2IVTA

Crystal structure of phosphorylated ret tyrosine kinase domain
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
313
structure length
288
Chain Sequence
b'GPLSLSVDAFKIPKWEFPRKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVRALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR RET PRECURSO
publication title Structure and chemical inhibition of the RET tyrosine kinase domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 288
sequence length 313
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2006-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2ivtA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2ivtA01
4HYSA 5I9WA 1WVYA 2G01A 3G33A 3KRXA 2E9VA 4K77A 2FSLX 5DBXA 2YM4A 3Q4CA 1XHAA 4FSZA 4IB3A 3CJFA 3VS6A 3QHWA 3FLYA 2QCSA 1UU7A 4ACDA 4RIOA 4D5KA 4IM0A 3ZZEA 1CM8A 2WU6A 4ZZNA 2KULA 4DEAA 5IU2A 5ANEA 3SQQA 4OTQA 1OITA 2QOQA 2WTWA 5I9YA 1FPUA 4I92A 3LFFA 4UMRA 1SNUA 4H1JA 2W9ZB 2HY0A 4MHAA 3U6HA 3CY3A 3IONA 4FKQA 5CSWA 3FMMA 5HI2A 1WBTA 4CG8A 3UPXA 4RC2A 4BIEA 3UTOA 2CCIA 2V55A 2PMLX 3QRUA 4IAIA 4L00A 4FV6A 4OGRA 4C36A 2ETRA 3BCEA 2VTQA 5IA0A 5F94A 3HV4A 1YQJA 3CKXA 4FI1A 4OTIA 3W2PA 3PFQA 4KD1A 4DBXA 4X3FA 5J5TA 1UNLA 1YI4A 5KZIA 2V5QA 4IE9A 4PL5A 5AUXA 2BHEA 3VQHA 4A9UA 3CCNA 4CKIA 3G0FA 3P7BA 4OT6A 3R6XA 2B55A 4LRKA 5JFSA 5EM8A 5M53A 3MWUA 4NFMA 4BCJA 4GK3A 4EYJA 3S00A 2VO6A 4B0GA 4O82A 5BYYA 3HV3A 2XIXA 4C59A 3RAWA 4I6HA 3KVXA 5A4CA 3AMBA 3UG1A 4DGGA 3PG1A 2B7AA 5FTOA 4EL9A 3R0TA 1A48A 2BAQA 3ZM9A 1PXJA 4I0TA 4DFXE 1F3MC 4RA5A 2AYPA 4P7EA 3UQFA 3EL8A 4KWPA 2PMOX 3FXWA 3TXOA 4C2VA 4ZS0A 3ZZWA 3KQ7A 1P2AA 3OUKA 4NJDA 5CSHA 3RK9A 3Q6WA 3DB6A 3ZO1A 1XR1A 2J0KA 1FVTA 4AQCA 5L2IA 5J79A 1H08A 4NZWB 3P23A 2GS7A 1PXLA 3RGFA 3POZA 3WZDA 2JKOA 4GT4A 4U79A 4E4NA 3F9NA 4O0RA 3OCTA 1XBCA 2OFVA 4A7CA 5L8LA 2R2PA 4IVCA 1REKA 4AU8A 2HK5A 3EN4A 3NWWA 4OTFA 1E1XA 3I7CA 2PZIA 4GYGA 2X4FA 5AP4A 3UOJA 1SZMA 3SW7A 5E91A 3VUMA 3H9RA 1PKGA 1PXOA 5DPVA 4BKYA 3DK7A 2WTKC 1GZOA 1RE8A 1YI3A 4FTIA 4PDPA 4CFVA 3FKOA 3BYMA 5TT7A 3LM0A 3QXOA 5CSPA 3QUDA 4TNDA 3M1SA 2YEXA 4CFFA 3NW6A 2XP2A 3CJGA 1OIQA 5C26A 4I1ZA 4IC7A 1M7NA 4FKUA 5K5NA 5IQBA 1BKXA 5BVFA 5EDQA 1Q8WA 3ZLWA 4F9CA 5AUWA 3FPMA 1UA2A 2C5OA 4WNMA 4FEVA 3S4QA 5BVDA 3U51A 1LPUA 4IC8A 4X3FB 4F9AA 2P33A 4AE6A 4QYFA 4OW8A 1Q3DA 4AA5A 1KOBA 1LEWA 2VN9A 2GNIA 1ZRZA 3TNWA 5DOSA 3QALE 1O6KA 1BYGA 4A4LA 3EQPA 4B8MA 4K1BA 4DHFA 3EIDA 4GW8A 4XBRA 4FIFA 3R01A 2RG6A 3G9LX 1PJKA 4WKQA 3DOGA 4YJOA 2V0DA 3T3UA 3KF4A 5JT2A 5HNBA 3UO5A 3JR1A 3HVCA 3D5UA 4M0ZA 4AZVA 4EK6A 5DT0A 4GT3A 5IH6A 5LXMA 2HXLA 2XNGA 2OIBA 4C57A 2GHGA 5E8YA 4L3LA 4O0UA 4Z7HA 4P5QA 1OL7A 5B2KA 3QFVA 4BKJA 5BUEA 3EN7A 3O8PA 4ZJIA 2BAJA 3NUYA 3ZDIA 4H3BA 2FUMA 3L9LA 3MB7A 4L68A 2XCHA 4KABA 2RIOA 2OZOA 2B53A 4GSBA 3O0GA 4CT1A 4PDYA 4S31A 4DT9A 3AC3A 3DAEA 5E9EA 3RNYA 1R1WA 3MIAA 5LMAA 2W1ZA 3NDMA 2W7XA 4IACA 4UB7A 4HOKA 5ANDA 3RKBA 2VO0A 3FBVA 3PPZA 4I5MA 3RBWA 3VW6A 4DG3E 4QD6A 1YWRA 2W99B 3OT3A 5AR8A 4EOIA 3MJ2A 5JH6A 5K0XA 4LQMA 4BDJA 4UY9A 4YZNA 3FY0A 2PVKA 3GCUA 3ORIA 4RT7A 2GHMA 2PY3A 4LOOA 4EOKA 3BV2A 3UNKA 2CKPA 4IWOA 4PMMA 4KINA 4X2GA 4R7HA 2UUEA 2UZBA 2YIQA 2YIYA 3DAJA 2Y6OA 3VS3A 3F88A 3K3IA 1XQZA 3WF8A 4BBEA 4L45A 4CZTA 2VTJA 2IWIA 1H8FA 3AT4A 4RQKA 5EOLA 3ZU7A 4F7SA 5E8VA 1UNHA 3QGWA 3KB7A 4EUTA 1M2PA 4MX9A 5K4JA 2BRGA 3CSVA 1QCFA 4CV9A 4ANOA 4ANBA 2YHVA 5L6OA 3FLZA 4BGGA 4AFEA 2XK8A 1PXMA 4IDVA 4MAOA 4BDFA 3I1AA 3ORMA 4I93A 3GBZA 2W05A 2YM8A 2JDSA 3F2NA 4RVLA 5AR3A 3PP0A 4LL0A 4ZTLA 3FMKA 3WIKA 1W98A 2ZV8A 4F64A 2HZ0A 2EU9A 4QTBA 1Q5KA 4U40A 5L2WA 3LLTA 1H1QA 3MH0A 3SX9A 3OCGA 1CKIA 3QCQA 2XIYA 4IANA 2QOLA 3FXXA 4CD0A 2C6KA 1NVQA 4QP7A 4FZ7A 1BX6A 2RGPA 1ZYLA 4YPDA 3QTXA 3QBNA 3FHIA 3O96A 4TRLA 2W1IA 5C8NA 1OBGA 5J7HA 1Z5MA 3RHXA 2UV2A 3RPOA 2YACA 4QTDA 4FTRA 4RVMA 4F7LA 4CFMA 4UZDA 1NXKA 3Q4UA 4FV4A 2OIDA 4CNHA 4ACCA 2J7TA 2ZAZA 4DEEA 3KY2A 1PXNA 3ZFYA 3C4EA 1KE9A 4DEGA 4MXAA 2ZV7A 1DS5A 2IZUA 3ZEWA 1JOWB 1OL6A 3D7ZA 4BIDA 2DYLA 4MXZA 5DA3A 2RFDA 5E8TA 3AMYA 4E4MA 4G34A 2I1MA 3NYVA 4N0SA 4JJRA 1SVHA 3BZ3A 3DBCA 2XEZA 2I0YA 4TXCA 2F49A 3QUPA 3H0YA 5AV0A 5HESA 1MQ4A 2O0UA 2PPQA 3WZUA 1Q62A 5ETCA 3E8DA 4W8DA 3FL5A 2YZAA 3JUHA 3LQ5A 4FTOA 2QC6A 4GUBA 3VS1A 2FGIA 2X8DA 4UX9A 4BR3A 4C62A 4U43A 3ZXZA 4ZAUA 3IS5A 5BYLA 3O7LB 5CAOA 4ACHA 5JQ5A 1OL5A 2C1BA 2WO6A 4KSPA 3DNEA 3PE1A 4MTAA 4IX4A 5JGBA 2JIVA 2OH4A 4D0XA 3RPYA 3KU2A 4CKJA 4AGDA 4GYIA 2BCJA 4DLJA 3CXWA 5HE3A 3ITZA 1WZYA 2IJMA 2P3GX 4FV9A 4MKCA 4E3CA 3QU0A 4D5HA 3KXHA 5HGIA 5JMSA 3PWDA 4IH8A 3DLSA 2XZSA 4QP3A 2R3RA 2VTIA 4QTEA 5CEKA 3QYWA 1V1KA 2QKRA 5AFVA 2BDFA 2GFCA 1SVEA 4G31A 2AC3A 5K4IA 3AD6A 4LYNA 4YC6A 3LJ1A 1OKYA 2B1PA 2QKWB 2W1CA 2WFYA 2A27A 4AP7A 4RIWA 4NT4A 3W8LA 4QQCA 4A07A 4EK3A 5L8KA 3UMWA 4FNZA 3LIJA 2VU3A 3GC8A 2XYNA 4R5YA 3V6SA 3MSSA 3U4WA 4JDJA 4PDSA 4BZDA 4ZY5A 4L52A 5CAVA 2X81A 3UIUA 5KBRA 4Q5EA 4YJTA 3CR0A 3MPAA 4X2FA 4R78A 3OXTA 3LFBA 4G6NA 4MEDA 5CWZA 3ZC5A 1ZYCA 4HGTA 2YLEA 3NNWA 5HVYA 5M4IA 3TZ9A 4KKGA 1J1CA 2J0IA 4YLKA 4C3RA 2CLQA 4JT3A 2IZRA 2YCFA 3Q2MA 2C4GA 4O7ZA 5ETIA 3WF6A 3EFJA 3GVUA 1VR2A 3I6UA 4F99A 4FTTA 4ALVA 1H26A 3NZ0A 5CSVA 5M56A 4I5PA 3ZLYA 3PXYA 2JDOA 4U6RA 5EW3A 3MPTA 4EKLA 1HOWA 2PZ5A 2QOCA 3R71A 2PHKA 2VO7A 4TYIA 2DWBA 4TYJA 4BI1A 4X6QC 3V51A 5IH4A 3EKNA 1XH5A 2PK9A 3IW5A 4ZTMA 5M4FA 3JVRA 3DXQA 2QU5A 4S30A 4FTLA 4DC2A 2FVDA 5FEQA 4QYYA 4KB8A 3D4QA 4GVJA 4ZZOA 3EQRA 4R6VA 5HE1A 2F4JA 2WTCA 2QOIA 4NM0A 3U87A 3PLSA 4YJNA 2R3MA 2W4KA 4AE9A 3GQIA 3C50A 3NPCA 5GNKA 4EOOA 2QI8A 5J7BA 3UPZA 2I0VA 5CSXA 3RTPA 2R5TA 3W1FA 3A7FA 4FTCA 3COKA 5EM6A 3ZM4A 3W2RA 3LAUA 3QRTA 3Q4ZA 3GU7A 3E7VA 5H3QA 3W32A 4E6AA 4NL0A 4E5BA 2OXXA 3TEIA 5I9XA 1K3AA 5HHWA 3VJOA 3CQEA 4FIHA 3LCTA 4FVPA 3R9RA 4PF4A 1GZ8A 4RIWB 2PZRA 4YC3A 3RP9A 3UNJA 3MY5A 1BI8A 1YRPA 1Q41A 2XK4A 4IAAA 1JKSA 4KIOA 4YJPA 1V0PA 4USDA 3C4CA 4EHVA 4RRVA 2BPMA 3FXZA 3PXQA 1Q61A 4GJ2A 3R83A 5KMMA 4EWHA 4XJ0A 2C68A 4BZOA 2X9FA 4EEVA 1NA7A 2BR1A 3TJDA 4TWCA 3G90X 4WNKA 3R00A 4MYGA 1W84A 5HVJA 3B8RA 5LWNA 4CXAA 2Y6MA 1YKRA 4HPTE 2ZVAA 3MB6A 3U6IA 1Q8ZA 2OJ9A 2NRUA 4R5SA 5C27A 4MD7E 3FY2A 2I6LA 2OGVA 3C4WA 5JRSA 4BCGA 4G6OA 3GCPA 5L4QA 3R21A 5IUGA 1UKHA 3AOXA 3MVMA 3QTQA 4NUSA 2QD9A 2OJGA 3MYGA 5A4QA 4QO9A 2F57A 5KBQA 1J1BA 4FSYA 5T3QA 2YIRA 4MNFA 1JSTA 5D7AA 2BRMA 5L6PA 4HVGA 1QMZA 4PPAA 4LMNA 1H00A 5IA2A 4R7BA 4F70A 4OTPA 1YWVA 4BCKA 4UALA 4O7SA 2HELA 2UZEA 4TW9A 3FC2A 3LJ0A 4AACA 4A9YA 2BKKA 2J0LA 2WQNA 3DBDA 4C4IA 4YNEA 4FTQA 4KS7A 3FMNA 2WHBA 3H0ZA 3AD4A 4M67A 3VBXA 4IADA 3SDJA 5EW9A 4XV9A 1OIYA 2CNQA 3R9NA 3R9OA 1ZZ2A 2G15A 2JDVA 2Y7JA 4AN9A 2QHMA 2QNJA 4X6RA 5FM3A 5HD7A 1BL6A 3ZHPC 4BI0A 3IKAA 3Q04A 3P1AA 4TT7A 2YZLA 4NCTA 4O84A 4J8NA 3T9TA 3LXLA 4FOBA 3QX4A 4CZYB 4MF1A 2WTIA 3NW5A 1YVJA 4JBVA 4M13A 3VS7A 4BCPA 3HZTA 4RVTA 4ACMA 3EMGA 4RJ3A 3JPVA 3MH3A 5HCZA 5JZJA 4JDKA 5DHJA 2OO8X 2C0OA 4M69A 2EWAA 5D10A 4E20A 2F7ZE 3BQRA 3UIMA 2XM9A 3GENA 4C38A 4NIFA 4XX9A 4EHZA 5HNIX 3NIZA 4XG8A 3B8QA 3E93A 2XK9A 1AD5A 3KK9A 2WD1A 3R02A 3R63A 4JRVA 3L9MA 5EM7A 1XH4A 4A06A 2X8EA 2WMWA 4IVDA 3VQUA 2UZWE 4E4XA 3U6JA 3DGKA 5M07A 3KMWA 4KRDA 2ITZA 2ZDUA 4LV5A 3EQFA 3OXIA 2IW9A 4G9RA 2QR8A 3QLFA 4JNWA 4PTCA 3AC5A 4X3JA 3KK8A 4YSMA 4CKRA 4EJ7A 5HG9A 4FICA 4RQVA 4MBLA 3DY7A 3NW7A 2A0CX 4XG4A 5L2SA 4QTAA 2WQMA 3QTRA 3SW4A 2HW6A 4FE2A 2IG7A 2FO0A 3AXWA 2B9FA 3JYAA 4FKOA 3FYJX 4BY9E 3MDYA 1YXSA 2JD5A 4OT5A 4GVAA 1FVRA 2F7EE 3RM6A 3DTCA 3FZTA 4O6LA 3A8XA 4ZZMA 3EQBA 3OCBA 3R7UA 2ZYBA 3PJ3A 1PXKA 4DLIA 4EHEA 4AG8A 2WMUA 3KL8A 3SRVA 4EOSA 4AOJA 2UZNA 4JR3A 4UMPA 4IJPA 2J2IB 2ZV2A 1GJOA 4HGEA 5EHLA 5FD2A 2VTOA 2VWIA 3C7QA 2XB7A 3FMDA 1X8BA 3ODYX 4ITHA 3TDVA 3PY1A 5HBEA 2J9MA 2C47A 3F7WA 5HVKA 1GNGA 5CU2A 4ZTNA 4O27B 4OTWA 3KRLA 4RG0A 4FT7A 4ACGA 4D2RA 2WMRA 5DFPA 3GU8A 4NW5A 3LFDA 3R22A 2I0EA 2PL0A 3QTSA 3PY0A 3PRIA 5HCYA 2WIHA 1Q99A 3BRBA 5M4UA 5CALA 1OBDA 4GKHA 5FDXA 4C33A 2J51A 2YM7A 2E2BA 2JFLA 3JY0A 3NUPA 4X2JA 1CMKE 3IDPA 3UODA 2BDJA 3RCDA 1IEPA 2C6LA 2WQEA 4I6FA 4RZVA 2PZYA 3IECA 2WNTA 4ASEA 2W96B 3A7IA 1OL2A 5CEOA 5AP1A 4U3ZA 3Q5ZA 2GQGA 5FTQA 3QTIA 5CYIA 3BYVA 5CXZA 2B52A 4RLLA 3DDPA 5HOAA 4N70A 2R64A 4QMPA 2O2UA 4FR4A 5EHYA 5EQEA 4I6BA 2PULA 2HZIA 2C69A 5IMXA 3NYOA 4QPMA 4FKSA 1Y57A 1GIJA 3GCVA 4IWPA 4Z55A 3UC4A 5GHVA 1CKPA 3QXPA 3LHJA 3OD6X 3K2LA 3AGLA 4XV2A 1M14A 3Q4TA 3HP2A 2CCHA 3DK3A 4FSQA 4GT5A 4K6ZA 4LM5A 1XBBA 5AR5A 4DFNA 3ANRA 4JX3A 5A46A 3U55A 1YOMA 3P9JA 4FEQA 4QNAA 1R78A 3E8NA 3PWYA 5KHXA 5KMKA 4CGAA 3EJ1A 3BEAA 4U42A 2RFNA 4TKSA 4D58A 4E5AX 2CSNA 4IWDA 4JBPA 4ANNA 4L42A 3BGZA 1OIRA 3SRVB 4APCA 5ITAA 3ATSA 4GFGA 2REIA 3TIZA 3HV6A 3MIYA 3ENHA 4RX8A 5EH0A 4FTJA 5FP5A 5GJDA 3TACA 1IAJA 2HAKA 4IZAA 2ITWA 3LXNA 4EOPA 2OJFE 1YHWA 2QO9A 2RG5A 3VIDA 3SHEA 3RAHA 4F1TA 4CFXA 5C8KA 3QD3A 3EQCA 5CTPA 2ITUA 2QOHA 4O91A 3OMVA 2R3PA 4U5JA 4YP8A 4HVDA 1JPAA 3I0QA 4G17A 2XBAA 2R0IA 3UP7A 3NUAA 3BYUA 3FLNC 2UW9A 3P08A 2W06A 3L9PA 4LRMA 4YMJA 4UYAA 3W55A 5ACKA 4ZEGA 2GTMA 1DAWA 5E92A 2PSQA 1KE7A 1XBAA 1S9JA 1OZ1A 5IH5A 5B0XA 5HO7A 4R3PA 4Q9SA 2C5XA 3OFMA 5JFVA 4UMTA 4WNOA 2H6DA 1OKVA 3CTJA 5JN2A 4KKHA 3F3ZA 4EOQA 4G1WA 5GZ8A 3ZRMA 3KC3A 4L43A 4BKZA 3VF9A 3D2KA 3MTLA 3ZOSA 2C5VA 4C3PA 3Q5IA 3WILA 2IVUA 2R7IA 2W1GA 4OLIA 4FSMA 4BICA 2OK1A 3Q52A 3RWQA 1JQHA 2PMIA 3MA3A 4BCOA 4V04A 3FQSA 3ZXTA 1G5SA 4P5ZA 5AUZA 2NP8A 3VRZA 4DEDA 3IG7A 3WF5A 2B9JA 4BFMA 5JEBA 4AT4A 2BZIB 4C8BA 2C6EA 4N4SA 5DEYA 3V8WA 4CLIA 2YDKA 4RIYB 4UXLA 4DEIA 1OPJA 1KE5A 3SV0A 4UWBA 4TY1A 4KRCA 5FXRA 4QYEA 3DV3A 1YXUA 3EFLA 5AP0A 5EYKA 5F95A 3LLAA 5IA1A 3R9HA 3KEXA 4UEUA 3EB0A 4RA4A 4IX5A 5HLNA 4BHNA 2UW5A 2X6EA 4NM7A 3ROCA 4FIEA 2IN6A 4RVKA 5HBJA 3ZBXA 2C0IA 4PP7A 5A4EA 3ZSIA 2C6OA 2IZSA 5EFQA 4ERWA 2JLDA 3LKMA 1XH7A 4PL3A 3MFSA 3IW8A 4YO4A 5LCJA 2IPXA 3LPBA 3PXFA 3KKVA 4JDHA 5FXSA 2IW6A 1PRYA 3GU4A 4IM3A 4AZFA 2Q83A 3OP5A 5AP6A 3DFCB 2Q0BA 1RW8A 2YABA 2GFSA 3PJ1A 4QP8A 3MY1A 5E4HA 3DU8A 2R4BA 4FTKA 4N6ZA 3LZBA 4IJ9A 3RCJA 5KMIA 2O8YA 1APME 2BTRA 3GB2A 4J52A 5ANOA 2XH5A 3V8TA 3HEGA 1QPCA 2JDRA 2YN8A 1H24A 3GGFA 4WRSA 2WGJA 2VNWA 3ETAA 4GUEA 1URCA 3SD0A 4ANQA 3KN5A 2C6IA 2B4SB 4ZSGA 4AW5A 4EZ3A 2G2FA 3IDCA 3GI3A 3OXZA 2C6TA 5D7VA 4CEGA 1ND4A 3OWKA 1YOJA 4EQUA 3E3BX 2I7QA 5L3AA 2VWUA 4JAJA 5F1ZA 4ZJJA 3TNQB 4PMTA 3LFSA 2BTSA 4QTCA 4QMMA 4C58A 3V6RA 1G8AA 3U8WA 3QYZA 3R2YA 1H01A 2BRNA 4MBJA 4USEA 3D94A 4MH7A 3MH1A 1XO2B 3UBDA 3LFEA 4RJ8A 4Y5QA 4K18A 5CEMA 4O6EA 4C2WA 4XCUA 3DKOA 5EDPA 1FMKA 1P4OA 3JY9A 3FSKA 3DJ5A 4EYMA 3GUBA 2DS1A 4DF3A 5IF1A 2VTTA 3FLQA 2VWXA 3TTJA 5BUJA 3NYXA 4G9CA 4JQEA 1JAMA 3MN3A 3HX4A 5FEEA 4I6QA 2XNPA 4NM5A 4ANMA 4ZTRA 1BUHA 2BFYA 2CGXA 3QGYA 4ZTHA 3TG1A 3FAAA 5CF6A 2QG7A 5I9ZA 1MRYA 4XG2A 1ZMVA 5CVFA 2J50A 2FSMX 4AOIA 3B2WA 4FIJA 3D9VA 3F3VA 5HTBA 3TV6A 2NO3A 4CV8A 4YJRA 3QKMA 3Q9YA 5CX9A 3HMOA 1PXIA 4FKRA 3A7JA 4P2KA 2WMTA 2XS0A 3F5UA 3BYOA 2VX0A 2GQSA 3F61A 5CS6A 3SGCA 1Y8YA 2PVMA 2HENA 1OI9A 3ET7A 5I9VA 3NS9A 1E1VA 3F6XA 4O38A 3I5ZA 1FQ1B 4WBBB 4BDCA 4UZHA 4RWJA 4U0IA 5IKWA 2EUFB 4MNEA 3L8VA 1ZY4A 2PVLA 1CSNA 1P4FA 5HO6A 3F3TA 3T8OA 1H0VA 4IEBA 4Q5HA 3OUNB 5I3OA 5HU3A 3ALOA 3R1YA 3BELA 5CQUA 2EXEA 5BNJA 2A4LA 5BQ0A 4MBIA 5DI1A 4ONAA 5K0KA 3VUGA 4TTHB 4G5PA 2Z2WA 5HG7A 3LMHA 3NVKI 4EH6A 4ZSAA 3TUCA 4BDDA 1S9IA 5IQIA 4FKLA 2WZJA 3THBA 1YDSE 2XJ2A 2ZM1A 4BB4A 4RWIA 4GMYA 4JR7A 2FYSA 4F0IA 1WBNA 2YFXA 3BX5A 3KMUA 3BGQA 3P7CA 1ZYJA 3F7ZA 3P79A 3NCGA 4Q9ZA 2GNGA 3DQXA 3NVMB 5EYDA 4CMTA 2RFSA 4C61A 4AGCA 5E8UA 4J53A 3QA8A 1YOLA 2IZTA 5D41A 1R3CA 4OAVB 2VWYA 3GU6A 3P7AA 1GZKA 2QLQA 2XMYA 3RPVA 3CGOA 1KE6A 4FC0A 1KUTA 3DXNA 5A54A 3MGYA 2BIYA 2WOUA 2G1TA 4HCUA 2W4OA 2FA2A 4E1ZA 2JIIA 3PJ2A 4LV8A 1OL1A 1GIIA 4E73A 3R1QA 5HO8A 4GCJA 2A19B 3QTUA 3N9XA 4J7BA 4S2ZA 4PRJA 4ARKA 4GL9A 3R7OA 3EOCA 3VBWA 3WI6A 1MUOA 2CGUA 2CLXA 4BI2A 2BIKB 4YZDA 3TKHA 2UVZA 3H3CA 2R3FA 4TWPA 4XH6A 3KGAA 5EW8A 4DINA 2R3LA 1LEZA 1W82A 2YLFA 5DE2A 4DAWA 2RSVA 4O7WA 2XKDA 4IX3A 2ESMA 2WB8A 3F66A 3TZ7A 4AA4A 3CPCA 4LOQA 3R8VA 4KUJA 5IQHA 2XCKA 1WFCA 1CDKA 2HCKA 3QRKA 4WG4A 4FTMA 1TQPA 5I0BA 4G3DA 5IQDA 4F9YA 5J9LA 4FTUA 2WEIA 4CMOA 2P55A 4IZYA 5AIRA 1KV1A 1WBSA 4RGJA 4AGWA 4KIQA 4KBCA 3HA6A 4RWKA 1IRKA 2VX3A 4YTHA 3NAYA 2BAKA 2BZJA 2ETMA 2AC5A 3W2QA 3G0EA 4J97A 5HNGA 3ZO4A 2Y4IC 2Z8CA 4DFYA 4BTFA 4EI4A 4XS2A 3BI6A 4BWKA 5KMNA 3QRIA 1U5RA 4XMOA 4LGGA 2ITVA 3PA4A 2PYWA 4G2FA 3ZRKA 3DKCA 3OWPA 5CZHA 5BVOA 2JAMA 3W2CA 4UN0C 4O7VA 5M09A 3KXMA 4CG9A 1IASA 3PVWA 3QQHA 3D5XA 2VGPA 5CNOA 1JWHA 2IVVA 4XP3A 5C01A 3AT3A 4TPTA 4IBMA 4ITIA 2QG5A 3FEGA 2BALA 3Q32A 4OUCA 2WEVA 3UOLA 4JXFA 3ZLSA 3WE4A 4AW0A 4MWHA 3EN9A 5FLFA 2BKZA 5FUTA 3Q53A 3VHKA 2PUUA 2WIPA 2UW3A 4Z9LA 5AUTA 5IMEA 2ONLA 3UIBA 3N4TA 1M7QA 3ROYA 3VRYA 4M15A 4J8MA 5H8EA 3JXWA 5J95A 4AT3A 4ASDA 3UZTA 2BROA 4C0TA 3NYNA 1R0EA 4YBJA 1B6CB 4PQNA 1H1WA 4F6SA 2C3KA 3TUBA 3COIA 2WMVA 5HIDA 1Q4LA 2NPQA 2XYUA 4EJNA 3HV7A 3C9WA 4RIXA 2VTLA 4EKKA 3RMFA 3TV7A 3NUUA 4PMSA 3LW0A 3UIXA 1UKIA 1STCE 4BYIA 3EN6A 5TO8A 4FT5A 3EYHA 4L3PA 5HEZA 4ZLOA 4F7JA 1O6LA 4CFNA 3LOKA 5AEPA 3DT1A 4JDIA 3CE3A 4G16A 4ZSEA 5IG1A 3LXPA 4IFCA 1MQBA 4FF8A 2C3LA 4O86A 4BRXA 4RPVA 5D11A 3MBLA 2SRCA 2ETKA 4XRJA 3KCFA 1OIUA 2PMNX 3F5XA 5AR2A 1QL6A 3Q2JA 4C34A 2VWZA 2UZUE 3HMNA 4U45A 4ZS4A 2H8HA 5ETFA 2ZDTA 3EWHA 1PF8A 4KSQA 4RFYA 3TT0A 4H3QA 3FQEA 4ALUA 3VS2A 2CPKE 4EQCA 2X7GA 3MH2A 5AA8A 3TNIA 4A9RA 3HRCA 3CQUA 5M55A 2X2LA 3DB8A 3V5WA 3IGGA 3BEGA 5C8MA 3EFWA 4NKSA 1OUYA 1H1RA 1UU9A 3GOPA 1Q8UA 4UWYA 4F09A 3A2CA 5KHWA 4DH8A 1W8CA 3OC1A 3DQWA 3EH9A 4F6UA 3TTIA 1KOAA 3IW4A 1DAYA 4JLCA 2C6MA 4QMQA 2O65A 5DT4A 4GRBA 4I20A 4GFMA 5I3RA 4B4LA 4IMYA 3ORLA 2ZV9A 1IG1A 4MXCA 5J8IA 2JDTA 1RQQA 1Q24A 3EL7A 3MY0A 3ORNA 5L2QA 3O8TA 4Z3VA 3G51A 1ZMWA 3E8CA 3ZFXA 3CP9A 4BDHA 2HZNA 3TUDA 1OKWA 4WUAA 3VUIA 4XUFA 3O71A 4QMUA 3GCSA 2H34A 5AV2A 2XUUA 4R1VA 4JQ8A 3E87A 4E93A 3OVVA 3TZMA 2JAVA 3D2IA 4JAIA 3LCOA 3FI2A 3HMPA 3RJCA 4IAFA 3FHRA 5DGZA 4AZTA 3HA8A 1OM1A 2UZOA 4ZLZA 4RIXB 2CN8A 2ZOQA 1WBVA 4HNIA 4LOPA 5BMMA 5AAFA 5J1WA 4NW6A 3ZYAA 4MXOA 1Q97A 2Y4IB 3BE9A 3SC1A 4BCHA 2GQRA 2XK6A 4TYEA 2JITA 5A9UA 4FEXA 2HOGA 1WBPA 5ICPA 2GDOA 2GHLA 2GMXA 5AX9A 4II5A 3S1HA 1PMVA 3BE2A 5EK7A 3GC0A 2YJSA 3ODZX 4ORKA 1M17A 2VUWA 1UNGA 4IB0A 4R3RA 3V5LA 4B99A 5FTGA 2IVSA 2W0JA 4E6QA 1FGIA 5CLPA 3E8EA 2WELA 3BLQA 4WSQA 2QO7A 2ACXA 3R2BA 4JG7A 4MQ2A 3LCDA 5AWMA 3VJNA 3VULA 4YJSA 5DYJA 2QVSE 1NY3A 2CDZA 3FE3A 4M97A 5HLPA 3BHVA 2QR7A 4WA9A 5GZ9A 4YUQA 3UVRA 3QQUA 3IQ7A 1PMUA 4GG5A 2JBPA 2XIRA 3NAXA 4IAKA 2GNJA 4LMUA 5DRDA 3KREA 4H05A 3HMIA 3DDQA 3RWPA 2Y9QA 3U4UA 3KVWA 4EORA 4A9TA 2HY81 3NGAA 1URWA 5HX6A 3QRJA 3KXXA 3QCXA 1G3NA 4RX5A 1H0WA 2A1AB 2HWOA 4NCTC 2J0JA 1PKDA 4GH2A 4WBOA 3IOKA 4Y46A 3VF8A 3RVGA 5J9YA 2YCSA 2X9EA 3GP0A 3QQJA 4K11A 1FMOE 4OR5A 4GIIA 1SYKA 1P5EA 3ZFMA 2OICA 2C5NA 4HPUE 2VNYA 3FQHA 3A61A 5E1SA 4B6LA 2UW0A 3QCYA 4NYEA 3D14A 3NEWA 4AZWA 2G2HA 4IZ5A 4AUAA 4FKVA 2WMQA 1KWPA 3BPRA 3EYGA 4XV3A 4I0SA 1UV5A 5GIPE 4KBKA 3BYSA 2OXDA 1B38A 4C4FA 3P86A 5FDPA 5AR7A 5LOHA 3VBVA 4FT0A 2V62A 1U5QA 3PIXA 4AFJA 5H2UA 3FDNA 2WMAA 5C4LA 3EQHA 3QCSA 5EQYA 5CF4A 4A9SA 3I79A 4ZOGA 4C35A 4Y8DA 1OMWA 4MK0A 4TYHA 4YZCA 5HIBA 5CANA 4DH1A 2QLUA 1OB3A 3MTFA 3VBTA 5K3YA 2WU7A 3DA6A 3PSDA 2XNBA 1LUFA 4WD5A 2VWBA 3DLZA 4CVAA 2P0CA 3LJ2A 4I3ZA 4FKIA 3R8MA 2OBJA 5AP3A 5EYMA 3R7VA 1FBNA 4HYUA 4DFBA 4DGMA 4Y73A 4XLIA 3HGKA 4PTEA 4UBAA 3IK3A 3ANQA 5IQCA 4YZ9A 4RLKA 2O5KA 5JSMA 2O3PA 4GFOA 2QOKA 1NVSA 4BGQA 4AX8A 1ZWSA 3CY2A 1G8SA 5M06A 4A4OA 1KSWA 3GCQA 4FIGA 4FSWA 3F3WA 3MW1A 2C0TA 3UG2A 5AA9A 4LL5A 3TZ8A 3BKBA 4FV1A 1W0XC 2VTPA 4ZSLA 5FRIA 4U3YA 1H27A 3QAME 4CT2A 4O81A 4DA5A 4USFA 4HVSA 2A2AA 1VYWA 4BDAA 5HTIA 2CNVA 3FZPA 3QF9A 5AP5A 5CEIA 3BWJA 3K54A 3C5IA 2R3JA 1VYZA 2XRWA 2H96A 1YWNA 1CKJA 3NIEA 1JSUA 5BVWA 3DBEA 5HG8A 4YLLA 1ZYSA 2CHLA 2XF0A 3HDMA 3Q3BA 4GJ3A 4K33A 3QHRA 4MF0A 4WNPA 4WG5A 5LMKA 4NH1A 3OBJA 3PPJA 3UDBA 4ANLA 1QPEA 4YJQA 4Z7GA 5CF5A 1J3HA 3C1XA 5LCKA 2FB8A 2G9XA 4EK4A 3RHKA 5C1QB 3OY3A 3A7GA 4D2PA 2VTMA 4O21A 4BDGA 1Q3WA 4YZBA 4YPSA 3SXFA 3O51A 3W2SA 4EH5A 2OG8A 2VAGA 3VUKA 2JKKA 4PDOA 4M12A 3F2RA 2IVTA 2YM3A 4WT6A 4XNEA 5FEDA 3NNVA 4FT9A 5AP2A 3PXKA 2GCDA 2P2HA 2B54A 1FOTA 4AWIA 4KAOA 4BL1A 2CGWA 5DEWA 4OTHA 4O0XA 2WMXA 3C5UA 2BVAA 3P78A 4FKJA 2W5BA 3V5JA 4NJ3A 2BDWA 3RALA 3MJ1A 4FYOA 3V5QA 2JIUA 3HRFA 5M51A 4S34A 2XKCA 4WIHA 3QWJA 4PUZA 1GAGA 4EQMA 2WQBA 2E9NA 2Z7SA 4NKAA 1RJBA 4TWNA 4E8AA 3GT8A 1ZXEA 2EXCX 3H9FA 4F65A 2BILB 2R3NA 1ZAOA 4O1PA 4GK2A 3K5UA 5LARA 3SG9A 4A4XA 4IXPA 3S95A 3C0GA 3DJ7A 2GNHA 5DH3A 2GPHA 3LMGA 2PVJA 3ORKA 2QHNA 3QQGA 3D15A 3LCKA 4HGSA 4J99A 2W1EA 4LUEA 4M69B 2EB2A 4F6WA 3S0OA 4FG8A 1U54A 4NIFB 1BL7A 2CKQA 3HAMA 1OPKA 2VWWA 4LGHA 4S33A 2IW8A 3FI4A 3EQGA 2V7AA 4ENXA 5AV4A 4LUDA 3OS3A 3SG8A 4GG7A 3DZOA 4CTBA 3RM7A 3TDWA 4FZAB 1UWHA 5FQDC 2Y4PA 3TJCA 5KCVA 1QPDA 3DFAA 4FBXA 3UVPA 2PE2A 3COMA 2RL5A 3EZVA 3HECA 1H28A 4JS8A 4B7TA 3PPKA 4H39A 2PZPA 4FKGA 2YAAA 3F3UA 4DH7A 3OZ6A 3ZTXA 4QQ5A 4TNBA 3T3VA 4FKWA 3CD3A 3PXRA 3HKOA 2UZLA 3LE6A 3POOA 4RC3A 5HZNA 1JBPE 3I60A 3LCSA 3R7GA 4XG6A 4CRLA 3G5DA 3KXGA 3PA5A 2GNFA 4QMWA 4U81A 5EDRA 5HKMA 3OTVA 3K3JA 4YC8A 4XP2A 5CI7A 4BBFA 4BVUA 4NU1A 3UOHA 4O7RA 4QOXA 1YHVA 3NR9A 5CENA 3ACKA 3C13A 5F20A 3PA3A 3W10A 3AC4A 5GJFA 4L9IA 4NTTA 1SMHA 3SOCA 3V3VA 1B39A 4F1MA 3HAVA 3DBQA 1ZYDA 2YDIA 2R3IA 4D4VA 2XJ1A 4E7WA 1PXPA 4BC6A 2ZB0A 5EYCA 5H9BA 5GINE 2X4ZA 4MXYA 2ERKA 4QP9A 4R8QA 4FV3A 2WXVA 5H8GA 2C5YA 3BQCA 1J7IA 1UU8A 3VBYA 3KMMA 2UZVA 3PY3A 4ZY6A 5AADA 4PPBA 4DE4A 2R3GA 4TYGA 3F82A 4AXAA 5AMNA 4YURA 3NNUA 4RMZA 3N4VA 4QT1A 4X0MA 3IPHA 3QTZA 2FSOX 3R1SA 3MA6A 4JIKA 1A9UA 1SVGA 1Y6AA 5ANKA 1K9AA 1L3RE 4I4EA 5BMSA 5CAPA 4ZXTA 3UC3A 4AN3A 1DI8A 1PYXA 4AT5A 4FEWA 1V0OA 1GIHA 4PV0A 4HYIA 5JRQA 2OI4X 2GTNA 4ZMEA 4UYNA 4APPA 2UW7A 2J5EA 4FA2A 4XG9A 4DFUA 4C3FA 2UZTA 5CASA 2Z02A 4V05A 1YDTE 4G3CA 4OBOA 4FODA 2VTSA 3RAIA 5LQFA 3M2WA 4MQ1A 1O9UA 4NWMA 5DWRA 2J6MA 3A99A 3RNIA 3KF7A 3MFRA 4O0YA 2XNOA 3WBLA 4BDKA 4NSTA 4YSJA 4YZMA 4DGLC 2O64A 2WMBA 3MV5A 3A60A 3VUHA 4R3CA 4UWCA 4YHJA 3VHEA 3QZHA 3TKIA 1REJA 4F63A 3ZO2A 2OW3A 4M3QA 4Y95A 1FVVA 2VX1A 3C4FA 3HRBA 4FK3A 3OW3A 2W17A 3PYYA 4DH5A 2JBOA 2XNEA 3C4XA 4PNIA 3AQVA 3LVPA 3ZEPA 4RX7A 4HGLA 3KCKA 3W16A 1PYEA 2FSTX 3VUTA 4FKPA 3WZJA 4QP1A 3U9NA 3HYHA 4FV5A 4DCAA 1VZOA 2NRYA 2R9SA 3FPQA 2JKMA 3CKWA 5C9CA 2QOBA 3H10A 3WIGA 3KRWA 3VNTA 2YM6A 3DKFA 3E63A 4EZ5A 3L9NA 3TV4A 1EH4A 2PUIA 4FSTA 3OROA 3PTGA 1YXXA 2DQ7X 4JG8A 5IZFA 2XRUA 2E9UA 4PX6A 1YXTA 5CY3A 4EOLA 3LFNA 2XJ0A 3ZO3A 4KIKA 4G3EA 4MXXA 3N51A 1UVRA 3UZPA 2ERZE 3MI9A 4H36A 4PTGA 1OKZA 1GZNA 3PJCA 1BMKA 4L3JA 2OXYA 3O7LD 3R73A 3O50A 3KA0A 4K8AA 3MFTA 2OU7A 1ERKA 4C4HA 4CFUA 3OF0A 4XG7A 4LG4A 1WVXA 1WMKA 3VS5A 4D2SA 3ZC6A 3V5TA 2UVYA 4D9TA 5IQFA 4ITJA 3DBFA 5EI2A 1TQIA 3CGFA 5HU9A 3LQ3A 4BDBA 3PZEA 2VTRA 4ZLYA 3F2AA 4KA3A 3NSZA 2QONA 2F9GA 1DM2A 4M66A 4W9WA 5FP6A 2C1AA 2QODA 1AGWA 5M57A 4BDEA 2CGVA 4UV0A 2IO6A 4FGRA 4PL4A 2PVRA 5ACBC 3SLSA 4MD8E 1BI7A 4K0YA 4DGOA 3BU3A 3IW7A 2J4ZA 3R7EA 3P5KA 4YTCA 2O63A 1H07A 4O7LA 1XH9A 3CTHA 4XRLA 5AJQA 4CCUA 3GEQA 2OJIA 3IW6A 4ZK5A 3FZRA 3ORTA 1VEBA 3BHUA 5EHOA 3EQDA 4L46A 3QD0A 4G5JA 3R04A 3BHYA 3GFEA 3I5NA 3PIYA 1DI9A 4H3PA 4IAYA 4BCNA 4QMTA 5TR6A 4QMVA 4BCFA 4DG2E 3C0IA 2OH0E 2R0UA 5JK3A 5KE0A 2OFUA 3UQCA 3OHTA 2Z7QA 3CPBA 4I23A 3DK6A 2OIQA 4IX6A 3G15A 1YHSA 3RZFA 5CEPA 3QKLA 3H30A 3PVUA 5JFWA 4DTAA 2B9HA 5G6VA 3TIYA 1TQMA 3LMIA 3CC6A 3IGOA 2WTDA 4IB5A 4CLJA 4EK5A 3K5VA 3FLSA 4FEUA 5HQ0A 3WF7A 5JKGA 2GU8A 4FZDB 4HZRA 3FLWA 2E9PA 2R7BA 5F9EA 5LVMA 4M68A 3V8SA 4KBAA 3RK7A 5A6NA 2YCRA 5FWKK 2GS2A 1H1SA 3D7TA 3VBQA 4F7NA 4M7IA 3CIKA 3ZSHA 4KIKB 3PG3A 4FSUA 4RJ7A 4HJOA 5BX0A 5FGKA 1ZLTA 1SM2A 4ZY4A 1ZARA 4X2KA 2CJMA 3R9DA 1JVPP 3KRJA 3EFKA 4ZP5A 1ZMUA 2C30A 4BTMA 2UVXA 3CBLA 3OEZA 5KZ0A 2UW6A 3R7IA 4O96A 4O7NA 5CNNA 3LQ8A 4J98A 4FNWA 4XHKB 1LR4A 3NUNA 4QMSA 4U8ZA 4YJVA 2ZJWA 4L44A 5TE0A 5BPYA 4FUXA 4L8MA 3RINA 1FGKA 3FMEA 4MVFA 3CS9A 3ZDUA 4G3GA 1H25A 5K9IA 1PW2A 4F0FA 5CVGA 3FL4A 3LM5A 3NNXA 4RZWA 3UP2A 4J95A 5CU3A 4ENYA 3ZONA 2E9OA 5TF9A 3WZEA 4BDIA 2OLCA 3IOPA 1YDRE 4N57A 2ITTA 3DS6A 4IFGA 4CRSA 3A7HA 1MRUA 3SKCA 2VV9A 2FH9A 2XIZA 5FG8A 3F69A 5EI6A 1SNXA 1OUKA 4U97A 3BWFA 4WUNA 3RPRA 3OCSA 5J87A 3HMMA 4QYGA 3UMXA 3FSFA 4RX9A 3A4OX 4O0VA 3GC7A 3R8UA 5DMZA 4V0GA 3MS9A 5CF8A 5C4KA 5E1EA 3RK5A 4ID7A 1XKKA 5DRBA 5HCXA 4I24A 2X8IA 3FZSA 4IWQA 3KRRA 4FIIA 3QWKA 4IHPA 4XBUA 1NT2A 4CQEA 1RDQE 3QX2A 5KO1A 3BBTB 5M4CA 4FOCA 4OTGA 3NLBA 2BRBA 3FC1X 4QP2A 4U7ZA 3DAKA 2KTYA 2VO3A 3OY1A 5ANGA 2CKEA 2Z7RA 1MRVA 2ONLC 5B2LA 1E9HA 4PY1A 3L8PA 5A4TA 3REPA 2F2UA 3SOAA 1JSVA 3RZBA 2W4JA 4JOAA 2EB3A 3FYKX 4HZSA 5DLSA 5J1VA 1PHKA 5AIKA 2Y8OA 3B2TA 3D7TB 3FI3A 2PTKA 2PWLA 4BIBA 4MNEB 5CXHA 1KE8A 4FTAA 3O23A 3ULZA 3ACJA 4PNKA 3FZOA 3R28A 2VTNA 3ZMMA 3E88A 4DYMA 4TZRA 4RWLA 4FSNA 4FV0A 4WRGA 4K9YA 4O0WA 3S3IA 3ULIA 3G6GA 4JQ7A 4ALWA 4ASZA 5IEVA 4ZMFA 2CNUA 2HYYA 3QQKA 5T6KA 3WYYA 4JVGA 4F4PA 2X2MA 1OPLA 4FTNA 4LGDA 4H58A 1QPJA 4D1XA 4BTKA 2GSFA 3ID6C 4D55A 3W8QA 4ANSA 3VAPA 5HIEA 4D4RA 2OSCA 5M44A 3NMUF 3PP1A 1OVEA 3R8PA 4U41A 4QMXA 1K2PA 3OEFX 1XH6A 5CI6A 5AUYA 1XJDA 2XM8A 4UXQA 5DT3A 1P14A 2VZ6A 4DFZE 5G1XA 4EC9A 3HV5A 3GNIB 5E8ZA 3PDTA 1YI6A 2X7OA 3F5GA 1W7HA 4EOJA 4TL0A 4XP0A 2PVYA 4G3FA 5KMOA 4B9DA 5GZAA 4XV1A 2PUNA 4C37A 3CQWA 2JEDA 3D5WA 3R7YA 4FVQA 4F08A 2WTKB 1JNKA 4X7QA 3VC4A 3S2PA 2C3JA 2QQ7A 1NVRA 2BUJA 2XKEA 4YO6A 4F1OA 5CU0A 3VW8A 3TNHA 5L2TA 3V5PA 4L6QA 4V0GB 2GS6A 3TNPC 3FKNA 4QMOA 3VVHA 2J5FA 4YJUA 3V01A 2PU8A 4O2ZA 3H9OA 2Y0AA 2I40A 5IISA 3FI8A 3BU6A 5EQPA 4E5WA 5JGDA 1Q8YA 2QU6A 2C6DA 4LRJA 3MVJA 2BMCA 5A14A 4XOYA 3ERKA 2YDJA 5IUIA 2EVAA 4EH7A 2RKUA 3UZRA 4D9UA 5DR9A 5CT0A 5DR2A 2R3HA 2X2KA 5LVLA 3ZRLA 3PVBA 2ITPA 4XYFA 4D1SA 4QNYA 5CAQA 5HD4A 3DJ6A 4M84A 5FBOA 4JL9A 4O0SA 4C7TA 3LFQA 2X7FA 4ZIMA 1J91A 4EOMA 3C51A 4HCTA 4GS6A 4GV1A 3FKLA 2BRHA 5L6WL 2VD5A 3AC1A 2JGZA 3DZQA 3COHA 1I44A 1WAKA 2XEYA 3GU5A 2DUVA 4DTKA 3FJQE 2ITNA 2PE0A 4IZ7A 5FM2A 1F5QA 4QMNA 4G6LA 3UOKA 4BBMA 2YA9A 4D2TA 3ZUTA 4CQGA 3Q9WA 4XOZA 4DBNA 1IA9A 3QKKA 4HCVA 1WCCA 2YJRA 4FT3A 4QPAA 4I22A 2AUHA 4FNYA 3WZKA 2W1FA 5A6OA 2HXQA 3N4UA 1U59A 5AM6A 5E8XA 2QOFA 2R3OA 3EN5A 3QQFA 4FSRA 5IQGA 3F5PA 1WBOA 4CZUA 4FK6A 3MESA 3AD5A 5H8BA 2ITXA 4FG7A 4WSYA 5IEXA 3KN6A 3KFAA 3JS2A 4KNBA 5LVNA 2WAJA 3PXZA 5D12A 3ALNA 3TKUA 3VN9A 4CSVA 4YTFA 2BFXA 4IW0A 4D1ZA 5B7VA 3CEKA 2Z7LA 3FUPA 4Q2AA 4AZEA 2PUPA 2Q0NA 4QRCA 4YHFA 5BVEA 4FX3A 1LP4A 5AX3A 3E62A 3QD2B 2F2CB 5IDNA 3G9NA 3WE8A 4O1OA 5IDPA 4EH2A 4ZTQA 3BV3A 3W18A 2WTVA 3PRFA 2XNMA 4YGAA 5F4NA 5AUVA 3ZH8A 3TM0A 2QURA 4H1MA 4M0YA 5J5SA 1L8TA 3O17A 4DG0E 1ZOHA 3ELJA 5E8WA 4AGUA 1Y91A 4HYHA 4GU9A 5TKDA 3EHAA 4D28A 5AR4A 2W9FB 3QZGA 1VJYA 1TKIA 4GK4A 1W83A 3DPKA 4YU2A 2XNNA 2YCQA 3LXKA 3HNGA 4O22A 3HUBA 3A8WA 5HTCA 4WG3A 3BBWA 3PZHA 4KKEA 4D0WA 4L7FA 4CCBA 5LVPA 3QTWA 1FINA 4FUYA 1Y8GA 4E4LA 4RFZA 3TWJA 4Z16A 5T68A 4AAAA 4MD9E 5GIOE 3AC2A 2WPAA 4BYJA 1YXVA 2JKQA 2VGOA 5EOBA 2ZB1A 2UW4A 3I81A 1R39A 4FL3A 2LAVA 3Q9ZA 5HX8A 2XBJA 5HE0A 4EBWA 4D4YA 3VS0A 4QMYA 3WYXA 3PLAE 4WHZA 1WVWA 2R3KA 2VTHA 3NUXA 1U4DA 3M11A 2H9VA 5EI8A 4PPCA 4DEBA 4EUUA 4N6YA 4AA0A 3GQLA 3ZS5A 2YM5A 2VTAA 4NTSA 3V04A 3ZUVA 3PVGA 3OWLA 4FMQA 4DN5A 5KKRC 1PMNA 1T45A 5DVRA 1A06A 2P4IA 2YWVA 3I0OA 2BHHA 4UMQA 3W33A 4HW7A 3PSCA 1JKLA 4E6CA 4EH3A 4LFIA 3AG9A 3TI1A 5AM7A 4QP4A 4Y72A 3WOWA 3R30A 2ITYA 4OTDA 3E7OA 3QZIA 4I41A 4HVIA 2V7OA 4ZTSA 4IAZA 4DT8A 5LVOA 5CU4A 5BUIA 3D0EA 4IB1A 2ZM3A 5EKOA 2OWBA 4OBQA 3HP5A 3OW4A 4XLVA 3D5VA 5EKNA 3BLRA 4W9XA 5D9HA 4HVHA 3UYSA 5LMKC 3Q6UA 3QQLA 5I9UA 2OZAA 4GU6A 2X1NA 4IVBA 4TN6A 2GNLA 4RJ6A 1UWJA 5CEQA 2W5AA 3FMHA 4FKTA 3FWQA 5BVKA 3MVLA 4ERKA 4FVRA 4QQTA 1HCKA 1I09A 1M2RA 2YWPA 1ZOGA 1V0BA 3RPSA 3SAYA 5KMLA 4O7TA 3ORXA 4O7YA 5M08A 2VWVA 4M14A 4QQJA 1AQ1A 3IDBA 4FG9A 5JQ8A 2ITOA 2YIXA 4EHGA 5ETAA 1J7UA 4BWPA 4RC4A 2F7XE 1UU3A 3C0HA 5EM5A 4EZ7A 2NNWB 3EZRA 5CVHA 4MCVA 3NUSA 4D4SA 3U9CA 4NK9A 4AF3A 3BLHA 4S32A 5DIAA 1U46A 5DR6A 3LFAA 1Y6BA 5I4NA 4FZ6A 2X39A 4IVAA 5IA4A 2BZHB 2WTJA 5A4LA 3DCVA 1ZZLA 4IIRA 3CD8A 4ASXA 4TWOA 4PP9A 5CQWA 4O0TA 3Q96A 4BCQA 4CYIA 4D2WA 3CLYA 4L7SA 4OBPA 5D1JA 3G6HA 2YIWA 1XH8A 3AT2A 4DTBA 4MWIA 4C4GA 2G2IA 3ORZA 4M8TA 4RJ4A 3CTQA 2B0QA 5JFXA 4DCEA 4AW1A 1GOLA 1OGUA 2X6DA 3BHHA 5LWMA 3W2OA 1Z9XA 2R3QA 3OG7A 3HL7A 4JG6A 5L8JA 4XEYA 4OTRA 3L8SA 3SXSA 4V01A 5ANJA 4JI9A 3C4ZA 3LFCA 3FV8A 1J7LA 4GKIA 3U54A 2JC6A 5EG3A 3TCPA 4YBKA 3PIZA 1H4LA 3P0MA 4FL1A 1TVOA 3ENMA 4I21A 4JIAA 3RI1A 3UQGA 5BYZA 4EWQA 3KULA 2W5HA 2XVDA 1Q8TA 3ZBFA 3AGMA 2W1DA 4E6DA 4CFWA 5DG5A 3OTUA 5HG5A 2WOTA 4GEOA 4EH8A 4L53A 2VRXA 2OF4A 2RF9A 3VO3A 5CAUA 4L01A 4WOVA 5CT7A 3M42A 3G2FA 5C03A 4EONA 5IPJA 5JZNA 5LJJA 2WMSA 1O6YA 3DNDA 1KV2A 2OZAB 3KXZA 4TYHB 1H1PA 4BF2A 4FV2A 2CMWA 4YHTA 1BLXA 3P4KA 3BGPA 3BU5A 3DTWA 4NM3A 4CTCA 5FXQA 5BVNA 4Y5HA 3NX8A 3HDNA 2XK3A 3AMAA 3ZCLA 4EBVA 2XIKA 5CU6A 1HCLA 2LGCA 4K2RA 5E8SA 3Q60A 3UYTA 4ZSJA 2WKMA 4U9AA 3VS4A 4F9BA 3VUDA 3UNZA 2HWPA 3SA0A 4YNOA 3ATTA 4W4VA 3E64A 3MPMA 4FV8A 5FBNC 4NFNA 4YR8A 3PJ8A 3QUEA 4JRNA 5HLWA 1PY5A 5AP7A 3FMLA 3UVQA 3JVSA 4W8EA 3I7BA 1IAHA 5K5XA 5KKRB 2HIWA 2EXMA 3HUCA 4BZNA 1JLUE 3E5AA 4BCIA 3E3PA 3I6WA 4R7IA 3RAKA 2QOOA 4DH3A 1CTPE 3MFUA 3UE4A 4AZSA 5HORA 1NW1A 3T9IA 4D2VA 4FYNA 4AS0A 4YTIA 4EH4A 5IA3A 1JKKA 4C4EA 3GOKA 3IO7A 4JX7A 1MP8A 1ZOEA 1PMEA 3SXRA 4FV7A 4HNFA 4X21A 3WARA 3GFWA 4C02A 4JBQA 2W1HA 1T46A 5E7RA 2CKOA 4FGBA 4CMUA 3I4BA 2PE1A 5IQEA 3OBGA 4I5HA 2RFEA 5AV3A 4RJ5A 2PVNA 4U44A 5CZIA 4U80A 3OWJA 4E26A 5J9ZA 4R77A 3L1SA 3MVHA 2J90A 2PVHA 1JKTA 4DEHA 4W4WA 3TN8A 3VWAA 5IA5A 1Z57A 2JFMA 2J0MB 3L8XA 4FNXA 3EKKA 4X2NA 2YERA 3KULB 4BWXA 5LMBA 3TL8A 3A62A 3HLLA 2ZM4A 4QYHA 4EC8A 1IR3A 4F9WA 1ATPE 5KUPA 3O8UA 3R8ZA 1M52A 3GC9A 4AOTA 4OAUC 5IQAA 3UO4A 5AV1A 3ZUUA 3KXNA 5AUUA 4W4YA 4RIYA 2XK7A 5HE2A 4LI5A 3R8LA 4FZFB 2ZMDA 3AC8A 4AN2A 4BGHA 5E90A 3ORPA 2ZMCA 3GXLA 2C3IB 4XG3A 4R1YA 3UJGA 2CN5A 4I4FA 4AW2A 4BHZA 4IQ6A 4EK8A 2UZDA 3UGCA 3ZSGA 2HW7A 2X0GA 4JBOA 4J1RA 4CYJA 4PMPA 2YAKA 4KIPA 4I94A 4J96A 3PE2A 3QZFA 4QPSA 4QMZA 2XA4A 3WF9A 1YW2A 4L67A 2OKRA 3FZ1A 5IEYA 2V22A 3EQIA 1F0QA 3D83A 3II5A 1IA8A 4RSSA 1OECA 2B9IA 2OF2A 5TOZA 2I0HA 2OJJA 4Y83A 4BTJA 2HZ4A 4YLJA 4IDTA 3R1NA 5ANIA 3QC9A 4I5CA 5A3XA 1M2QA 4QP6A 3QD4A 5DNRA 2ITQA 4WO5A 4ZJVA 4I0RA 5KX8A 3DXPA 4C4JA 2YISA 2WQOA 3OOMA 4P90A 4EH9A 4O2PA 5IUHA 4O83A 5JGAA 4GIHA 4DITA 4KS8A 3ZLXA 4PWNA 3NRMA 2P2IA 1U54B 2BZKB 3H4JA 1GY3A 3QA0A 4DFLA 5B2MA 3OT8A 5DN3A 3BIZA 4BCMA 5AAEA 2XKFA 2QO2A 3E92A 4NEUA 2UW8A 3PUPA 5HICA 3BHTA 1R0PA 4X3FC 3PSBA 4W4XA 5KNJA 2PVFA 5I5ZA 5AAGA 4UMUA 4P4CA 5GJGA 4IM2A 4F0GA 4FL2A 3FMJA 4J71A 3SVVA 4Y85A 1WBWA 3QLGA 2Z60A 2YITA 3UO6A 4DGNA 3QC4A 3OOGA 3NCZA 3Q9XA 4RFMA 3QL8A 5KMJA 3O2MA 4BN1A 1XWSA 3A4PA 3DKGA 5HBHA 1ZY5A 4RBLA 4QMLA 4B8LA
chains in the Genus database with same CATH superfamily
4HYSA 5I9WA 1WVYA 2G01A 3G33A 3KRXA 2E9VA 4K77A 2FSLX 5DBXA 2YM4A 3Q4CA 1XHAA 4FSZA 4IB3A 3CJFA 3VS6A 3QHWA 3FLYA 2QCSA 1UU7A 4ACDA 4RIOA 4D5KA 4IM0A 3ZZEA 1CM8A 2WU6A 4ZZNA 2KULA 4DEAA 5IU2A 5ANEA 3SQQA 4OTQA 1OITA 2QOQA 2WTWA 5I9YA 1FPUA 4I92A 3LFFA 4UMRA 1SNUA 2XANA 4H1JA 2W9ZB 2HY0A 4MHAA 3U6HA 3CY3A 3IONA 4FKQA 5CSWA 3FMMA 5HI2A 1WBTA 4CG8A 3UPXA 4RC2A 4BIEA 3UTOA 2CCIA 2V55A 2PMLX 3QRUA 4IAIA 4L00A 4FV6A 4OGRA 4C36A 2ETRA 3BCEA 2VTQA 5IA0A 5F94A 3HV4A 1YQJA 3CKXA 4FI1A 4OTIA 3W2PA 3PFQA 4KD1A 4DBXA 4X3FA 5J5TA 1UNLA 1YI4A 5KZIA 2V5QA 4IE9A 4PL5A 5AUXA 2BHEA 3VQHA 3PFYA 4A9UA 3CCNA 4CKIA 3G0FA 3P7BA 4OT6A 3R6XA 2B55A 4LRKA 5JFSA 5EM8A 5M53A 3MWUA 4NFMA 4BCJA 4GK3A 4EYJA 3S00A 2VO6A 4B0GA 4O82A 5BYYA 3HV3A 2XIXA 4C59A 3RAWA 4I6HA 3KVXA 5A4CA 3AMBA 3UG1A 4DGGA 3PG1A 2B7AA 5FTOA 4EL9A 3R0TA 1A48A 2BAQA 3ZM9A 1PXJA 4I0TA 4DFXE 1F3MC 3P5JC 4RA5A 2AYPA 4P7EA 3UQFA 3EL8A 4KWPA 2PMOX 3FXWA 3TXOA 4C2VA 4ZS0A 3ZZWA 3KQ7A 1P2AA 3OUKA 4NJDA 5CSHA 3RK9A 3Q6WA 3DB6A 3ZO1A 1XR1A 2J0KA 1FVTA 4AQCA 5L2IA 5J79A 1H08A 4NZWB 3P23A 2GS7A 1PXLA 3RGFA 3POZA 3WZDA 2JKOA 4GT4A 4U79A 4E4NA 3F9NA 4O0RA 3OCTA 1XBCA 2OFVA 4A7CA 5L8LA 2R2PA 4IVCA 1REKA 4AU8A 2HK5A 3EN4A 3NWWA 4OTFA 1E1XA 3I7CA 2PZIA 4GYGA 2X4FA 5AP4A 3UOJA 1SZMA 3SW7A 5E91A 3VUMA 3H9RA 1PKGA 1PXOA 5DPVA 4BKYA 3DK7A 2WTKC 1GZOA 1RE8A 1YI3A 4FTIA 4PDPA 4CFVA 3FKOA 3BYMA 5TT7A 3LM0A 3QXOA 5CSPA 3QUDA 4TNDA 3M1SA 2YEXA 4CFFA 3NW6A 2XP2A 3CJGA 1OIQA 5C26A 4I1ZA 4IC7A 1M7NA 4FKUA 5K5NA 5IQBA 1BKXA 5BVFA 5EDQA 1Q8WA 3ZLWA 4F9CA 5AUWA 3FPMA 1UA2A 2C5OA 4WNMA 4FEVA 3S4QA 5BVDA 3U51A 1LPUA 4IC8A 4X3FB 4F9AA 2P33A 4AE6A 4QYFA 4OW8A 1Q3DA 4AA5A 1KOBA 1LEWA 2VN9A 2GNIA 1ZRZA 3TNWA 5DOSA 3QALE 1O6KA 1BYGA 4A4LA 3EQPA 4B8MA 4K1BA 4DHFA 3EIDA 4GW8A 4XBRA 4FIFA 3R01A 2RG6A 3G9LX 1PJKA 4WKQA 3DOGA 4YJOA 2V0DA 3T3UA 3KF4A 5JT2A 5HNBA 3UO5A 3JR1A 3HVCA 3D5UA 4M0ZA 4AZVA 4EK6A 1OGYA 5DT0A 4GT3A 5IH6A 5LXMA 2HXLA 2XNGA 2OIBA 4C57A 2GHGA 5E8YA 4L3LA 4O0UA 4Z7HA 4P5QA 1OL7A 5B2KA 3QFVA 4BKJA 5BUEA 3EN7A 3O8PA 4ZJIA 2BAJA 3NUYA 3ZDIA 4H3BA 2FUMA 3L9LA 3MB7A 4L68A 3W0OA 2XCHA 4KABA 2RIOA 2OZOA 3AKJA 2B53A 4GSBA 3O0GA 4CT1A 4PDYA 4S31A 4DT9A 3AC3A 3DAEA 5E9EA 3RNYA 1R1WA 3MIAA 5LMAA 2W1ZA 3NDMA 2W7XA 4IACA 4UB7A 4HOKA 5ANDA 3RKBA 2VO0A 3FBVA 3PPZA 4I5MA 3RBWA 3VW6A 4DG3E 4QD6A 1YWRA 2W99B 3OT3A 5AR8A 4EOIA 3MJ2A 5JH6A 5K0XA 4LQMA 4BDJA 4UY9A 4YZNA 3FY0A 2XALA 2PVKA 3GCUA 1TFFA 3ORIA 4RT7A 2GHMA 2PY3A 4LOOA 4EOKA 3BV2A 3UNKA 2CKPA 4IWOA 4PMMA 4KINA 4X2GA 4R7HA 2UUEA 2UZBA 2YIQA 2YIYA 3DAJA 2Y6OA 3VS3A 3F88A 3K3IA 1XQZA 3WF8A 4BBEA 4L45A 4CZTA 2VTJA 2IWIA 1H8FA 3AT4A 4RQKA 5EOLA 3ZU7A 4F7SA 5E8VA 1UNHA 3QGWA 3KB7A 4EUTA 1M2PA 4MX9A 5K4JA 2BRGA 3CSVA 1QCFA 4CV9A 4ANOA 4ANBA 2YHVA 5L6OA 3FLZA 4BGGA 4AFEA 2XK8A 1PXMA 4IDVA 4MAOA 4BDFA 3I1AA 3ORMA 4I93A 3GBZA 2W05A 2YM8A 2JDSA 3F2NA 4RVLA 5AR3A 3PP0A 4LL0A 4ZTLA 3FMKA 3WIKA 1W98A 2ZV8A 4F64A 2HZ0A 2EU9A 4QTBA 1Q5KA 4U40A 5L2WA 3LLTA 1H1QA 3MH0A 3SX9A 3OCGA 1CKIA 3QCQA 2XIYA 3W0RA 4IANA 2QOLA 3FXXA 4CD0A 2C6KA 1NVQA 4QP7A 4FZ7A 1BX6A 2RGPA 1ZYLA 4YPDA 3QTXA 3QBNA 3FHIA 3O96A 4TRLA 2W1IA 5C8NA 1OBGA 5J7HA 1Z5MA 3RHXA 2UV2A 3RPOA 2YACA 4QTDA 4FTRA 4RVMA 4F7LA 4CFMA 4UZDA 1NXKA 3Q4UA 4FV4A 2OIDA 4CNHA 4ACCA 2J7TA 2ZAZA 4DEEA 3KY2A 1PXNA 3ZFYA 3C4EA 1KE9A 4DEGA 4MXAA 2ZV7A 1DS5A 2IZUA 3ZEWA 1JOWB 1OL6A 3D7ZA 4BIDA 2DYLA 4MXZA 5DA3A 2RFDA 5E8TA 3AMYA 4E4MA 4G34A 2I1MA 3NYVA 4N0SA 4JJRA 1SVHA 3BZ3A 4O4DA 3DBCA 2XEZA 2I0YA 4TXCA 2F49A 3QUPA 3H0YA 5AV0A 5HESA 1MQ4A 2O0UA 2PPQA 3WZUA 1Q62A 5ETCA 3E8DA 4W8DA 3FL5A 2YZAA 3JUHA 3LQ5A 4FTOA 2QC6A 4GUBA 3VS1A 2FGIA 2X8DA 4UX9A 3O5AA 4BR3A 4C62A 4U43A 3ZXZA 4ZAUA 3IS5A 5BYLA 3O7LB 5CAOA 4ACHA 5JQ5A 1OL5A 2C1BA 2WO6A 4KSPA 3DNEA 3PE1A 4MTAA 4IX4A 5JGBA 2JIVA 2OH4A 4D0XA 3RPYA 3KU2A 4CKJA 4AGDA 4GYIA 2BCJA 4DLJA 3CXWA 5HE3A 3ITZA 1WZYA 2IJMA 2P3GX 4FV9A 4MKCA 4E3CA 3QU0A 4D5HA 3KXHA 5HGIA 5JMSA 3PWDA 4IH8A 3DLSA 2XZSA 4QP3A 2R3RA 2VTIA 4QTEA 5CEKA 3QYWA 1V1KA 2QKRA 5AFVA 2BDFA 2GFCA 1SVEA 4G31A 2AC3A 5K4IA 3AD6A 4LYNA 4YC6A 3LJ1A 1OKYA 2B1PA 2QKWB 2W1CA 2WFYA 2A27A 4AP7A 4RIWA 4NT4A 3W8LA 4QQCA 4A07A 4EK3A 5L8KA 3UMWA 4FNZA 3LIJA 4QDEA 2VU3A 3GC8A 2XYNA 4R5YA 3V6SA 3MSSA 3U4WA 4JDJA 4PDSA 4BZDA 4ZY5A 4L52A 5CAVA 2X81A 3UIUA 5KBRA 4Q5EA 4YJTA 3CR0A 3MPAA 4X2FA 4R78A 3OXTA 3LFBA 4G6NA 4MEDA 5CWZA 3ZC5A 1ZYCA 4HGTA 2YLEA 3NNWA 5HVYA 5M4IA 3TZ9A 4KKGA 1J1CA 2J0IA 4YLKA 4C3RA 2CLQA 4JT3A 2IZRA 2YCFA 3Q2MA 2C4GA 4O7ZA 5ETIA 3WF6A 3EFJA 3GVUA 1VR2A 3I6UA 4F99A 4FTTA 4ALVA 1H26A 3NZ0A 5CSVA 5M56A 4I5PA 3ZLYA 3PXYA 2JDOA 4U6RA 5EW3A 3W0NA 3MPTA 4EKLA 1HOWA 2PZ5A 2QOCA 3R71A 2PHKA 2VO7A 4TYIA 2DWBA 4TYJA 4BI1A 4X6QC 3V51A 5IH4A 3EKNA 1XH5A 2PK9A 3IW5A 4ZTMA 5M4FA 3JVRA 3DXQA 2QU5A 4S30A 4FTLA 4DC2A 2FVDA 5FEQA 4QYYA 4KB8A 3D4QA 4GVJA 4ZZOA 3EQRA 4R6VA 5HE1A 2F4JA 2WTCA 2QOIA 4NM0A 3U87A 3PLSA 4YJNA 2R3MA 2W4KA 4AE9A 3GQIA 3C50A 3NPCA 5GNKA 4EOOA 2QI8A 5J7BA 3UPZA 2I0VA 5CSXA 3RTPA 2R5TA 3W1FA 3A7FA 4FTCA 3COKA 5EM6A 3ZM4A 3W2RA 3LAUA 3QRTA 3Q4ZA 3GU7A 3E7VA 5H3QA 3W32A 4E6AA 4NL0A 4E5BA 2OXXA 3TEIA 5I9XA 1K3AA 5HHWA 3VJOA 3CQEA 4FIHA 3LCTA 4FVPA 3R9RA 4PF4A 1GZ8A 4RIWB 2PZRA 4YC3A 3RP9A 3UNJA 3TMOA 3MY5A 1BI8A 1YRPA 1Q41A 2XK4A 4IAAA 1JKSA 4KIOA 4YJPA 1V0PA 4USDA 3C4CA 4EHVA 4RRVA 2BPMA 3FXZA 3PXQA 1Q61A 4GJ2A 3R83A 5KMMA 4EWHA 4XJ0A 2C68A 4BZOA 2X9FA 5BV3A 4EEVA 1NA7A 2BR1A 3TJDA 4TWCA 3G90X 4WNKA 3R00A 4MYGA 1W84A 5HVJA 3B8RA 5LWNA 4CXAA 2Y6MA 1YKRA 4HPTE 3PUFC 2ZVAA 3MB6A 3U6IA 1Q8ZA 2OJ9A 2NRUA 4R5SA 5C27A 4MD7E 3FY2A 2I6LA 2OGVA 3C4WA 5JRSA 4BCGA 4G6OA 3GCPA 5L4QA 3R21A 5IUGA 1UKHA 3AOXA 3MVMA 3QTQA 4NUSA 2QD9A 2OJGA 3MYGA 5A4QA 4QO9A 2F57A 5KBQA 1J1BA 4FSYA 5T3QA 2YIRA 4MNFA 1JSTA 5D7AA 2BRMA 5L6PA 4HVGA 1QMZA 4PPAA 4LMNA 1H00A 5IA2A 4R7BA 4F70A 4OTPA 1YWVA 4BCKA 4UALA 4O7SA 2HELA 4JMQA 2UZEA 4TW9A 3FC2A 3LJ0A 4AACA 4A9YA 2BKKA 2J0LA 2WQNA 3DBDA 4C4IA 4YNEA 4FTQA 4KS7A 3FMNA 2WHBA 3H0ZA 3AD4A 4M67A 3VBXA 4IADA 3SDJA 5EW9A 4XV9A 1OIYA 2CNQA 3R9NA 3R9OA 1ZZ2A 2G15A 2JDVA 2Y7JA 4AN9A 2QHMA 2QNJA 4X6RA 5FM3A 5HD7A 1BL6A 3ZHPC 4BI0A 3IKAA 4BJJA 4F78A 3Q04A 3P1AA 4TT7A 2YZLA 4NCTA 4O84A 4J8NA 3T9TA 3LXLA 4FOBA 3QX4A 4CZYB 4MF1A 2WTIA 3NW5A 1YVJA 4JBVA 4M13A 3VS7A 4BCPA 3HZTA 4RVTA 4ACMA 3EMGA 4RJ3A 3JPVA 3MH3A 5HCZA 5JZJA 4JDKA 5DHJA 2OO8X 2C0OA 4M69A 2EWAA 5D10A 4E20A 2F7ZE 3BQRA 3UIMA 2XM9A 3GENA 4C38A 4NIFA 4XX9A 4EHZA 5HNIX 3NIZA 3UDTA 4XG8A 3B8QA 3E93A 2XK9A 1AD5A 3KK9A 2WD1A 3R02A 3R63A 4JRVA 3L9MA 5EM7A 1XH4A 4A06A 2X8EA 2WMWA 4IVDA 3VQUA 2UZWE 4E4XA 3U6JA 3DGKA 5M07A 3KMWA 4KRDA 2ITZA 2ZDUA 4LV5A 3EQFA 3OXIA 2IW9A 4G9RA 2QR8A 3QLFA 4JNWA 4PTCA 3AC5A 4X3JA 3KK8A 4YSMA 4CKRA 4EJ7A 5HG9A 4FICA 4RQVA 4MBLA 3DY7A 3NW7A 2A0CX 4XG4A 5L2SA 4QTAA 2WQMA 3QTRA 3SW4A 2HW6A 4FE2A 2IG7A 2FO0A 3AXWA 2B9FA 3JYAA 4FKOA 3FYJX 4BY9E 3MDYA 1YXSA 2JD5A 4OT5A 4GVAA 1FVRA 2F7EE 3RM6A 3DTCA 3FZTA 4O6LA 3A8XA 4ZZMA 3EQBA 3OCBA 2AQXA 2ZYBA 3PJ3A 1PXKA 3R7UA 4DLIA 4EHEA 4AG8A 2WMUA 3KL8A 3SRVA 4EOSA 4AOJA 2UZNA 4JR3A 4UMPA 4IJPA 2J2IB 2ZV2A 1GJOA 4HGEA 5EHLA 5FD2A 2VTOA 2VWIA 3C7QA 2XB7A 3FMDA 1X8BA 3ODYX 4ITHA 3TDVA 3PY1A 5HBEA 2J9MA 2C47A 3F7WA 5HVKA 1GNGA 5CU2A 4ZTNA 4O27B 4OTWA 3KRLA 4RG0A 4FT7A 4ACGA 4D2RA 2WMRA 5DFPA 3GU8A 4NW5A 3LFDA 3R22A 2I0EA 2PL0A 3QTSA 3PY0A 3PRIA 5HCYA 2WIHA 1Q99A 3BRBA 5M4UA 5CALA 1OBDA 4BJJB 4GKHA 5FDXA 4C33A 2J51A 2YM7A 3BL9A 2E2BA 2JFLA 3JY0A 3NUPA 4X2JA 1CMKE 3IDPA 3UODA 2BDJA 3RCDA 1IEPA 2C6LA 2WQEA 4I6FA 4RZVA 2PZYA 3IECA 2WNTA 1W2CA 4ASEA 2W96B 3A7IA 1OL2A 3KIOC 5CEOA 5AP1A 4U3ZA 3Q5ZA 2GQGA 5FTQA 3QTIA 5CYIA 3BYVA 5CXZA 2B52A 4RLLA 3DDPA 5HOAA 4N70A 2R64A 4QMPA 2O2UA 4FR4A 5EHYA 5EQEA 4I6BA 2PULA 2HZIA 2C69A 5IMXA 3NYOA 4QPMA 4FKSA 1Y57A 1GIJA 3GCVA 4IWPA 4Z55A 3UC4A 5GHVA 1CKPA 3QXPA 3LHJA 3OD6X 3K2LA 4AXFA 3AGLA 4XV2A 1M14A 1VLRA 3Q4TA 3HP2A 2CCHA 3DK3A 4FSQA 4GT5A 4K6ZA 4LM5A 1XBBA 5AR5A 4DFNA 3ANRA 4JX3A 5A46A 3U55A 1YOMA 3P9JA 4FEQA 4QNAA 1R78A 3E8NA 3PWYA 5KHXA 5KMKA 4CGAA 3EJ1A 3BEAA 4U42A 2RFNA 4TKSA 4D58A 4E5AX 2CSNA 4IWDA 4JBPA 4ANNA 4L42A 3BGZA 1OIRA 3SRVB 4APCA 5ITAA 3ATSA 4GFGA 2REIA 3TIZA 3HV6A 3MIYA 3ENHA 4RX8A 5EH0A 4FTJA 5FP5A 5GJDA 3TACA 1IAJA 2HAKA 4IZAA 2ITWA 3LXNA 4EOPA 2OJFE 1YHWA 2QO9A 2RG5A 3VIDA 3SHEA 3RAHA 4F1TA 4CFXA 5C8KA 3QD3A 3EQCA 5CTPA 2ITUA 2QOHA 4O91A 3OMVA 2R3PA 4U5JA 4YP8A 4HVDA 1JPAA 3I0QA 4G17A 2XBAA 2R0IA 4AQKA 3UP7A 3NUAA 3BYUA 3FLNC 2UW9A 4MUQA 3P08A 2W06A 3L9PA 4LRMA 4YMJA 4UYAA 3W55A 5ACKA 4ZEGA 2GTMA 1XMMA 1DAWA 5E92A 2PSQA 1KE7A 1XBAA 1S9JA 1OZ1A 5IH5A 5B0XA 5HO7A 4R3PA 4Q9SA 2C5XA 3OFMA 5JFVA 4UMTA 4WNOA 2H6DA 1OKVA 3CTJA 5JN2A 4KKHA 3F3ZA 4EOQA 4G1WA 5GZ8A 3ZRMA 3KC3A 4L43A 4BKZA 3VF9A 3D2KA 3MTLA 3ZOSA 2C5VA 4C3PA 3Q5IA 3WILA 2IVUA 2R7IA 2W1GA 4OLIA 4FSMA 4BICA 2OK1A 3Q52A 3RWQA 1JQHA 2PMIA 2A98A 3MA3A 4V04A 4BCOA 3FQSA 3ZXTA 1G5SA 4P5ZA 5AUZA 2NP8A 3VRZA 4DEDA 3IG7A 3WF5A 2B9JA 4BFMA 5JEBA 4AT4A 2BZIB 4C8BA 2C6EA 4N4SA 5DEYA 3V8WA 4CLIA 2YDKA 4RIYB 4UXLA 4DEIA 1OPJA 1KE5A 3SV0A 4UWBA 4TY1A 4KRCA 5FXRA 4QYEA 3DV3A 1YXUA 3EFLA 5AP0A 5EYKA 5F95A 3LLAA 5IA1A 3R9HA 3KEXA 4UEUA 3EB0A 4RA4A 4IX5A 5HLNA 4BHNA 2UW5A 2X6EA 4NM7A 3ROCA 4FIEA 2IN6A 4RVKA 5HBJA 3ZBXA 2C0IA 4PP7A 5A4EA 3ZSIA 2C6OA 2IZSA 5EFQA 4ERWA 2JLDA 3LKMA 1XH7A 4PL3A 3MFSA 3IW8A 4YO4A 5LCJA 2IPXA 3LPBA 3PXFA 3KKVA 4JDHA 5FXSA 2IW6A 1PRYA 3GU4A 4IM3A 4AZFA 2Q83A 3OP5A 5AP6A 3DFCB 2Q0BA 1RW8A 2YABA 2GFSA 3PJ1A 4QP8A 3MY1A 5E4HA 3DU8A 2R4BA 4FTKA 4N6ZA 3LZBA 4IJ9A 3RCJA 5KMIA 2O8YA 1APME 2BTRA 3GB2A 4J52A 5ANOA 2XH5A 3V8TA 3HEGA 1QPCA 2JDRA 2YN8A 1H24A 3GGFA 4WRSA 2WGJA 2VNWA 3ETAA 4GUEA 1URCA 3SD0A 4ANQA 3KN5A 2C6IA 2B4SB 4ZSGA 4AW5A 4EZ3A 2G2FA 3IDCA 3GI3A 3OXZA 2C6TA 5D7VA 4CEGA 1ND4A 3OWKA 1YOJA 4EQUA 3E3BX 2I7QA 5L3AA 2VWUA 4JAJA 5F1ZA 4ZJJA 3TNQB 4PMTA 3LFSA 2BTSA 4QTCA 4QMMA 4C58A 3V6RA 1G8AA 3U8WA 3QYZA 3R2YA 1H01A 2BRNA 4MBJA 4USEA 3D94A 4MH7A 3MH1A 1XO2B 3UBDA 3LFEA 4RJ8A 4Y5QA 4K18A 5CEMA 4O6EA 4C2WA 4XCUA 3DKOA 5EDPA 1FMKA 1P4OA 3JY9A 3FSKA 3DJ5A 4EYMA 3GUBA 2DS1A 4DF3A 5IF1A 2VTTA 3FLQA 2VWXA 3TTJA 5BUJA 3NYXA 4G9CA 4JQEA 1JAMA 3MN3A 3HX4A 5FEEA 4O4BB 4I6QA 2XNPA 4NM5A 4ANMA 4ZTRA 1BUHA 2BFYA 2CGXA 3QGYA 4ZTHA 3TG1A 3FAAA 5CF6A 2QG7A 5I9ZA 1MRYA 4XG2A 1ZMVA 5CVFA 2J50A 2FSMX 4AOIA 3B2WA 4FIJA 3D9VA 3F3VA 5HTBA 3TV6A 2NO3A 4CV8A 4YJRA 3QKMA 3Q9YA 5CX9A 3HMOA 1PXIA 4FKRA 3A7JA 4P2KA 2WMTA 2XS0A 3F5UA 3BYOA 2VX0A 2GQSA 3F61A 5CS6A 3SGCA 1Y8YA 2PVMA 2HENA 3NFFB 1OI9A 3ET7A 5I9VA 3NS9A 1E1VA 3F6XA 4O38A 3I5ZA 1FQ1B 4WBBB 4BDCA 4UZHA 4RWJA 4U0IA 5IKWA 2EUFB 4MNEA 3L8VA 1ZY4A 2PVLA 1CSNA 1P4FA 5HO6A 3F3TA 3T8OA 1H0VA 4IEBA 4Q5HA 3OUNB 5I3OA 5HU3A 3ALOA 3R1YA 3BELA 5CQUA 2EXEA 5BNJA 2A4LA 5BQ0A 4MBIA 5DI1A 4ONAA 5K0KA 3VUGA 4TTHB 4G5PA 2Z2WA 5HG7A 3LMHA 3NVKI 4EH6A 4ZSAA 3TUCA 4BDDA 1S9IA 5IQIA 4FKLA 2WZJA 3THBA 1YDSE 2XJ2A 2ZM1A 4BB4A 4RWIA 4GMYA 4JR7A 2FYSA 4F0IA 1WBNA 3ML1A 2YFXA 3BX5A 3KMUA 3BGQA 3P7CA 1ZYJA 3F7ZA 3P79A 3NCGA 4Q9ZA 2GNGA 3DQXA 3NVMB 5EYDA 4CMTA 2RFSA 4C61A 4AGCA 5E8UA 4J53A 3QA8A 1YOLA 2IZTA 5D41A 1R3CA 4OAVB 2VWYA 3GU6A 3P7AA 1GZKA 2QLQA 2XMYA 3RPVA 3CGOA 1KE6A 4FC0A 1KUTA 3DXNA 5A54A 3MGYA 2BIYA 2WOUA 2G1TA 4HCUA 2W4OA 2FA2A 4E1ZA 2JIIA 3PJ2A 4LV8A 1OL1A 1GIIA 4E73A 3R1QA 5HO8A 4GCJA 2A19B 3QTUA 3N9XA 4J7BA 4S2ZA 4PRJA 4ARKA 4GL9A 3R7OA 3EOCA 3VBWA 3WI6A 1MUOA 2CGUA 2CLXA 4BI2A 3TYKA 2BIKB 4YZDA 3TKHA 2UVZA 3H3CA 2R3FA 4TWPA 4XH6A 3KGAA 5EW8A 4DINA 2R3LA 1LEZA 1W82A 2YLFA 5DE2A 4DAWA 2RSVA 4O7WA 2XKDA 4IX3A 2ESMA 2WB8A 3F66A 3TZ7A 4AA4A 3CPCA 4LOQA 3R8VA 4KUJA 5IQHA 2XCKA 1WFCA 1CDKA 2HCKA 3QRKA 4WG4A 4FTMA 1TQPA 5I0BA 4G3DA 5IQDA 4F9YA 5J9LA 4FTUA 2WEIA 4CMOA 2P55A 4IZYA 5AIRA 1KV1A 1WBSA 4RGJA 4AGWA 4KIQA 4KBCA 3HA6A 4RWKA 1IRKA 2VX3A 4YTHA 3NAYA 2BAKA 2BZJA 2ETMA 2AC5A 3W2QA 3G0EA 4J97A 5HNGA 3ZO4A 2Y4IC 2Z8CA 4DFYA 4BTFA 4EI4A 4XS2A 3BI6A 4BWKA 5KMNA 3QRIA 1U5RA 4XMOA 4LGGA 2ITVA 3PA4A 2PYWA 4G2FA 3ZRKA 3DKCA 3OWPA 5CZHA 5BVOA 2JAMA 3W2CA 4UN0C 4O7VA 5M09A 3KXMA 4CG9A 1IASA 3PVWA 3QQHA 3D5XA 2VGPA 5CNOA 1JWHA 2IVVA 4XP3A 5C01A 3AT3A 4TPTA 4IBMA 4ITIA 2QG5A 3FEGA 2BALA 3Q32A 4OUCA 2WEVA 3UOLA 4JXFA 3ZLSA 3WE4A 4AW0A 4MWHA 3EN9A 5FLFA 2BKZA 5FUTA 3Q53A 3VHKA 2PUUA 2WIPA 2UW3A 4Z9LA 5AUTA 5IMEA 2ONLA 3UIBA 3N4TA 1M7QA 3ROYA 3VRYA 4M15A 4J8MA 5H8EA 3JXWA 5J95A 4AT3A 4ASDA 3UZTA 2BROA 4C0TA 3NYNA 1R0EA 4YBJA 1B6CB 4PQNA 1H1WA 4F6SA 2C3KA 3TUBA 3COIA 2WMVA 5HIDA 1Q4LA 2NPQA 2XYUA 4EJNA 3HV7A 3C9WA 4RIXA 2VTLA 4EKKA 3RMFA 3TV7A 3NUUA 4PMSA 3LW0A 3UIXA 1UKIA 1STCE 4BYIA 3EN6A 5TO8A 4FT5A 3EYHA 4L3PA 5HEZA 4ZLOA 4F7JA 3BLAA 1O6LA 4CFNA 3LOKA 5AEPA 3DT1A 4JDIA 3CE3A 4G16A 1TZDA 4ZSEA 5IG1A 3LXPA 4IFCA 1MQBA 4FF8A 2C3LA 4O86A 4BRXA 4RPVA 5D11A 3MBLA 2SRCA 2ETKA 4XRJA 3KCFA 1OIUA 2PMNX 3F5XA 5AR2A 1QL6A 3Q2JA 4C34A 2VWZA 2UZUE 3HMNA 4U45A 4ZS4A 2H8HA 5ETFA 2ZDTA 3EWHA 1PF8A 4KSQA 4RFYA 3TT0A 4H3QA 3FQEA 4ALUA 3VS2A 2CPKE 4EQCA 2X7GA 3MH2A 1XMLA 5AA8A 3TNIA 4A9RA 3HRCA 3CQUA 5M55A 2X2LA 3DB8A 3V5WA 3IGGA 3BEGA 5C8MA 3EFWA 4NKSA 1OUYA 1H1RA 1UU9A 4AAYA 3GOPA 1Q8UA 4UWYA 4F09A 3A2CA 5KHWA 4DH8A 1W8CA 3OC1A 3DQWA 3EH9A 4F6UA 3TTIA 1KOAA 3IW4A 1DAYA 4JLCA 2C6MA 4QMQA 2O65A 5DT4A 4GRBA 4I20A 4GFMA 5I3RA 4B4LA 4IMYA 3ORLA 2ZV9A 1IG1A 4MXCA 5J8IA 2JDTA 1RQQA 1Q24A 3EL7A 3MY0A 3ORNA 5L2QA 3O8TA 4Z3VA 3G51A 1ZMWA 3E8CA 3ZFXA 3CP9A 4BDHA 2HZNA 3TUDA 1OKWA 4WUAA 3VUIA 4XUFA 3O71A 2IEWA 4QMUA 3GCSA 2H34A 5AV2A 2XUUA 4R1VA 4JQ8A 3E87A 4E93A 3OVVA 3TZMA 2JAVA 3D2IA 4JAIA 3LCOA 3FI2A 3HMPA 3RJCA 4IAFA 3FHRA 5DGZA 4AZTA 3HA8A 3AKKA 1OM1A 2UZOA 4ZLZA 4RIXB 2CN8A 2ZOQA 1WBVA 4HNIA 4LOPA 5BMMA 5AAFA 5J1WA 4NW6A 3ZYAA 4MXOA 1Q97A 2Y4IB 3BE9A 3SC1A 4BCHA 2GQRA 2XK6A 4TYEA 2JITA 5A9UA