2V5QA

Crystal structure of wild-type plk-1 kinase domain in complex with a selective darpin
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
285
structure length
285
Chain Sequence
EIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of wild-type Plk-1 kinase domain in complex with a selective DARPin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE PLK1
total genus 83
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2007-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2v5qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2v5qA01
3E8DA 1OITA 4BDEA 2BRNA 1JKKA 4R5SA 4FTKA 5HCXA 2IO6A 3V3VA 4EZ5A 2WQMA 3E64A 5ETAA 1WAKA 4DFXE 3DCVA 3C0HA 3UYSA 1FMKA 2Q0BA 2YM4A 3NVKI 4BTJA 3RPVA 4KS8A 5FTOA 5L6WL 4HYIA 3R7IA 5M4CA 1PKDA 4ITIA 2DYLA 4YHJA 4O81A 3V51A 3HMOA 4FC0A 5IMEA 1OIYA 4NTTA 2C47A 4A9YA 3NX8A 1YWNA 4I94A 3EKNA 2R3QA 3R7OA 3VUHA 2X7FA 4QNAA 2RSVA 2PHKA 4QP8A 2JDOA 3KFAA 5DPVA 2OI4X 1RQQA 3EQFA 3OT8A 4OBOA 4ACCA 4IWPA 4Y73A 3TACA 4I0SA 4CZTA 1Z9XA 3VHKA 3ZLSA 5KBQA 4BDKA 4A9SA 4I20A 1OL1A 4NIFA 3EOCA 4FV4A 4BDGA 4H39A 4F0IA 5A6NA 3A7JA 4RX5A 2P33A 4JRNA 4AN3A 3ROCA 2QNJA 3L8VA 2XM8A 2P55A 5CU4A 4EK5A 4EUUA 5HZNA 5J5TA 4P5ZA 2W0JA 2HIWA 4EOIA 3CEKA 3SW7A 2W1GA 3CTHA 2VTOA 3RPOA 4WG4A 5M56A 3MH0A 3R8LA 4BHNA 2YITA 4AA0A 5FTGA 4NKSA 5F9EA 2HZIA 2WMBA 4IVBA 3CC6A 5E4HA 2YIXA 4OTDA 4KIOA 3A60A 4TWNA 3PA4A 5AV2A 2WQEA 2X39A 5K5XA 2JFLA 5HVKA 4RWLA 4CQGA 4DITA 3VUMA 4MVFA 4Z7HA 2XP2A 4HZRA 1KE5A 3VWAA 2QO9A 3RHXA 3G15A 2W96B 4YZDA 2BZHB 2A27A 2PMNX 2QLQA 3F3ZA 3FKLA 3GCUA 2YM8A 4LL0A 3D7TA 4RWKA 4XG8A 1XQZA 2HY0A 3V5TA 5IUIA 1FPUA 4L68A 2ZM4A 5E1SA 5IH6A 4II5A 4QP7A 4EH3A 4IXPA 2VUWA 3OOGA 4O0UA 4OTWA 5AR5A 1CKJA 3DJ5A 5M4IA 4FTRA 3RCDA 1BUHA 3VRZA 3R8VA 3Q4TA 4GK3A 3VUGA 5FEQA 1IG1A 5A14A 1RJBA 2H8HA 2REIA 2UZEA 3QX2A 4I6QA 5ANOA 3QGYA 4RZWA 2X4ZA 3REPA 2VNYA 3Q52A 5CZHA 3UBDA 5LMKC 1Q97A 2J6MA 4R7HA 3ULZA 4CFMA 4LYNA 3ULIA 1GZ8A 3THBA 4EH7A 2EVAA 3BZ3A 2BFXA 3D7TB 3PJ8A 3QUEA 2C69A 3BRBA 2GHLA 4J96A 2XCKA 4Y5HA 4PL5A 3TNHA 4H36A 4FTJA 1W0XC 5F95A 2W17A 1KE6A 2W99B 4V01A 2VWVA 2BPMA 3LQ3A 4RIYB 4GV1A 4C58A 2VU3A 2YIWA 4CRLA 3VS4A 4ANMA 2HW6A 3F9NA 4BCPA 4YHTA 5HIBA 5CAPA 2BILB 4S2ZA 2Y6MA 3IW5A 3KXZA 4C33A 5DR2A 1ZYDA 3GU8A 2QI8A 3LCTA 4FSRA 3RK7A 5DWRA 3ZONA 1Q99A 4BGQA 4FTOA 4MBLA 4IBMA 2NNWB 3CKXA 4H3QA 2W4JA 4OBQA 3NUYA 3PP1A 3UO4A 1WBTA 2UW3A 4RLKA 1KE7A 2R5TA 4HJOA 5HTCA 3QXOA 4OTQA 5AAFA 2O5KA 3A7GA 3A8XA 3HNGA 3LFAA 3G0FA 4MWHA 4KUJA 4QMOA 5I9VA 3QAME 4G5PA 4W9XA 4CVAA 4NL0A 2BROA 2W1HA 1IR3A 4RFYA 4GJ3A 4UWBA 4M67A 3GP0A 4OAVB 2YIRA 3E3PA 3NUUA 5EHLA 4PTEA 1Q8ZA 2UZBA 3NVMB 4YZ9A 1UNGA 1WCCA 3FMKA 1YRPA 3IW4A 4WUAA 2QU6A 2GS2A 3TEIA 5B2LA 1V1KA 1OB3A 3W16A 3RJCA 4AZFA 3GXLA 2HY81 3QTZA 4FEUA 4CZYB 2VN9A 2YA9A 4EHGA 4YC8A 4U9AA 4CKJA 5C1QB 5BUJA 3QHWA 3L9LA 3UQCA 3B2WA 4PMTA 3QA8A 2ITXA 2XJ0A 4XV3A 4E8AA 5KMNA 2Z8CA 3GU5A 3H4JA 5C9CA 1XO2B 3KRRA 4YJSA 4QQTA 3PG3A 2PVLA 4XMOA 3ZUTA 3HDMA 4FSYA 1WBSA 3IDBA 5KNJA 1ZXEA 4G3EA 4NM3A 3TTIA 4D4VA 2GHMA 4XCUA 3ZEPA 2JBPA 4F65A 5JSMA 3JPVA 5KMMA 5AIRA 1VYWA 3C50A 4IACA 1W84A 5AAEA 3R7UA 4QPSA 1OPLA 3HDNA 4WSYA 5KCVA 3QC9A 1M17A 2OJ9A 4YJNA 1H1SA 4C4IA 1ZYLA 3O2MA 3ZRLA 1W8CA 2J0LA 3CP9A 4FSMA 5LWMA 3N4UA 3EN6A 2UVYA 4TPTA 1B6CB 4UEUA 4V0GA 1SVGA 3CQUA 3H10A 3ZS5A 1PXOA 5M09A 1MUOA 3RTPA 3LQ5A 5C8KA 4L46A 4WRGA 3PRFA 4CMUA 3HVCA 2PZYA 4J97A 3UG2A 3BE2A 5EYMA 3UPXA 4GUEA 2RL5A 3LE6A 4Y95A 2A1AB 5BYLA 4PL3A 4K1BA 2J0MB 2G2IA 4X2NA 4OW8A 4ZMFA 1Q5KA 4J7BA 4WSQA 3FYJX 3EWHA 2Z7RA 3Q32A 3VJNA 4G6NA 5FBNC 3D2KA 4K11A 2PUUA 3OW4A 4QQ5A 3O51A 5M53A 3R21A 2X9FA 5BUIA 1ZZ2A 2ETKA 2WELA 4F9WA 2IW6A 4MXYA 1A9UA 3R7VA 2PU8A 4IJPA 2ITQA 2R0IA 4WKQA 3QX4A 3MVLA 2GU8A 4WNMA 4TKSA 4XRLA 4C7TA 2QLUA 5DEYA 5KUPA 3FLWA 4TYHB 1V0PA 2UZLA 4PUZA 4EH5A 5IDNA 3OOMA 3KN5A 1UNLA 4ASEA 1Q3DA 4ZY5A 5KO1A 3ZUVA 2J90A 4FV1A 4ASXA 4BRXA 1QPEA 4FEWA 3PFQA 2CCIA 2BZKB 2UW7A 3PDTA 4W4YA 3R02A 1MRUA 4YTFA 5KMIA 3R73A 4H3BA 4ZJVA 3HZTA 3LFSA 2Z7SA 4FL1A 1M7QA 4GW8A 2XEYA 2CPKE 3WZJA 4YU2A 4JQEA 4O1OA 3C9WA 1WBOA 2PSQA 3E8NA 4TYGA 5DRDA 4Z3VA 4S30A 5I9WA 1ZMUA 2HZ0A 4E4NA 1FGKA 3SXFA 2YDJA 3MPTA 3BHHA 5JZNA 5JH6A 2VWIA 4JDKA 4L7SA 4ZK5A 1GIJA 4Y83A 3TZMA 4EH9A 3QTWA 1H00A 5CT7A 4YP8A 3RP9A 4QMUA 4EOJA 5HU9A 4FKQA 1RE8A 3MBLA 3OROA 3ORPA 4JR7A 3RPRA 4QYEA 3ZSIA 5BVDA 4Z9LA 3W2QA 1BX6A 5JK3A 5GZAA 4CYJA 1PMUA 2XIYA 3FPMA 3FLNC 4R77A 2WOUA 4M14A 5CEKA 4M13A 2X0GA 3P08A 2A4LA 1E1VA 3ALNA 4UMRA 3TCPA 3ZC6A 5J9ZA 4QP4A 3I4BA 4G3GA 4MD8E 2LGCA 4JS8A 3TL8A 2CMWA 4UBAA 5JRQA 2ITUA 3GUBA 5AM7A 3ZHPC 4IX6A 3BQCA 4NFMA 3FY0A 3G0EA 4DF3A 1B38A 3POZA 2R3GA 3PZEA 4CNHA 3OC1A 3IG7A 4JRVA 3OCBA 4QMQA 3VUTA 2OZOA 2WU6A 1VZOA 1QPDA 1OUKA 1MP8A 2ESMA 3QRUA 1ZAOA 4KIKA 4F0GA 4IVCA 3BU6A 3H0YA 3NUSA 4S33A 4XNEA 3R9NA 3OBGA 4D2VA 1JVPP 3DK7A 5HNBA 1O6LA 4EH4A 3ZO1A 5HICA 3QQKA 2PE1A 4FKVA 4J95A 5ACBC 5A4LA 4XEYA 4C59A 4I5CA 4F7JA 5AAGA 3TZ9A 1DAYA 4P90A 2WQNA 1ZOEA 4X7QA 3MY0A 5JMSA 1DAWA 2IW8A 5L2SA 3R2YA 5EFQA 4IADA 2H34A 3EQRA 2F9GA 5CVFA 4PPCA 4O22A 4GT4A 1OGUA 2XNOA 3QQGA 2X81A 4EHEA 4Q5EA 1YXUA 2RG5A 4KAOA 4DGOA 3PXQA 3RK5A 2J0IA 4QP6A 1Q8TA 3E62A 2FVDA 4IZ5A 5IDPA 3QTSA 3DNDA 2HZNA 4MBIA 4XOYA 4USDA 4D2TA 3W8QA 1E1XA 4YLKA 1TQPA 3GU4A 3UO5A 4RX8A 3W2SA 3GB2A 4RFZA 3QWJA 3C4FA 3FMNA 3SG9A 1H27A 3LJ1A 5FDPA 3FHIA 4IB3A 4GYGA 4ZSLA 1OUYA 1OL7A 4JVGA 4ZSJA 4NCTA 4YTIA 2WTIA 2RFSA 1T46A 3PIYA 2NP8A 3GFWA 4FKTA 2OJJA 3ODYX 1WBNA 3R1SA 4FV2A 5HESA 3PYYA 2OBJA 4FZAB 4AUAA 3QKMA 3OY1A 3R8ZA 3COMA 2ZB0A 1UVRA 3OBJA 4X0MA 3E63A 5ACKA 4HCTA 3WZEA 5HORA 5JKGA 3NAXA 3VHEA 2QG7A 2WTDA 5EHOA 2VZ6A 3MJ1A 2QOHA 5J9LA 3FSFA 4BL1A 1GIHA 1H26A 3Q96A 4NFNA 2BDJA 4E20A 3UOLA 4EKKA 5IUGA 5M06A 4N4SA 4IAZA 4EEVA 3WOWA 3R1QA 1Y8GA 4O7VA 2C1BA 2YWPA 4QMWA 4AE9A 3A8WA 3FE3A 1UWHA 3HRBA 5CEPA 3PA3A 1BKXA 2VWBA 4HGEA 3TN8A 2VO0A 4FODA 2CLXA 4EI4A 4EZ3A 3KL8A 2PK9A 4AT5A 5C01A 1M2QA 4WD5A 3NUXA 5IISA 2ZV2A 5JQ5A 5JT2A 3L9NA 5EQYA 4R5YA 5I3RA 2WMTA 3E8EA 5H2UA 1SVEA 3EIDA 3QCXA 4RZVA 3DY7A 3OY3A 4RJ3A 5IA2A 3LFNA 2I6LA 2HXQA 3LM0A 1REKA 2G9XA 4WG5A 4XP0A 3EN5A 5HO6A 3PPJA 4WRSA 3Q60A 3PWDA 4B4LA 1DM2A 4DC2A 4XOZA 4ERKA 5ANEA 5AUXA 1JNKA 1S9IA 4O7YA 1GIIA 4OAUC 2IVVA 2FB8A 4RJ5A 2R7IA 3BYUA 2Q83A 2PMLX 2R3HA 2O2UA 5EDQA 2WO6A 3PJ1A 5M4FA 5DIAA 3EFWA 2BDFA 2XNNA 4L43A 4PDSA 4RJ8A 3A99A 3U54A 3TV7A 2I0YA 3HV6A 1ZARA 1YDSE 3NUNA 1H24A 5M57A 4FI1A 4YJPA 3UNKA 3EL8A 4K18A 5IQDA 2VWYA 2OKRA 5AP4A 4LOQA 5BVWA 4BWXA 4C2VA 3NNUA 3KRXA 1OECA 4V04A 3DAKA 3QTRA 4FZ6A 4UN0C 3QUPA 3LQ8A 3BLQA 4B6LA 3D0EA 3VIDA 5DI1A 2W7XA 2R3RA 3CLYA 1GAGA 4IB0A 3EQCA 5HG9A 5CU0A 3UMWA 4ANSA 2OH4A 3DA6A 4YZMA 3PVUA 3NS9A 5G6VA 4R78A 2YJSA 4F1TA 3QZHA 4QP3A 4UZHA 3P9JA 2UZOA 2OFVA 3SD0A 2J51A 5A4TA 2W1ZA 4EK6A 1QL6A 1Y57A 4AW0A 4BCNA 2WNTA 5EI2A 1RDQE 1AD5A 2XCHA 5HIDA 3SAYA 1LEZA 4GEOA 5JGAA 2PY3A 3LFEA 5AUVA 4GSBA 5IA5A 4UV0A 1R0EA 3LOKA 4O0XA 3V5PA 3OMVA 4QYFA 5EI8A 5HHWA 2JFMA 3R1YA 4X2FA 5E8WA 3C0IA 3RKBA 4O7WA 3MVMA 1HOWA 3UMXA 3RZBA 1ZMVA 2V7OA 2XJ2A 5HKMA 1REJA 4MTAA 2VTIA 5KMOA 2UVXA 2OLCA 4FSUA 1NVQA 2J50A 4L42A 4H05A 2C6DA 4FIGA 3FXXA 4NW5A 4W4VA 2OIBA 5AP5A 4PV0A 3LFBA 2B1PA 1UKIA 4U41A 2FSOX 3LHJA 1L3RE 2B52A 5CSVA 4BC6A 3D5XA 3P7AA 4WA9A 5D1JA 4ZS4A 4BI0A 2RFNA 1YOLA 3LAUA 3R6XA 3BHTA 2XIXA 1WZYA 2YCRA 1P14A 3JY9A 4I5HA 2BAQA 4RIOA 3O23A 5GJGA 2H96A 4CQEA 3ACJA 1QCFA 4RQKA 3KC3A 3S00A 2W1CA 2G2FA 3K5VA 4IC7A 1H1PA 5C8NA 5J7BA 1R3CA 4FSWA 4MNFA 1PXIA 3EHAA 4ZY4A 2HAKA 3I6WA 3TUCA 4FG7A 4QMTA 5IEYA 4FV8A 4NW6A 4YGAA 3I0QA 1PXNA 3LCSA 3PIZA 4FYOA 4XHKB 3GNIB 1WVYA 3IS5A 2XKEA 3T9IA 3UYTA 3D83A 4B0GA 3KVXA 3MB6A 4ZOGA 3MFSA 4KBKA 4CFWA 2BIKB 4U40A 4R7BA 3DXQA 3H9OA 2GDOA 4FEXA 1BYGA 3LPBA 3ALOA 2JEDA 1FGIA 1H1QA 4R8QA 4LV5A 4CCUA 5IZFA 5EM8A 4JBVA 2R3MA 4BVUA 5L2WA 2XKDA 4E93A 4C4JA 3LFFA 5TE0A 4BDDA 2CCHA 5LWNA 3OF0A 4KWPA 1GZKA 3R00A 4XRJA 4MQ1A 5LJJA 3A62A 1XJDA 2EWAA 1P4OA 4QOXA 4BIBA 5GIPE 1FVVA 4AGCA 2QVSE 4ANQA 5BVKA 4KB8A 3F2AA 4YC6A 4F9AA 2AUHA 1R1WA 3ODZX 4F1OA 2OIDA 4X3FA 3DFCB 3F88A 2UZWE 5DVRA 4C4GA 5D11A 3MY5A 4BIEA 3R1NA 4OT6A 2Z2WA 4Y46A 5L8KA 4EHZA 4YPDA 2SRCA 2R3LA 2JKOA 3A4PA 3DTWA 5CYIA 2YERA 3OUKA 1J1BA 4YO6A 3V04A 4IWQA 4D1XA 2H9VA 3OXZA 2WAJA 1U59A 4FV3A 4HGLA 4D4YA 3F69A 5CSWA 3MW1A 5AUZA 2IVUA 1IA9A 4XYFA 3ZLXA 5HVYA 4DTBA 4PDOA 4C02A 4X2GA 1JBPE 3OHTA 1PXMA 4UB7A 3CE3A 2VTAA 3SOAA 1OPJA 2ITOA 1QPJA 3VBQA 4J8MA 4AGDA 2UW0A 3OCTA 4RC3A 2XNPA 2VGPA 4RT7A 2E9VA 3EZVA 3MJ2A 4O7ZA 4EH2A 4Y5QA 2VD5A 3C4XA 3R9HA 4BCQA 1PW2A 2KULA 3A7IA 3EN9A 3F3UA 1G8AA 3RBWA 2UVZA 3UQGA 4Z55A 1ZMWA 5F94A 3ZDUA 4HYSA 2R3FA 2WIPA 4GVAA 2R64A 4KSPA 4FKWA 4APPA 3FI2A 1XH6A 2GNIA 4BF2A 4NZWB 4DEIA 2O3PA 1CDKA 3KA0A 4FTAA 1U5QA 3QQUA 4ZTHA 5IQAA 5BVNA 1ZY4A 3LXPA 4FKPA 4RIXA 4DEEA 4LMUA 5DT3A 3QA0A 4HW7A 1H28A 5IQCA 4O0WA 2FH9A 4WNPA 4F1MA 1O6YA 3G90X 1T45A 5HX8A 2X6DA 2YCSA 4IX4A 2P2HA 3DB8A 3NNWA 3IDCA 4C4HA 5BMMA 3DDPA 4FV7A 4EOKA 2PVJA 2XA4A 2YIQA 1V0BA 2YM7A 3DQWA 3I7CA 4BCMA 3BI6A 3CTJA 4QNYA 5AP0A 4MXXA 4W4XA 4HNIA 3ITZA 3NLBA 1J7LA 4WNOA 4BBEA 3DAEA 3VQHA 3GCSA 2WTCA 3C5UA 3D4QA 2XIRA 1LR4A 4IH8A 1K9AA 4E6AA 2ZMDA 3MB7A 4ACMA 3NIZA 1XH9A 3OTVA 5JN2A 4I5PA 4YJTA 2ZM3A 2FGIA 2V62A 3B2TA 4DEBA 3R63A 2OJIA 3AG9A 4MXZA 3ZSGA 3KKVA 4LQMA 4TL0A 4M84A 5ITAA 1Q24A 4PNKA 3IPHA 3IGGA 5BQ0A 4G9CA 3R2BA 5BYZA 1ZWSA 3KXNA 3EN4A 4JG6A 1TVOA 4IZ7A 3R7YA 3LW0A 4DLJA 1K2PA 2YDIA 2P3GX 4D1ZA 2YCFA 4W9WA 1R78A 3RK9A 4C35A 3EQPA 4DH8A 2JDTA 2BZJA 3D9VA 4FIIA 1VEBA 5B0XA 4ALVA 5CNNA 2WHBA 4PY1A 3V01A 1K3AA 4DGLC 4EJ7A 2NO3A 5FBOA 1XH5A 2YAKA 1PYXA 3EQIA 3FHRA 2WQBA 4PF4A 4QTDA 2UZDA 4OLIA 5E92A 4BGHA 4GK4A 3TKHA 3OS3A 2FSMX 3EKKA 4IB5A 3G6HA 4P5QA 4GUBA 3EQDA 4RC4A 4AXAA 3EMGA 2ZOQA 4A7CA 4CMOA 4YURA 3SGCA 1YKRA 3NWWA 4GFOA 4FSTA 4RWJA 1SNXA 3DKGA 3VRYA 1YDTE 2QU5A 4AG8A 4CZUA 3AC3A 3GQLA 4TZRA 2W1EA 2BALA 3Q9XA 1G3NA 1YXVA 4FSQA 1KOAA 5DEWA 1MRVA 1YXXA 4KKHA 5T68A 1HCLA 2PYWA 5KZIA 3KEXA 1JWHA 1X8BA 4FV9A 3UOKA 3MSSA 3QKLA 1NA7A 4ENXA 3C4CA 2I0EA 1XHAA 1PF8A 2WMQA 5DR6A 3N9XA 4AU8A 4FK3A 1OZ1A 3HP2A 3NAYA 1PYEA 2XK9A 3KY2A 4JDJA 4UYNA 5DLSA 4X2KA 4C8BA 5IEXA 3LMHA 4JI9A 4F9BA 5AR8A 3KMMA 1YVJA 2ERKA 3QD2B 3ACKA 4CSVA 2W4KA 1OKYA 4IVAA 5DE2A 2QOBA 4NCTC 5CNOA 1P5EA 2HZ4A 2P2IA 3LFCA 3OT3A 5TT7A 4CT1A 1U46A 4JAJA 2W1IA 3U87A 2R0UA 3CKWA 3N51A 1PXLA 4HCVA 5GZ8A 5EOBA 4PP9A 3TNQB 3MH2A 4OTIA 3ORZA 4MXCA 3KN6A 1Q61A 4YJQA 3F82A 2BUJA 4PMPA 4AOTA 3PZHA 2O64A 3FBVA 4R1YA 3ID6C 3Q4UA 3QQHA 4ZTSA 3WZUA 4CG8A 4D0XA 5FWKK 4L67A 2JIVA 3TUBA 5J1VA 2VX1A 2B54A 5FGKA 3QBNA 2X4FA 5HG8A 4BDAA 2ZDUA 2BTRA 3S4QA 5CANA 3FC1X 5IQIA 2ZAZA 3NNVA 4TWOA 1XH7A 5A4QA 3FMDA 4NT4A 2IZRA 4MXAA 2B55A 1R0PA 4O0VA 4HNFA 4QMPA 5CS6A 3FYKX 4QYYA 4EBWA 2PMOX 2JAMA 4EJNA 2CKEA 2OXXA 4QYHA 4UXLA 4G6OA 2W06A 4UZDA 3FI3A 4CG9A 3NCGA 2CKQA 2C3JA 2BRHA 5BX0A 2XS0A 3FMJA 3UG1A 5LVNA 4FZ7A 2OH0E 4I4EA 4B7TA 3F2RA 3BYOA 2HWOA 3KXMA 5CXZA 4YPSA 5IQBA 3ET7A 3R28A 1STCE 4GIIA 5E8TA 3K54A 4HPTE 5E7RA 4E5AX 4TNDA 3UIXA 4AA5A 3W2RA 1FBNA 3FMEA 2Y4IB 1FVRA 3MY1A 4J71A 4AA4A 5L2TA 3FI4A 3C7QA 2Z7QA 3EYGA 2B9FA 4FT3A 3FZRA 4LOOA 3OVVA 1FMOE 4KKGA 4QTCA 3WARA 4X3JA 4ZSGA 5D9HA 1EH4A 4EOSA 5EKOA 2PZ5A 2RFEA 3C4ZA 3II5A 3RZFA 2I1MA 1KSWA 3HGKA 5HD7A 3S2PA 2R4BA 4L45A 5HE2A 5HI2A 2Q0NA 4MNEB 2ZM1A 5T6KA 1VR2A 4JDIA 3DFAA 3GEQA 4HGSA 5AR4A 4MWIA 4JG7A 3TT0A 5L6OA 3WZKA 5AR3A 2UZNA 4J98A 3EYHA 1YHSA 5GHVA 3D14A 2WMSA 2X2LA 3MS9A 2NRYA 2WGJA 3LFDA 4FVQA 4FKJA 4JR3A 4U5JA 3UZTA 1JSTA 2JGZA 3QZIA 4JBQA 3LXLA 3NUPA 3PJ3A 4YUQA 3P4KA 5EM6A 2IZTA 2IZSA 3HP5A 1JAMA 3QYWA 3BGPA 4NK9A 3VS1A 1H07A 4FVPA 3NCZA 2E9NA 4JDHA 3T8OA 3Q53A 1ZYJA 3W2PA 2F2UA 3AC2A 2JLDA 1XKKA 3F5GA 3P0MA 4BDHA 3IECA 2BRMA 1Y6AA 3MH1A 4RWIA 4FIFA 3TXOA 5LMKA 3NYOA 1F0QA 1NY3A 4GL9A 2IN6A 4QMMA 3D7ZA 1OIRA 3UNJA 3HAVA 5E1EA 2UW6A 3FJQE 5CX9A 1BI8A 2CHLA 2ONLC 4NM5A 2EU9A 3KCKA 3H0ZA 4C2WA 3VUKA 5IA1A 5AX9A 4GT3A 3O96A 4WIHA 2CNVA 2HXLA 2PVRA 2IPXA 5DBXA 3NIEA 3D5VA 4DEAA 4WBOA 1BLXA 2VTSA 2GNLA 4IFGA 4KRCA 3G2FA 4Y8DA 4UMTA 2JD5A 3Q2JA 3DOGA 3VS2A 2JDSA 4ERWA 4K77A 5LMBA 1TQIA 3H30A 1JSVA 2OG8A 4PTCA 3PXZA 3VS5A 3R9OA 4FT7A 2C3IB 5AP6A 4YHFA 3KK8A 4RX7A 4UWCA 4DN5A 3NNXA 3VAPA 1KE8A 2P4IA 3MTFA 2ZDTA 4IQ6A 3HV5A 2QOFA 4RA4A 2C5OA 4AFJA 3G9NA 2IWIA 2PE2A 4GU6A 4RC2A 4LGGA 4XG3A 5HTIA 1NXKA 2C6LA 3GC0A 4I1ZA 5FXRA 3A7FA 1SZMA 4IIRA 5HO7A 3ERKA 4V0GB 5LVLA 3N4TA 4ZZNA 3SLSA 3BEAA 4L01A 3UO6A 2CNUA 4C0TA 4PX6A 3OWKA 3F5UA 4C38A 4GRBA 5CEOA 2CKOA 3P79A 2QG5A 1XBBA 2WEIA 2VTLA 4FTTA 1U54B 5CSXA 2YFXA 3MIAA 3RNIA 2XYUA 1ZOHA 2OGVA 4D4RA 3E3BX 3M42A 3EL7A 3UC4A 2B0QA 1S9JA 4O2PA 3E7VA 4IZAA 3M1SA 4L52A 1H08A 4FT0A 3ZO4A 4JX7A 4XG6A 2C3KA 5L8LA 3GC8A 5ANIA 4DFZE 2FSLX 3U51A 3SHEA 4IAAA 3UVQA 3TV6A 1XBCA 4BI1A 2O0UA 2QR7A 4ANBA 1WVXA 4DFYA 4BBFA 3BX5A 5IG1A 4DT9A 2YM3A 1G5SA 4R7IA 1UA2A 2PVNA 3V5QA 3P78A 3PTGA 4O86A 4DE4A 4HVDA 4O0YA 2CN5A 4FTUA 3RAHA 4F7NA 3DTCA 4S31A 4UMQA 5HIEA 4RQVA 3SRVB 3TV4A 4LRJA 4AWIA 2C6TA 2VGOA 3QQFA 4FSNA 5HG5A 3S1HA 3COHA 1F5QA 4AE6A 4ALWA 4IANA 1WMKA 4KIPA 3V5LA 4TXCA 3GU7A 5A46A 5C4KA 2V55A 2PUIA 4WT6A 2PVKA 1IEPA 3TWJA 3HKOA 2RG6A 4XH6A 4CXAA 5HG7A 3FI8A 4CTCA 3IONA 3RINA 4F6WA 2B9JA 2OICA 4G3CA 4BY9E 4RA5A 1YDRE 4D5HA 1KOBA 1CTPE 3F66A 4YJRA 2XIKA 5KKRC 4GFGA 2HWPA 4XV2A 4FIJA 4U6RA 2GTMA 3C4EA 4WOVA 3RAKA 4KINA 5HQ0A 1H25A 1O9UA 2WTWA 3VS0A 3TM0A 4MHAA 3PSDA 3TNWA 5CVHA 2XNEA 2W4OA 3NW5A 3UP2A 3AC8A 3OEFX 3UNZA 1OI9A 2W9FB 5HCYA 4E4XA 3SG8A 4AN2A 2R3NA 4A9UA 4S32A 5AP7A 3W18A 2E9OA 1PY5A 3Q04A 2G2HA 4IVDA 3FSKA 5B2KA 4CRSA 3BYMA 3F3WA 4FF8A 5KKRB 3O71A 3FXZA 3G33A 3QALE 3U6HA 4O7NA 4Z7GA 4F4PA 4MD7E 1JKTA 3WILA 5FTQA 2Y9QA 1IA8A 2C5XA 2OU7A 4AF3A 2GSFA 2CGUA 5AMNA 4LUEA 1OBGA 4XG2A 1G8SA 3BEGA 4IX3A 3BWJA 2WTJA 5JFWA 3HLLA 4K9YA 4ZTLA 3K2LA 3KQ7A 3MVHA 3VW6A 3DT1A 4FEVA 2CNQA 3P5KA 2CGWA 3FLQA 2C3LA 2XYNA 4D2SA 4G6LA 4MF1A 5E8VA 4XJ0A 4FNXA 3H9RA 4FNWA 4ZP5A 2QODA 3DXNA 5AUUA 3ZZWA 2FSTX 4IWDA 2OJFE 5H3QA 4NEUA 4JLCA 3R9DA 3UPZA 3R9RA 4M15A 3FPQA 4EQCA 4YBJA 4B8LA 5HD4A 2C0IA 3MDYA 3AMBA 3SQQA 3QTQA 4C3PA 4G16A 4AAAA 5IA4A 3R7EA 4DGNA 4ZLOA 3NYVA 5DH3A 2DUVA 3AC4A 3GENA 4HZSA 2R2PA 2RIOA 2OF2A 2YISA 4NKAA 3W10A 4ZAUA 2C0TA 3BHVA 3IO7A 4RFMA 4NU1A 4FBXA 4TN6A 5G1XA 5J5SA 4IAFA 4YZCA 5HLPA 5AV4A 4DTAA 5K4JA 4XP2A 2YLFA 5EW8A 3AGLA 4ALUA 2V22A 3PY0A 1RW8A 4LUDA 2WMUA 2W9ZB 5TOZA 2VWWA 3NEWA 3QRJA 3ORNA 4TYJA 5J79A 3ROYA 4F9CA 2QCSA 2QR8A 4ZXTA 4O82A 3ORXA 3QLFA 4RJ6A 1OPKA 3MN3A 4ONAA 4KSQA 5TKDA 4FKGA 3RAWA 3OEZA 3BBTB 2JKKA 3WF9A 3RGFA 3ZXTA 4CYIA 3VNTA 3PXRA 5LVOA 4GJ2A 3UQFA 2PMIA 3LLTA 3NR9A 4HVHA 3SVVA 3GFEA 1CMKE 3UVPA 4IB1A 4QP1A 4ZEGA 3BGQA 3R22A 4RIWA 3WYYA 4FKSA 4JG8A 5DGZA 5EH0A 4TW9A 4CD0A 4RPVA 3KXHA 2C30A 3O8UA 3A7HA 2WXVA 3MV5A 4MD9E 4OTHA 4M0ZA 5DYJA 4IDTA 3ZLYA 4DYMA 4PPAA 3PVBA 3IK3A 3UIMA 3UZRA 3QC4A 1W7HA 2C6IA 2UUEA 3C0GA 1MQBA 3PSCA 5F20A 3V8WA 5EYCA 4BGGA 4EZ7A 3UOJA 3S95A 1NT2A 2OFUA 3CXWA 2YLEA 4ITHA 3P1AA 3BV3A 2EXCX 3QTXA 3EFJA 1YWVA 3G6GA 3ZDIA 3MYGA 3FMMA 3DBEA 4XV9A 3VQUA 2JIIA 4QYGA 3SC1A 3U6IA 2PULA 4WNKA 2Z02A 1VJYA 2XRUA 3Q6UA 4QP2A 1ZRZA 4AQCA 4I6FA 3ZBXA 3C5IA 3FLZA 4R6VA 3RHKA 3JVSA 3P7CA 2JKMA 1OL5A 4U43A 2QO7A 4EWQA 4KBCA 4FT9A 4EYMA 5AM6A 4GKIA 4OTGA 2QO2A 3Q4ZA 1ATPE 2ZVAA 3AC1A 2OXYA 3UGCA 4AOIA 5J7HA 1JPAA 5J95A 4XP3A 5B7VA 3BLHA 4IM0A 3ZH8A 1GOLA 1GZOA 4PMMA 4EK8A 5CENA 4LMNA 2VTJA 2XEZA 2XH5A 4CT2A 1PMVA 3SDJA 3UC3A 5EKNA 3FQSA 3MFUA 3W33A 1GNGA 4UMUA 2C68A 4X6QC 4XG7A 5IEVA 2QOLA 2X7OA 3JY0A 5EYKA 3TUDA 5D41A 4O2ZA 4FV6A 2YZLA 5C4LA 3NW6A 1PRYA 2F7EE 3AD6A 5AUYA 5EOLA 4MEDA 5CU6A 1SVHA 4QT1A 3WI6A 4EOQA 2BKZA 2QKWB 1URCA 2VWUA 3CQWA 3KRLA 4L7FA 3UVRA 4ACGA 3IW7A 2PZPA 2X9EA 4JNWA 4MNEA 4CFXA 2XB7A 5LMAA 4DEHA 3LMGA 5K3YA 3NYXA 4EYJA 3F6XA 2JBOA 3B8QA 5AA9A 5J9YA 4W8DA 1GJOA 3GBZA 4DG3E 1PXPA 2FO0A 2OF4A 4FX3A 4R3PA 4BCOA 1QMZA 5LCKA 3EZRA 3O50A 4WO5A 3JUHA 1LPUA 3KF4A 4I6BA 3ZUUA 4APCA 4U97A 2WD1A 4I23A 3M2WA 4RVMA 3D2IA 4TY1A 2EB3A 4X3FC 3VBYA 3ZFXA 4D9UA 3DS6A 5I9UA 4B9DA 5LOHA 4AT4A 4F6SA 3VC4A 2OK1A 4Q5HA 3LIJA 4R3RA 2C6KA 5E9EA 2CKPA 3ELJA 4I92A 4NIFB 1H1RA 4QD6A 2QOQA 4I4FA 5IA0A 4YNEA 2C5NA 4IFCA 4E7WA 3I5NA 2GQGA 3ORIA 4H1JA 4MBJA 1PJKA 3VF9A 3BLRA 4X3FB 4N6ZA 5HE3A 3CGFA 3U55A 5L6PA 3GCPA 3FLYA 4OUCA 4I6HA 3QQJA 4BDJA 3CJFA 1GY3A 4JQ7A 4FUYA 3NDMA 4XLVA 4E3CA 1WBWA 5HLWA 2NPQA 4BYIA 2O63A 2XBJA 5HLNA 3QGWA 4D2WA 2G15A 4P2KA 4EKLA 1H0VA 4LV8A 2OZAB 3QL8A 3HUBA 1Z57A 2C1AA 3HMMA 4ZIMA 3BE9A 3COIA 3IQ7A 3QKKA 3RI1A 3N4VA 2XJ1A 2WTKB 5J87A 2BCJA 4M0YA 4AZTA 2OIQA 4KKEA 4RVLA 4CFVA 1L8TA 4PRJA 2GQSA 5IPJA 2AC5A 4O6LA 5D7AA 4AW2A 2GNFA 5ETCA 4EWHA 2GQRA 5IQFA 2WQOA 5AV0A 3AQVA 2WFYA 3PWYA 3MGYA 4I5MA 3AT4A 4BYJA 4ASDA 5DRBA 3IOPA 3VUDA 4BCKA 4O38A 5ANGA 2WTKC 4HOKA 4TTHB 5ETIA 2QHNA 2EB2A 3NUAA 4PTGA 4XBRA 3Q5ZA 4L6QA 1PMEA 3HYHA 3VBVA 4DG0E 3BKBA 2ZYBA 3EQGA 3JVRA 5DOSA 4BFMA 2BIYA 2X8DA 5JGDA 3FEGA 3V5JA 4EONA 4FG8A 4P4CA 3VUIA 4FIEA 4U7ZA 5KHXA 2J7TA 3UODA 3O8TA 1LP4A 5DFPA 5DT4A 4BWKA 5IA3A 2R9SA 2VTPA 5IQEA 1YWRA 4GH2A 4WBBB 4HCUA 4O7RA 5HBEA 4KRDA 3BQRA 3DGKA 4FKOA 4YTHA 3O8PA 3OCGA 2C6OA 4BCIA 4N57A 5K9IA 2G01A 3PE2A 1FVTA 4L44A 1Y91A 5CEQA 3W55A 3DPKA 4YNOA 4BBMA 2RF9A 2C5VA 2VTTA 3H3CA 4QMVA 1I44A 3PPZA 4F63A 3JS2A 4F64A 2A0CX 3L8XA 4M12A 3AD4A 3DBDA 3PXFA 3FL4A 4J52A 2ITTA 2GS7A 2B7AA 2GTNA 3TJDA 3T3UA 3FZ1A 5DG5A 2VWZA 4DLIA 1J7UA 1CSNA 4YJVA 1PXJA 2ITVA 4FV0A 3DBCA 4F08A 3S0OA 4MYGA 2CDZA 5TF9A 2BDWA 1XR1A 3F3TA 4DGGA 5CF6A 4A4XA 4BZOA 5ICPA 2BHEA 3AD5A 3TKIA 4FKUA 5D12A 3AT2A 2B4SB 3KGAA 4L9IA 2OSCA 3I81A 5HBHA 4D5KA 2RFDA 4Q2AA 4K2RA 3BYVA 1OKVA 2HELA 1W83A 1F3MC 2I0HA 1JKLA 3IW8A 4C62A 4CV8A 1Q8UA 5KE0A 2OO8X 5FM3A 3GOPA 3LXKA 2C5YA 4H3PA 4X21A 3ZEWA 4FIHA 4ZTQA 1SM2A 5H8BA 3DBFA 4TWPA 4XS2A 4HVSA 4CFUA 4AGUA 3WF7A 4UYAA 4IM3A 3CPCA 4ZMEA 4EH6A 4GG7A 4FOCA 4E4MA 2VTNA 2WEVA 3CY3A 3FMHA 5CU2A 3U8WA 5JZJA 2WIHA 2UW5A 5K4IA 1A48A 4BCGA 4LL5A 4FYNA 4ZTNA 2HYYA 3FZTA 5HO8A 1LEWA 5A3XA 5GJDA 4BCHA 5AEPA 4MH7A 2XF0A 1WFCA 3ZCLA 3AXWA 4HYHA 1BL6A 2GHGA 4D4SA 1PHKA 2X1NA 3HUCA 3I1AA 3R7GA 4RVTA 3UE4A 4AX8A 4BTKA 1R39A 3NW7A 5EG3A 2RKUA 3ZM4A 2VTRA 2WKMA 3QYZA 4MKCA 4DFLA 3F7ZA 2Y7JA 3ENHA 4LI5A 1CKPA 1ERKA 4QPAA 4RVKA 4BZNA 3SA0A 2VX0A 2R3PA 4RRVA 2XUUA 4J1RA 3V8SA 3CPBA 3POOA 3QTUA 4C57A 3FC2A 1MRYA 4QTBA 2J5EA 1Q8YA 1YOMA 3QCYA 5JEBA 5LCJA 1UWJA 3MH3A 3BPRA 5J1WA 3R8UA 2F57A 4U79A 4TWCA 2OWBA 2VWXA 4G17A 3VVHA 4RJ7A 4A9TA 3O0GA 2ONLA 2YACA 3SXRA 2R3JA 4FZFB 4M7IA 3W2CA 4CFNA 1IAJA 2YZAA 4YJUA 2I0VA 4BTMA 4ZZOA 3CBLA 4Q9SA 3SRVA 3UIBA 2X7GA 1BI7A 3EQHA 4FTLA 4FOBA 4USFA 3F5XA 4OT5A 4CKRA 1AGWA 3RAIA 2E9PA 3BCEA 5CF4A 4QMNA 2BMCA 4IW0A 4FE2A 3FKNA 3RM7A 5A54A 3PY1A 2OZAA 5BUEA 3AOXA 3A61A 3OWPA 4B8MA 2J2IB 4BKYA 3LCOA 4GCJA 5HE0A 3ZSHA 2BTSA 2W5AA 1NW1A 3ZMMA 3MVJA 1KE9A 2F7XE 5CAUA 3TNPC 1DS5A 4W4WA 1JQHA 1UU9A 2XRWA 3Q4CA 4E6QA 4EORA 3K5UA 4FTCA 3TNIA 3FAAA 4NJ3A 3KXGA 3FDNA 3KK9A 5BYYA 4EQMA 2A19B 2B53A 3DK3A 4QMZA 2H6DA 3HA6A 3JXWA 4Z16A 3FXWA 4EBVA 3E93A 3V8TA 1U5RA 2WTVA 4GG5A 1ZY5A 4FICA 5AFVA 2CJMA 1P4FA 3BU3A 5L2QA 2PVMA 4FTMA 3BWFA 3W8LA 5DT0A 1OKZA 4RMZA 3Q9WA 2ETMA 4DINA 5K5NA 3ETAA 4FTQA 3CD8A 5L8JA 5GJFA 2XNBA 2HENA 5FM2A 2ZJWA 4TYEA 1UKHA 2R3IA 4ENYA 4DH1A 5LQFA 5IQHA 5CTPA 5CY3A 2VTHA 3DKFA 3OWJA 4ANLA 4DH5A 1OMWA 4IDVA 4N6YA 3DXPA 5FEEA 5BVEA 5CLPA 4OGRA 3PXKA 4RBLA 2PE0A 4J8NA 4LRKA 4QO9A 3WIKA 3Q5IA 2QURA 3TZ7A 3QCQA 4QTEA 4L00A 4RG0A 3FV8A 5CEMA 4UMPA 1XBAA 4QQCA 3B8RA 5KMLA 4CMTA 5HU3A 5CAOA 3PJCA 4RX9A 4FG9A 4L3JA 4E5BA 2O65A 1O6KA 4NM7A 3UTOA 4JQ8A 3SKCA 4C34A 3OCSA 5FD2A 2BHHA 5CZIA 3CJGA 4AFEA 3ZFMA 1YW2A 1YOJA 4YZNA 2CGXA 4X2JA 4UY9A 4DG2E 4G31A 3R30A 4KA3A 5LARA 5JFSA 4LRMA 4KNBA 2CN8A 3C13A 4YMJA 4DTKA 3HMIA 3OD6X 3FZOA 4DBXA 4GIHA 3KCFA 2BRGA 1SMHA 3PUPA 4JT3A 3ZO2A 2FYSA 2J0KA 2PWLA 4E5WA 4C3FA 4D0WA 3QD4A 5CQWA 5AP3A 4EQUA 4A4LA 3F7WA 3NMUF 2UW9A 3HRCA 2NRUA 4ZSAA 3MFRA 3FL5A 4IX5A 4DA5A 2C4GA 4C37A 4AZVA 5B2MA 4RSSA 2PUPA 3QU0A 4NH1A 3CS9A 4NJDA 3IW6A 4QRCA 1NVSA 2OXDA 4O1PA 3U4WA 2XK8A 4O96A 2R7BA 3KULB 4K6ZA 4EOPA 3ATSA 1FQ1B 1IASA 3OXIA 4I24A 4DAWA 5A4EA 3QLGA 3QZGA 4I22A 4EK4A 3EQBA 5C8MA 4FGBA 2YEXA 5ANJA 1M2RA 1YI6A 4IM2A 5HTBA 2IZUA 2WMXA 5CXHA 2ITPA 1ZOGA 3UZPA 3I6UA 3GOKA 3HV4A 4ANNA 4ASZA 1TKIA 4PQNA 4D2RA 4U80A 3TDWA 4F6UA 2PZIA 4DCEA 2IJMA 4FA2A 3TG1A 3I5ZA 3ZFYA 4BR3A 3I60A 3HMPA 3PY3A 3I79A 4WHZA 4JBPA 4YSJA 4FR4A 1ZZLA 2ZV7A 4TYHA 5TR6A 1E9HA 1WVWA 3QHRA 4K0YA 1DI8A 4JXFA 2E9UA 5EW3A 4BCFA 1Q4LA 2UZTA 4BHZA 4GKHA 2JAVA 2WMVA 4EHVA 5FLFA 4JIAA 4YLLA 4C4EA 1H8FA 3QTIA 4M66A 1WBVA 5IQGA 2FA2A 3DZQA 5CEIA 5I5ZA 3KMUA 5EK7A 4FSZA 4KABA 4U42A 3A4OX 4LOPA 5HCZA 4DCAA 2QOKA 3WYXA 3PLAE 4YJOA 2DQ7X 3IGOA 4EK3A 5CALA 3BGZA 3BHYA 4R3CA 4BDBA 5E91A 5GNKA 5E8SA 4HVGA 4PMSA 4O0RA 5K0KA 5JRSA 3GCVA 3OXTA 1XWSA 3OUNB 1SYKA 1M2PA 3C1XA 3UOHA 3G51A 4BDFA 2XNMA 4BN1A 4BKJA 5HBJA 3KVWA 4LFIA 1OBDA 3WBLA 4JOAA 3R83A 4EH8A 5M08A 4O84A 3AC5A 4E4LA 3L1SA 4N70A 2WZJA 4BDCA 4BI2A 1B39A 4I41A 4ID7A 3LKMA 3O17A 3L8PA 3AGMA 3TKUA 1JKSA 4Q9ZA 5HEZA 3AMAA 4IEBA 3VBWA 4E6CA 4R1VA 2YABA 4CGAA 3BELA 5L4QA 1OKWA 1U4DA 5CU3A 2BRBA 4FMQA 1YXTA 3PA5A 2XM9A 3CD3A 2ACXA 4G34A 2EXMA 5F1ZA 4U8ZA 2Y4IC 3GQIA 4NM0A 2W5HA 2C6EA 2WB8A 5FEDA 5FQDC 3BU5A 3ZTXA 4EUTA 1M52A 2J4ZA 1XH4A 3DLSA 3VS6A 2PZRA 1LUFA 2O8YA 5JQ8A 2YHVA 3OG7A 4O0TA 2J5FA 4U44A 2PL0A 1ZLTA 2F4JA 2YM6A 4FGRA 3WE8A 3VS7A 4DEGA 4HYUA 3KRJA 5EW9A 2W1DA 3FZPA 3NZ0A 4E26A 5ETFA 4AN9A 3MPMA 2OW3A 2BAJA 2Y8OA 2DWBA 4O6EA 2QKRA 4TRLA 3SXSA 4FL3A 4JAIA 4JIKA 5CSPA 4L3PA 4BTFA 2CLQA 2ZV9A 3R0TA 5DMZA 2VAGA 2BZIB 3Q9ZA 4IWOA 2WMWA 1IAHA 3E7OA 3WF8A 3DBQA 4KIKB 3ZZEA 2W5BA 2JC6A 3BIZA 3MWUA 3MPAA 2C0OA 5C26A 5GINE 3KREA 4DH7A 2QD9A 2AYPA 1KUTA 5HVJA 4UALA 3PPKA 3COKA 4N0SA 4MQ2A 3T3VA 4ANOA 4YBKA 1W82A 2VO7A 5M51A 4AACA 3AT3A 4IJ9A 3GGFA 5I3OA 2JDRA 3NRMA 4PWNA 3BHUA 3IKAA 3ZOSA 4J99A 3E8CA 1OM1A 3HMNA 3R8MA 2EXEA 5DA3A 5HNGA 4F7LA 3EFLA 5M4UA 4Y85A 4BCJA 4DGMA 3HX4A 1U54A 3TTJA 2LAVA 1IRKA 5CSHA 2YM5A 5ANDA 3V6RA 4KIQA 4DFNA 3EFKA 2QQ7A 2VNWA 3F5PA 3PJ2A 3UP7A 3W1FA 4GU9A 2C6MA 2YJRA 4KD1A 5AV1A 4XX9A 1YHWA 3GC9A 5HX6A 3NYNA 3MESA 3HECA 2OJGA 3E87A 5BPYA 3SOCA 2IVTA 3TDVA 3FKOA 2PVFA 4D28A 3QD3A 3U9NA 5FXQA 4KBAA 3ZO3A 5A9UA 4WG3A 3OWLA 3HV7A 4FKIA 5EDRA 2IW9A 4Y72A 1DI9A 3ZXZA 4ORKA 4GT5A 3L8SA 4J53A 4X6RA 4G5JA 3FQEA 4C61A 3KRWA 2JITA 3W32A 2IG7A 4ARKA 3D15A 2XIZA 3V6SA 3QXPA 3U4UA 2JKQA 1Q8WA 3CY2A 5HE1A 2WPAA 5CI7A 5E8XA 2UZVA 3QUDA 2QOIA 4AZSA 3G9LX 3EJ1A 3D5UA 4U45A 5AJQA 3ANQA 4U81A 4E73A 4FEQA 3ZRKA 3FWQA 2EUFB 3VJOA 1CKIA 2Y4PA 5C03A 1URWA 4M69B 3T9TA 3ZYAA 2X2KA 3I0OA 4GVJA 4CV9A 3GT8A 4KS7A 3G5DA 4BZDA 3QF9A 5AR7A 3QQLA 4JBOA 5CF8A 2F2CB 2X6EA 2X8IA 5CI6A 3RM6A 4YLJA 5AR2A 3TIZA 4BWPA 3MFTA 4AZWA 4G2FA 3ZBFA 5AIKA 3HV3A 4BICA 4C36A 4M97A 2X8EA 1KV2A 1FOTA 3CTQA 2ERZE 5LVPA 1UU8A 5EQPA 1CM8A 4JJRA 5D7VA 4O83A 1KWPA 3CQEA 5AX3A 3FZSA 2JDVA 3VBTA 4TNBA 2UV2A 3UJGA 3RVGA 3DDQA 3PP0A 5CF5A 4P7EA 2GPHA 5AA8A 5EQEA 2GNJA 3PVGA 4CKIA 5KX8A 1UU3A 5I0BA 4D1SA 1OVEA 5M44A 3DU8A 4DT8A 2VO6A 2YAAA 4A07A 2BFYA 4DHFA 4PPBA 3JR1A 3LMIA 1OIQA 4AGWA 4I21A 2I40A 4A9RA 4EC9A 2VO3A 4ZLZA 5BMSA 4BDIA 3KF7A 5I9YA 3R8PA 1UV5A 2XBAA 4ZJJA 5DNRA 5IF1A 5IU2A 4ZTRA 2XVDA 3Q6WA 2YWVA 4O0SA 3PXYA 4CFFA 3ANRA 4ZTMA 5H9BA 4AT3A 5JGBA 1TQMA 2HW7A 2YDKA 3IDPA 2XKCA 3SV0A 3QZFA 3DKOA 4B99A 4YSMA 1YQJA 4LM5A 4ACHA 2X2MA 4M3QA 2J0JA 5EI6A 5FDXA 2PTKA 3WF5A 5D10A 1YHVA 3K3IA 1BL7A 1WBPA 5IMXA 4I3ZA 4MF0A 5EM5A 3LVPA 3ZRMA 4QMXA 1OL6A 2GFSA 3OFMA 5CAQA 4AS0A 4AP7A 4FKRA 5EHYA 3HL7A 3RWPA 2IVSA 5DN3A 5C27A 5IH4A 4ZZMA 3L9MA 2J9MA 3LXNA 1GZNA 5AP2A 2BR1A 1H1WA 1Q3WA 2PVYA 3CR0A 4PL4A 4XG9A 4XUFA 4XV1A 4ZLYA 3OTUA 5EYDA 4RGJA 3ATTA 4CLJA 2QONA 5DHJA 3RNYA 1YXSA 5BVFA 2CGVA 4YR8A 3P7BA 3QRIA 4PNIA 3GCQA 2UZUE 4FT5A 3PG1A 3VS3A 3RMFA 4A06A 3R04A 1YI3A 5CWZA 5AWMA 5T3QA 1OIUA 2GMXA 4RIWB 3QCSA 3UIUA 3GI3A 5A4CA 3VULA 2XK7A 2XKFA 3DNEA 4EOLA 3WE4A 1H0WA 2B9IA 4NUSA 4AW5A 4G1WA 5L3AA 5FRIA 4FVRA 4ZY6A 5TO8A 3RPYA 3PE1A 5GIOE 3QWKA 3FMLA 3P86A 4IAKA 4UXQA 5K0XA 2VTMA 1JLUE 4YC3A 2JIUA 2GNHA 3R01A 4O21A 2BVAA 2V0DA 1H01A 4LGDA 4XBUA 4FNZA 5E8ZA 5AP1A 4A4OA 4HVIA 5IH5A 1UNHA 3EB0A 4LG4A 4DEDA 5I9XA 5KMKA 4MAOA 2ITWA 4FZDB 4DBNA 1ZYSA 1W98A 4D9TA 2ITZA 4XLIA 3LM5A 4IE9A 3VN9A 2VTQA 2WMAA 2XK4A 5E8UA 1V0OA 4F9YA 1J1CA 2VX3A 5I9ZA 4YO4A 2QHMA 3P23A 5KMJA 1HCKA 2Y0AA 4E6DA 4EC8A 3TI1A 3VBXA 3NGAA 5KBRA 4GMYA 5CAVA 5LXMA 3PIXA 4I0RA 3E88A 4C3RA 4GS6A 4IMYA 1JOWB 5LVMA 2GFCA 4G9RA 4JX3A 4O7SA 3WIGA 1M7NA 1XH8A 3Q2MA 4RIYA 3PVWA 5FP6A 4LGHA 4O27B 2A2AA 4JL9A 2GNGA 3TIYA 2VRXA 3BBWA 4NYEA 5M55A 2P0CA 2XNGA 5CASA 3NSZA 1QPCA 4UX9A 2ITYA 1KV1A 2GCDA 4NWMA 3TZ8A 2V7AA 3F2NA 1PKGA 1YI4A 3F61A 4EL9A 3KMWA 4DH3A 4F70A 3OP5A 4FTNA 4BIDA 2ETRA 3UDBA 2KTYA 3BV2A 1JSUA 4FK6A 5H8GA 4NSTA 4QP9A 4V05A 3AMYA 3ZC5A 4IAIA 5L2IA 3Q3BA 5H8EA 2HOGA 3Q9YA 2PPQA 1UU7A 2W05A 2VV9A 3GC7A 3LFQA 4TYIA 4CEGA 5IUHA 4OBPA 1APME 2YIYA 1SNUA 3RWQA 2WMRA 1ZYCA 3HRFA 4QTAA 4AZEA 4I0TA 4TT7A 5KZ0A 2WU7A 3JYAA 3WZDA 4HPUE 2W1FA 4AW1A 1J7IA 5A6OA 3RPSA 2V5QA 2Y6OA 5E90A 4U3ZA 2DS1A 3RCJA 4O7TA 2QOCA 3LZBA 4EOOA 4CTBA 3E92A 3FY2A 2CSNA 3PRIA 2GS6A 1NVRA 2ZMCA 4PDYA 4FV5A 4ACDA 4FUXA 4DFUA 4L8MA 2XK3A 3CSVA 3LJ2A 1AQ1A 4GYIA 4QPMA 4YZBA 3MI9A 4OR5A 3SX9A 2E2BA 4GFMA 4WUNA 4AOJA 4HGTA 3PSBA 3DJ6A 4CCBA 4DFBA 4PDPA 2R3OA 4U3YA 3C51A 2QOOA 4G3DA 3R71A 5HNIX 1OL2A 1VYZA 2RGPA 3CIKA 3DLZA 4M69A 4C4FA 3FLSA 2UW8A 3DAJA 3BYSA 4S34A 4USEA 1J91A 2PUNA 4W8EA 5KHWA 4ZS0A 5AUTA 4XG4A 3U6JA 5I4NA 1Y8YA 3HA8A 4QMLA 2F7ZE 3EN7A 2ITNA 3ENMA 4MK0A 3S3IA 3CGOA 4F99A 4IAYA 2XK6A 4IZYA 3CCNA 3MTLA 3F3VA 4FKLA 4FNYA 4MXOA 3DB6A 4M68A 4EOMA 3ZM9A 2B9HA 1Q41A 4ITJA 3C4WA 3DV3A 3IOKA 4QMSA 4H1MA 2F49A 3W2OA 3QRTA 5DR9A 3ZU7A 3M11A 2BKKA 3EH9A 2XZSA 2BAKA 3MA3A 5FP5A 3K3JA 5BNJA 1Z5MA 2HCKA 2YN8A 3O7LD 4OTFA 3V5WA 3E5AA 3O7LB 3VF8A 1Q62A 3LCKA 5CT0A 3I7BA 4MX9A 5F4NA 2FUMA 4IHPA 3HEGA 3LCDA 3OW3A 2ZV8A 4GK2A 4D55A 4MCVA 3VO3A 3U9CA 1PMNA 2WOTA 4OTRA 3ORLA 5FG8A 3DJ7A 1J3HA 5AUWA 4F09A 2Z60A 4O7LA 4YTCA 3DZOA 1A06A 2ZB1A 3ORKA 2G1TA 5ANKA 4D2PA 3GU6A 4L53A 1PXKA 3KU2A 3LLAA 4K8AA 2HK5A 3FQHA 3DQXA 3MIYA 4NTSA 4F0FA 5EM7A 5CQUA 5E8YA 4O91A 4UWYA 5FUTA 5AV3A 3A2CA 4I93A 3ORTA 5JFVA 1M14A 5GZ9A 4L3LA 4FTIA 4IC8A 3DKCA 1P2AA 2QC6A 4E1ZA 3VW8A 3WF6A 3ZLWA 2PVHA 2Z7LA 3H9FA 3D5WA 1ND4A 1BMKA 2UW4A 3RALA 3L9PA 5M07A 2YCQA 3MA6A 5HOAA 3HAMA 4D58A 3KXXA 5IKWA 3QRKA 1H4LA 1Y6BA 3DK6A 4QMYA 3SW4A 4F7SA 1I09A 3PLSA 4RLLA 5BVOA 3KB7A 3NPCA 3OZ6A 3GVUA 4BB4A 3TJCA 4ZJIA 2I7QA 3QD0A 5HGIA 4M8TA 3QFVA 4FL2A 5J8IA 5JFXA 3KULA 4K33A 4RIXB 4RJ4A 5CVGA 5FXSA 5AADA 4CLIA 4QQJA 2R3KA 5EDPA 1FINA 4U0IA 4H58A 4BKZA 4G3FA 4PP7A 4ZSEA 2AC3A 4OTPA 2XMYA 3D94A 1MQ4A 3FUPA 3LJ0A 3ORMA
chains in the Genus database with same CATH superfamily
3E8DA 1OITA 4BDEA 2BRNA 1JKKA 4R5SA 4FTKA 5HCXA 2IO6A 3V3VA 4EZ5A 2WQMA 3E64A 5ETAA 1WAKA 4DFXE 3DCVA 3C0HA 3UYSA 1FMKA 2Q0BA 2YM4A 3NVKI 4BTJA 3RPVA 4KS8A 5FTOA 5L6WL 4HYIA 3R7IA 5M4CA 1PKDA 4ITIA 2DYLA 4YHJA 4O81A 3V51A 3HMOA 4FC0A 5IMEA 1OIYA 4NTTA 2C47A 4A9YA 3NX8A 1YWNA 4I94A 3EKNA 2R3QA 3R7OA 3VUHA 2X7FA 4QNAA 2RSVA 2PHKA 4QP8A 2JDOA 3KFAA 5DPVA 2OI4X 1RQQA 3EQFA 3OT8A 4OBOA 4ACCA 4IWPA 4Y73A 3TACA 4I0SA 4CZTA 1Z9XA 3VHKA 3ZLSA 5KBQA 4BDKA 4A9SA 4I20A 1OL1A 4NIFA 3EOCA 4FV4A 4BDGA 4H39A 4F0IA 5A6NA 3A7JA 4RX5A 2P33A 4JRNA 4AN3A 3ROCA 2QNJA 3L8VA 2XM8A 2P55A 5CU4A 4EK5A 4EUUA 5HZNA 5J5TA 4P5ZA 2W0JA 2HIWA 4EOIA 3CEKA 3SW7A 2W1GA 3CTHA 2VTOA 3RPOA 4WG4A 5M56A 3MH0A 3R8LA 4BHNA 2YITA 4AA0A 5FTGA 4NKSA 5F9EA 2HZIA 2WMBA 4IVBA 3CC6A 5E4HA 2YIXA 4OTDA 4QDEA 4KIOA 3A60A 4TWNA 3PA4A 5AV2A 2WQEA 2X39A 5K5XA 2JFLA 5HVKA 4RWLA 4CQGA 4DITA 3NFGB 3VUMA 4MVFA 4Z7HA 2XP2A 4HZRA 1KE5A 3VWAA 2QO9A 3RHXA 3G15A 2W96B 4YZDA 2BZHB 2A27A 2PMNX 2QLQA 3F3ZA 3FKLA 3GCUA 2YM8A 4LL0A 3D7TA 4RWKA 4XG8A 1XQZA 2HY0A 3V5TA 5IUIA 1FPUA 4L68A 2ZM4A 5E1SA 5IH6A 4II5A 4QP7A 4EH3A 4IXPA 2VUWA 3OOGA 4O0UA 4OTWA 5AR5A 1CKJA 3DJ5A 5M4IA 4FTRA 3RCDA 1BUHA 3VRZA 3R8VA 3Q4TA 4GK3A 3VUGA 5FEQA 1IG1A 5A14A 1RJBA 2H8HA 2REIA 2UZEA 3QX2A 4I6QA 5ANOA 3QGYA 4RZWA 2X4ZA 3REPA 2VNYA 3Q52A 5CZHA 3UBDA 5LMKC 1Q97A 2J6MA 4R7HA 3ULZA 4CFMA 4LYNA 3ULIA 1GZ8A 3THBA 4EH7A 2EVAA 3BZ3A 2BFXA 3D7TB 3PJ8A 3QUEA 2C69A 3BRBA 2GHLA 4J96A 2XCKA 4Y5HA 4PL5A 3TNHA 4H36A 4FTJA 1W0XC 5F95A 2W17A 1KE6A 2W99B 4V01A 2VWVA 2BPMA 3LQ3A 4RIYB 4GV1A 4C58A 2VU3A 2YIWA 4CRLA 3VS4A 4ANMA 2HW6A 3F9NA 4BCPA 4YHTA 5HIBA 5CAPA 2BILB 4S2ZA 2Y6MA 3IW5A 3KXZA 4C33A 5DR2A 1ZYDA 3GU8A 2QI8A 3LCTA 4FSRA 3RK7A 5DWRA 3ZONA 1Q99A 4BGQA 4FTOA 4MBLA 4IBMA 2NNWB 3CKXA 4H3QA 2W4JA 4OBQA 3NUYA 3PP1A 3UO4A 1WBTA 2UW3A 4RLKA 1KE7A 2R5TA 4HJOA 5HTCA 3QXOA 4OTQA 5AAFA 2O5KA 3A7GA 3A8XA 3HNGA 3LFAA 3G0FA 4MWHA 4KUJA 4QMOA 5I9VA 3QAME 4G5PA 4W9XA 4CVAA 4NL0A 2BROA 2W1HA 1IR3A 4RFYA 4GJ3A 4UWBA 4M67A 3GP0A 4OAVB 2YIRA 3E3PA 3NUUA 5EHLA 4PTEA 1Q8ZA 2UZBA 3NVMB 4YZ9A 1UNGA 3KIOC 1WCCA 3FMKA 1YRPA 3IW4A 4WUAA 2QU6A 2GS2A 3TEIA 5B2LA 1V1KA 1OB3A 3W16A 3RJCA 4AZFA 3GXLA 2HY81 3QTZA 4FEUA 4CZYB 2VN9A 2YA9A 4EHGA 4YC8A 4U9AA 4CKJA 5C1QB 5BUJA 3QHWA 3L9LA 3UQCA 4I6LA 3B2WA 4PMTA 3QA8A 2ITXA 2XJ0A 4XV3A 4E8AA 5KMNA 2Z8CA 3GU5A 3H4JA 5C9CA 1XO2B 3KRRA 4YJSA 4QQTA 3PG3A 2PVLA 4XMOA 3ZUTA 3HDMA 4FSYA 1WBSA 3IDBA 5KNJA 1ZXEA 4G3EA 4NM3A 3TTIA 4D4VA 2GHMA 4XCUA 3ZEPA 2JBPA 4F65A 5JSMA 3JPVA 5KMMA 5AIRA 1VYWA 3C50A 4IACA 1W84A 5AAEA 3R7UA 4QPSA 1OPLA 3HDNA 4WSYA 5KCVA 3QC9A 1M17A 2OJ9A 4YJNA 1H1SA 4C4IA 4AQKA 1ZYLA 3O2MA 3ZRLA 1W8CA 2J0LA 3CP9A 4FSMA 5LWMA 3N4UA 3EN6A 2UVYA 4TPTA 1B6CB 4UEUA 4V0GA 1SVGA 3CQUA 3H10A 3ZS5A 1PXOA 5M09A 1MUOA 3RTPA 3LQ5A 5C8KA 4L46A 4WRGA 3PRFA 4AXDA 4CMUA 3HVCA 2PZYA 4J97A 1G8KA 3UG2A 3BE2A 5EYMA 3UPXA 1W2DA 4GUEA 2RL5A 3LE6A 4Y95A 2A1AB 5BYLA 4PL3A 4K1BA 2J0MB 2G2IA 4X2NA 4OW8A 4ZMFA 1Q5KA 4J7BA 4WSQA 3FYJX 3EWHA 2Z7RA 3Q32A 3VJNA 4G6NA 5FBNC 3D2KA 4K11A 2PUUA 3OW4A 4QQ5A 3O51A 5M53A 3R21A 2X9FA 5BUIA 2IEWA 1ZZ2A 2ETKA 2WELA 4F9WA 2IW6A 4MXYA 1A9UA 3R7VA 2PU8A 4IJPA 2ITQA 2R0IA 4WKQA 3QX4A 3MVLA 2GU8A 4WNMA 4TKSA 4XRLA 4C7TA 2QLUA 5DEYA 5KUPA 3FLWA 4TYHB 1V0PA 2UZLA 4PUZA 4EH5A 5IDNA 3OOMA 3KN5A 1UNLA 4ASEA 1Q3DA 4ZY5A 5KO1A 3ZUVA 2J90A 4FV1A 4ASXA 4BRXA 1QPEA 4FEWA 3PFQA 2CCIA 2BZKB 2UW7A 3PDTA 4W4YA 3R02A 1MRUA 4YTFA 5KMIA 3R73A 4H3BA 4ZJVA 3HZTA 3LFSA 2Z7SA 4FL1A 1M7QA 4GW8A 2XEYA 2CPKE 3WZJA 4YU2A 4JQEA 4O1OA 3C9WA 1WBOA 2PSQA 3E8NA 4TYGA 5DRDA 4Z3VA 4S30A 5I9WA 1ZMUA 2HZ0A 4E4NA 1FGKA 3SXFA 2YDJA 3MPTA 3BHHA 5JZNA 5JH6A 2VWIA 4QEBA 4JDKA 4L7SA 4ZK5A 1GIJA 4Y83A 3TZMA 4EH9A 3QTWA 1H00A 5CT7A 4YP8A 3RP9A 4QMUA 4EOJA 5HU9A 4FKQA 1RE8A 3MBLA 3OROA 3ORPA 4JR7A 3RPRA 4QYEA 3ZSIA 5BVDA 4Z9LA 3W2QA 1BX6A 5JK3A 5GZAA 4CYJA 1PMUA 2XIYA 3FPMA 3FLNC 4R77A 2WOUA 4M14A 5CEKA 4M13A 2X0GA 3P08A 2A4LA 1E1VA 3ALNA 4UMRA 3TCPA 3ZC6A 5J9ZA 4QP4A 3I4BA 4G3GA 4MD8E 2LGCA 4JS8A 3TL8A 2CMWA 4UBAA 5JRQA 2ITUA 3GUBA 5AM7A 3ZHPC 4IX6A 3BQCA 4NFMA 3FY0A 3G0EA 4DF3A 1B38A 3POZA 2R3GA 3PZEA 4CNHA 3OC1A 3IG7A 4JRVA 3OCBA 4QMQA 3VUTA 2OZOA 2WU6A 1VZOA 1QPDA 1OUKA 1MP8A 2ESMA 3QRUA 3P5JC 1ZAOA 4KIKA 4F0GA 4IVCA 3BU6A 3H0YA 3NUSA 4S33A 4XNEA 3R9NA 3OBGA 4D2VA 1JVPP 3DK7A 5HNBA 1O6LA 4EH4A 3ZO1A 5HICA 3QQKA 2PE1A 4FKVA 4J95A 5ACBC 5A4LA 4XEYA 4C59A 4I5CA 4F7JA 5AAGA 3TZ9A 1DAYA 4P90A 2WQNA 1ZOEA 4X7QA 3MY0A 5JMSA 1DAWA 2IW8A 5L2SA 3R2YA 5EFQA 4IADA 2H34A 3EQRA 2F9GA 5CVFA 4PPCA 4O22A 4GT4A 1OGUA 2XNOA 3QQGA 2X81A 4EHEA 4Q5EA 1YXUA 2RG5A 4KAOA 4DGOA 3PXQA 3RK5A 2J0IA 4QP6A 1Q8TA 3E62A 2FVDA 4IZ5A 5IDPA 3QTSA 3DNDA 2HZNA 4MBIA 4XOYA 4USDA 4D2TA 3W8QA 1E1XA 4YLKA 1TQPA 3LMHA 3GU4A 3UO5A 4RX8A 3W2SA 3GB2A 4RFZA 3QWJA 3C4FA 3FMNA 3SG9A 1H27A 3LJ1A 5FDPA 3FHIA 4IB3A 4GYGA 4ZSLA 1OUYA 1OL7A 4JVGA 4ZSJA 4NCTA 4YTIA 2WTIA 2RFSA 1T46A 3PIYA 2NP8A 3GFWA 4FKTA 2OJJA 3ODYX 1WBNA 3R1SA 4FV2A 5HESA 3PYYA 2OBJA 4FZAB 4AUAA 3QKMA 3OY1A 3R8ZA 3COMA 2ZB0A 1UVRA 3OBJA 4X0MA 3E63A 5ACKA 4HCTA 3WZEA 5HORA 5JKGA 3NAXA 3VHEA 2QG7A 2WTDA 5EHOA 2VZ6A 3MJ1A 2QOHA 5J9LA 3FSFA 4BL1A 1GIHA 1H26A 3Q96A 4NFNA 2BDJA 4E20A 3UOLA 4EKKA 5IUGA 5M06A 4N4SA 4IAZA 4EEVA 3WOWA 3R1QA 1Y8GA 4O7VA 2C1BA 2YWPA 4QMWA 4AE9A 3A8WA 3FE3A 1UWHA 3HRBA 5CEPA 3PA3A 1BKXA 2VWBA 4HGEA 3TN8A 2VO0A 4FODA 2CLXA 4EI4A 4EZ3A 3KL8A 2PK9A 4AT5A 5C01A 1M2QA 4WD5A 3NUXA 5IISA 2ZV2A 5JQ5A 5JT2A 3L9NA 5EQYA 4R5YA 5I3RA 2WMTA 3E8EA 5H2UA 1SVEA 3EIDA 3QCXA 4RZVA 3DY7A 3OY3A 4RJ3A 5IA2A 3LFNA 2I6LA 2HXQA 3LM0A 1REKA 2G9XA 4WG5A 4XP0A 3EN5A 5HO6A 3PPJA 4WRSA 3PUFC 3Q60A 3PWDA 4B4LA 1DM2A 4DC2A 4XOZA 4ERKA 5ANEA 5AUXA 1JNKA 1S9IA 4O7YA 1GIIA 4OAUC 2IVVA 2FB8A 4RJ5A 2R7IA 3BYUA 2Q83A 2PMLX 2R3HA 2O2UA 5EDQA 2WO6A 3PJ1A 5M4FA 5DIAA 3EFWA 2BDFA 2XNNA 4L43A 4PDSA 4RJ8A 3A99A 3U54A 3TV7A 2I0YA 3HV6A 1ZARA 1YDSE 4AXEA 3NUNA 1H24A 3W0PA 5M57A 4FI1A 4YJPA 3UNKA 3EL8A 4K18A 5IQDA 2VWYA 2OKRA 5AP4A 4LOQA 5BVWA 4BWXA 4C2VA 3NNUA 3KRXA 1OECA 4V04A 3DAKA 3QTRA 4FZ6A 4UN0C 3QUPA 3LQ8A 3BLQA 4B6LA 3D0EA 3VIDA 5DI1A 2W7XA 2R3RA 3CLYA 1GAGA 4IB0A 3EQCA 5HG9A 5CU0A 3UMWA 4ANSA 2OH4A 3DA6A 4YZMA 3PVUA 3NS9A 5G6VA 2AEGA 4R78A 2YJSA 4F1TA 3QZHA 4QP3A 4UZHA 3P9JA 2XALA 2UZOA 2OFVA 3SD0A 2J51A 5A4TA 2W1ZA 4EK6A 1QL6A 1Y57A 4AW0A 4BCNA 2WNTA 5EI2A 1RDQE 1AD5A 2XCHA 5HIDA 3SAYA 2XAMA 1LEZA 4GEOA 5JGAA 2PY3A 3LFEA 5AUVA 4GSBA 5IA5A 4UV0A 1R0EA 3LOKA 4O0XA 3V5PA 3OMVA 4QYFA 5EI8A 5HHWA 2JFMA 3R1YA 4X2FA 5E8WA 3C0IA 3RKBA 4O7WA 3MVMA 1HOWA 3UMXA 3RZBA 1ZMVA 2V7OA 2XJ2A 5HKMA 1REJA 4MTAA 2VTIA 5KMOA 2UVXA 2OLCA 4FSUA 1NVQA 2J50A 4L42A 4H05A 2C6DA 4FIGA 3FXXA 4NW5A 4W4VA 2OIBA 5AP5A 4PV0A 3LFBA 2B1PA 1UKIA 4U41A 2FSOX 3LHJA 1L3RE 2B52A 5CSVA 4BC6A 3D5XA 3P7AA 4WA9A 5D1JA 4ZS4A 4BI0A 2RFNA 1YOLA 3LAUA 3R6XA 3BHTA 2XIXA 1WZYA 2YCRA 1P14A 3JY9A 4I5HA 2BAQA 4RIOA 3O23A 5GJGA 2H96A 4CQEA 3ACJA 1QCFA 4RQKA 3KC3A 3S00A 2W1CA 2G2FA 3K5VA 4IC7A 1H1PA 5C8NA 5J7BA 1R3CA 4FSWA 4MNFA 1PXIA 3EHAA 4ZY4A 2HAKA 3I6WA 3TUCA 4FG7A 4QMTA 5IEYA 4FV8A 4NW6A 4YGAA 3I0QA 1PXNA 3LCSA 3PIZA 4FYOA 4XHKB 3GNIB 1WVYA 3IS5A 2XKEA 3T9IA 3UYTA 3D83A 4B0GA 3KVXA 3MB6A 4ZOGA 3MFSA 4KBKA 4CFWA 2BIKB 4U40A 4R7BA 3DXQA 3H9OA 2GDOA 4FEXA 1BYGA 3LPBA 3ALOA 2JEDA 1FGIA 1H1QA 4R8QA 4LV5A 4CCUA 5IZFA 5EM8A 4JBVA 2R3MA 4BVUA 5L2WA 2XKDA 4E93A 4C4JA 3LFFA 5TE0A 4BDDA 2CCHA 5LWNA 3OF0A 4KWPA 1GZKA 3R00A 4XRJA 4MQ1A 5LJJA 2A98A 3A62A 1XJDA 2EWAA 1P4OA 4QOXA 4BIBA 5GIPE 1FVVA 4AGCA 2QVSE 4ANQA 5BVKA 4KB8A 3F2AA 4YC6A 4F9AA 2AUHA 1R1WA 4DDGA 3ODZX 4F1OA 2OIDA 4X3FA 3DFCB 3F88A 2UZWE 5DVRA 4C4GA 4AXCA 5D11A 3MY5A 4BIEA 3R1NA 4OT6A 2Z2WA 4Y46A 5L8KA 4EHZA 4YPDA 2SRCA 2R3LA 2JKOA 3A4PA 3DTWA 5CYIA 2YERA 3OUKA 1J1BA 4YO6A 3V04A 4IWQA 4D1XA 2H9VA 3OXZA 2WAJA 1U59A 4FV3A 4HGLA 4D4YA 3F69A 5CSWA 3MW1A 5AUZA 2IVUA 1IA9A 4XYFA 3ZLXA 5HVYA 4DTBA 4PDOA 4C02A 4X2GA 1JBPE 3OHTA 1PXMA 4UB7A 3CE3A 2VTAA 3SOAA 1OPJA 2ITOA 1QPJA 3VBQA 4J8MA 4AGDA 2UW0A 3OCTA 4RC3A 2XNPA 2VGPA 4RT7A 2E9VA 3EZVA 3MJ2A 4O7ZA 4EH2A 4Y5QA 2VD5A 3C4XA 3R9HA 4BCQA 1PW2A 2KULA 3A7IA 3EN9A 3F3UA 1G8AA 3RBWA 2UVZA 3UQGA 4Z55A 1ZMWA 5F94A 3ZDUA 4HYSA 2R3FA 2WIPA 4GVAA 2R64A 4KSPA 4FKWA 4APPA 3FI2A 1XH6A 2GNIA 4BF2A 4NZWB 4DEIA 2O3PA 1CDKA 3KA0A 4FTAA 1U5QA 3QQUA 4ZTHA 5IQAA 5BVNA 1ZY4A 3LXPA 4FKPA 4RIXA 4DEEA 4LMUA 5DT3A 3QA0A 4HW7A 1H28A 5IQCA 4O0WA 2FH9A 4WNPA 4F1MA 1O6YA 3G90X 1T45A 5HX8A 2X6DA 2YCSA 4IX4A 2P2HA 3DB8A 3NNWA 3IDCA 4C4HA 5BMMA 1G8JA 3DDPA 4FV7A 4EOKA 2PVJA 2XA4A 2YIQA 1V0BA 2YM7A 3DQWA 3I7CA 4BCMA 3BI6A 3CTJA 4QNYA 5AP0A 4MXXA 4W4XA 4HNIA 3W0RA 3ITZA 1TZDA 3NLBA 1J7LA 4WNOA 4BBEA 3DAEA 3VQHA 3GCSA 2WTCA 3C5UA 3D4QA 2XIRA 1LR4A 4IH8A 1K9AA 4E6AA 2ZMDA 3MB7A 4ACMA 3NIZA 1XH9A 3OTVA 5JN2A 4I5PA 4YJTA 2ZM3A 2FGIA 2V62A 3B2TA 4DEBA 3R63A 2OJIA 3AG9A 4MXZA 3ZSGA 3KKVA 4LQMA 2X0OA 3W0MA 4TL0A 4M84A 5ITAA 1Q24A 3AKJA 4PNKA 3IPHA 3IGGA 5BQ0A 4G9CA 3R2BA 5BYZA 1ZWSA 3KXNA 3EN4A 4JG6A 1TVOA 4IZ7A 3R7YA 3LW0A 4DLJA 1K2PA 2YDIA 2P3GX 4D1ZA 2YCFA 4W9WA 1R78A 3RK9A 4C35A 3EQPA 4DH8A 2JDTA 2BZJA 3D9VA 4FIIA 1VEBA 5B0XA 4ALVA 5CNNA 2WHBA 4PY1A 3V01A 1K3AA 4DGLC 4EJ7A 2NO3A 5FBOA 1XH5A 2YAKA 1PYXA 3EQIA 3FHRA 2AQXA 2WQBA 4PF4A 4QTDA 2UZDA 4OLIA 5E92A 4BGHA 4GK4A 3TKHA 3OS3A 2FSMX 3EKKA 4IB5A 3G6HA 4P5QA 4GUBA 3EQDA 4RC4A 4AXAA 3EMGA 2ZOQA 4A7CA 4CMOA 4YURA 3SGCA 1YKRA 3NWWA 4GFOA 4FSTA 4RWJA 1SNXA 3DKGA 3VRYA 1YDTE 2QU5A 4AG8A 4CZUA 3AC3A 3GQLA 4TZRA 2W1EA 2BALA 3Q9XA 1G3NA 1YXVA 4FSQA 1KOAA 5DEWA 1MRVA 1YXXA 4KKHA 5T68A 1HCLA 2PYWA 5KZIA 3KEXA 1JWHA 1X8BA 2XAOA 4FV9A 3UOKA 3MSSA 3QKLA 1NA7A 4ENXA 3C4CA 2I0EA 1XHAA 1PF8A 2WMQA 5DR6A 3N9XA 4AU8A 4FK3A 1OZ1A 3HP2A 3NAYA 1PYEA 2XK9A 3KY2A 4JDJA 4UYNA 5DLSA 4X2KA 4C8BA 5IEXA 1ST4A 4JI9A 4F9BA 4FJVA 5AR8A 3KMMA 1YVJA 2ERKA 3QD2B 3ACKA 4CSVA 2W4KA 1OKYA 4IVAA 5DE2A 2QOBA 4NCTC 5CNOA 1P5EA 2HZ4A 2P2IA 3LFCA 3OT3A 5TT7A 4CT1A 1U46A 4JAJA 2W1IA 3U87A 2R0UA 3CKWA 3N51A 1PXLA 4HCVA 5GZ8A 5EOBA 1XMMA 4PP9A 3TNQB 3MH2A 4OTIA 3ORZA 4MXCA 3KN6A 1Q61A 4YJQA 3F82A 2BUJA 4PMPA 4AOTA 3PZHA 2O64A 3FBVA 4R1YA 3ID6C 3Q4UA 3QQHA 4ZTSA 3WZUA 4CG8A 4D0XA 5FWKK 4L67A 2JIVA 3TUBA 5J1VA 2VX1A 2B54A 5FGKA 3QBNA 2X4FA 5HG8A 4BDAA 2ZDUA 2BTRA 3S4QA 5CANA 3FC1X 5IQIA 2ZAZA 3NNVA 4TWOA 1XH7A 5A4QA 3FMDA 4NT4A 2IZRA 4MXAA 2B55A 1R0PA 4O0VA 4HNFA 4QMPA 5CS6A 3FYKX 4QYYA 4EBWA 2PMOX 2JAMA 4EJNA 2CKEA 2OXXA 4QYHA 4UXLA 4G6OA 2W06A 4UZDA 3FI3A 4CG9A 3NCGA 2CKQA 2C3JA 2BRHA 5BX0A 2XS0A 3FMJA 3UG1A 5LVNA 4FZ7A 2OH0E 4I4EA 4B7TA 3F2RA 3BYOA 2HWOA 3KXMA 5CXZA 4YPSA 5IQBA 3ET7A 3R28A 1STCE 4GIIA 5E8TA 3K54A 4HPTE 5E7RA 4E5AX 4TNDA 3UIXA 4AA5A 3W2RA 1FBNA 3FMEA 2Y4IB 1FVRA 3MY1A 4J71A 4AA4A 5L2TA 3FI4A 3C7QA 2Z7QA 3EYGA 2B9FA 4FT3A 3FZRA 4LOOA 3OVVA 1FMOE 4KKGA 4QTCA 3WARA 4X3JA 4ZSGA 5D9HA 1EH4A 4EOSA 5EKOA 2PZ5A 2RFEA 3C4ZA 3II5A 3RZFA 2I1MA 1KSWA 3HGKA 5HD7A 3S2PA 2R4BA 4L45A 5HE2A 5HI2A 2Q0NA 4MNEB 2ZM1A 5T6KA 1VR2A 4JDIA 3DFAA 3GEQA 4HGSA 5AR4A 4MWIA 4JG7A 3TT0A 5L6OA 3WZKA 5AR3A 2UZNA 4J98A 3EYHA 1YHSA 5GHVA 3D14A 2WMSA 2X2LA 3MS9A 2NRYA 2WGJA 3LFDA 4FVQA 4FKJA 4JR3A 4U5JA 3UZTA 1JSTA 2JGZA 3QZIA 4JBQA 3LXLA 3NUPA 3PJ3A 4YUQA 3P4KA 5EM6A 2IZTA 2IZSA 3HP5A 1JAMA 3QYWA 3BGPA 4NK9A 3VS1A 1H07A 4FVPA 3NCZA 2E9NA 4JDHA 3T8OA 3Q53A 1ZYJA 3W2PA 2F2UA 3AC2A 2JLDA 1XKKA 3F5GA 3P0MA 4BDHA 3IECA 2BRMA 1Y6AA 3MH1A 4RWIA 4FIFA 3TXOA 5LMKA 3NYOA 1F0QA 1NY3A 4GL9A 2IN6A 4QMMA 3D7ZA 1OIRA 3UNJA 3HAVA 5E1EA 2UW6A 3FJQE 5CX9A 1BI8A 2CHLA 2ONLC 4NM5A 2EU9A 3KCKA 3H0ZA 2X0QA 3VUKA 4C2WA 1XMLA 5IA1A 5AX9A 4GT3A 3O96A 4WIHA 2CNVA 2HXLA 2PVRA 2IPXA 5DBXA 3NIEA 3D5VA 4DEAA 4LDTA 4WBOA 1BLXA 2VTSA 2GNLA 4IFGA 4KRCA 3G2FA 4Y8DA 4UMTA 2JD5A 3Q2JA 3DOGA 3VS2A 2JDSA 4ERWA 4K77A 5LMBA 1TQIA 3H30A 1JSVA 2OG8A 4PTCA 3PXZA 3VS5A 3R9OA 4FT7A 2C3IB 5AP6A 4YHFA 3KK8A 4RX7A 4UWCA 4DN5A 3NNXA 3VAPA 1KE8A 2P4IA 3MTFA 2ZDTA 4IQ6A 3HV5A 2QOFA 4RA4A 2C5OA 4AFJA 3G9NA 2IWIA 2PE2A 4GU6A 4RC2A 4LGGA 4XG3A 4O4EA 1NXKA 2C6LA 3GC0A 4I1ZA 5FXRA 5HTIA 3A7FA 1SZMA 4IIRA 5HO7A 3ERKA 4V0GB 5LVLA 3N4TA 4ZZNA 3SLSA 3BEAA 4L01A 3UO6A 2CNUA 4C0TA 4PX6A 3OWKA 3F5UA 4C38A 4GRBA 5CEOA 2CKOA 3P79A 2QG5A 1XBBA 2WEIA 2VTLA 4FTTA 1U54B 5CSXA 2YFXA 3MIAA 3RNIA 2XYUA 1ZOHA 2OGVA 4D4RA 3E3BX 3M42A 3EL7A 3UC4A 2B0QA 1S9JA 4O2PA 3E7VA 4IZAA 3M1SA 4L52A 1H08A 4FT0A 3ZO4A 4JX7A 4XG6A 2C3KA 5L8LA 3GC8A 5ANIA 4DFZE 2FSLX 3U51A 3SHEA 4IAAA 3UVQA 3TV6A 1XBCA 4BI1A 2O0UA 2QR7A 4ANBA 1WVXA 4DFYA 4BBFA 3BX5A 5IG1A 4DT9A 2YM3A 1G5SA 4R7IA 1UA2A 2PVNA 3V5QA 3P78A 3PTGA 4O86A 4DE4A 4HVDA 4O0YA 2CN5A 4FTUA 3RAHA 4F7NA 3W0OA 3DTCA 4S31A 4UMQA 5HIEA 4RQVA 3SRVB 3TV4A 4LRJA 4AWIA 2C6TA 2VGOA 3QQFA 4FSNA 5HG5A 3S1HA 3COHA 1F5QA 4AE6A 4ALWA 4IANA 1WMKA 4KIPA 3V5LA 4TXCA 3GU7A 5A46A 5C4KA 2V55A 2PUIA 4WT6A 2PVKA 1IEPA 4DHIB 3TWJA 3HKOA 2RG6A 4XH6A 4CXAA 5HG7A 3FI8A 4BJJB 4CTCA 3IONA 3RINA 4F6WA 2B9JA 2OICA 4G3CA 4BY9E 4RA5A 1YDRE 4D5HA 1KOBA 1CTPE 3F66A 4YJRA 2XIKA 5KKRC 4GFGA 2HWPA 4XV2A 4FIJA 4U6RA 2GTMA 3C4EA 4WOVA 3RAKA 1W2FA 4KINA 5HQ0A 1H25A 1O9UA 2WTWA 3VS0A 3TM0A 4MHAA 3PSDA 3TNWA 5CVHA 2XNEA 2W4OA 3NW5A 3UP2A 3AC8A 3OEFX 3UNZA 1OI9A 2W9FB 5HCYA 4E4XA 3SG8A 4AN2A 2R3NA 4A9UA 4S32A 5AP7A 3W18A 2E9OA 1PY5A 3Q04A 2G2HA 4IVDA 3FSKA 5B2KA 4CRSA 3BYMA 3F3WA 4FF8A 5KKRB 3O71A 4DHZA 3FXZA 3G33A 3QALE 3U6HA 4O7NA 4Z7GA 4F4PA 4MD7E 1JKTA 3WILA 5FTQA 2Y9QA 1IA8A 2C5XA 2OU7A 4AF3A 2GSFA 2CGUA 5AMNA 4LUEA 1OBGA 4XG2A 1G8SA 3BEGA 4IX3A 3BWJA 2WTJA 5JFWA 3HLLA 4K9YA 4ZTLA 3K2LA 3KQ7A 3MVHA 3VW6A 3DT1A 4FEVA 2CNQA 3P5KA 2CGWA 3FLQA 2C3LA 2XYNA 4D2SA 4G6LA 4MF1A 5E8VA 4XJ0A