6A 2IVUA 1SMHA 5D9HA 4JDJA 5M56A 5C03A 2VTTA 3UP2A 5AA9A 3VN9A 1CMKE 3A99A 4D2WA 3QC9A 4FKSA 4R5YA 2WMAA 3GCPA 4CFMA 4DITA 4H3PA 4YJSA 4GL9A 1ZYJA 2V5QA 3KN6A 5DR9A 4EC9A 5I9WA 5I9YA 5DGZA 5ANDA 4F0FA 1UKHA 2FO0A 4X3JA 5FRIA 3FQSA 2FVDA 4UALA 1PMNA 4K6ZA 2RFDA 4UY9A 1YKRA 4TN6A 1WBVA 2CCIA 2CJMA 4J53A 4QYHA 4AN9A 4C8BA 1MRVA 3ZXZA 4ERWA 2PE1A 4GK4A 4DFUA 2GTMA 2C3JA 5AV4A 2VWBA 3Q04A 4NKAA 4BICA 5HU3A 1MUOA 4QPSA 5KKRC 3SOAA 1GNGA 3MJ1A 4OTQA 3OUKA 3G9LX 3SX9A 5C9CA 2DS1A 3QFVA 5TKDA 4DFBA 4ZEGA 4BDKA 4ZLZA 2Y4IB 1KSWA 2C5VA 2G2HA 5CAQA 1PXJA 3P7BA 2QU5A 2XRWA 5HO8A 3VS7A 2HZ0A 3R01A 4M14A 4O0SA 5AP4A 2Z8CA 4TW9A 1QCFA 3D2IA 4GUBA 2ZYBA 3PXFA 4USFA 4EH4A 5ANKA 1S9IA 2VTNA 3P08A 4HYUA 3KVWA 2GQGA 3H30A 1JPAA 5FWKK 4GH2A 4L3PA 1GIHA 4MCVA 3LMGA 1U5RA 3FMLA 3SG9A 3NX8A 2C5NA 5IQDA 3AC3A 2G15A 2PVYA 4B99A 4BTFA 4U3ZA 4S34A 3VUDA 5CEOA 5H8GA 4MTAA 2O64A 3FSKA 4FV7A 4GK3A 4JDIA 4YJPA 2UVZA 2JDSA 3BE9A 2WELA 1T45A 3QBNA 4P2KA 2VX0A 3ZLXA 2CNUA 4IB1A 3NPCA 1ZOEA 4IW0A 2BILB 3ACKA 3LCOA 4EBWA 2W06A 4DTAA 1QPCA 2OH0E 4IVAA 4L45A 5AV3A 5IEVA 1ZXEA 2FSLX 5L2QA 1ZYDA 3E8NA 4II5A 4RQKA 5C1QB 5EYDA 2RSVA 3MTFA 5FEQA 2XZSA 3OEZA 1LR4A 1NW1A 1CM8A 4FVQA 5H2UA 3GENA 3WYYA 3ZSIA 4BHZA 3MFTA 4X2NA 2W17A 2JLDA 2W1DA 4GIIA 4BI2A 4AN3A 3ZRMA 4X2GA 3EKNA 4BZNA 5B0XA 2WHBA 3HV6A 4EK3A 3SHEA 1PXIA 4R7BA 1YRPA 3UOJA 4KKHA 3VBWA 4RZVA 4U43A 3QCQA 2NRUA 2F4JA 4EBVA 4O27B 2BPMA 4LV8A 4I5PA 4IB3A 4C4JA 4DEAA 4Q9ZA 4ZIMA 3AD5A 1YW2A 1XH5A 2ITWA 4J96A 4IZ5A 3M11A 2VTRA 2BFYA 2QOFA 4TL0A 4KIOA 2CNQA 3U54A 2YZAA 1YXSA 2B7AA 3R21A 4CGAA 3IW4A 3MESA 3ORMA 3R6XA 1R0EA 3RHXA 4YO6A 3A7JA 4ENYA 4RVKA 4DC2A 4GCJA 5E90A 2ZV2A 4FR4A 4CZTA 4F65A 5CU6A 3WF9A 3SVVA 4M7IA 3VIDA 2VU3A 2B9HA 3UOHA 1PKDA 5CENA 4I21A 3TTIA 5KNJA 4XG9A 2R3NA 1V1KA 2XBAA 5E9EA 4L8MA 5CS6A 4UYAA 4EH8A 2C6KA 5E8SA 3D7TA 4FTKA 4DCAA 2P2HA 4QOXA 5BPYA 1JVPP 2HOGA 3NZ0A 4FIHA 5EH0A 2WMQA 3P79A 3OUNB 4XG3A 4BCOA 1E1XA 4DLJA 1KOAA 1KE5A 2UW0A 5DR2A 2BR1A 5HBJA 4DE4A 3BYMA 1WBWA 3LFEA 4I4EA 3SDJA 4E5BA 2JBPA 4O0WA 2I0EA 3R71A 3BQCA 2X4FA 3ELJA 1Z57A 4EZ3A 4XHKB 1PYEA 3DJ5A 4S31A 4PDOA 2F7XE 2ZAZA 5LMKC 4W4XA 1LP4A 4LL5A 2AYPA 3P9JA 3IQ7A 3L1SA 4TY1A 5CQWA 3BHHA 3P5KA 5EM8A 3ZSHA 5J95A 3DU8A 3IK3A 5KE0A 4ZZMA 4ZMFA 3WE4A 1XH7A 1ZOHA 3TNHA 3TZ8A 3ZHPC 4D55A 3F88A 4EWQA 5HLNA 3I6UA 2XIXA 3QHWA 3Q60A 3FI8A 3CSVA 3NNXA 5HG8A 2IPXA 3SGCA 3QHRA 3EIDA 1GZOA 5KMMA 4BN1A 3LFQA 4IWQA 1Q61A 1ZRZA 5CLPA 3HYHA 3QTQA 4D2VA 4I23A 3V8WA 4O83A 3A62A 3ZFMA 3KMWA 4DEEA 1A9UA 1FGKA 3ZCLA 4YTCA 3QX2A 4DGGA 3MIAA 3ROYA 3FZOA 4QPMA 5AUVA 5CSPA 1XBBA 3HL7A 3AC2A 5CEIA 3UVQA 5K5XA 2JDTA 3RGFA 2DQ7X 4FIEA 4KRCA 4RC2A 5E8XA 4O38A 5CU3A 3SD0A 3NAYA 5CZIA 1XKKA 3UOLA 4O82A 4CV8A 5LMAA 3KK9A 5CT0A 1OKZA 2QG7A 3LLTA 4IDVA 3DTCA 4R1VA 2X8EA 1J1BA 2WOUA 1OPJA 3VS1A 2PYWA 4XYFA 4LGGA 3O96A 4DFNA 3BLRA 3BWFA 3VBQA 1YHSA 3CTHA 4MH7A 3UZTA 3EZRA 2R0IA 4DT9A 5EDRA 1YI3A 2WIPA 3CQWA 2WPAA 3DJ6A 4FTMA 3EN5A 4ID7A 4CSVA 4RVTA 4KNBA 3BYVA 2C69A 3OG7A 4WHZA 5EOBA 1OPKA 3IW7A 2ONLC 3JXWA 2PMNX 2GNJA 4JRVA 4ZXTA 4BDCA 5IPJA 1ATPE 2OI4X 2XRUA 4L42A 5JKGA 4GV1A 3QKKA 4IAIA 1BX6A 1T46A 1BL7A 4FSUA 3Q9XA 4O7TA 3KQ7A 4WSYA 2VO7A 4JLCA 4JT3A 4HVDA 2I40A 5L6WL 3O7LB 1HCLA 2E9PA 3COIA 1J7UA 5BUIA 3HV4A 4W8EA 3I0QA 2PHKA 5EW3A 3P78A 3ZUTA 3W2OA 4EH9A 1FVRA 3COHA 5C27A 3LQ3A 2G2IA 3PLAE 4APCA 5HIEA 4DFZE 4FTQA 1DAWA 2WIHA 4DFLA 3UO6A 3BU6A 4ZSJA 4I0SA 2YEXA 3ULIA 3UVRA 4EOOA 2QOKA 3UDBA 4NFNA 5AJQA 3QD4A 4KRDA 3V5LA 4B0GA 5GNKA 5J1WA 1I44A 2IW9A 2QOCA 3GQLA 4FGRA 4L01A 3RALA 4BTMA 4D0XA 5LVPA 1U46A 5H8BA 4AOJA 4UZDA 3WIGA 3PWDA 3U9NA 3QAME 2QKRA 5EW8A 3BU5A 4EJ7A 2QO9A 5CX9A 2VX1A 4FZAB 4L44A 2LAVA 2GHMA 3EKKA 3IPHA 3H9OA 4JL9A 3CBLA 5CVGA 2JFLA 2VUWA 4X21A 3FMDA 3KREA 3PWYA 4HW7A 3CD3A 3O8UA 4KSPA 5C8MA 4C4FA 4ZSAA 3SAYA 5HNIX 5IZFA 1Q8ZA 5EI6A 5DNRA 3VUIA 5AV2A 4NCTA 2ERZE 3DAEA 4BCQA 4D4RA 3KY2A 4EHEA 4TKSA 4EI4A 2X9FA 1YXTA 2XM8A 4FKOA 3Q53A 1YXVA 4PTEA 4EKLA 1WMKA 5DA3A 4AFJA 2KULA 2QONA 3HECA 3KGAA 4Q5EA 5HCYA 3I5ZA 3PXZA 5AR3A 5CASA 4D9TA 4BGGA 4BFMA 3QQFA 4QNAA 2AUHA 4CKJA 1OBDA 3DXQA 4BDIA 3DBEA 4AW5A 4XBUA 4AW1A 4PMPA 1UWHA 1H00A 4B8LA 3BHVA 1OKYA 3A4OX 4RC3A 5IUGA 3Q3BA 4D28A 3I4BA 2IJMA 3OZ6A 2RFNA 2BRBA 4CFUA 5L8LA 5DEYA 3OF0A 4OTWA 2X6DA 1OB3A 1BI7A 3HGKA 4HCVA 2CSNA 4QMYA 3KMUA 4D5KA 3JS2A 3NVKI 2J50A 3HV3A 3NNVA 4FV2A 5CALA 2EB2A 5AUTA 1E1VA 3ENMA 4FKVA 2GSFA 4WG5A 2RFEA 5CNNA 3D2KA 2W9ZB 3A7HA 3BKBA 4H39A 3R9NA 4FZ7A 2WMSA 4B7TA 2OK1A 3GUBA 2R3HA 1EH4A 4CT1A 4EHGA 5BQ0A 1BLXA 4IWDA 4QNYA 4FSRA 3IKAA 4U45A 3HDMA 2C68A 5BVEA 4F63A 3KXZA 4NTTA 1NVRA 3Q4UA 5FXQA 4G34A 3FMHA 5AP6A 3EQCA 2WMRA 2YIQA 3A61A 2C4GA 4A9TA 2X2MA 4DFYA 3NR9A 3UQFA 3R7YA 2PPQA 1BYGA 4K1BA 3UZRA 2YWVA 3U4UA 3TWJA 4H3BA 5HG9A 2C3IB 2HZNA 2V7OA 1UA2A 3V5JA 4NUSA 1Y57A 2FH9A 3NRMA 4LOOA 4P7EA 3RCJA 3U6HA 4XRLA 4AUAA 2C1BA 2IZSA 4GRBA 4QMMA 4OT6A 4GYGA 2CN5A 2ETRA 2QOHA 3G90X 4IIRA 4RZWA 4FICA 5IKWA 4F7JA 5L2WA 4AS0A 2W1ZA 3LVPA 4ACDA 3SXFA 3QQLA 3QYZA 4IACA 3C4EA 3EQRA 2OJFE 3OY1A 3R9DA 3ZDIA 2YZLA 3MFRA 2XKCA 1WBOA 3BE2A 3KVXA 5CF5A 4B8MA 2H34A 3IDPA 3LW0A 4ANLA 3VRYA 1OGUA 2XK9A 3QZFA 1RQQA 4FIGA 4GVAA 4B4LA 1B39A 5B2LA 4JXFA 1E9HA 4I5HA 5ANGA 3WZEA 4L7FA 2ZV7A 1JSUA 2XEZA 3OTUA 4CMTA 1Q8WA 1R39A 2XYUA 4G6LA 5JGBA 3PVUA 4MXZA 3TTJA 5HICA 5K5NA 2JBOA 4YHTA 5AP2A 2ZM1A 5AAGA 4W8DA 2Z2WA 2R3MA 4S30A 5HG5A 5J7BA 3ID6C 4PTGA 3FL4A 4BCNA 4QMLA 1DM2A 2YITA 4GVJA 3SKCA 1ZZ2A 5TO8A 2YABA 3BGQA 4YPDA 3JUHA 4TWPA 4MBIA 4CFFA 3TL8A 2C1AA 2WB8A 4EOSA 4EEVA 3F5GA 4Y72A 2GHGA 1HCKA 1H07A 1PMUA 5HCXA 2NRYA 3ZLYA 4ACMA 4DBNA 4JAJA 4QMVA 2BROA 5JQ8A 3A7IA 3PYYA 2QQ7A 3LJ0A 5GJFA 3WBLA 3O0GA 2JKOA 4QTAA 2PULA 1OL2A 4BZDA 4CD0A 1REJA 4FKQA 4U5JA 3LXLA 1ZY5A 3DBDA 3PG1A 4QYEA 2ZDUA 3V5QA 4Y95A 4J99A 5IDNA 3M42A 3HRCA 5IISA 2XK7A 4ITIA 4AE9A 2YFXA 2Y6MA 5CQUA 3VF9A 5CF4A 2UZDA 4ONAA 5EI2A 3GC9A 3HZTA 3PSDA
chains in the Genus database with same CATH superfamily
2Z60A 4IWPA 2RG5A 4IZ7A 4FTTA 4JOAA 4XV9A 4C33A 3GCQA 1CKPA 1XO2B 2QKWB 3FMJA 2XIRA 4IE9A 5E8WA 2JIIA 3ZZWA 4CXAA 1ZYLA 4FNWA 4GT5A 2OJ9A 4S2ZA 2BAJA 4UMTA 1TZDA 4NJDA 3KULB 2GTNA 5FP6A 2WD1A 3LJ1A 1O6YA 4YZ9A 4NEUA 1G8SA 3MH1A 4LGHA 4JMQA 4J8NA 4RGJA 5FXRA 4FEVA 3FI2A 3BV3A 4GFMA 4M12A 3TUCA 4EUUA 2BKZA 2UW7A 1OMWA 2I0VA 4IM0A 3EOCA 3NW7A 4IJ9A 3THBA 4CQGA 4YC8A 5HVKA 4B9DA 2BZIB 5AIKA 4OTPA 4X7QA 4L9IA 1ZY4A 1PXLA 5IQAA 3ZRLA 5JRQA 2CCHA 3F69A 2WTCA 2WQMA 2XH5A 1GY3A 2ITVA 3EFLA 3LQ5A 3MH2A 1O6KA 3VWAA 4E3CA 5CAOA 5JFVA 1YWNA 3WF6A 4E6QA 4FKGA 4G9RA 2R64A 2WU7A 4MD7E 3G6HA 3KF4A 4IDTA 4F1MA 3EQBA 3FY2A 5CU2A 2I0HA 2V7AA 3SQQA 3OBJA 4G9CA 3HMMA 5IA3A 3R7OA 3FZSA 2OIQA 3NYVA 3HVCA 2DYLA 2J0IA 4IAZA 1YQJA 2R3RA 3FLWA 3OS3A 2B9JA 3OVVA 2ITXA 4JBOA 2QO2A 2IZUA 2QU6A 3JY9A 2ITTA 4IFCA 3FL5A 2R7BA 4QMUA 3BGPA 4BIDA 4C3PA 3PJ2A 3F82A 4E1ZA 4U6RA 1JLUE 3G9NA 2UZOA 3O17A 4LFIA 3M2WA 3R30A 5FDXA 3QRIA 3TNWA 1OI9A 3VONA 3BHTA 5M44A 3DY7A 4OTGA 2PVKA 5J9LA 4CYIA 5FM3A 5LWMA 3I7CA 5M4CA 4GIHA 1KWPA 2W5HA 3GU5A 3OCTA 2A2AA 2YM7A 4QMWA 4DHZA 5AM7A 5A4LA 2BRHA 2ZB0A 3Q2JA 3QTUA 3T3VA 5LJJA 4E4XA 3Q6WA 4Y5QA 3MW1A 4YURA 1PY5A 4F64A 2IW8A 4EOQA 2OWBA 3NDMA 1H08A 3K3IA 3MVJA 3L9LA 1YDRE 3R22A 2GS2A 4IJPA 4HVHA 3S0OA 1Q3DA 2R3JA 5LVNA 3SXRA 4O2PA 3RVGA 5F94A 4AG8A 3LM0A 5EKNA 5HTCA 4EH6A 4G31A 4XG7A 2BTSA 5FQDC 3LKMA 2F2UA 2C0OA 4V0GA 4C2WA 2OF2A 1UKIA 4EONA 3FJQE 4MEDA 4JQ7A 4TWNA 2OJGA 2OJJA 1G5SA 3V5PA 4ZY5A 2HW6A 4DEBA 4N57A 4BYIA 4UX9A 2PVRA 3QX4A 3AD6A 4D4SA 2O2UA 4RWLA 4L00A 4BCFA 3VS3A 4TTHB 2PUIA 4KKEA 4CFVA 3TUDA 4XG2A 4DEHA 4R6VA 4MWHA 1M17A 2JDOA 3GNIB 3R00A 5BVWA 4L43A 4C02A 4MXOA 2J0LA 2F57A 3G6GA 5DWRA 3UO4A 3WZJA 4YJQA 1UNHA 4Y46A 4AT3A 3DKCA 1XR1A 3F2NA 4E4MA 4X3FA 4XX9A 3W8QA 4EOJA 5B7VA 5CANA 1WVYA 4OTHA 3R7EA 3I0OA 3NYNA 5IDPA 2H8HA 1UU3A 3MPTA 5AP3A 3R8PA 3NUAA 1H0VA 1OL1A 5GJGA 3A2CA 3COMA 3IOPA 4PDSA 4M0ZA 5CSVA 5HESA 3FE3A 3ZH8A 4L3JA 2WTDA 3EJ1A 4DG2E 4YUQA 5JMSA 3F3VA 5CVFA 1JKLA 5EHYA 4FT5A 4QQTA 5A46A 5HI2A 4RIOA 4UB7A 2WQEA 3QTZA 2NPQA 2X81A 4KS7A 4FSYA 3D7ZA 4FKWA 4QP4A 5DN3A 2VN9A 5DRDA 5CXZA 5HU9A 4GT3A 4WT6A 5DOSA 2PK9A 5HVYA 4ZY4A 3ZZEA 3FLSA 4GFOA 4ZAUA 3FV8A 4L3LA 3RM6A 3MB6A 1H01A 4D4YA 2EXEA 2W96B 3Q96A 3TNIA 5FUTA 3R28A 5CSXA 1J1CA 4TYHB 1PF8A 3CLYA 3I7BA 4MYGA 4RFMA 3EQPA 5J5SA 1ST4A 3UDTA 4P4CA 3VQUA 2JDRA 4WO5A 4MNEB 4D1SA 2XYNA 4LI5A 3TNQB 4LV7A 4EUTA 3PG3A 3RJCA 3VNTA 1ZZLA 5HNBA 2E9OA 3IECA 4U3YA 3C9WA 4ZOGA 3GGFA 5EYCA 5ETAA 2WU6A 3GEQA 4DA5A 4FSTA 4USEA 3TZ9A 3WF5A 2WMUA 4R77A 4YZDA 1J7IA 4JQEA 3FLYA 4O2ZA 3OT3A 4PL5A 2OGVA 4O0VA 2Y7JA 3OHTA 4QQJA 2YISA 5J7HA 5JN2A 2IVVA 3DXPA 4FV8A 2CN8A 2PZ5A 4ENXA 2PVJA 2F7ZE 4N0SA 3DNEA 4OW8A 4QQ5A 4RA5A 5CT7A 4C58A 5A14A 4QO9A 4M13A 4O0RA 2OZOA 3FPQA 2VWWA 1OECA 3OFMA 4OGRA 3UPZA 4O7SA 4RJ6A 5AAFA 4DCEA 5IQEA 2BALA 1J3HA 4BR3A 4JIKA 3UG2A 1XWSA 3O71A 3Q4CA 3RZFA 4C37A 3ZSGA 1WBPA 3H0YA 2WEIA 2GPHA 2XNNA 3NWWA 4KBKA 3ZFYA 2PU8A 2P3GX 4F7NA 4AZTA 4BBMA 4ZTSA 4E4LA 3QQUA 4HYHA 1SNUA 1VR2A 5DMZA 2XIZA 3R1SA 1DI8A 2UV2A 2RL5A 2UZEA 3EHAA 4PWNA 5ETIA 4AF3A 3ALOA 3NNWA 5ACBC 4YMJA 4M69A 1GIIA 4JVGA 4Z7HA 3D5VA 5J1VA 2VO0A 4JG7A 3TIZA 2UZVA 2CGXA 4UXLA 5F4NA 3W2SA 4BIEA 3UQCA 4XLIA 2X1NA 3M1SA 4I94A 4FL3A 4Q2AA 3PA3A 3A8WA 4QP6A 4YC3A 3MS9A 4BBEA 1ZAOA 3R9OA 3MA3A 3PPJA 5A4QA 3E88A 2G01A 3FXXA 4IVDA 2BAKA 3GC8A 3UG1A 2JGZA 3O50A 4YZNA 1YOLA 3ZO2A 1O9UA 4KABA 4F7SA 4F9WA 2WTKB 4AX8A 3MY1A 3KIOC 3PE1A 1ERKA 3TDVA 1XHAA 2R3KA 4DEGA 3IGGA 3R1NA 1Q5KA 4RWJA 4S33A 1ZARA 1NY3A 4N6ZA 4EOIA 2I7QA 1SVGA 3VW6A 3PE2A 4CEGA 1IRKA 3BZ3A 4IANA 3WZKA 3VS6A 1PHKA 2X0PA 2GQRA 3NCGA 3R04A 4H3QA 3HUCA 3JVRA 2FB8A 3RK5A 1OBGA 1FPUA 3KMMA 3UMXA 4QMNA 1R78A 4RFZA 3UIXA 2HYYA 5AR4A 2VTIA 4EH5A 4KBAA 4FKLA 2XKFA 5ETFA 2C6IA 2FSOX 2O5KA 2HWPA 5FG8A 5L6OA 4J52A 5AADA 4JBQA 3OW4A 4EHVA 3W2RA 5LOHA 4GT4A 5AV1A 3DDQA 4FBXA 4F0IA 5CEKA 1W8CA 5HCZA 4YNOA 4L67A 4CCUA 2HZ4A 3VHKA 5KMKA 3W0PA 2W1CA 3VUTA 3C0HA 3BQRA 4YJOA 3BLQA 3UYSA 2X39A 3OWJA 3UZPA 4BCMA 4HGEA 4YHFA 2FSMX 3HMPA 2V62A 2CKPA 2VWIA 4L6QA 5I3RA 5I9VA 3SRVA 3AQVA 5FM2A 2VTQA 4UWCA 4Z16A 2A1AB 4KS8A 3RI1A 3KU2A 4G2FA 1LPUA 2JKMA 4QMPA 4ZTQA 3B8RA 4QYGA 3VF8A 5G1XA 2BRMA 3ZU7A 4G16A 4EH2A 4GKIA 2WXVA 2A98A 4DGNA 3T3UA 3KC3A 3ACJA 3D9VA 3FI4A 2P0CA 3QQJA 4M97A 3KRXA 3RPOA 4RIWB 3BRBA 4PPBA 2EUFB 2XARA 2I1MA 3QCYA 2O65A 4ZTLA 5BYYA 3U55A 4RLKA 4TRLA 5EM7A 3ZRKA 1OIUA 2VO6A 4KKGA 4O1OA 1WCCA 2WMWA 4AGWA 4ZJVA 3TJCA 1FBNA 5IEYA 2XJ0A 3MN3A 3NS9A 2OO8X 2C6OA 2QCSA 3TKUA 5IQHA 2W1HA 4O7VA 1SZMA 1ZOGA 2XEYA 4XEYA 5HNGA 3P5JC 1MQBA 4LQMA 4F0GA 3QUEA 2PVFA 3EQIA 3RINA 4K33A 4P5ZA 4F9YA 3UC3A 2IN6A 2UZNA 2VGPA 3UNJA 1OUYA 4FSNA 5BNJA 4L52A 3D4QA 1UU9A 2W05A 3LCSA 3QQKA 2YN8A 3R7UA 3COKA 3HV7A 3ZO3A 4MVFA 4MK0A 5LVLA 4X6QC 5HTIA 4YC6A 3DNDA 5FTQA 3PUPA 4I6QA 4HGTA 4GU6A 4G5PA 4QMQA 4MQ1A 3GI3A 2VTPA 3PP0A 2IWIA 1YOJA 4PNIA 2Z7RA 3DOGA 4O0UA 1XJDA 4N70A 5I4NA 3CPBA 3NW5A 2YLEA 3EFJA 4YNEA 3OW3A 1M2RA 2IZTA 2XB7A 3AMYA 4MQ2A 1MRUA 1OUKA 1OKWA 2R2PA 2YCRA 4IZYA 4O0TA 2XAOA 4AA0A 3UGCA 3QGWA 1IA8A 1URCA 4KIKB 3HMOA 5GIPE 4DINA 3NIZA 3EZVA 3VBTA 3LJ2A 4A4OA 3F2AA 4HPUE 3NEWA 2JAVA 3PJ1A 4OTFA 5KO1A 1JAMA 5GHVA 3ZFXA 3QKLA 5DRBA 3ORTA 5GZ8A 5EW9A 1UWJA 3EMGA 3FXWA 2VWUA 2XNMA 1M14A 4BYJA 4C61A 4CCBA 4KUJA 4FGBA 4E7WA 3KEXA 4GU9A 1WVWA 4QP8A 4D2TA 3MFSA 5CI7A 2G1TA 1R3CA 3T8OA 5KMJA 1YWRA 3ERKA 1B38A 4PDPA 4HVIA 1OIQA 4K2RA 3VS0A 2PTKA 5DFPA 2Z02A 3KB7A 2GFSA 3E7VA 3TCPA 3VS5A 4J71A 2VX3A 5AP1A 4KIPA 1Q4LA 5EDQA 3PPZA 5JQ5A 4WNOA 3HA6A 4E4NA 2WMXA 3BLHA 3FQEA 4JBVA 4M69B 3N4TA 1OL6A 2B55A 3FXZA 3Q4TA 5CAVA 2ITQA 2R4BA 2AQXA 1BMKA 2XIKA 2IG7A 3DBFA 4FTIA 1YXXA 3ZUUA 2WQOA 1NA7A 3QZGA 4GG5A 4MBLA 4EHZA 2I6LA 4WBBB 1PXKA 2QR8A 5ETCA 3TT0A 5BUEA 3DLZA 1OVEA 5M57A 3FLZA 5CU0A 5HX8A 3Q9WA 2B1PA 1V0BA 2OFVA 3H0ZA 2JIVA 3TNPC 4LG4A 2J2IB 1ST0A 1KE9A 4YR8A 2A4LA 4L53A 4G6NA 3H4JA 5E92A 3I6WA 1Q8YA 1M7QA 3FDNA 4W4WA 1IG1A 5AR8A 4C35A 2UZUE 3DZQA 4QTEA 2OH4A 4FTAA 5HHWA 3TZMA 2JDVA 2OZAA 3MVHA 1PXPA 4FKPA 4JX7A 3RAKA 4I41A 4DTKA 3ZM4A 1JKSA 3RAHA 3E63A 5GZAA 5HLWA 3DJ7A 4ZLOA 5IA1A 2IVSA 3ET7A 4IH8A 2HY0A 1KE6A 2GFCA 2XNOA 3SC1A 3NUSA 4GG7A 3RAWA 2AEGA 4I22A 4FSQA 5JK3A 5AM6A 5A6NA 2RGPA 3CXWA 4X6RA 5BVDA 2J51A 1TKIA 2VTJA 1OIRA 2Y4IC 1YXUA 4FYOA 4NM7A 4PP7A 5IA2A 1G3NA 1Y8GA 4R3RA 4YTFA 3CQUA 2WTKC 3E8CA 2XCHA 4C4IA 4FUXA 5TF9A 4B6LA 5J9ZA 2P2IA 4ASZA 1BKXA 2VTSA 3EYGA 3VJNA 1PYXA 2QLUA 4LMNA 1F0QA 2X8IA 3N9XA 4P5QA 1XMLA 4W9WA 5CWZA 2GNFA 4IX4A 5F95A 3S00A 1KE7A 1GAGA 2ZM4A 3MVMA 3L8SA 4AZWA 4DH3A 4PX6A 4H36A 3SRVB 4AZFA 4PF4A 5CSWA 4AGCA 4FMQA 2LGCA 4U97A 2BIYA 5D12A 1R1WA 3TV7A 4TWOA 3KXNA 4I92A 4NZWB 4F9AA 1W0XC 3QXOA 3QUPA 3F5PA 3AGLA 4UZHA 5H8EA 2ZVAA 2HENA 3NYOA 4USDA 5AUUA 3CD8A 3EL7A 1J7LA 2YWPA 2J5FA 4TPTA 5J87A 5IUHA 4E26A 4UV0A 1NVQA 4AAYA 4G17A 4O4FA 2JIUA 2R0UA 5DHJA 2C6TA 3QZIA 3RBWA 3HDNA 2ITUA 3LFBA 1XMMA 1CKJA 2FYSA 3KXHA 4PY1A 2HCKA 2XUUA 4XP0A 3W2CA 4FTUA 4V04A 4AXFA 2C3LA 1P14A 5L2IA 2B9IA 2R9SA 3EYHA 2Y0AA 2ESMA 4GW8A 2R3FA 5BVOA 3QL8A 5FBOA 2QLQA 3TN8A 2J0KA 3BIZA 3R8VA 5BV3A 3IDCA 5J9YA 3D7TB 4E6DA 1SVEA 3AOXA 4QMSA 2HELA 2OKRA 3BU3A 4S32A 5E8YA 4RX7A 5A4EA 3KCKA 2CKOA 3AT2A 4LRKA 2BDFA 3NUXA 4FE2A 4BKZA 4ZSEA 5HBHA 1PXMA 4JR3A 5E8TA 2PVHA 3O8TA 1JQHA 3H9FA 3TXOA 1SNXA 1YDSE 4BL1A 3ORZA 4TT7A 5DI1A 4BCJA 4IX3A 1IA9A 1V0OA 2ITZA 2VWXA 4U80A 4HVSA 2QC6A 4XLVA 3SXSA 3UMWA 4ACCA 3RM7A 4O6LA 4DGOA 3MVLA 4LRJA 3VC4A 4DG0E 4YJVA 2OXXA 1WBNA 1K2PA 3HRBA 3PDTA 3FEGA 1LEWA 3ORLA 4WUAA 2GS6A 4AP7A 1G8AA 5AUXA 1OITA 3DAJA 2PZRA 2J6MA 3WZUA 4FC0A 3VUHA 3GB2A 5FGKA 2B54A 4BHNA 4GMYA 3ATTA 5E8UA 4BDDA 1QPEA 4EQUA 3R7VA 4BGHA 4ZJIA 1FINA 4Y85A 5K0KA 4RA4A 3VJOA 5M4IA 4QP3A 5IG1A 3D94A 3LCTA 3AMAA 5BMSA 4AGDA 3HUBA 2EXMA 5EFQA 5HE2A 5E8VA 4DH7A 4JG6A 2BTRA 3CGOA 5D10A 4ANSA 4BB4A 3EQGA 3K2LA 2OLCA 5FP5A 3IOKA 2VAGA 5EHOA 5CZHA 2XNBA 3PIXA 4N4SA 3UIUA 3PJCA 3SW7A 5L8KA 3LHJA 3ORNA 3BBWA 2X2LA 3HP2A 3KXXA 4O1PA 5BMMA 2RFSA 3O2MA 4TYIA 2UW8A 3VRZA 4K9YA 2UZLA 5CY3A 3U87A 1Q99A 4EZ5A 5KX8A 3E3PA 3R63A 5EM5A 5IA0A 3F7WA 3FKNA 4G5JA 5CYIA 4A4XA 4NKSA 4ANBA 5I5ZA 4FIJA 4LDTA 3K3JA 3P86A 5EYKA 5LMKA 1JBPE 3VW8A 3CIKA 4L68A 4WNPA 4FV0A 3ZDUA 3GC0A 2NYAA 4EK5A 3LOKA 3W18A 3GC7A 4FSWA 4E8AA 1PRYA 3GFWA 4H05A 4F08A 5KBRA 2W1FA 3MFUA 3NW6A 3MB7A 3QD2B 2C6LA 1H24A 4XMOA 2GDOA 2CLQA 3IONA 3W2PA 3QZHA 3C51A 1W7HA 5I0BA 2JITA 2WKMA 4DEIA 5AX9A 4MWIA 3AMBA 3CY2A 1U54A 2QHMA 1B6CB 3EN4A 2A19B 1XH6A 3MI9A 3MTLA 3EH9A 4RBLA 4AXDA 2P55A 3FQHA 3PP1A 3P1AA 4FV1A 5HO7A 2HXQA 3FZPA 3N4VA 4RRVA 4XCUA 5C01A 4QTCA 4U42A 3AC5A 4CYJA 3JYAA 2OICA 1STCE 5F20A 2A0CX 2GNHA 3W1FA 4BCPA 4PNKA 3U4WA 4AGUA 4Y5HA 2O3PA 2C0IA 1RDQE 4APPA 4BDAA 4QP7A 4XOZA 4ZTHA 2HAKA 4YU2A 4G3GA 4JNWA 1LEZA 3MH3A 4FKTA 5ITAA 1Y6AA 4FTLA 4JDKA 4R8QA 4DDIA 3KKVA 3NVMB 4PUZA 3R83A 3E92A 3I81A 5EOLA 4EOPA 2ZM3A 5D41A 1YOMA 5BUJA 3QRUA 5LWNA 4FEUA 4FZ6A 4C34A 3LCKA 4W9XA 1KV1A 2ONLA 2CMWA 4ACHA 4DHIB 2YIYA 3DZOA 3FMNA 5HQ0A 5HKMA 1XH8A 3FMMA 4O4DA 3AC4A 4U81A 4X2JA 2VD5A 3VO3A 4FL1A 4MKCA 4AT4A 2PUPA 4FL2A 3VHEA 5C4LA 4FKRA 2HZIA 4R5SA 3OD6X 3OXZA 3F66A 3VBVA 4IADA 2JD5A 4O0XA 5H9BA 3Q9ZA 4LYNA 2F9GA 1YDTE 4RIYA 4UXQA 3BHUA 5EYMA 1OM1A 3WOWA 4GEOA 5IH6A 5BVKA 3LFDA 4AW0A 5DVRA 2AC5A 4E20A 4J8MA 3NSZA 4G3EA 5IA5A 4DF3A 2XNGA 2VRXA 5E1EA 4IWOA 4E93A 4D0WA 4UYNA 3HKOA 5EQEA 2Z7QA 1SM2A 3LIJA 1FQ1B 5DE2A 3BX5A 4CG9A 4BTJA 4LL0A 4M68A 4WUNA 3UP7A 2JFMA 4BDJA 4BJJA 3DT1A 5AMNA 2P4IA 3QWJA 4LOPA 4EYMA 2RG6A 1Q24A 3C5UA 1ND4A 4BCIA 4RG0A 2YDKA 2GQSA 5KHWA 4BC6A 4AXAA 1JSVA 4EOKA 4L46A 2VZ6A 4UBAA 2J7TA 3MV5A 4FIIA 4F70A 5F9EA 3KXMA 5KMOA 2OIDA 4JI9A 4OAUC 4EWHA 5TE0A 3PA5A 3ENHA 2UZWE 3HMIA 3Q5ZA 3BWJA 3C4XA 5T6KA 3RNIA 4RIXA 4CMOA 3F3UA 2C5OA 3UE4A 3W0MA 1P5EA 2XKDA 4GKHA 2VWZA 3ITZA 3W33A 3UNZA 2C30A 5LMBA 5IEXA 5GINE 4U9AA 5JZNA 3VUKA 1W82A 3SA0A 1W84A 2W5BA 4FV9A 4NWMA 4WOVA 3OCGA 3QD3A 4FV3A 2KTYA 4XV3A 4JBPA 1VLRA 4R3CA 3G0FA 3QXPA 2X8DA 3ZXTA 4OBOA 2W1EA 3Q9YA 1AQ1A 1WFCA 2R3GA 3NNUA 3QYWA 4A7CA 4E5AX 1JWHA 4FIFA 2J0JA 1CSNA 3LFNA 3QC4A 3KN5A 2YAKA 1GZKA 4F7LA 2X7OA 2VV9A 4O81A 4AN2A 4Z7GA 4DGLC 5FDPA 4FEWA 2X6EA 4FZDB 1JKTA 3IW8A 3OWKA 4XG8A 5L2TA 3EFWA 4E6AA 3EN6A 5DYJA 1BI8A 4E6CA 2XAMA 3DK3A 4DDGA 3TV4A 2X0GA 3GP0A 1OKVA 4DT8A 4FT0A 4FSZA 4CMUA 3PIYA 4HNFA 2W7XA 4Z9LA 3SLSA 2JAMA 3MYGA 4Y73A 3BELA 2C0TA 1RE8A 5DT4A 2FSTX 5HBEA 2AC3A 3JVSA 4I20A 3OBGA 4KSQA 4MF0A 4NM5A 4WG4A 5AR2A 2GNLA 5CEPA 4I0RA 4JS8A 4BTKA 5AAEA 4D1XA 2XF0A 3I60A 2R3PA 4CZYB 5IMXA 3PVWA 5CEQA 3VULA 4YGAA 2ACXA 2I0YA 4CKRA 4O7RA 2OIBA 3OOMA 2W4OA 3NFGB 3HX4A 4NYEA 4ZMEA 3R9RA 5LCKA 4RFYA 5I9UA 4O6EA 4ANQA 3BBTB 4AOIA 3R73A 2YCFA 3DFAA 3FSFA 5D7AA 2GU8A 4QP9A 3S95A 3KRWA 4HZRA 5JZJA 2O63A 2QOQA 2XA4A 1LUFA 5DEWA 2QOBA 4Z3VA 3HV5A 3II5A 3LXPA 5A3XA 2VTLA 4FRFA 3CTQA 2CKQA 2XK4A 4X0MA 5CU4A 5M08A 4XOYA 3MJ2A 4YHJA 5IU2A 3QA8A 1TQMA 3ORPA 3NIEA 3QUDA 2YDIA 3O7LD 5J5TA 2F7EE 3ORXA 4C4HA 3P7CA 4E5WA 1Z5MA 3WF7A 4EH3A 1Q8TA 5IQCA 4D1ZA 2WZJA 2VGOA 2QOOA 4F9CA 3D0EA 2YM5A 3ZUVA 3ETAA 2VNWA 4MHAA 3PIZA 3ZONA 4BDGA 3HAMA 1H1QA 5AUYA 3ZLWA 3L9NA 3PJ3A 2VNYA 4W4VA 4O22A 2PMIA 4ASEA 3JR1A 2XBJA 1K9AA 4PMTA 4YTHA 1W83A 3ZBFA 3DKFA 4IB5A 5B2KA 4C59A 5GIOE 2ZMDA 2BDWA 2C6DA 3BV2A 3MPMA 5I9XA 5IQGA 2R5TA 4QD6A 5AEPA 4BKJA 4C3FA 3S2PA 4H1JA 1UNGA 4XP2A 3OEFX 1TQIA 2JC6A 3DLSA 3KRLA 3MA6A 4I5CA 5DT0A 4BCKA 4DFXE 5A54A 3DTWA 3WYXA 3G15A 2X9EA 3DXNA 3GU7A 3A8XA 3NUNA 3POOA 3NGAA 2W1IA 4X2KA 2XK8A 1S9JA 3DCVA 4RSSA 4RVMA 3VUMA 4XBRA 1CTPE 4RC4A 1KV2A 5CSHA 3OXIA 4M67A 3JY0A 2UW9A 4FI1A 4QP1A 4YLKA 2REIA 3GQIA 4IEBA 1GZ8A 2WGJA 2UVXA 4KB8A 3MDYA 4M8TA 5K4IA 3GXLA 4P90A 4W4YA 2WTJA 4A06A 2YIXA 5JRSA 4MUQA 3DB6A 2ERKA 4ANMA 3EQFA 3F6XA 1ZLTA 4X2FA 3DKOA 3TYKA 3LXNA 3DAKA 3FC1X 1PJKA 4FG8A 5TR6A 4NFMA 4A07A 3V8SA 4BDHA 3CY3A 3L8PA 3JPVA 2Q83A 1YI4A 3TKIA 3DS6A 2DUVA 3C4ZA 2WNTA 3PVGA 4FT9A 4JIAA 2CDZA 4EL9A 4F1OA 4RIYB 4FODA 5HORA 5AUZA 2IF8A 4G1WA 3BYUA 2IVTA 2W5AA 3G5DA 5BVNA 2RF9A 2X7FA 2OSCA 4QP2A 4FG9A 4YBJA 3UODA 5IH5A 5CAUA 3MY0A 4CLIA 1QPJA 2EVAA 3BGZA 1APME 3QLGA 5T68A 5AWMA 3RAIA 3GOPA 3ZS5A 4F09A 2YM4A 1U4DA 5HE1A 3TI1A 1ZMVA 1H25A 4RJ4A 3C0GA 3EB0A 4Y8DA 4FEXA 3O8PA 4YTIA 3PY0A 1BUHA 1DS5A 4IAKA 3UIMA 4EK6A 2HIWA 3CR0A 3GVUA 4QTDA 3W2QA 3FZTA 3UIBA 5JFXA 2W0JA 3DPKA 1MRYA 3F3TA 1OL5A 1FGIA 4NCTC 4ZP5A 4OLIA 2EU9A 4OTRA 2BDJA 4DYMA 3HA8A 4PRJA 5T3QA 2FA2A 4RJ7A 4ALWA 1MP8A 4O4EA 5EHLA 1Y91A 3L9PA 1M52A 4ZS4A 4FOCA 5LARA 3ZC5A 2BHHA 4PP9A 4J7BA 4RIXB 4EQMA 3RPVA 5K9IA 4UN0C 4EK8A 4U7ZA 2BFXA 4I5MA 2GS7A 2PY3A 3R9HA 3DDPA 1L3RE 1WZYA 2HK5A 4WNKA 4DHFA 3PFYA 1TQPA 4CZUA 4F4PA 2CLXA 4BZOA 4C3RA 3F5UA 4HNIA 1U5QA 4CV9A 1GZNA 2R7IA 3FYJX 4FTCA 2X0QA 4V0GB 5KBQA 3MH0A 4PPCA 4OUCA 2BRGA 2XM9A 4LMUA 3K54A 3REPA 4C38A 1IAJA 4ZS0A 4FT3A 4KD1A 4LGDA 2BZKB 2PVMA 2JEDA 4NIFA 1PW2A 2R3OA 3V8TA 3CJGA 2BMCA 3P4KA 5CTPA 4DEDA 4DH8A 3TZ7A 3AD4A 4DH5A 4PDYA 4RPVA 3U8WA 2V55A 4ZK5A 2XNEA 4A9YA 4JQ8A 3KRJA 4PTCA 5IF1A 4EYJA 5M07A 2E2BA 4EK4A 2PUUA 3AT3A 2J5EA 3C4FA 5AFVA 4EH7A 3UPXA 2OBJA 5EQYA 3W0RA 2PWLA 3R1YA 5JGAA 2GMXA 4GJ3A 3FMEA 4O96A 5BVFA 4WG3A 4AU8A 4O7YA 5ICPA 4EQCA 3RWPA 4X3FB 1M2QA 5I3OA 1WVXA 2OJIA 5FD2A 4RJ3A 5HZNA 3CTJA 3OP5A 2XNPA 2BVAA 4FK6A 4IQ6A 3ROCA 3B8QA 4BI1A 1VYZA 3ZO1A 3Q4ZA 1F5QA 2B9FA 3L9MA 4HOKA 4NM0A 3OWLA 3ATSA 4CVAA 3Q6UA 4E73A 3VBXA 3DV3A 4BI0A 4K0YA 3GOKA 4Q9SA 3UO5A 2H6DA 4HZSA 3RNYA 2UZTA 3P7AA 4IHPA 4JR7A 4C62A 1Q41A 2V22A 3L8XA 4XJ0A 3O23A 1VYWA 4QYFA 4YJTA 4ASDA 2PVNA 2PMOX 1SVHA 3A4PA 5D1JA 3KK8A 4YZBA 4I4FA 4YPSA 5ANJA 4EOMA 2PL0A 3AKJA 4F6SA 1UU8A 4QMOA 1ZYCA 2ETMA 3TM0A 3DQXA 4O86A 3P0MA 3CC6A 3I5NA 3ZTXA