2V5QA

Crystal structure of wild-type plk-1 kinase domain in complex with a selective darpin
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
285
structure length
285
Chain Sequence
EIPEVLVDPRSRRRYVRGRFLGKGGFAKCFEISDADTKEVFAGKIVPKSLLLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVLELCRRRSLLELHKRRKALTEPEARYYLRQIVLGCQYLHRNRVIHRDLKLGNLFLNEDLEVKIGDFGLATKVEYDGERKKTLCGTPNYIAPEVLSKKGHSFEVDVWSIGCIMYTLLVGKPPFETSCLKETYLRIKKNEYSIPKHINPVAASLIQKMLQTDPTARPTINELLNDEFFTSGYIPARLPITCLTIPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE PLK1
publication title Structure of wild-type Plk-1 kinase domain in complex with a selective DARPin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 83
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature ec 2.7.11.21: Polo kinase.
pdb deposition date 2007-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2v5qA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2v5qA01
2AC5A 2BHHA 3HV7A 1XKKA 1YWVA 3F6XA 3FL5A 4TYJA 4FIIA 4TT7A 2WHBA 3KMWA 3UJGA 3M42A 4JG6A 5C03A 1UKIA 2UW7A 2YDJA 4PDPA 2VWIA 4TW9A 4IVDA 4OBQA 2F2UA 3QC9A 3DB6A 2JBOA 4FTUA 3PXRA 1K2PA 4IANA 3PJ3A 2ZB1A 4EQUA 2UZTA 3NLBA 4IVAA 1TQMA 3N4TA 2O65A 2ZV2A 2OU7A 1GJOA 3MH3A 3C13A 4FV8A 2WMXA 1VR2A 5EOBA 3NUXA 2GFCA 4N0SA 4E7WA 5C01A 3IPHA 4I24A 4WO5A 3FEGA 5I0BA 2JDRA 3PZEA 4M67A 3SW7A 4FEVA 1KWPA 3R9DA 4AN2A 5GIOE 3G5DA 5DLSA 3FZPA 3ZS5A 3LFSA 3KVXA 3IQ7A 3QLGA 4UALA 1V1KA 2OF2A 3QQGA 5BUIA 3QUEA 3V5LA 5AV0A 2BFXA 3W32A 1AGWA 3Q32A 1OVEA 4FUYA 1CKJA 5D11A 4EHGA 3F2NA 3ZTXA 5HTIA 2B1PA 5DEWA 5K4IA 3NW6A 4D0XA 1ZYSA 3TNHA 2BZJA 5FTGA 1WBTA 5I3RA 5LMKC 2WGJA 3S0OA 1Z57A 2PVJA 3ALNA 4Z3VA 4CCBA 3KCKA 2Z02A 2QG5A 2PVLA 5F1ZA 4GT5A 5IA3A 5KZIA 2I0EA 5BUJA 4BVUA 4TWCA 3QGWA 4ZTRA 4W8EA 4EZ3A 3ZO4A 4NIFA 4QTBA 4DFXE 1JKLA 2YZAA 3C7QA 4HYUA 3ZCLA 5HE3A 1ZMVA 3AGLA 3NYOA 3ZFXA 5J5SA 5J9LA 5E8XA 2NRYA 4H36A 3ATSA 4A07A 3IK3A 4GFOA 3RZBA 2JGZA 3NUSA 4XOZA 4WRSA 3MY1A 5HG8A 3UYSA 3RK5A 1JKSA 3ZRKA 2QOCA 2HK5A 3LXNA 2W1HA 1XJDA 1YDSE 1CTPE 1BLXA 2NRUA 3OD6X 1PF8A 1ZXEA 3NW7A 4K8AA 4U45A 3CQUA 5KO1A 3EQPA 4GU6A 5EI6A 3PXFA 3AC1A 2XIZA 4W4VA 1P14A 4YJRA 4MXXA 4LYNA 4QMOA 4RQKA 2R3KA 4KBKA 5EKOA 2XCKA 4CZYB 2ITVA 5AFVA 4LL0A 3V6RA 4CT1A 5M09A 2C6TA 3FC2A 3SOCA 4O21A 5FXSA 1BX6A 2FSOX 3BZ3A 5HE0A 3KRJA 5CVGA 5HZNA 3QD2B 4W9WA 3RAWA 3LMGA 3LKMA 1DAYA 2R7BA 2VX1A 4F1TA 1UV5A 3NZ0A 3HMMA 4U81A 1X8BA 5HU3A 4N70A 3ODZX 4YBJA 2BAJA 2WMUA 1QMZA 2I0VA 2PY3A 2WMTA 3DLSA 3EHAA 4C4GA 4E4NA 4NKSA 3CQWA 4CQEA 3E8EA 1H0VA 2W1DA 3OROA 4ZSGA 4YMJA 1QPCA 1ZY4A 2YFXA 1UU7A 3OOMA 3QCQA 4DBNA 3NUUA 3KGAA 4DEEA 1H24A 2WTDA 3NUYA 3MIYA 2GS2A 3ZUTA 4UMTA 2X8DA 4A9RA 3DJ7A 3CSVA 4IJPA 4IVCA 3TTJA 5DVRA 4FKVA 1OPJA 1H08A 2XM9A 2WEIA 3K2LA 1YI6A 3PIZA 4IXPA 1UWJA 2YERA 3E8NA 4MD8E 4UWYA 4XG2A 4IMYA 5HNBA 4KKGA 2IVVA 4DFUA 5C4KA 3PPKA 2CCHA 3ANRA 4FL3A 4E5WA 3EQRA 3THBA 5LVMA 5GJFA 4I5PA 4BCPA 5A4TA 3TG1A 1IR3A 2VN9A 1IASA 1YOLA 5CZHA 3F7WA 4PV0A 4E20A 1XQZA 2HZ4A 3GCQA 3NAYA 2XKFA 3EN5A 3Q60A 4FVPA 3TCPA 3VUGA 4AE9A 2XIXA 2IN6A 1W84A 5AM6A 3PZHA 5CU4A 2I1MA 4GSBA 1IG1A 5EM8A 4EOQA 4KKHA 5IZFA 4XRJA 5L6OA 5CEIA 5J87A 1BI8A 2JFLA 4LRJA 4JQ7A 2J7TA 4S30A 4WSQA 5HX6A 3W10A 2X4ZA 5LCJA 5FXRA 4XG4A 5GINE 4FEQA 3FY0A 4PWNA 4PX6A 4ZIMA 4G2FA 5JEBA 5CVFA 3KREA 3UE4A 2VX3A 4RIWA 4ZLOA 2ZM4A 4EHZA 4NTSA 2GMXA 2UZWE 5IA5A 4BDCA 3MJ1A 4LOPA 3FXWA 3W1FA 3ZSIA 1H1RA 4HGSA 3RAKA 5J5TA 2CCIA 4LI5A 4CNHA 5IQBA 3PPJA 4EH7A 4YSMA 3ZSGA 4WUAA 4KWPA 2R3JA 3OCGA 5HLWA 3O8UA 2JDSA 3S3IA 1UU9A 1YXXA 2ZDUA 3G6GA 3ZUVA 4P4CA 3UPZA 4FV4A 5KNJA 1UNHA 2ITNA 2P4IA 2W1IA 3PXYA 3ERKA 1GZOA 4ITJA 1EH4A 2VRXA 3P7AA 3QBNA 3RPSA 4EHEA 5BVDA 2VTTA 4DFZE 4FG8A 4RX8A 2BZHB 3NR9A 3QZHA 2EVAA 3I5ZA 2OWBA 4TTHB 4UYNA 3R7UA 3ALOA 2QKRA 4N6ZA 2PULA 3DY7A 1H1QA 1STCE 4AA0A 2UW6A 3DAEA 1ZY5A 4NFNA 2PWLA 2PZ5A 3R04A 5CALA 3TKUA 3LPBA 1VEBA 3BBWA 2X6DA 5EHOA 5JFWA 2O8YA 2XBJA 3G9LX 4O82A 4FR4A 1I09A 3RCJA 3D15A 3UQFA 3OCTA 2GCDA 3CY2A 3VBXA 5EH0A 3NIZA 3GI3A 5F20A 4FYNA 3AMYA 2RFEA 3LFDA 5DPVA 4ANNA 3QTXA 1SZMA 3BQCA 3N4UA 1PMNA 4EJ7A 4E4XA 3R9RA 4FEWA 2ZOQA 4CCUA 5AWMA 2C3LA 3PDTA 2OI4X 2ZMDA 4D4SA 2C6LA 4M14A 5FUTA 4CLIA 5KMNA 4B8LA 1JSTA 2ZV9A 5EW3A 3WF8A 3DFAA 2ETKA 4DFNA 2WQMA 4PDOA 4DGGA 4F6WA 5KUPA 3IGGA 2WEVA 3C51A 4CLJA 5IF1A 2VZ6A 3UYTA 3LZBA 2IVSA 3FKNA 1WBSA 3PA3A 4O0UA 5AR5A 3ZOSA 1JSVA 4TPTA 5CNNA 4EC9A 3EIDA 4YNOA 3AOXA 3E8DA 3OS3A 2XK9A 3ZSHA 4ZY4A 4BZOA 3HA6A 2VWZA 3F3WA 2GS6A 2VO3A 3FXXA 4HYSA 4GUEA 4BTKA 1MQ4A 5DT3A 4C4IA 2BPMA 3DK6A 4W8DA 2VTNA 1ZYCA 4HVDA 4KA3A 5I5ZA 2XVDA 4YC8A 4O7LA 5EFQA 5HD7A 3P79A 1CMKE 2CDZA 2OJGA 2OICA 1KE6A 4FBXA 3E3PA 3QD0A 4RIOA 4RQVA 3A7HA 3HP5A 4IC8A 4BDJA 4IQ6A 4V01A 1GZ8A 4AZSA 4AZFA 1H1WA 2WNTA 3UVPA 5HIDA 4U3YA 5IH6A 4WNMA 4JXFA 5TR6A 4CFNA 3UTOA 3T9TA 1PKGA 2PVMA 3IO7A 4BI0A 3LQ3A 2WPAA 3A99A 2V22A 4HJOA 3TTIA 3UG2A 4EK3A 3C5IA 5TO8A 2E9VA 3R7GA 5AX9A 1FQ1B 2WZJA 5AX3A 3POZA 4KIKB 5T68A 4U8ZA 4BI2A 4DGLC 5E8UA 2ZYBA 2OGVA 5CEKA 3LCKA 5C4LA 3E7OA 3ODYX 5D7VA 3EQIA 4CRLA 4GYIA 5TOZA 3D83A 4FC0A 1B39A 2YISA 4PNKA 5JK3A 3HX4A 2PYWA 3R8LA 5KBRA 4IACA 3LCTA 3TNPC 4BN1A 1WMKA 4MF0A 4QQTA 1RDQE 2I0YA 4O22A 1XHAA 5FEEA 4WG4A 2UW9A 4FIJA 3OUNB 4F99A 3TN8A 4ZTMA 1XWSA 5BUEA 1JBPE 4GFGA 4GK2A 3BCEA 2YM8A 4U40A 3NIEA 4G9CA 3QXPA 1R78A 4KSPA 5BNJA 3AT4A 3WF6A 2F9GA 4IZAA 3JUHA 3NX8A 3HRCA 4I41A 3R1SA 4OUCA 2C4GA 2VAGA 3CJFA 4L53A 4PY1A 5DR2A 4AGDA 4O86A 4BC6A 3GEQA 3U4WA 3A8XA 4KB8A 4NJDA 3RPRA 1M7NA 3MW1A 1YHVA 4WSYA 2C5YA 4IAKA 4MF1A 5ACKA 2UUEA 4PL3A 4BCKA 5L2QA 3H9RA 4RA5A 2IZUA 3FHRA 4FUXA 4E3CA 5KMJA 1PXJA 2HW6A 3BELA 3WF7A 3DTCA 4OT6A 3UP7A 4XG9A 5CAOA 5KMLA 4YO6A 2BUJA 5J95A 1L8TA 3R28A 4FSUA 2P2IA 5A3XA 3ATTA 2ONLA 1LR4A 3DBDA 4J95A 3MVJA 3OP5A 4P5ZA 2WQEA 2PMIA 3VO3A 1O6YA 4ANOA 2PMLX 2YLFA 4P90A 4QD6A 1WVWA 3DKOA 3RNIA 5K5NA 1XBAA 4DCAA 4AW1A 2B9HA 3NPCA 3PE1A 5TE0A 5KKRC 4S34A 2C6IA 4KKEA 1GZNA 4WNOA 3ZH8A 4BRXA 4CSVA 3DAKA 4EBVA 2QOKA 3UOKA 3DKGA 1ERKA 3TDWA 4GG5A 2XIKA 2FGIA 1IEPA 3K5VA 2R3RA 2VNWA 5HTBA 4IAYA 5EI8A 2PZIA 2YDKA 3OWPA 2R0IA 2CKOA 2X2MA 3A4OX 4FKIA 2ERZE 3CBLA 4GUBA 3VUMA 5JKGA 1W8CA 4CFWA 1G5SA 2H8HA 2X0GA 4ZSAA 5J1VA 3Q9YA 3DKFA 2BRHA 1NT2A 3GNIB 4GVJA 2BRBA 4IADA 4BDAA 4BWXA 2XF0A 3Q9XA 4MXOA 4FSTA 5HCYA 3DZOA 3KQ7A 4IZ5A 5DI1A 4C58A 4EHVA 4PTEA 4F0GA 2BKKA 5BYZA 2J0IA 2VWWA 3QYZA 3HP2A 4MWIA 5D10A 3L9PA 4EONA 5CSXA 3L8XA 4KNBA 3QL8A 4D4YA 2A2AA 3FMHA 2O64A 4J53A 1KOBA 4OGRA 3DBFA 5BYLA 4PNIA 4FV6A 3Q52A 4UBAA 2FH9A 3OCSA 5DRBA 3WF9A 2PVRA 2BRMA 4IX3A 3RBWA 5HHWA 1PXNA 1OPLA 2J90A 5AA8A 3AGMA 3OT3A 4LGGA 4KIOA 5CEOA 2G9XA 4DH3A 2Y7JA 1HCLA 5DN3A 5GIPE 3OBJA 4HNIA 3AD4A 2FB8A 3F3ZA 5GZ8A 3KN6A 4A9TA 3W2CA 4WA9A 3HLLA 2YJSA 2J0LA 2BHEA 2VD5A 2JLDA 3Q96A 4YBKA 1KOAA 3T9IA 4F9CA 1CDKA 5HLPA 4V0GA 3D7TA 5E1EA 3GENA 5HQ0A 3I7BA 1P5EA 3DGKA 4IB1A 4WG3A 3NWWA 1Y6BA 4L67A 5H9BA 1U5QA 4ACCA 4L3PA 3ZONA 2VU3A 3HMIA 4UZHA 5ETAA 3MDYA 3R8VA 1SNXA 3MESA 1F3MC 4LGDA 4DH7A 4DYMA 5AR8A 3TIZA 1RE8A 3O50A 4RJ5A 4ZTSA 5A54A 5AV4A 4A9UA 4HVHA 3RMFA 5L2WA 4I20A 2VTLA 3PA4A 4FV0A 4YZMA 2B4SB 3AT3A 4IHPA 1M2QA 3A4PA 5CF6A 3Q9ZA 3WE4A 4ALUA 1O9UA 1Q62A 5CEQA 1SYKA 3LLAA 2QOFA 4N6YA 2ZV8A 4BDKA 4O7WA 3IW5A 2Z2WA 3CLYA 2WFYA 3RI1A 4D0WA 5J9YA 4K2RA 3ZC6A 3TKHA 4NTTA 2VWXA 4W4XA 4Y5QA 2WOTA 3TUBA 3ORTA 2WMRA 3QFVA 2R3HA 4AE6A 3UO4A 3JY9A 2FYSA 3IDPA 2ZM3A 3ORIA 3QWKA 3D0EA 4EORA 3FC1X 4TKSA 3ITZA 4CKIA 4YU2A 4Z7GA 1PXLA 1BYGA 2X2KA 3MY0A 1GZKA 2YLEA 4G3CA 4HCTA 3ZM9A 5AJQA 2C5NA 5KHXA 4APPA 3LHJA 1P2AA 4GIHA 1PXMA 4AZEA 4BCJA 2RGPA 4O7RA 1JKTA 2UW8A 3VNTA 5C26A 3PA5A 5C9CA 1MP8A 4JG7A 3R73A 2O63A 2PVNA 5FDPA 5JFVA 2EXEA 2WELA 4X2GA 5HE1A 4EOOA 2GQSA 3WF5A 2I40A 2IZRA 4M3QA 4R78A 1WBPA 4B8MA 1M2PA 3BGZA 4NM3A 5IG1A 3R71A 3IOKA 2R7IA 1V0BA 4BCFA 4D2WA 4MBIA 2ZB0A 2VWBA 2IZTA 4OT5A 4IM3A 1FVVA 2RSVA 4IZ7A 4GKHA 5LVOA 1YXSA 1MUOA 3LCSA 1R0PA 2RFSA 4LMUA 3T3UA 4AXAA 2BDFA 3MSSA 2JKQA 3CJGA 3CEKA 4EH5A 2RG6A 2PUNA 1FVRA 4QTAA 3GUBA 3HECA 1Q5KA 3Q4CA 4Q9ZA 4X6QC 3WOWA 4QP6A 3LIJA 4H3QA 3F66A 2Z8CA 2ZAZA 2O3PA 3E92A 1J1BA 3HA8A 3OTVA 4IAZA 4QYGA 4UV0A 1J1CA 2UZLA 5FRIA 4AU8A 3DT1A 3KC3A 5CXHA 2GQRA 3EQBA 2OJ9A 3JY0A 4KRDA 3H9OA 1H27A 3I5NA 4BCOA 5GZAA 2CKQA 4ARKA 1IAJA 3POOA 2OF4A 3RPVA 2C5XA 5M4UA 3SVVA 1J91A 4JDHA 3MA6A 4O0YA 4D2PA 1NVRA 3B2WA 3VAPA 2JC6A 5CAUA 3FQSA 4D5KA 3AD5A 2GTMA 2H96A 4O0TA 4BTMA 4KAOA 5E92A 5FP5A 4I4FA 4R5SA 4DEAA 5F95A 2YM6A 4M0YA 1BKXA 3FXZA 5FG8A 4YPDA 4YPSA 4BI1A 3F3VA 2GNLA 2W4OA 3FDNA 4FSYA 2CSNA 4L8MA 4XMOA 2WTCA 3MVMA 3PFQA 3QCXA 3P08A 4FZ7A 4IIRA 3SOAA 3TNIA 4EKLA 5FEDA 4JAJA 2QLQA 3K3JA 2P55A 4NKAA 4QMMA 4Y5HA 3G2FA 5A9UA 4QYEA 2R9SA 2VTPA 4Y8DA 3CTHA 4KS8A 4RC2A 5BVEA 3IW6A 4FG9A 4BCGA 3FI2A 5JZJA 4X3FC 4O7TA 4YTCA 1OIRA 2GFSA 5IQFA 2R3LA 4HGEA 4U79A 4BTFA 4ZSEA 3SG9A 3FLWA 3KMUA 2OK1A 4L00A 3LXPA 5CT0A 2PU8A 4ITIA 4FTMA 4JS8A 3ROCA 3OG7A 5IA0A 2Y4IC 4NW6A 3R0TA 3BLRA 3RGFA 3F5UA 3H9FA 4X2FA 3NS9A 3PG1A 4FV9A 1FOTA 4IBMA 4L7SA 3NYVA 1Q8TA 2GS7A 1YXVA 2XNBA 3CC6A 3F82A 4LUDA 3PYYA 2WB8A 2OBJA 3HV3A 2VGPA 3BHTA 3KRLA 2UVYA 2VO7A 3FQEA 2C6DA 4LG4A 5HBJA 2HW7A 4OTWA 3A7IA 5DT0A 2ITOA 2XJ0A 4PQNA 3PIYA 3TL8A 3LQ5A 4BHNA 5A4EA 1CKPA 1PY5A 5G6VA 4XLVA 2IG7A 5ETCA 3LFFA 4QMWA 3L8VA 3A7FA 4U6RA 4ZS4A 1KV1A 4TWOA 2XKCA 3ORMA 3ZUUA 3JXWA 4OTFA 3UO5A 2W7XA 3GU7A 3ZO2A 3DV3A 4NZWB 4FKLA 5BMMA 2HYYA 2YHVA 3H0YA 4M69A 3PY3A 2I7QA 3A60A 4E93A 4F7SA 1PXOA 5IKWA 3U8WA 5M06A 3GP0A 2XK4A 5KZ0A 2PVHA 2R3FA 3F3TA 3CGFA 5E8VA 4AA4A 3PY1A 4XV1A 1HOWA 3QWJA 1Q8UA 2OIQA 3GU5A 4IWPA 4JT3A 2GDOA 3DZQA 5EK7A 3UO6A 2QU6A 4R7HA 4AX8A 3ZRLA 3HV6A 4C61A 4RRVA 4TYEA 2O5KA 4P5QA 1A48A 4UB7A 2YIWA 4U97A 2J51A 4WUNA 5CU3A 3FMLA 3VS1A 3BI6A 4XS2A 3QUPA 1WVXA 4F65A 2WO6A 3F3UA 1YDRE 3E8CA 3EQDA 3K5UA 4BCQA 4D9UA 5L2SA 3NUAA 2YWPA 1Q3WA 4R3CA 2QOBA 4EOLA 3ULIA 4HVIA 5D7AA 1WVYA 3VC4A 4O2ZA 2ITPA 3GOKA 4F1MA 4F9BA 1M52A 3IDCA 3EFKA 4P2KA 4D58A 5I9UA 5HCZA 5I9VA 1Q97A 5KHWA 2IW6A 3I6UA 1GY3A 1YI3A 3QD3A 2J0KA 5HVKA 2P0CA 2V55A 1QCFA 3RCDA 2BVAA 5KMIA 4QTEA 3R1YA 4I6QA 4ASDA 3CR0A 4FIFA 1URWA 4I5HA 3OCBA 3SKCA 3HAVA 2W1GA 3K3IA 4YGAA 5C8NA 4D55A 4UXLA 3SQQA 1SVEA 2C6MA 3RAIA 4QP7A 3BHHA 4EOIA 2QO7A 1F0QA 2UW0A 2QO9A 1XR1A 3ZXTA 2GNGA 3P5KA 2P2HA 4DLIA 2YITA 2CNUA 2DWBA 3R2BA 4OAUC 4G34A 2CGUA 5DBXA 5EG3A 2R3IA 5DHJA 4YUQA 1JWHA 4FE2A 5CAVA 4BZDA 4JDKA 5DMZA 4G3FA 5HI2A 3SG8A 2QD9A 4RIWB 4NK9A 3QC4A 4DEGA 4HCVA 1OMWA 4PDYA 3I0OA 3Q53A 4YP8A 2UZVA 4BDEA 5M4FA 4O6LA 5DR9A 4EK5A 5DYJA 3O23A 4RJ7A 2YA9A 1P4OA 5AR2A 3GOPA 1P4FA 4FMQA 5CASA 3O8PA 4C4FA 3H30A 3ZLXA 3U51A 3R7YA 2V0DA 2W17A 4MHAA 4XHKB 5K0KA 4DFYA 2RG5A 5B2MA 3C4ZA 5LJJA 5LMBA 4O7NA 3MFTA 3LXLA 3MS9A 5L8JA 4V05A 4XP0A 3VS0A 4ZY6A 3RTPA 2DS1A 3FPMA 4EKKA 1Z9XA 4DH5A 4FT7A 3NAXA 3QKKA 2YCQA 3QRJA 3S4QA 5JMSA 3QX4A 3COKA 3FLNC 4YLKA 4E1ZA 1VYZA 3NNXA 4NT4A 2Q0NA 3C4EA 3GC0A 3FZRA 3FL4A 4FZFB 4R1YA 1CKIA 4XP2A 4NYEA 4PF4A 3I4BA 2JKKA 4RZWA 5EHYA 4C57A 2C1AA 4YR8A 5ETIA 5G1XA 1VJYA 2XNNA 3GU4A 4MVFA 4ANSA 3G0FA 3MA3A 3ZDIA 2GTNA 5ETFA 2UZBA 3V3VA 4KD1A 3WZEA 2R2PA 4TWPA 1MQBA 3KA0A 3PWDA 4PPCA 5GHVA 1MRUA 3D4QA 4H39A 1W83A 4CZUA 4E5AX 3OVVA 2W5AA 2EU9A 4N4SA 3KY2A 4RLKA 1KUTA 4QQ5A 2CGXA 5ANIA 5T3QA 3KF7A 4CG8A 2BRGA 1SVGA 4GK4A 2Z7RA 3D9VA 4GS6A 4Q2AA 2C3JA 3JS2A 4X6RA 1OUYA 3VIDA 3IG7A 3D2KA 3EN7A 2FVDA 2QU5A 4X3FA 2OFVA 2HZ0A 5DGZA 3K54A 4K6ZA 5BVFA 3QQJA 4FNWA 2HXQA 3U87A 3LFEA 4AFEA 3EL7A 3LQ8A 5JZNA 3R7IA 4CFVA 5BX0A 2XRWA 3KB7A 3NUNA 2XNEA 4XBRA 1FMOE 4P7EA 4WD5A 4AT3A 3W2SA 3VUIA 4PTGA 4XRLA 3UNZA 3ZLSA 2XK8A 4G9RA 2V7OA 1PXKA 2Z7LA 5HESA 4IH8A 3HEGA 5M55A 2F57A 2RF9A 4FNZA 3U9NA 3NSZA 4LGHA 4YTFA 3FPQA 3UZTA 1B38A 2ONLC 2YJRA 3MIAA 5BVOA 4DGMA 3HDMA 2B0QA 3I7CA 4IWOA 4X21A 1OM1A 4C4JA 3DK7A 1ATPE 1PW2A 4IFGA 4UXQA 3RK7A 4B9DA 3MYGA 2QONA 1AQ1A 3CGOA 5H2UA 3PSDA 3VBWA 3UIUA 3VUDA 4WHZA 2C3IB 4L45A 3FMNA 1YRPA 2BCJA 2Q83A 3UQGA 5HO6A 3UIBA 4AUAA 4ZLYA 1SMHA 2QC6A 2BIYA 4FKOA 4J97A 4O7ZA 1H0WA 2FSTX 3WARA 5E7RA 5H8GA 1PRYA 1H26A 4RVTA 4UMRA 2YM5A 2XRUA 3P4KA 4FK6A 4EH2A 3LFBA 3KRWA 4BDIA 4DGOA 4L52A 2OFUA 2XKDA 3MN3A 4BGQA 2BIKB 3FMDA 4YZBA 5JFSA 4QTCA 1Q24A 2UW5A 2HXLA 3GQLA 3TZMA 3MVHA 5M44A 5B7VA 4B4LA 4IAAA 4AT5A 3R7VA 4DEBA 2Z60A 4HYHA 4O96A 3EN9A 5H8BA 3DS6A 4EWQA 1S9IA 1ZMUA 5LARA 5CF5A 4M13A 1H1SA 4IX6A 3UVRA 2IW8A 1W98A 1RW8A 1NVSA 4M84A 4U5JA 3A61A 5JRQA 2PMOX 2E9OA 3W2QA 4J7BA 4O91A 4Y83A 3IOPA 4E4MA 4U80A 2BMCA 2OH0E 4XG6A 1Q8ZA 4OTGA 4XBUA 1OIQA 4GIIA 4RIYA 3EQFA 3LVPA 4C36A 4UEUA 4BKZA 2GPHA 5CAQA 1CM8A 3ENHA 4YTIA 2EUFB 4PRJA 1IA9A 3CPBA 2XH5A 2W4JA 3MPTA 2EXCX 2FO0A 3TIYA 4QPMA 5D12A 4K18A 4ZXTA 5I9XA 5FM2A 1WBVA 3Q6UA 3U6IA 3ULZA 1S9JA 3LFCA 3DB8A 4TYHA 4AWIA 4C35A 3R7EA 3QLFA 2YCSA 3WZDA 1A06A 1XH9A 1OI9A 2QQ7A 4WOVA 4HVGA 3DLZA 2XJ1A 2FUMA 5HCXA 3LMHA 4YHTA 3OTUA 3I0QA 5IA2A 1MRYA 5DEYA 1ZYLA 3BEGA 3GQIA 4C02A 2UZUE 4YC6A 2X7OA 4TYGA 5CS6A 2XK6A 4ITHA 2B54A 3AMAA 4GCJA 1REJA 5AP5A 3UODA 4ANQA 4ZOGA 3RALA 5DRDA 1AD5A 3P7CA 3T8OA 3BHVA 4A4LA 1H8FA 4BIDA 2E9UA 5T6KA 3HMNA 4FEUA 2WMSA 1PXIA 1J3HA 4NM5A 4DG3E 1ZMWA 2OIBA 5AADA 1MRVA 3OXIA 3KXGA 3SC1A 1ZOHA 1W0XC 1O6LA 5FGKA 1ZOGA 3KU2A 1M7QA 1REKA 3JYAA 5M57A 3CD8A 3H3CA 1UNLA 3OC1A 3PXKA 1XH6A 3HRBA 1OB3A 4YJNA 4I6HA 4M0ZA 2CGVA 4O1PA 2VWUA 4YZCA 4BCHA 4DINA 2WD1A 2XK3A 3QD4A 4MXYA 1Q8YA 4RX9A 4QMSA 2OZAA 4AZVA 5M56A 3L8PA 2XB7A 4O6EA 3R9OA 1BL7A 3UOHA 1JLUE 1FGIA 3I79A 4IB0A 4L46A 4RC4A 4X3JA 4MNEA 5DWRA 3MB6A 2HWPA 3FWQA 5JN2A 4FT0A 4YHJA 4EQCA 1DAWA 1E9HA 3D14A 3QCYA 4CQGA 4DG2E 4GW8A 4BTJA 4PUZA 4MTAA 2W4KA 4E6QA 3UIXA 4LUEA 4NSTA 3VULA 4RX7A 3FYJX 1WFCA 4C4EA 4AZTA 4F1OA 5CXZA 2VO6A 3AC5A 4ZJJA 3Q5ZA 5D41A 1NXKA 3FZTA 4LOOA 3L9NA 4A06A 3FHIA 3RP9A 3BWFA 3VWAA 4UX9A 3COMA 2XNPA 1YOMA 2X6EA 2PVKA 2UW3A 3EB0A 2HELA 2OXXA 2JKMA 3TV4A 5IQDA 4AG8A 3UC3A 2OKRA 3R00A 4GG7A 3GCSA 4D28A 5CX9A 2UVXA 4ALVA 4V0GB 3D7TB 4CMUA 2VNYA 1Q61A 3MGYA 2GHGA 1URCA 2J0JA 3H0ZA 3QTRA 1GIJA 4QT1A 4BCMA 3TM0A 4DF3A 4E5BA 4KIPA 2W06A 1TVOA 3VBYA 2DQ7X 3V8TA 4S33A 4O0XA 1Q3DA 3PE2A 1PJKA 2UZNA 4YNEA 4RJ6A 5AMNA 3OWKA 3D94A 4A7CA 4IC7A 4EI4A 1LUFA 4RPVA 3DDPA 4JG8A 2OG8A 1H00A 5L4QA 4L6QA 4AGUA 4X2KA 3BU5A 3QA0A 5HICA 4DCEA 2BRNA 1IA8A 2JEDA 3PVWA 3TJCA 4EOSA 2JIUA 3OUKA 4UYAA 4BYIA 2VUWA 2E2BA 2OW3A 3QHRA 4CTBA 2PMNX 3OEFX 4CD0A 3QTIA 3OOGA 4I0TA 4F9AA 3B8RA 4TYIA 3GCVA 2EXMA 4AGWA 5IA1A 5KMMA 2WXVA 2X8IA 3EOCA 3R83A 4JBPA 3S00A 3C0GA 3N9XA 3SXFA 4ACDA 2G01A 3NNUA 2WU6A 3GT8A 4FOBA 4XJ0A 1YVJA 4IE9A 5EDPA 4D1SA 3MTFA 4UMUA 1RJBA 4Y85A 2RKUA 2OXYA 2WTKC 4MXAA 4U9AA 3VJOA 2WQOA 4CTCA 2W1EA 5FLFA 4LL5A 3Q4TA 4QQCA 4HZRA 2C0OA 4DBXA 5IUHA 5BMSA 3KXHA 4IFCA 5CSVA 1Q99A 4E26A 2UVZA 5AUTA 3EKNA 5HD4A 4RT7A 3LJ1A 4UMPA 2XNOA 5AP1A 3EKKA 4ASZA 4USFA 1J7IA 2F7XE 4MCVA 3ELJA 5CU0A 3VHKA 1OL2A 4QMYA 3E3BX 2XIRA 3DQWA 4IDVA 2XS0A 3R8ZA 3OFMA 2PUIA 4ZSLA 3O17A 3QUDA 3DBEA 4LV8A 4CMTA 4G17A 4EWHA 2GNHA 3U4UA 3H4JA 4BWPA 4GJ2A 3F7ZA 2LGCA 3DU8A 3RM7A 5A14A 2J9MA 5AP7A 4B0GA 4F0FA 3ORKA 4K11A 2JDTA 2WIHA 1G8AA 3OBGA 4MWHA 1BI7A 4YLJA 2QCSA 4L3LA 3NYNA 3KN5A 3QZIA 3ZDUA 4D9TA 5IISA 1ZAOA 3COHA 1TQPA 4NM7A 4WBOA 4O81A 4QNAA 4RSSA 3P23A 3FYKX 1GOLA 4ZTLA 4Y46A 5IEXA 4ZTQA 4FX3A 1ZOEA 5K3YA 3TNWA 4J52A 3BIZA 2JKOA 2C47A 4O0VA 2QOLA 4DGNA 3DXPA 4G5PA 4APCA 4I5CA 1ZARA 3E5AA 3D7ZA 4JR7A 3GC8A 3WILA 4WIHA 5FXQA 4FI1A 5DR6A 2OZOA 2QR8A 4Q9SA 3R2YA 5CZIA 4RZVA 3FQHA 3UNKA 5E4HA 5AP4A 4NH1A 3RHKA 4AGCA 4CRSA 4H05A 4PL4A 4E6DA 1H07A 1YDTE 4BCNA 3V01A 3SRVB 4HGLA 3P7BA 2YABA 2XEZA 3QRUA 3R01A 3DXNA 4RLLA 5ANOA 3RVGA 3ZFYA 4RG0A 3W33A 4HVSA 5EYKA 2J4ZA 2X7FA 2VX0A 5HO7A 2IPXA 3ACJA 3BE2A 4F7JA 5B2LA 1UU8A 5AAGA 2VTRA 3OY3A 3F9NA 5BYYA 4DEDA 3BWJA 4GEOA 5E8WA 4ZTHA 5KKRB 4W4WA 5EHLA 4LMNA 4C3RA 2I0HA 4ANMA 3VVHA 2JDOA 4AN9A 4EEVA 1YW2A 3R22A 3QRIA 4QP1A 2G2FA 2GHMA 4OBOA 3CKXA 4HOKA 4L43A 3KXNA 4ACHA 1ND4A 3V5PA 2B9JA 5EDRA 4BY9E 3MTLA 1KE7A 2GSFA 2BTSA 3D5UA 4DAWA 5DIAA 2XKEA 4KUJA 3QQKA 4FKQA 3WZUA 2YIRA 4LV5A 3D2IA 5EYMA 5AP0A 4USEA 4DT8A 3KF4A 1OBGA 3MH0A 4H1JA 3E7VA 3RWPA 3W8QA 4AF3A 5CEPA 2UZDA 2B55A 4QYYA 1PKDA 2OIDA 3EL8A 4CFUA 1KSWA 2ITWA 2ETRA 5IU2A 2ZM1A 5L2TA 1OZ1A 5AUVA 4I3ZA 3PIXA 2JD5A 4RIXB 4EBWA 3PSBA 4YHFA 3PP0A 4GMYA 5LWNA 2J50A 5CT7A 2VTQA 4MH7A 4XNEA 3LJ2A 1G3NA 3IKAA 3DPKA 3L9LA 2YM7A 3DFCB 4FGBA 3O96A 3KEXA 3QU0A 1BMKA 2B7AA 5ANDA 3RZFA 3UC4A 3IW7A 3SAYA 5JQ5A 3VQUA 3A2CA 2Y0AA 3LCOA 4CV9A 5HO8A 4ZJIA 1R1WA 5EQPA 4R7IA 2Z7QA 3ZU7A 5F4NA 4K33A 2R0UA 4DHFA 3DXQA 3CIKA 4IB3A 1M17A 4LRKA 2NPQA 1XH8A 4FA2A 2VWYA 3IW8A 4DN5A 1V0OA 4FTOA 2PE2A 3VF9A 1T45A 1FMKA 4YURA 4BR3A 2CN5A 2ZMCA 4RC3A 4MEDA 4M69B 3TT0A 4XG7A 1UA2A 3ENMA 2X9EA 5FM3A 4G31A 4RGJA 3KCFA 4FTCA 4QP2A 3DNEA 3QF9A 1I44A 2PSQA 4XX9A 5IQIA 5E91A 5IH4A 2FSMX 3EFWA 2YACA 3FMMA 3NCGA 4FT3A 4NEUA 4PP9A 4PMSA 3UPXA 4D2TA 4OTDA 1ZZ2A 2YM4A 2PTKA 5DT4A 1WBNA 4G3DA 4MQ1A 4TNDA 5IDNA 3TV6A 5CU6A 2O0UA 4QMXA 5KE0A 3C1XA 4I0SA 4JBQA 1UWHA 2X7GA 3RJCA 4KBCA 2IJMA 3UG1A 3MBLA 4Y95A 3CP9A 3RNYA 4RWIA 4J8MA 3FI8A 2W9ZB 4F6UA 2CPKE 4FGRA 3KK8A 1NW1A 3DNDA 5IEVA 5DH3A 2XCHA 2XYUA 2YEXA 3QA8A 1TKIA 4U43A 3R7OA 3EWHA 4D2SA 4GRBA 3VRZA 3SGCA 3M11A 3KMMA 1Y6AA 3N51A 1O6KA 4ZZOA 5E90A 3FI3A 3GXLA 5IMXA 3EJ1A 4FSMA 3G33A 3LJ0A 4MBJA 3VS7A 4NU1A 2QOQA 2XNMA 4C3FA 5F9EA 3BU3A 3QTZA 3VUTA 2PPQA 2ITXA 4EH8A 5FBNC 4RFZA 4DFLA 5ITAA 3NEWA 3OXTA 3W18A 3C5UA 2P3GX 4A9YA 3HZTA 3ZXZA 5ICPA 5JGBA 3TZ8A 1GNGA 4B99A 4M66A 2XBAA 1OKYA 1M14A 4IAIA 4BHZA 3S1HA 5FWKK 3UBDA 1PXPA 1RQQA 1XBBA 2REIA 3HYHA 5L6PA 4AAAA 4QPAA 3GFWA 3ORNA 3DJ6A 4NIFB 4IM0A 5EYCA 2PZRA 4RA4A 4EZ7A 1YXTA 2QI8A 3PTGA 3PVUA 5FP6A 4KABA 5IQAA 4HZSA 4WRGA 2C0TA 4LFIA 1H01A 5J79A 4O0RA 3ZO1A 3BEAA 4FZ6A 3B2TA 4CFMA 3GU8A 3BE9A 2BAQA 5AV3A 4FSZA 4ZP5A 3KXMA 5CF4A 2W1FA 3I6WA 5M07A 4O7YA 1GAGA 2GNIA 4R6VA 4H1MA 5EM6A 2ZVAA 2J5FA 5GJGA 3VF8A 3CTJA 4DFBA 1KE9A 2BKZA 3NYXA 2OJJA 3QRTA 3ZLYA 4BBFA 1BL6A 5HLNA 1L3RE 3KRRA 3W16A 3I81A 3P1AA 3MPMA 1CSNA 3EQGA 5BQ0A 2B9IA 3DAJA 5DNRA 4Y72A 1H4LA 4F08A 2YIXA 4BGGA 3FKOA 5LWMA 4QP4A 4MK0A 1OIYA 4AQCA 4OAVB 2PL0A 3R63A 5AR7A 2OH4A 5ANKA 4MD7E 4O84A 2ACXA 2Z7SA 3QQUA 4RWLA 1H28A 4GK3A 5A4LA 5AUWA 1JOWB 4FIEA 5LVLA 4RVKA 4XH6A 3FLSA 4QYFA 2R3PA 3F69A 2W05A 3GCUA 3ZMMA 4FK3A 5CWZA 3LLTA 2E9NA 3RPOA 4ENXA 2F7ZE 5I9WA 5IQHA 2XNGA 3D5XA 1H1PA 4DLJA 3C4XA 3N4VA 4I6FA 4FTKA 2BZIB 4CYJA 1PMEA 5FDXA 5IDPA 5E9EA 4ZMFA 3OW3A 2CGWA 3OEZA 4FF8A 2PVYA 1APME 3V51A 4XEYA 1IAHA 4DA5A 2A4LA 3O7LD 3G9NA 1GIHA 3WZKA 3OWJA 5CVHA 3SLSA 1YXUA 5EM5A 3V8SA 2F4JA 4IM2A 3PVBA 4A4XA 4LM5A 3OT8A 2C6KA 2IVUA 2WTJA 2VTAA 5AM7A 4CKRA 5JFXA 2YCFA 1UKHA 3EN6A 3U54A 1KE8A 4NFMA 3SV0A 4X3FB 3TUCA 4TY1A 4ASEA 1QL6A 2BR1A 1Y91A 1OL5A 3NW5A 3WYXA 3D5VA 4DG0E 5FBOA 5E8TA 5AV1A 3CTQA 5KMOA 3FV8A 3QQHA 5E8YA 3PXZA 5LMAA 4EC8A 3COIA 3DOGA 2Y4IB 3MY5A 5CANA 2NO3A 4ENYA 4OW8A 4DEIA 5M08A 5HBHA 2XUUA 3P0MA 3OWLA 3QQLA 4XV3A 5EW9A 4BDFA 5CI7A 2PE0A 5AP6A 4FTQA 5B0XA 2VTJA 4V04A 4YJPA 2PUUA 3DA6A 1DI8A 1YKRA 1OUKA 4ZY5A 2PUPA 3FKLA 3OMVA 5F94A 1WBOA 4L42A 5FEQA 3BQRA 3BV3A 3FZSA 4LQMA 1JAMA 5BPYA 4LRMA 1PYEA 3JPVA 3KULA 3O51A 1W7HA 5IQCA 5DA3A 3U9CA 4R5YA 4X7QA 4BDHA 5EQEA 2X9FA 3C4WA 5E8ZA 5EYDA 4Z9LA 2W96B 3QQFA 2CMWA 4F9YA 4ZEGA 1SNUA 4HPTE 4CZTA 3EZRA 4ERKA 2CKEA 5HNGA 5LQFA 2X1NA 3QXOA 4CXAA 3JVSA 4OTIA 2ITUA 3O71A 3PJ1A 4ZLZA 5C27A 5KBQA 1JVPP 3Q9WA 4QMNA 4EL9A 4J98A 3SXRA 4S2ZA 2IO6A 4XG3A 4PPBA 4YJQA 3VHEA 1YI4A 4I93A 2BZKB 4RVMA 2CNQA 2IVTA 2JAVA 2B52A 1E1VA 2H9VA 3HUBA 3ZO3A 4B7TA 3Q2MA 4JI9A 2GQGA 5AAEA 3G6HA 3QRKA 4YTHA 4FNYA 1SVHA 2NP8A 4DE4A 2W1CA 3E88A 4MX9A 4D4RA 4FV1A 3FE3A 3F2AA 3EQCA 3SXSA 1U54A 2YWVA 4FYOA 2XIYA 4FOCA 4GYGA 3L9MA 1FPUA 3FMJA 3P78A 2QOOA 4RIYB 4YJOA 3CXWA 5ANGA 4DC2A 3F5XA 3DDQA 3QKMA 1ZWSA 4S32A 4X0MA 5FQDC 3SW4A 3TKIA 3R02A 4J96A 4U44A 2BALA 4OTRA 4F7LA 1OPKA 2AUHA 2G2HA 3OZ6A 3UMWA 1KV2A 4C33A 3QTUA 1HCKA 4R7BA 2R64A 4BYJA 3W2PA 3HMPA 4A4OA 1Y57A 5CQWA 4TYHB 4C37A 3M2WA 4M68A 2C5OA 3TACA 2WU7A 3FI4A 1FGKA 3IONA 4JX7A 4DTBA 3GBZA 5CF8A 3RWQA 3R30A 4MBLA 4TRLA 1YHWA 5HGIA 3VBTA 2BDWA 1OKZA 3BGPA 3FLZA 4QP3A 2C3KA 5CI6A 3ANQA 3ORPA 3RPYA 1J7LA 3PLAE 1A9UA 2GNJA 3PVGA 3VQHA 4BDGA 3NVKI 4K77A 5HX8A 2FSLX 3FUPA 3NMUF 1OKWA 4EH9A 4ZSJA 5HU9A 2QURA 4U41A 5CENA 4QP9A 5E8SA 5AP3A 4PMPA 5AUUA 2G1TA 2YZLA 4MXZA 1U59A 1PYXA 4FVQA 3QAME 3KRXA 4IJ9A 3UNJA 4EH3A 3FSKA 2LAVA 3R1QA 4S31A 5BVWA 3REPA 3ZYAA 3II5A 3AC4A 4I1ZA 2H34A 2WQBA 3H10A 3W8LA 4Z16A 1V0PA 2UW4A 5A4QA 3EMGA 3F61A 2X39A 4RBLA 5LVPA 3PPZA 4R8QA 3TI1A 3BHUA 3VRYA 3WYYA 4PPAA 5EQYA 4MXCA 4FKSA 1FBNA 2J2IB 2CKPA 4HPUE 3EQHA 3ORZA 3TNQB 3HVCA 3QCSA 2VWVA 4IX5A 4EZ5A 1OIUA 2UZEA 3TV7A 4F7NA 2CJMA 3PXQA 3A62A 5J9ZA 5L3AA 4L44A 3LMIA 3QKLA 4EYMA 1XH7A 4PDSA 5CY3A 4ONAA 2AC3A 2ITQA 4C59A 4RX5A 4CEGA 2OZAB 3IGOA 2F7EE 4EK6A 4I6BA 2A19B 4E4LA 3VBVA 3ORXA 4O2PA 2Y6OA 4MNEB 5FD2A 4M7IA 5HG7A 5JT2A 4GKIA 5ANEA 2QOHA 5AV2A 1UVRA 2C6EA 4KSQA 4BF2A 3BRBA 3E63A 4UWBA 4D2RA 4PMTA 3UQCA 4YO4A 3RHXA 3OY1A 4O38A 4Y73A 1GIIA 5GNKA 1T46A 3SDJA 3DCVA 3E93A 3NVMB 1UNGA 4FVRA 5JH6A 2QO2A 3D5WA 3IECA 1OL1A 2JBPA 2WIPA 3RINA 3WI6A 5IUGA 4M97A 5E1SA 5AR4A 5D9HA 2QG7A 2AYPA 2CN8A 4YJSA 5AIRA 4C7TA 3CPCA 2X2LA 2UZOA 4Q5HA 3OXZA 2QHNA 1FINA 2R5TA 3BYOA 3QHWA 3UZPA 1K9AA 4GT3A 3R9HA 1U46A 3SX9A 3VW6A 2YM3A 1DM2A 3F5PA 4FV5A 4I21A 4RWJA 3V5WA 4AZWA 4Z55A 3FLYA 5A6NA 3C50A 3CQEA 3LFQA 2HAKA 3MH1A 4F70A 2CNVA 5LCKA 2Q0BA 3GCPA 3P9JA 5IEYA 4FTNA 4CYIA 5JQ8A 3O7LB 4C0TA 5TT7A 3F88A 3VN9A 4EK8A 3O2MA 3R1NA 1OECA 5HIBA 3LAUA 4DH1A 4BDDA 2Y4PA 3ET7A 3M1SA 4EK4A 2F49A 2RFNA 1U5RA 4WT6A 4ZZNA 1Q4LA 5HVYA 1UU3A 4BIEA 3GVUA 4GJ3A 3WIKA 5K0XA 1JNKA 4YC3A 4X2NA 2ITZA 4QMVA 4G3GA 3HV4A 4QRCA 2NNWB 3F5GA 4OTPA 4CT2A 5J1WA 2C6OA 4IVBA 5BVKA 4F6SA 4BZNA 4MQ2A 5A46A 2WMBA 4GT4A 4RVLA 2OXDA 4YJTA 1IRKA 2C69A 3ZEPA 4M12A 1NY3A 2Y9QA 3BYVA 4YZNA 2YAAA 4PMMA 5CSWA 3AMBA 3W2RA 5LVNA 2CLQA 2PHKA 5IQGA 2DYLA 3VW8A 4TL0A 2BFYA 3BGQA 3RKBA 3FY2A 2HZIA 4JVGA 5B2KA 2G2IA 2HCKA 1QPEA 4G3EA 1WZYA 1YHSA 4D2VA 3KFAA 3LFAA 4I94A 3KXXA 4TNBA 5AR3A 4Z7HA 2C5VA 4QMPA 3FAAA 4IDTA 4F9WA 1E1XA 1R3CA 3GC9A 5LMKA 2HY0A 1XBCA 4C2WA 4PL5A 2YDIA 3IDBA 2XP2A 2JAMA 4O0SA 5C8KA 4ID7A 2HOGA 4JBOA 4F63A 4TN6A 4BKJA 4FICA 3R21A 4I5MA 4EOJA 2XJ2A 5L8LA 4G1WA 2VTHA 4KS7A 3EFLA 3L1SA 3I1AA 2ITYA 2QR7A 4FG7A 4XOYA 3PJCA 4WNPA 4ASXA 3C4CA 3HV5A 3LCDA 4GU9A 3E64A 4L01A 2YIQA 3MWUA 2IWIA 4RJ4A 2DUVA 4QO9A 3HAMA 5IQEA 5CU2A 4FTLA 4RFMA 4EYJA 4CMOA 2OJIA 1PMVA 3O0GA 4MAOA 4B6LA 4C3PA 4ZMEA 2W9FB 2ZDTA 4G6LA 1Z5MA 4H3PA 2A0CX 4JIAA 3BYSA 2XMYA 1ZYJA 3HKOA 2OSCA 3JVRA 3OF0A 4FV2A 3ZC5A 5AEPA 4U3ZA 1XH5A 5HG5A 3RAHA 4AS0A 1Y8GA 2W99B 4LOQA 3HMOA 1BUHA 5I9ZA 2EB2A 5H3QA 3ZFMA 3QGYA 4M8TA 2WTIA 3P86A 3VS6A 1NA7A 4EOMA 3MFSA 4FL1A 4JQ8A 5C8MA 4AP7A 2X81A 4O7SA 4CFXA 3BU6A 4H58A 3GB2A 4L3JA 3T3VA 3F2RA 2W0JA 3VJNA 4FTRA 4W9XA 3NUPA 4KRCA 3R8MA 3LFNA 4C8BA 5AUZA 3Q4ZA 4KIQA 5AAFA 1JQHA 4BIBA 5K9IA 3V5TA 2OO8X 2JITA 1OITA 1M2RA 5HORA 5DFPA 2KTYA 4YJVA 1Q41A 4FKUA 2KULA 3G51A 4XV9A 2QKWB 3BPRA 3ZLWA 1W82A 2C1BA 4BGHA 4BCIA 4JDJA 3ZM4A 5M4IA 3E62A 3G90X 4PP7A 4FODA 3SD0A 4AOIA 4ORKA 2E9PA 3S2PA 5L8KA 4FZAB 4J1RA 4MD9E 4RWKA 3W55A 4ZK5A 3Q3BA 3R8PA 3EFJA 3DBQA 4JBVA 3JR1A 4CGAA 4BWKA 4XV2A 2HWOA 4NM0A 3IS5A 4U7ZA 3QTWA 5IUIA 1PHKA 3HGKA 4QMTA 1YWRA 3VS5A 4DTKA 1Q8WA 2HY81 3QX2A 3SHEA 4E73A 4ZJVA 3MFUA 4E6CA 3BHYA 3FZ1A 3EYHA 4U0IA 4D4VA 2YAKA 1K3AA 1NVQA 2YCRA 4FT9A 3LM0A 4XG8A 4CKJA 2GU8A 5FTQA 5HBEA 3PP1A 1JSUA 2CLXA 5EM7A 2QLUA 4F0IA 3C9WA 3MFRA 5KX8A 4RMZA 1R0EA 2PE1A 3ZBXA 3KXZA 3LOKA 3VS3A 1OKVA 5CSPA 2JDVA 1R39A 4AW5A 4GV1A 5JRSA 3GU6A 2J0MB 2PZYA 2UV2A 4I22A 2JIVA 3WZJA 3DBCA 4FKTA 4BDBA 3Q2JA 4JRNA 5EDQA 1YWNA 1SM2A 4DEHA 4R3RA 4YJUA 3RK9A 2R3GA 5GJDA 4G5JA 4QPSA 2XZSA 3PWYA 2WTVA 3LXKA 5CQUA 4FTTA 1XO2B 3MJ2A 4O7VA 4XP3A 4F64A 1KE5A 2VTMA 3ACKA 4E8AA 5HNIX 4ZS0A 2XYNA 3UMXA 4O0WA 4WG5A 4UN0C 3TZ7A 2ESMA 5KMKA 3CS9A 4FKJA 3Q5IA 4XCUA 3MPAA 2O2UA 3R6XA 4ERWA 4QMLA 4BBEA 5EI2A 3FSFA 2EWAA 5GZ9A 3VS2A 4AA5A 2PVFA 1OL7A 4FSNA 5HIEA 5EW8A 5ANJA 4DITA 5LOHA 4OLIA 2VTOA 2H6DA 2WOUA 4WKQA 4EOKA 3EH9A 5JGAA 4FSQA 1WBWA 3ZZEA 2HIWA 5ACBC 2WMWA 4C38A 3GGFA 3MB7A 4AACA 4YZDA 1JPAA 3VBQA 1WCCA 4KIKA 4BBMA 5AIKA 2Y8OA 4J99A 5M4CA 4N57A 2Y6MA 3AD6A 3EYGA 3PY0A 3MH2A 4QP8A 4RJ8A 3QTQA 3UOLA 5HOAA 4O1OA 2C30A 3ZEWA 2OJFE 2VTIA 2QODA 4C62A 3FZOA 4NWMA 3V5JA 4D1XA 1LEZA 3NRMA 3PUPA 3UZRA 4L68A 2VGOA 3MV5A 5CLPA 3RM6A 2W5HA 4BKYA 4FNXA 1LEWA 4NCTC 4XUFA 5J8IA 3VUKA 4JAIA 2BILB 4IEBA 2ZV7A 2YIYA 3PRFA 4IW0A 3FJQE 3CCNA 3ZRMA 4HW7A 3HDNA 5K4JA 1Y8YA 3OHTA 4QOXA 4H3BA 4IZYA 3WBLA 1F5QA 3DTWA 2VO0A 3A7GA 3BLHA 1QPDA 2WTKB 2PK9A 4AN3A 4FTJA 3HL7A 3CD3A 5TF9A 4FIGA 2BTRA 4FSRA 4USDA 4XLIA 2QOIA 3G0EA 3FMKA 3NCZA 3NNWA 4QMZA 3G15A 1PMUA 2HENA 5HE2A 3NDMA 3FBVA 4I92A 3L8SA 4IWQA 3ZHPC 4GH2A 4ANLA 4DTAA 4UMQA 2X8EA 4AFJA 2I6LA 4JLCA 3BYUA 3DJ5A 1ZYDA 5CNOA 2WKMA 5CTPA 4NW5A 2JFMA 5AA9A 3BBTB 2XEYA 4EUUA 4FV7A 3PRIA 4MNFA 4OTHA 4TZRA 3KL8A 4XYFA 5IMEA 4JQEA 4CV8A 2GNFA 3TDVA 4FKGA 3UVQA 4A9SA 4K9YA 4AW0A 4ACGA 1XH4A 3S95A 3TXOA 3DK3A 2WMAA 3ZBFA 4GFMA 4FZDB 3V8WA 4D5HA 1VYWA 5K5XA 5C1QB 2J6MA 3WIGA 2R3QA 5CSHA 2ZJWA 3DQXA 5M53A 3BX5A 2J5EA 3R9NA 4JR3A 4J8NA 2A27A 1J7UA 1G8SA 3O8TA 4IB5A 5DG5A 3I60A 3AC8A 3VUHA 4BL1A 3CY3A 2R3OA 5LXMA 3KKVA 4BICA 4E6AA 2WMVA 4R1VA 4Q5EA 3KK9A 1JKKA 3QZGA 3UIMA 3U6JA 3UOJA 5HTCA 3UGCA 3NNVA 3LW0A 4MYGA 4L7FA 4WBBB 4EH4A 5BVNA 3BYMA 4EJNA 3CE3A 2WQNA 4RFYA 4ANBA 4EQMA 4II5A 4QMQA 1OL6A 2XM8A 5I4NA 2RFDA 3GC7A 5HEZA 1VZOA 1U4DA 3OW4A 4FTAA 2V5QA 5AUYA 3EN4A 4M15A 3ZZWA 4DH8A 5DOSA 4WNKA 5IA4A 5CEMA 3V5QA 4OBPA 5AUXA 4AOJA 3A8WA 3UDBA 3MI9A 1OGUA 2RL5A 3EZVA 4UWCA 5D1JA 4JNWA 2C68A 4QYHA 1FVTA 2SRCA 4AW2A 5L6WL 4I23A 2VTSA 3DKCA 3E87A 4QMUA 4D1ZA 4GL9A 3QTSA 4AT4A 4NL0A 3IW4A 5J7HA 4FKWA 3QZFA 4YSJA 2RIOA 3TUDA 4O83A 2QNJA 2B53A 4CVAA 3SA0A 3CKWA 3LE6A 3PLSA 3WE8A 4R3PA 2IZSA 2PZPA 4FV3A 3TJDA 4YLLA 3FLQA 1WAKA 4EH6A 4FTIA 4X2JA 5IPJA 4R77A 5I9YA 3Q6WA 5CYIA 3VS4A 1H25A 4JJRA 4TXCA 5TKDA 4YZ9A 5JGDA 2XK7A 1OBDA 4BFMA 3AG9A 3A7JA 3C4FA 4CG9A 4QQJA 5FTOA 5I3OA 4HYIA 4RJ3A 3Q4UA 4JX3A 2JIIA 2X4FA 3W2OA 3PG3A 1LP4A 2A1AB 5JSMA 4ALWA 1B6CB 5AP2A 4JIKA 3SRVA 3ID6C 1QPJA 3UP2A 4W4YA 2W5BA 4F4PA 2B9FA 2R3MA 5IH5A 3HRFA 4AOTA 4G16A 4GVAA 2F2CB 4HNFA 3HNGA 2WAJA 4FKRA 2XA4A 4G6OA 4IWDA 3QALE 3GFEA 2FA2A 4I4EA 4BB4A 4FIHA 4ACMA 2ERKA 3C0IA 5CAPA 3TEIA 4QNYA 4F09A 3U55A 3NGAA 3KULB 2BAKA 2P33A 4ZTNA 3FMEA 3U6HA 3PJ8A 5H8EA 3ORLA 2EB3A 3R8UA 5KCVA 1ZZLA 2VV9A 4OTQA 4C34A 5M51A 4KBAA 3BV2A 1DS5A 3AXWA 4FT5A 4MKCA 3BKBA 4ZAUA 4IAFA 5A4CA 5A6OA 5EKNA 4FEXA 5HG9A 2R4BA 1YOJA 1LPUA 2BROA 4UY9A 3ROYA 2WMQA 3AQVA 4L9IA 5DE2A 3LM5A 2ETMA 3AC2A 4C4HA 5J7BA 3V04A 4HGTA 4NUSA 4PTCA 4RIXA 3V6SA 2WTWA 2GHLA 2OLCA 2HZNA 2QHMA 3KVWA 4UZDA 3Q04A 2CHLA 4OR5A 4QTDA 3HUCA 4FL2A 3AC3A 3AT2A 4FKPA 1ZLTA 3BLQA 4I0RA 3TZ9A 2G15A 3ETAA 4KINA 5EOLA 2V62A 4HCUA 4NJ3A 2C0IA 2YN8A 4G6NA 1U54B 1YQJA 4CFFA 1TQIA 4FSWA 3MVLA 2IW9A 3TWJA 4DT9A 4NCTA 3C0HA 3B8QA 3QYWA 4IX4A 4EOPA 4K1BA 4O27B 1ZRZA 5HKMA 4TWNA 4JOAA 4JRVA 2ITTA 4EUTA 4J71A 4K0YA 5L2IA 2V7AA 3PSCA 5HVJA 1DI9A 2BDJA 3PJ2A 4JL9A 4ZZMA 2QVSE 4JDIA 2R3NA 4U42A 4C2VA 2W1ZA
chains in the Genus database with same CATH superfamily
2AC5A 2BHHA 3HV7A 1XKKA 1YWVA 3F6XA 3FL5A 4TYJA 4FIIA 4TT7A 2WHBA 3KMWA 3UJGA 3M42A 4JG6A 5C03A 1UKIA 3KIOC 2UW7A 2YDJA 4PDPA 2VWIA 4TW9A 4IVDA 4OBQA 2F2UA 3QC9A 3DB6A 2JBOA 4FTUA 3PXRA 1K2PA 4IANA 3PJ3A 2ZB1A 4EQUA 2UZTA 3NLBA 4IVAA 1TQMA 3N4TA 2O65A 2ZV2A 2OU7A 1GJOA 3MH3A 3C13A 4FV8A 2WMXA 1VR2A 5EOBA 3NUXA 2GFCA 4N0SA 4E7WA 5C01A 3IPHA 4I24A 4WO5A 3FEGA 5I0BA 2JDRA 3PZEA 4M67A 3SW7A 4FEVA 1KWPA 3R9DA 4AN2A 5GIOE 3G5DA 5DLSA 3FZPA 3ZS5A 3LFSA 4AAYA 3KVXA 3IQ7A 3QLGA 4UALA 1V1KA 2OF2A 3QQGA 5BUIA 3QUEA 1XMMA 3V5LA 5AV0A 2BFXA 3W32A 1AGWA 3Q32A 1OVEA 4FUYA 1CKJA 5D11A 4EHGA 3F2NA 3ZTXA 5HTIA 2B1PA 5DEWA 5K4IA 3NW6A 4D0XA 1ZYSA 3TNHA 2BZJA 5FTGA 1WBTA 5I3RA 5LMKC 2WGJA 3S0OA 1Z57A 2PVJA 3ALNA 4Z3VA 4CCBA 3KCKA 2Z02A 2QG5A 2PVLA 5F1ZA 4GT5A 5IA3A 5KZIA 2I0EA 5BUJA 4BVUA 4TWCA 3QGWA 4ZTRA 4W8EA 4EZ3A 3ZO4A 4NIFA 4QTBA 4DFXE 1JKLA 2YZAA 3C7QA 4HYUA 3ZCLA 5HE3A 1ZMVA 3AGLA 3NYOA 3ZFXA 5J5SA 5J9LA 5E8XA 2NRYA 4H36A 3ATSA 4A07A 3IK3A 4GFOA 3RZBA 2JGZA 3NUSA 4XOZA 4WRSA 3MY1A 5HG8A 3UYSA 3RK5A 1JKSA 3ZRKA 2QOCA 2HK5A 3LXNA 2W1HA 1XJDA 1YDSE 1CTPE 1BLXA 2NRUA 3OD6X 1PF8A 1ZXEA 3NW7A 4K8AA 4U45A 3CQUA 5KO1A 3EQPA 4GU6A 5EI6A 3PXFA 3AC1A 2XIZA 4W4VA 1P14A 4YJRA 4MXXA 4LYNA 4QMOA 4RQKA 2R3KA 4KBKA 5EKOA 2XCKA 4CZYB 2ITVA 5AFVA 4LL0A 3V6RA 4CT1A 5M09A 2C6TA 3FC2A 3SOCA 4O21A 5FXSA 1BX6A 2FSOX 3BZ3A 5HE0A 3KRJA 5CVGA 5HZNA 3QD2B 4W9WA 3RAWA 3LMGA 3LKMA 1DAYA 2R7BA 2VX1A 4F1TA 1UV5A 3NZ0A 3HMMA 4U81A 1X8BA 5HU3A 4N70A 3ODZX 4YBJA 2BAJA 2WMUA 1QMZA 2I0VA 2PY3A 2WMTA 3DLSA 3EHAA 4C4GA 4E4NA 4NKSA 3CQWA 4CQEA 3E8EA 1H0VA 2W1DA 3OROA 4ZSGA 4YMJA 1QPCA 1ZY4A 2YFXA 1UU7A 3OOMA 3QCQA 4DBNA 3NUUA 3KGAA 4DEEA 1H24A 2WTDA 3NUYA 3MIYA 2GS2A 3ZUTA 4UMTA 2X8DA 4A9RA 3DJ7A 3CSVA 4IJPA 4IVCA 3TTJA 5DVRA 4FKVA 1OPJA 1H08A 2XM9A 2WEIA 3K2LA 1YI6A 3PIZA 4IXPA 1UWJA 2YERA 3E8NA 4MD8E 4UWYA 4XG2A 4IMYA 5HNBA 4KKGA 2IVVA 4DFUA 5C4KA 3PPKA 2CCHA 3ANRA 4FL3A 4E5WA 3EQRA 3THBA 5LVMA 5GJFA 4I5PA 4BCPA 5A4TA 3TG1A 1IR3A 2VN9A 1IASA 1YOLA 5CZHA 3F7WA 4PV0A 4E20A 1XQZA 2HZ4A 3GCQA 3NAYA 2XKFA 3EN5A 3Q60A 4FVPA 3TCPA 3VUGA 4AE9A 2XIXA 2IN6A 1W84A 5AM6A 3PZHA 5CU4A 2I1MA 4GSBA 1IG1A 5EM8A 4EOQA 4KKHA 5IZFA 4XRJA 5L6OA 5CEIA 5J87A 1BI8A 2JFLA 4LRJA 4JQ7A 2J7TA 4S30A 4WSQA 5HX6A 3W10A 2X4ZA 5LCJA 5FXRA 4XG4A 5GINE 4FEQA 3FY0A 4PWNA 4PX6A 4ZIMA 4G2FA 5JEBA 5CVFA 3KREA 3UE4A 2VX3A 4RIWA 4ZLOA 2ZM4A 4EHZA 4NTSA 2GMXA 2UZWE 5IA5A 4BDCA 3MJ1A 4LOPA 3FXWA 3W1FA 3ZSIA 1H1RA 4HGSA 3RAKA 5J5TA 2CCIA 4LI5A 4CNHA 5IQBA 3PPJA 4EH7A 4YSMA 1W2FA 3ZSGA 4WUAA 4KWPA 2R3JA 3OCGA 5HLWA 3O8UA 2JDSA 3S3IA 1UU9A 1YXXA 2ZDUA 3G6GA 3ZUVA 4P4CA 3UPZA 4FV4A 5KNJA 1UNHA 2ITNA 2P4IA 2W1IA 3PXYA 3ERKA 1GZOA 4ITJA 1EH4A 2VRXA 3P7AA 3QBNA 1TZDA 3RPSA 4EHEA 5BVDA 2VTTA 4DFZE 4FG8A 4RX8A 2BZHB 3NR9A 3QZHA 2EVAA 3I5ZA 2OWBA 4TTHB 4UYNA 3R7UA 3ALOA 2QKRA 4N6ZA 2PULA 3DY7A 1H1QA 1STCE 4AA0A 2UW6A 3DAEA 1ZY5A 4NFNA 2PWLA 2PZ5A 3R04A 5CALA 3TKUA 3LPBA 1VEBA 3BBWA 2X6DA 5EHOA 5JFWA 2O8YA 2XBJA 3G9LX 4O82A 4FR4A 1I09A 3RCJA 3D15A 3UQFA 3OCTA 2GCDA 3CY2A 3VBXA 5EH0A 3NIZA 3GI3A 5F20A 4FYNA 3AMYA 3BL7A 2RFEA 3LFDA 5DPVA 4ANNA 3QTXA 1SZMA 3BQCA 3N4UA 1PMNA 4EJ7A 4E4XA 3R9RA 4FEWA 2ZOQA 4CCUA 5AWMA 2C3LA 3PDTA 2OI4X 2ZMDA 4D4SA 1ST4A 2C6LA 4M14A 5FUTA 4CLIA 5KMNA 4B8LA 1JSTA 2ZV9A 5EW3A 3WF8A 3DFAA 2ETKA 4DFNA 2WQMA 4PDOA 4DGGA 4F6WA 5KUPA 3IGGA 2WEVA 3C51A 4CLJA 5IF1A 2VZ6A 3UYTA 3LZBA 2IVSA 3FKNA 1WBSA 3PA3A 4O0UA 5AR5A 3ZOSA 1JSVA 4TPTA 5CNNA 4EC9A 3EIDA 4YNOA 3AOXA 3E8DA 3OS3A 2XK9A 3ZSHA 4ZY4A 4BZOA 4AXFA 4DHIB 3HA6A 2VWZA 3F3WA 2GS6A 3UDTA 2VO3A 3FXXA 4HYSA 4GUEA 4BTKA 1MQ4A 5DT3A 4C4IA 2BPMA 3DK6A 4W8DA 2VTNA 1ZYCA 4HVDA 4KA3A 5I5ZA 2XVDA 4YC8A 4O7LA 5EFQA 5HD7A 3P79A 1CMKE 2CDZA 2OJGA 2OICA 1KE6A 4FBXA 3E3PA 3QD0A 4RIOA 4RQVA 3A7HA 3HP5A 4IC8A 4BDJA 4IQ6A 4V01A 1GZ8A 4AZSA 4AZFA 1H1WA 2WNTA 3UVPA 5HIDA 4U3YA 5IH6A 4WNMA 4JXFA 5TR6A 4CFNA 3UTOA 3T9TA 1PKGA 2PVMA 3IO7A 4BI0A 3LQ3A 2WPAA 3A99A 2V22A 4HJOA 3TTIA 3UG2A 4EK3A 3C5IA 5TO8A 2E9VA 3R7GA 5AX9A 1FQ1B 2WZJA 5AX3A 3POZA 4KIKB 5T68A 4U8ZA 4BI2A 4DGLC 5E8UA 2ZYBA 2OGVA 5CEKA 3LCKA 5C4LA 3E7OA 3ODYX 5D7VA 3EQIA 4CRLA 4GYIA 5TOZA 3D83A 4FC0A 1B39A 2YISA 4PNKA 5JK3A 3AKJA 3HX4A 2PYWA 3R8LA 5KBRA 4IACA 3LCTA 3TNPC 4BN1A 1WMKA 4MF0A 4QQTA 1RDQE 2I0YA 4O22A 1XHAA 5FEEA 4WG4A 2UW9A 4FIJA 3OUNB 4F99A 3TN8A 4ZTMA 1XWSA 5BUEA 1JBPE 4GFGA 4GK2A 3BCEA 2YM8A 4U40A 3NIEA 4G9CA 3QXPA 1R78A 4KSPA 5BNJA 3AT4A 3WF6A 2F9GA 4IZAA 3JUHA 3NX8A 3HRCA 4I41A 3R1SA 4OUCA 2C4GA 2VAGA 3CJFA 4L53A 4PY1A 5DR2A 4AGDA 3P5JC 4O86A 4BC6A 3GEQA 3U4WA 3A8XA 4KB8A 4NJDA 3RPRA 1M7NA 3MW1A 1YHVA 4WSYA 2C5YA 4IAKA 4MF1A 5ACKA 2UUEA 4PL3A 4BCKA 5L2QA 3H9RA 4RA5A 2IZUA 3FHRA 4FUXA 4E3CA 5KMJA 1PXJA 2HW6A 3BELA 3WF7A 3DTCA 4OT6A 3UP7A 4XG9A 5CAOA 5KMLA 4YO6A 2BUJA 5J95A 1L8TA 3R28A 4FSUA 2P2IA 5A3XA 3ATTA 2ONLA 1LR4A 3DBDA 4J95A 3MVJA 3OP5A 4P5ZA 2WQEA 2PMIA 3VO3A 1O6YA 4ANOA 2PMLX 2YLFA 4P90A 4QD6A 1WVWA 3DKOA 3RNIA 5K5NA 1XBAA 4DCAA 4AW1A 2B9HA 3NPCA 3PE1A 5TE0A 5KKRC 4S34A 2XARA 2C6IA 4KKEA 1GZNA 4WNOA 3ZH8A 4BRXA 4CSVA 3DAKA 4EBVA 2QOKA 3UOKA 3DKGA 1ERKA 3TDWA 4GG5A 2XIKA 2FGIA 1IEPA 3K5VA 2R3RA 2VNWA 5HTBA 4IAYA 5EI8A 2PZIA 3TMOA 2YDKA 3OWPA 2R0IA 2CKOA 2X2MA 3A4OX 4FKIA 2ERZE 3CBLA 4GUBA 3VUMA 5JKGA 1W8CA 4CFWA 1G5SA 2H8HA 2X0GA 4ZSAA 5J1VA 3Q9YA 3DKFA 2BRHA 1NT2A 3GNIB 4GVJA 2BRBA 4IADA 4BDAA 4BWXA 2XF0A 3Q9XA 4MXOA 4O4FA 4FSTA 5HCYA 3DZOA 3KQ7A 4IZ5A 5DI1A 4C58A 4EHVA 4PTEA 4F0GA 2BKKA 5BYZA 2J0IA 2VWWA 3QYZA 3HP2A 4MWIA 5D10A 3L9PA 4EONA 5CSXA 3L8XA 4KNBA 3QL8A 4D4YA 2A2AA 3FMHA 2O64A 4J53A 1KOBA 4OGRA 3DBFA 5BYLA 4PNIA 4FV6A 3Q52A 4UBAA 2FH9A 3OCSA 5DRBA 3WF9A 2PVRA 2BRMA 4IX3A 3RBWA 5HHWA 1PXNA 1OPLA 2J90A 5AA8A 3AGMA 3OT3A 4LGGA 4KIOA 5CEOA 2G9XA 4DH3A 2Y7JA 1HCLA 5DN3A 5GIPE 3OBJA 4HNIA 3AD4A 2FB8A 3F3ZA 5GZ8A 3KN6A 4A9TA 3W2CA 4WA9A 3HLLA 2YJSA 2J0LA 2BHEA 2VD5A 2JLDA 3Q96A 4YBKA 1KOAA 3T9IA 4F9CA 1CDKA 5HLPA 4V0GA 3D7TA 5E1EA 3GENA 5HQ0A 3I7BA 1P5EA 3DGKA 4IB1A 4WG3A 3NWWA 1Y6BA 4L67A 5H9BA 1U5QA 4ACCA 4L3PA 3ZONA 2VU3A 4AXCA 3HMIA 4UZHA 5ETAA 3MDYA 3R8VA 1SNXA 3MESA 1F3MC 4LGDA 4DH7A 4DYMA 5AR8A 3TIZA 1RE8A 3O50A 4RJ5A 4ZTSA 5A54A 5AV4A 4A9UA 4HVHA 3RMFA 5L2WA 4I20A 2VTLA 3PA4A 4FV0A 4YZMA 2B4SB 3AT3A 4IHPA 1M2QA 3A4PA 5CF6A 3Q9ZA 3WE4A 4ALUA 1O9UA 1Q62A 5CEQA 1SYKA 3LLAA 2QOFA 4N6YA 2ZV8A 4BDKA 4O7WA 3IW5A 2Z2WA 3CLYA 2WFYA 3RI1A 4D0WA 5J9YA 3W0QA 4K2RA 3ZC6A 3TKHA 4NTTA 2VWXA 4FJVA 4W4XA 4Y5QA 2WOTA 3TUBA 3ORTA 2WMRA 3QFVA 2R3HA 4AE6A 3UO4A 3W0MA 3JY9A 2FYSA 3IDPA 2ZM3A 3ORIA 3QWKA 3D0EA 4EORA 3FC1X 4TKSA 3ITZA 4CKIA 4YU2A 4Z7GA 1PXLA 1BYGA 2X2KA 3MY0A 1GZKA 2YLEA 4G3CA 4HCTA 3ZM9A 5AJQA 2C5NA 5KHXA 4APPA 3LHJA 1P2AA 4GIHA 1PXMA 4AZEA 4BCJA 2RGPA 4O7RA 1JKTA 2UW8A 3VNTA 5C26A 3PA5A 5C9CA 1MP8A 4JG7A 3R73A 2O63A 2PVNA 5FDPA 5JFVA 2EXEA 2WELA 4X2GA 5HE1A 4EOOA 2GQSA 3WF5A 2I40A 2IZRA 4M3QA 4R78A 1WBPA 4B8MA 1M2PA 3BGZA 4NM3A 5IG1A 3R71A 3IOKA 2R7IA 1V0BA 4BCFA 4D2WA 4MBIA 2ZB0A 2VWBA 2IZTA 4OT5A 4IM3A 1FVVA 2RSVA 4IZ7A 4GKHA 5LVOA 1YXSA 1MUOA 3LCSA 1R0PA 2RFSA 4LMUA 3T3UA 4AXAA 2BDFA 3MSSA 3VONA 2JKQA 3CJGA 3CEKA 4EH5A 2RG6A 2PUNA 1FVRA 4QTAA 3GUBA 3HECA 1Q5KA 3Q4CA 4Q9ZA 3PUFC 4X6QC 3WOWA 4QP6A 3LIJA 4H3QA 3F66A 2Z8CA 2ZAZA 2O3PA 3E92A 1J1BA 3HA8A 3OTVA 4IAZA 4QYGA 4UV0A 1J1CA 2UZLA 5FRIA 4AU8A 3DT1A 3KC3A 5CXHA 2GQRA 3EQBA 2OJ9A 3JY0A 4KRDA 3H9OA 1H27A 3I5NA 4BCOA 5GZAA 2CKQA 4ARKA 1IAJA 3POOA 2OF4A 3RPVA 2C5XA 5M4UA 3SVVA 1J91A 4JDHA 3MA6A 4O0YA 4D2PA 1NVRA 3B2WA 3VAPA 2JC6A 5CAUA 3FQSA 4D5KA 3AD5A 2GTMA 2H96A 4O0TA 4BTMA 4KAOA 5E92A 5FP5A 4I4FA 4R5SA 4DEAA 5F95A 2YM6A 4M0YA 1BKXA 3FXZA 5FG8A 4YPDA 4YPSA 4BI1A 3F3VA 2GNLA 2W4OA 3FDNA 4FSYA 2CSNA 4L8MA 4XMOA 2WTCA 3MVMA 3PFQA 3QCXA 3P08A 4FZ7A 4IIRA 3SOAA 3TNIA 4LDTA 4EKLA 5FEDA 4JAJA 2QLQA 3K3JA 2P55A 4NKAA 4QMMA 4Y5HA 3G2FA 5A9UA 4QYEA 2R9SA 2VTPA 4Y8DA 3CTHA 4KS8A 4RC2A 5BVEA 3IW6A 4FG9A 4BCGA 3FI2A 5JZJA 4X3FC 4O7TA 4YTCA 1OIRA 2GFSA 5IQFA 2R3LA 4HGEA 4U79A 4BTFA 4ZSEA 3SG9A 3FLWA 3KMUA 2OK1A 4L00A 3LXPA 5CT0A 2PU8A 4ITIA 4FTMA 4JS8A 3ROCA 3OG7A 5IA0A 2Y4IC 4NW6A 3R0TA 3BLRA 3RGFA 3F5UA 3H9FA 4X2FA 3NS9A 3PG1A 4FV9A 1FOTA 4IBMA 4L7SA 3NYVA 1Q8TA 2GS7A 1YXVA 2XNBA 3CC6A 3F82A 4LUDA 3PYYA 2WB8A 2OBJA 2X0PA 3HV3A 2VGPA 3BHTA 3KRLA 2UVYA 2VO7A 3FQEA 2C6DA 4LG4A 5HBJA 2HW7A 4OTWA 3A7IA 5DT0A 2ITOA 2XJ0A 4PQNA 3PIYA 3TL8A 3LQ5A 4BHNA 5A4EA 1CKPA 1PY5A 5G6VA 3W0PA 4XLVA 2IG7A 5ETCA 3LFFA 4QMWA 3L8VA 3A7FA 4U6RA 1VLRA 4ZS4A 1KV1A 4TWOA 2XKCA 3ORMA 3ZUUA 3JXWA 4OTFA 3UO5A 2W7XA 3GU7A 3ZO2A 3DV3A 4NZWB 4FKLA 5BMMA 2HYYA 2YHVA 3H0YA 4M69A 3PY3A 2I7QA 3A60A 4E93A 4F7SA 1PXOA 5IKWA 3U8WA 5M06A 3GP0A 2XK4A 5KZ0A 2PVHA 2R3FA 3F3TA 3CGFA 5E8VA 4AA4A 3PY1A 4XV1A 1HOWA 2AEGA 3QWJA 1Q8UA 2OIQA 3GU5A 4IWPA 4JT3A 2GDOA 3DZQA 5EK7A 3UO6A 2QU6A 4R7HA 4AX8A 3ZRLA 3HV6A 4C61A 4RRVA 4TYEA 2O5KA 4P5QA 1A48A 4UB7A 2YIWA 4U97A 2J51A 4WUNA 5CU3A 3FMLA 3VS1A 3BI6A 4XS2A 3QUPA 1WVXA 4F65A 2WO6A 3F3UA 1YDRE 3E8CA 3EQDA 3K5UA 4BCQA 4D9UA 5L2SA 3NUAA 2YWPA 1Q3WA 4R3CA 2QOBA 4EOLA 3ULIA 4HVIA 5D7AA 1WVYA 3VC4A 4O2ZA 2ITPA 3GOKA 4F1MA 4F9BA 1M52A 3IDCA 3EFKA 4P2KA 4D58A 5I9UA 5HCZA 5I9VA 1Q97A 5KHWA 2IW6A 3I6UA 1GY3A 1YI3A 3QD3A 2J0KA 5HVKA 2P0CA 2V55A 1QCFA 3RCDA 2BVAA 5KMIA 4QTEA 3R1YA 4I6QA 4ASDA 3CR0A 4FIFA 1URWA 4I5HA 3OCBA 3SKCA 3HAVA 2W1GA 3K3IA 4YGAA 5C8NA 4D55A 4UXLA 3SQQA 1SVEA 4BJJA 2C6MA 3RAIA 4QP7A 3BHHA 4EOIA 2QO7A 1F0QA 2UW0A 2QO9A 1XR1A 3ZXTA 2GNGA 3P5KA 2P2HA 4DLIA 2YITA 2CNUA 2DWBA 3R2BA 4OAUC 4G34A 2CGUA 5DBXA 5EG3A 2R3IA 5DHJA 4YUQA 1JWHA 4FE2A 5CAVA 4BZDA 4JDKA 5DMZA 4G3FA 5HI2A 3SG8A 2QD9A 4RIWB 4NK9A 3QC4A 4DEGA 4HCVA 1OMWA 4PDYA 3I0OA 3Q53A 4YP8A 2UZVA 4BDEA 5M4FA 4O6LA 5DR9A 4EK5A 5DYJA 3O23A 4RJ7A 2YA9A 1P4OA 5AR2A 3GOPA 1P4FA 4FMQA 5CASA 3O8PA 4C4FA 3H30A 3ZLXA 3U51A 3R7YA 2V0DA 2W17A 4MHAA 4XHKB 5K0KA 4DFYA 2RG5A 5B2MA 3C4ZA 5LJJA 5LMBA 4O7NA 3MFTA 3LXLA 3MS9A 5L8JA 4V05A 4XP0A 3VS0A 4ZY6A 3RTPA 2DS1A 3FPMA 4EKKA 1Z9XA 4DH5A 4FT7A 3NAXA 3QKKA 2YCQA 3QRJA 3S4QA 5JMSA 3QX4A 3COKA 3FLNC 4YLKA 4E1ZA 1VYZA 3NNXA 4NT4A 2Q0NA 3C4EA 3GC0A 3FZRA 3FL4A 4FZFB 4R1YA 1CKIA 4XP2A 4NYEA 4PF4A 3I4BA 2JKKA 4RZWA 4AXDA 5EHYA 4C57A 2C1AA 4YR8A 5ETIA 5G1XA 1VJYA 2XNNA 3GU4A 4MVFA 4ANSA 2NYAA 3G0FA 3MA3A 3ZDIA 2GTNA 5ETFA 2UZBA 3V3VA 3AKLA 4KD1A 3WZEA 2R2PA 4TWPA 1MQBA 3KA0A 3PWDA 4PPCA 5GHVA 1MRUA 3D4QA 4H39A 1W83A 4CZUA 4E5AX 3OVVA 2W5AA 2EU9A 4N4SA 3KY2A 4RLKA 1KUTA 4QQ5A 2CGXA 5ANIA 5T3QA 3KF7A 4CG8A 2BRGA 1SVGA 4GK4A 2Z7RA 3D9VA 4GS6A 4Q2AA 2C3JA 3JS2A 4X6RA 1OUYA 3VIDA 3IG7A 3D2KA 3EN7A 2FVDA 2QU5A 4X3FA 2OFVA 1G8JA 2HZ0A 5DGZA 3K54A 4K6ZA 5BVFA 3QQJA 4FNWA 2HXQA 3U87A 3LFEA 4AFEA 3EL7A 3LQ8A 5JZNA 3R7IA 2IEWA 4CFVA 5BX0A 2XRWA 3KB7A 3NUNA 2XNEA 4XBRA 1FMOE 4P7EA 4WD5A 4AT3A 3W2SA 3VUIA 4PTGA 4XRLA 3UNZA 3ZLSA 2XK8A 4G9RA 2V7OA 1PXKA 2Z7LA 5HESA 4IH8A 3HEGA 5M55A 2F57A 2RF9A 4FNZA 3U9NA 1TFFA 3NSZA 4LGHA 4YTFA 3FPQA 3UZTA 1B38A 2ONLC 2YJRA 3MIAA 5BVOA 4DGMA 3HDMA 2B0QA 3I7CA 4IWOA 4X21A 1OM1A 4C4JA 3DK7A 1ATPE 1PW2A 4IFGA 4UXQA 3RK7A 3UDZA 4B9DA 3MYGA 2QONA 1AQ1A 3CGOA 5H2UA 3PSDA 2X0QA 3VBWA 3UIUA 3VUDA 4WHZA 2C3IB 4L45A 3FMNA 1YRPA 2BCJA 2Q83A 3UQGA 5HO6A 3UIBA 4AUAA 4ZLYA 1SMHA 2QC6A 2BIYA 4FKOA 4J97A 4O7ZA 1H0WA 2FSTX 3WARA 5E7RA 5H8GA 1OGYA 1PRYA 1H26A 4RVTA 4UMRA 2YM5A 2XRUA 3P4KA 4FK6A 4EH2A 3LFBA 3KRWA 4BDIA 4DGOA 4DDGA 4L52A 2OFUA 2XKDA 3MN3A 4BGQA 2BIKB 3FMDA 4YZBA 5JFSA 4QTCA 1Q24A 2UW5A 2HXLA 3GQLA 3TZMA 3MVHA 5M44A 5B7VA 4B4LA 4IAAA 4AT5A 3R7VA 4DEBA 2Z60A 4HYHA 4O96A 3EN9A 5H8BA 3DS6A 4EWQA 1S9IA 1ZMUA 5LARA 5CF5A 4M13A 1H1SA 4IX6A 3UVRA 2IW8A 1RW8A 1NVSA 1W98A 4M84A 4U5JA 3A61A 5JRQA 2PMOX 2E9OA 3W2QA 4J7BA 4O91A 4Y83A 3IOPA 4E4MA 4U80A 2BMCA 2OH0E 4XG6A 1Q8ZA 4OTGA 4XBUA 4JMQA 1OIQA 4GIIA 4RIYA 3EQFA 3LVPA 4C36A 4UEUA 4BKZA 2GPHA 5CAQA 1CM8A 3ENHA 4YTIA 2EUFB 4PRJA 1IA9A 3CPBA 2XH5A 2W4JA 3MPTA 2EXCX 2FO0A 3TIYA 4QPMA 5D12A 4K18A 4ZXTA 5I9XA 5FM2A 1WBVA 3Q6UA 3U6IA 3ULZA 1S9JA 3LFCA 3DB8A 4TYHA 4AWIA 4C35A 3R7EA 3QLFA 2YCSA 3WZDA 1A06A 1XH9A 1OI9A 2QQ7A 4WOVA 4HVGA 3DLZA 2XJ1A 2FUMA 5HCXA 3LMHA 4YHTA 3OTUA 3I0QA 5IA2A 1MRYA 5DEYA 1ZYLA 3BEGA 3GQIA 4C02A 2UZUE 4YC6A 2X7OA 4TYGA 5CS6A 2XK6A 4ITHA 2B54A 3AMAA 4GCJA 1REJA 5AP5A 3UODA 4ANQA 4ZOGA 3RALA 5DRDA 1AD5A 3P7CA 3T8OA 3BHVA 4A4LA 1H8FA 4BIDA 2E9UA 5T6KA 3HMNA 4FEUA 2WMSA 1PXIA 1J3HA 4NM5A 4DG3E 1ZMWA 2OIBA 5AADA 1MRVA 3OXIA 3KXGA 3SC1A 1ZOHA 1W0XC 1O6LA 5FGKA 1ZOGA 3KU2A 1M7QA 1REKA 3JYAA 5M57A 3CD8A 3H3CA 1UNLA 3OC1A 3PXKA 1XH6A 3HRBA 1OB3A 4YJNA 4I6HA 4M0ZA 2CGVA 4O1PA 2VWUA 4YZCA 4BCHA 4DINA 2WD1A 2XK3A 3QD4A 4MXYA 1Q8YA 4RX9A 4QMSA 2OZAA 4AZVA 5M56A 3L8PA 2XB7A 4O6EA 3R9OA 1BL7A 3UOHA 1JLUE 1FGIA 3I79A 4IB0A 4L46A 4RC4A 4X3JA 4MNEA 5DWRA 3MB6A 2HWPA 3FWQA 5JN2A 4FT0A 4YHJA 4EQCA 1DAWA 1E9HA 3D14A 3QCYA 4CQGA 4DG2E 4GW8A 4BTJA 4PUZA 4MTAA 2W4KA 4E6QA 3UIXA 4LUEA 4NSTA 3VULA 4RX7A 3FYJX 1WFCA 4C4EA 4AZTA 4F1OA 5CXZA 2VO6A 3AC5A 4ZJJA 3Q5ZA 5D41A 1NXKA 3FZTA 4LOOA 3L9NA 4A06A 3FHIA 3RP9A 3BWFA 3VWAA 4UX9A 3COMA 2XNPA 1YOMA 2X6EA 2PVKA 2UW3A 3EB0A 2HELA 2OXXA 2JKMA 3TV4A 5IQDA 4AG8A 3UC3A 2OKRA 3R00A 4GG7A 3GCSA 4D28A 5CX9A 2UVXA 4ALVA 4V0GB 3D7TB 4CMUA 2VNYA 1Q61A 3MGYA 2GHGA 1URCA 2J0JA 3H0ZA 3QTRA 1GIJA 4QT1A 4BCMA 3TM0A 4DF3A 4E5BA 4KIPA 2W06A 1TVOA 3VBYA 2DQ7X 3V8TA 4S33A 4O0XA 1Q3DA 3PE2A 1PJKA 2UZNA 4YNEA 4RJ6A 5AMNA 3OWKA 3D94A 4A7CA 4IC7A 4EI4A 1LUFA 4RPVA 3DDPA 4JG8A 2OG8A 1H00A 5L4QA 4L6QA 4AGUA 4X2KA 3BU5A 3QA0A 5HICA 4DCEA 2BRNA 1IA8A 2JEDA 3PVWA 3TJCA 4EOSA 2JIUA 3OUKA 4UYAA 4BYIA 2VUWA 2E2BA 2OW3A 3QHRA 4CTBA 2PMNX 3OEFX 4CD0A 3QTIA