3UVRA

Human p38 map kinase in complex with km064
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
347
structure length
331
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
source organism Homo sapiens
total genus 116
structure length 331
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3uvrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3uvrA01
5I9XA 3QQJA 4RWLA 3HLLA 1Q8WA 3R8UA 3P9JA 2JDSA 3W18A 2HY0A 5IUIA 4AT4A 3MIYA 5FGKA 2J4ZA 4O6EA 4ALUA 2R3JA 3RPSA 1REJA 1S9JA 2JFMA 4KIKB 5IUGA 3BU3A 1TQMA 3HVCA 5HNBA 1YI6A 2C5VA 1JSVA 4KKHA 4FVRA 4M66A 5HBJA 4EHGA 1X8BA 2IW6A 3POZA 3O71A 4IDTA 3V5WA 4BRXA 3DB8A 3NLBA 1U59A 2OZOA 2YM8A 5K9IA 3Q96A 4BDAA 3NVMB 5HLPA 4EK8A 1VJYA 4M67A 1FPUA 2JDRA 2UW9A 3BHHA 2PL0A 1PRYA 3FLSA 5KNJA 3QKKA 4EQUA 3QTXA 1Q8TA 2GHMA 3E63A 4O38A 3R9OA 4DBNA 1R78A 2P55A 4JBVA 3BRBA 2PUNA 2ZMDA 1GOLA 2G1TA 2JKMA 3NIZA 4L46A 3HUCA 2JC6A 5EOLA 3VS7A 4WOVA 4CV9A 3JYAA 4GYIA 4OBOA 4L00A 4C58A 3Q4ZA 1QMZA 4A7CA 2BRMA 2FUMA 5KMKA 2QLQA 4BDDA 4GFGA 5E8WA 4W8DA 1YI3A 2UZWE 4GUBA 3S95A 4BYIA 5CEPA 4R7BA 3IW5A 4FT9A 4LL5A 3VS6A 2O64A 4HW7A 4GKIA 5DFPA 4DEAA 3SG8A 5C8NA 2Z8CA 4MNEB 3PSDA 4BICA 3ZSHA 2BILB 3KKVA 4N6ZA 4YJRA 3U4UA 2C3LA 2B9HA 1G3NA 2O65A 4C4HA 5GIOE 3LQ3A 4A07A 3NNVA 1LUFA 2VTNA 4JNWA 4A9YA 3L1SA 4FTUA 1JSTA 3COHA 3SRVA 3ZRMA 4CYIA 4Q5HA 5CEOA 3RWQA 2XKEA 4MCVA 4PTCA 2JDOA 3OY3A 5FDXA 2W05A 3A2CA 4GK4A 4FSTA 5DVRA 2GDOA 4G6OA 4D4YA 4O82A 3HZTA 5C4LA 4RVMA 2WMVA 3JY9A 4WSQA 5EFQA 4YSMA 4BCMA 2WTWA 4OR5A 4Y85A 5E8SA 3N9XA 1OIQA 2R4BA 1WBTA 2UV2A 4PNIA 4FIGA 2X7FA 4R3CA 3ZO3A 3F3TA 1OL2A 1JLUE 3EFWA 2QOCA 4RQKA 5KHWA 1PHKA 2C6LA 5EDPA 1OL7A 3PUPA 3BE9A 4ONAA 3ZBXA 3RP9A 4K1BA 2G9XA 2PVMA 3BPRA 3QCYA 4OW8A 5ANGA 4IW0A 2IWIA 3TUCA 2QODA 4F1MA 1APME 5CY3A 4I24A 5E7RA 3NMUF 2QCSA 3TCPA 3NIEA 4ASEA 3FLYA 3PY0A 1ZAOA 4CFNA 4WBOA 4YTIA 4R1YA 5GZ9A 3NSZA 2GS6A 4MD9E 4U3ZA 3VO3A 2R9SA 3FAAA 2BUJA 3ZLSA 2VWBA 4IJ9A 4NM0A 4Y73A 5KZ0A 3IDBA 5M4IA 3PZHA 2WU6A 4RA5A 3L9NA 3S2PA 4XV2A 3DKFA 1WBSA 2BVAA 3K5UA 1UU7A 2W1EA 3LFDA 1MRYA 3M2WA 1MRVA 5IKWA 5ACBC 4CCBA 2GMXA 2Z60A 5FLFA 3DFCB 5ANOA 5FRIA 5J9LA 2W96B 4AFJA 2P2HA 3VUKA 5DWRA 1ZRZA 2FA2A 3Q5IA 4JQ8A 4BIBA 2E9UA 5I9YA 4C33A 5LCJA 3HV4A 3BWFA 4PMPA 2GQSA 4JBOA 3G5DA 4J98A 1SNUA 2JGZA 3D94A 1Q61A 1KE6A 5FBNC 1KOAA 1UVRA 3TIZA 3BLHA 2YERA 4AXAA 1YI4A 3EQGA 4AZTA 4J7BA 3VUTA 3FEGA 5CAUA 4ZJVA 2PVLA 5HI2A 2VTJA 1URCA 2VTTA 5BVWA 3K54A 4Z7HA 2C6MA 5HBHA 4C4FA 4UWBA 3OF0A 4WHZA 3TV7A 3GI3A 3F2NA 4B7TA 2XNGA 3UYTA 2EU9A 3ENHA 4E4LA 2Y4IC 2WZJA 2NRUA 1PMUA 4NW5A 2IG7A 4J95A 5AR3A 5AP7A 3P08A 1V0OA 3O96A 2GNGA 3VW8A 3HAMA 5JEBA 1ZLTA 2JFLA 2I0VA 4G17A 3EQDA 1DI8A 5DI1A 4F7SA 4E4XA 2JBPA 2BMCA 2YZLA 3G90X 3QTRA 4UV0A 3FXXA 3LQ8A 2JBOA 5M44A 2YACA 1JNKA 3SKCA 3TG1A 3H10A 4GG5A 1XH7A 3TNHA 1IA9A 2BRBA 3AT4A 4YMJA 4O96A 3ZM9A 3R1YA 2BDWA 3OBJA 3TZ9A 4X2JA 5HORA 4ACDA 1H1WA 3QRUA 4CZTA 3UVQA 2LGCA 3RNIA 1ERKA 2V0DA 3I79A 3PXYA 4YPSA 4M3QA 1TQIA 3QC9A 4RX9A 4FTRA 5KMJA 2WQNA 2W7XA 4U79A 4BDIA 5DGZA 2WQEA 3ACKA 3QQHA 2P3GX 4FTIA 2XNMA 5HQ0A 3R2BA 3ORTA 5L8LA 1KSWA 3W1FA 4FVPA 3R28A 3U6HA 4FNXA 4X2FA 3QF9A 3IKAA 4TPTA 4MKCA 4V04A 2YM6A 3SQQA 3UPXA 1OL6A 4CGAA 4J52A 1UWHA 2ERKA 4W8EA 4Z9LA 5I3OA 2W5AA 1Q99A 4A4LA 3BU5A 4ANSA 3VVHA 2B0QA 4BDBA 1JSUA 3SW4A 4O84A 3FYKX 2R3GA 3W2RA 1KUTA 4GUEA 3KRWA 3D2KA 4C4EA 2B1PA 2R3KA 3TJDA 2A27A 1Q3DA 1JKLA 2IN6A 3QD2B 2Z7LA 3KMMA 2QOIA 4AT5A 4BY9E 3D0EA 4FZ6A 2R3LA 5K5XA 5JN2A 1J1BA 5TR6A 2RL5A 3LCTA 3PXZA 1XJDA 4O0XA 3QALE 5CASA 4XRJA 3EHAA 5CSHA 5HVJA 3U8WA 1SNXA 2ITUA 4RIOA 5ANEA 5M51A 2YIRA 4ZLYA 5EHLA 3ACJA 1J91A 3NW6A 4QOXA 1UKHA 1QPCA 2QOBA 4QYGA 2FVDA 4BWKA 5M06A 4QTCA 5FDPA 1OM1A 4I93A 4FKOA 2RGPA 3BU6A 2RFNA 5EHYA 4Q9ZA 3OW3A 5KUPA 3MGYA 3DU8A 4RZWA 5AUYA 1E9HA 5HO7A 2R5TA 4NKSA 4BN1A 2XM9A 1M52A 4YJVA 5AUWA 5I9UA 1UA2A 3QTWA 4H3QA 5EQPA 4NK9A 4JRNA 3IK3A 3UIUA 4UBAA 4QMOA 2F7EE 5B2MA 3DBEA 4EHZA 4PL4A 2GFCA 4YBJA 3L8PA 4WG5A 2W1CA 4DH3A 4FV2A 2BRNA 3Q5ZA 4TYJA 4I21A 4EONA 2PE2A 5F20A 5T6KA 1ZYDA 1J7UA 2YM4A 3IW6A 2VTOA 1WBOA 2YJRA 1H28A 4RIWB 5E91A 4USFA 4QYYA 2VO3A 3E8EA 4O91A 1I44A 5HIBA 2OZAA 4CFXA 4CV8A 1GIJA 3HA6A 2PTKA 2R64A 4IVBA 4X6RA 3E7VA 4J8MA 2WTKB 4O83A 3PRFA 3KCKA 4NM3A 3N4UA 1MQ4A 4ANLA 2XK8A 2R2PA 4R6VA 4C02A 4O0WA 5A54A 5IA2A 2BPMA 1JKTA 4QMPA 5IEVA 4C4GA 3DY7A 1JKKA 4F6UA 3NYOA 4EZ5A 1XHAA 4RRVA 1YDRE 3U9CA 2I0EA 3U6JA 1Y6BA 3MTFA 4ZZOA 4G3GA 4P90A 5AP3A 4CQGA 3MJ1A 3EMGA 1YWRA 3DDPA 3EYHA 3I81A 4LI5A 1JWHA 1YVJA 4FL2A 4ZP5A 5IQCA 3ZZEA 4IMYA 2VWIA 4YP8A 2PVYA 1O6YA 5C01A 5AADA 5FEEA 4AN2A 5TOZA 4JDJA 2CJMA 4U0IA 4W4WA 5HLNA 3K2LA 3QRTA 1BX6A 1PXLA 5EK7A 3FI3A 4E73A 5E8TA 2W5BA 3F88A 3PJ1A 3L8XA 4EC8A 4E4MA 4XV1A 4DG2E 4XG4A 4QMTA 3B8QA 2VRXA 1W84A 1R0PA 2O63A 4JOAA 3QU0A 2IW8A 1JAMA 4QMYA 1QCFA 1PMVA 2PZRA 2BZHB 3PP0A 3IGOA 3SRVB 3ZM4A 5KMOA 2QC6A 1L3RE 3VS5A 2H6DA 2GS7A 2A2AA 1IAHA 1CKJA 2PHKA 4C3PA 3E92A 3C4XA 3VNTA 5LMKA 3PXRA 2WMRA 3ZLWA 2E2BA 2RFSA 4LGDA 4E8AA 1I09A 2J2IB 2YCSA 4ZIMA 1H1RA 3PXKA 3UZRA 3D7TA 4UZHA 5CXZA 1RQQA 4I23A 1M2QA 4N57A 3VUMA 5CT7A 3VF9A 1YDTE 4UMRA 1YXXA 2OU7A 4KABA 4E5WA 2V7AA 5EYDA 4F99A 1H01A 3N4VA 5IA1A 3TTIA 4DFUA 2OF4A 4LRKA 2C6IA 3RM7A 3H4JA 4X3FB 5CS6A 2G15A 4N70A 3P86A 4GEOA 5GJFA 4DA5A 4GV1A 4XP3A 3OOMA 4TW9A 4U45A 1XH5A 2QO7A 3LQ5A 4OBQA 3I60A 3PWDA 2UZNA 3R8ZA 1YXTA 4H1JA 1OZ1A 4GRBA 5DEYA 4JI9A 4X0MA 3CGOA 4F9BA 3ATTA 2JKQA 2RG5A 4F7LA 3LLTA 4WG3A 3P7AA 3MWUA 3NZ0A 5KMMA 2Y6MA 3GU6A 4BDFA 3RHXA 4Z55A 4DTAA 2Q83A 4KBCA 4O7NA 2OH0E 4RQVA 4I6QA 4AAAA 2HCKA 3DNDA 4CKJA 2C3JA 4XYFA 2YCQA 3ORZA 4FKRA 3DBDA 4TKSA 2UW5A 3R83A 4DEDA 4EJNA 1KE5A 4TRLA 3WYXA 1LPUA 3NYVA 5K4JA 3C4WA 3PJ8A 4HOKA 4WSYA 3R9DA 1Q4LA 1B6CB 4FTOA 5DPVA 4F4PA 5CSPA 3O50A 4IIRA 3UP7A 3G9LX 3D83A 2VUWA 3QLGA 2R3MA 4QP9A 5B2LA 5J1VA 5DHJA 2VTIA 2CHLA 4IAFA 4QQCA 5TO8A 5M53A 3DZQA 5HIDA 5ETCA 3CD8A 4ZTNA 1Q8UA 3ITZA 4IX4A 5H2UA 4GT3A 4DHFA 3DDQA 4QYHA 4CKIA 4ZS4A 4EQMA 3FMKA 3VBTA 3CSVA 2XA4A 3BLRA 5A9UA 2Z2WA 4F9WA 1W82A 1ZYCA 4R7HA 1AD5A 3PPKA 4QP3A 1UU3A 3HRCA 3QAME 1ZYJA 2IZUA 5AEPA 5HTIA 3D7ZA 2PVJA 2VTRA 2WB8A 5HE3A 3TJCA 3VUGA 3TKUA 5BVFA 5HO6A 3DK7A 3CIKA 4X7QA 5CU2A 3TDVA 3ERKA 4RPVA 4BGGA 3GOPA 3EN5A 2EVAA 4HGTA 4C4JA 4CNHA 4IAYA 3D5XA 3EQHA 4QP4A 2EXEA 2YDKA 3FMMA 2X6EA 3E5AA 3P7CA 3MA3A 4L53A 4G34A 4XS2A 5JQ8A 2XIKA 3LAUA 2BRHA 3W8LA 3QTQA 3DTWA 2YWVA 4BHZA 4MXXA 1YHSA 3PXQA 4YJNA 4DF3A 4LGGA 1ZARA 4C62A 3B8RA 4QP1A 4IB1A 2VTLA 2B9IA 3BGQA 4YJSA 3D5UA 4GJ2A 4QP7A 1QL6A 4JBPA 1VEBA 3PXFA 4FZFB 5F1ZA 4D4VA 5AWMA 2X1NA 4EZ7A 4FGRA 2QNJA 2XP2A 2WMSA 4KBAA 1XR1A 4CKRA 5LQFA 2Z02A 4F0GA 4IAKA 4PF4A 5KE0A 3MJ2A 2W4KA 4LRMA 3BX5A 5ICPA 4U41A 3ZFMA 3GXLA 2HZ0A 3C5IA 5JFWA 2ITOA 2Q0NA 4DEBA 3PIZA 4BGQA 2HENA 4FIJA 4C0TA 3HV5A 4U44A 5EQEA 2E9NA 5B7VA 4NZWB 4DLJA 4F9AA 1ZYSA 3UZPA 5CALA 3RZBA 4ZMEA 3K3IA 4FNWA 4OTQA 2ZB0A 4LRJA 4MTAA 5M07A 2ACXA 2JAVA 5LMKC 5E9EA 4O6LA 2FB8A 5IMEA 4AACA 4FV6A 4MAOA 4NU1A 1PXOA 2XF0A 2BKZA 4W9XA 2HZNA 5AAFA 4PL3A 2BR1A 4D5KA 4FV7A 4ZSEA 3TN8A 3R01A 3A99A 5E8VA 2QKRA 4YZDA 3Q9ZA 3KRRA 5CZIA 3I0QA 1BMKA 2PULA 3ZUTA 1G8SA 3FZTA 2ITNA 3GCVA 2YHVA 3E8CA 5FP5A 4FSZA 4JR3A 4AZVA 5IF1A 3TV4A 2Y0AA 3WZKA 3QCSA 2G2HA 3EN9A 3HP2A 3O51A 3QXPA 4QMUA 3AC1A 4EBWA 4RLLA 1ZWSA 3F5PA 5FEDA 4FTQA 2VWVA 4HYIA 5C1QB 4GK2A 1PXMA 2OFUA 3R8MA 4UMPA 3IOKA 4G31A 3GU8A 1LEZA 1MP8A 3KXNA 3AD5A 3FHIA 4IB0A 1WVYA 4USDA 3ZZWA 2YIWA 4BR3A 4IBMA 1FMKA 4L7FA 4LV5A 3KA0A 3QA8A 4LM5A 4YSJA 5GZAA 4IX6A 3ROCA 1NA7A 3P23A 1ZMUA 4UMQA 1LP4A 2FH9A 2R3HA 2VGPA 3OY1A 4QQ5A 3ORPA 4R5YA 3MVJA 4OUCA 2O0UA 2BIKB 4QMQA 3UG1A 2V5QA 3DKCA 4FSWA 4G16A 3RINA 1U46A 4FZAB 2UW0A 3AXWA 4JS8A 3G2FA 4YJOA 1WFCA 1H26A 4IXPA 4MBJA 4RA4A 3BHVA 3P1AA 3RAWA 2OZAB 2X2LA 2YITA 3G33A 4MQ2A 3ZRLA 4GL9A 4IJPA 5FP6A 1SVGA 2OF2A 3PLSA 3RK5A 3L8VA 3S1HA 2B53A 1WBWA 4H58A 3PWYA 4TYHA 4PNKA 5HNIX 4AX8A 3AT2A 1XH4A 3NW7A 5D7AA 5ITAA 5DT3A 3WILA 3NVKI 4EK6A 3ZTXA 1M2PA 5DOSA 5L8KA 4NFMA 4DEIA 3MY0A 1OPLA 3QWJA 2VTQA 3SAYA 4BZOA 5EDRA 5DT4A 4ERKA 4U40A 2XM8A 4AOTA 3RK7A 2PSQA 3Q60A 2GCDA 4DAWA 4KA3A 4AA4A 5A4QA 2C6DA 4EH4A 3EN4A 2ZAZA 1E1VA 3FQSA 3HDNA 5BX0A 4EOKA 4Q9SA 2Y9QA 3ZSGA 1R3CA 2FSOX 3ETAA 2ITPA 2J5EA 3M1SA 3DK3A 5CEMA 3L8SA 5IISA 4AOIA 4CFWA 3BQCA 2BTSA 5C03A 1P2AA 2VX1A 1PW2A 5CU3A 3BE2A 4JG8A 4C2VA 1R39A 2J0KA 2JIVA 5FM2A 4GIIA 4I0SA 5AP0A 1V0PA 3O8PA 3UTOA 2WTIA 4PY1A 3R2YA 4M69A 2C5XA 2PK9A 4GVAA 5A3XA 5M55A 4FGBA 4UWCA 4AZEA 2QU6A 3QCQA 2UZOA 4OTGA 3F5XA 2W4OA 3VJNA 4FTJA 4FTNA 5D10A 1B39A 1KV1A 4OT5A 3CPCA 2GNJA 5EW9A 3GU5A 3NEWA 3UP2A 2WFYA 3GC8A 4MHAA 3V5PA 2RIOA 3GGFA 2ZM4A 3B2TA 3CC6A 3LJ0A 4I0RA 3HMNA 3KVXA 4EOQA 4ZAUA 4OTFA 2CCHA 2R0IA 3CKWA 5DLSA 5HG9A 2ONLA 3V8SA 3C1XA 4XHKB 2H8HA 4YPDA 3FL4A 4ZTHA 1Y8YA 2GU8A 2IZTA 5JK3A 4NUSA 4TWOA 4WNKA 5L8JA 2JDVA 2WMBA 3TNIA 4YBKA 3R22A 3WF9A 3NS9A 3EQPA 4IACA 4ZLOA 4QMMA 1UKIA 4D1SA 2W9ZB 1PF8A 3DA6A 3UMXA 3MB6A 4F9CA 3DXPA 1R1WA 2WELA 1SVEA 3T9IA 5IEXA 1PJKA 4JRVA 3LJ1A 3VBXA 2H9VA 4AZSA 4MH7A 4CRSA 5I4NA 2VAGA 3A60A 4X21A 4DFYA 2QU5A 3AMAA 4H05A 2C6KA 4LUDA 1ZYLA 3KMUA 3Q3BA 2ERZE 4JX7A 4XRLA 4O21A 5A6OA 3OMVA 5FXSA 4AP7A 4FEVA 3MPAA 1OBGA 1H8FA 5AM6A 3RAIA 2WTDA 4BVUA 4RIYA 1FVTA 3C4ZA 5HLWA 3UVRA 5AV0A 1UV5A 5CI6A 3O23A 3OCTA 4ZLZA 5LVNA 4GYGA 1L8TA 3C7QA 2P2IA 2SRCA 4KBKA 2WMXA 4EOPA 3I7CA 2EB2A 3CJGA 1TKIA 4U3YA 4ZSLA 5M57A 2GNHA 4BCKA 3EL8A 5DA3A 1OMWA 4YO6A 3RPRA 5IU2A 4KKGA 4Z16A 4H1MA 4IWOA 2V62A 2PMNX 4GK3A 2HWPA 5AR5A 3QKLA 5HG5A 5EYCA 1R0EA 3G9NA 4FR4A 5BMMA 4KAOA 1DAYA 4FA2A 5J9YA 3OWLA 4IH8A 3AD4A 3P4KA 4JQ7A 3RMFA 4GT5A 5D41A 5CZHA 4EQCA 4K18A 3HECA 3LXPA 1WVWA 3U51A 4GKHA 5K3YA 5AV3A 2VX3A 3VS3A 3OUNB 2A0CX 3QBNA 3UE4A 2I7QA 4R8QA 4XG8A 4IADA 3VULA 1JOWB 2W1GA 4BTJA 1RJBA 3KC3A 5KMIA 3D14A 1FVRA 2R7IA 3KULB 3KXXA 4NIFA 5HD7A 2HW6A 4JIKA 3GB2A 3BV2A 2PZYA 4PRJA 4PMTA 3ALNA 4U8ZA 4Y83A 1IASA 3DV3A 3LOKA 2ITZA 4CQEA 3AC2A 4O0UA 4O1PA 5FTQA 4DFXE 5J7HA 4D2WA 2XKDA 4FV1A 1Z57A 4BTFA 3EQBA 3IOPA 3EJ1A 4QP8A 4ANOA 3RPYA 2ETRA 2UZUE 3ET7A 4GU9A 1JPAA 3I7BA 4MWHA 4WT6A 3AQVA 4XUFA 4XOYA 5FXQA 5KX8A 2CNVA 4OAVB 4HJOA 5AA8A 1XH8A 3ZXTA 2VWUA 3O8TA 3UPZA 1Y6AA 2OH4A 5HO8A 2XEYA 5LWMA 4HYUA 1U54A 3COMA 3VIDA 4C35A 4E4NA 1Z5MA 3NYNA 3VRYA 5FTGA 3DKOA 3O7LD 5EM8A 3TZ7A 3VBVA 5CNNA 3WZJA 3A4OX 3PIXA 4IWPA 5J5TA 2HWOA 3IGGA 4D2TA 4MXZA 3Q2MA 4II5A 2BDJA 4ANBA 5IH4A 1NVSA 5E8UA 2W5HA 3LMHA 5BYYA 3UOKA 1HCLA 3OP5A 5AUVA 4EUTA 3NNWA 4IAZA 1PXJA 4L44A 2WEIA 5KKRB 2WIPA 4JG7A 3IW7A 4AGDA 4BHNA 4FIIA 2PU8A 3H9OA 4MYGA 5DN3A 4EK3A 4HVHA 2XIRA 3G6HA 5IH5A 3ZS5A 4RIXA 3O17A 3KMWA 3MVLA 1ZOHA 4H36A 2YABA 3NDMA 3LJ2A 4FZ7A 2ETKA 3RKBA 4JJRA 4L52A 3VN9A 4EHVA 3DJ6A 4EH2A 5A6NA 4DH8A 2ONLC 1HCKA 3W2SA 2OJJA 3G0EA 4B99A 4G2FA 4QT1A 2XCKA 5HCYA 3GVUA 4KIOA 3RCJA 5DG5A 5GNKA 4RVTA 4B8LA 4BC6A 5AR8A 2HAKA 4O1OA 3GBZA 2CMWA 4RX5A 3U9NA 3OEZA 3UO5A 4JDKA 4UZDA 4LUEA 3THBA 2H34A 4R3RA 4ASZA 3VQHA 4AWIA 4UYAA 4HGSA 2QKWB 3ZLXA 5AX9A 4CFMA 3DQXA 2E9PA 3GFEA 3U6IA 2ZOQA 4NSTA 2JITA 4ACHA 2J0LA 3VS4A 2WIHA 4S34A 2UZDA 4DH5A 3G51A 2VWYA 1GNGA 3F69A 4I4FA 2XIXA 2XNNA 3JVSA 2RSVA 4IX3A 2QG5A 4EHEA 5CANA 2KULA 3OOGA 4GIHA 5AIRA 5IEYA 3HV7A 4EOLA 5J8IA 3FKNA 3LHJA 4FL1A 4FNZA 4Y95A 5EI6A 4LV8A 1Q62A 3TTJA 2C30A 3EZRA 5DRDA 1UU8A 2RF9A 3ALOA 4HPUE 4HGLA 3BZ3A 2UVZA 4TWCA 3D4QA 4FE2A 4C4IA 2XK9A 1Y91A 4ZJIA 1GZOA 3FQEA 1V0BA 4CFVA 3T3UA 3R7OA 4E5AX 5I9ZA 1V1KA 5AX3A 3HAVA 4ASDA 4R77A 2NO3A 4ENXA 2OICA 2C4GA 5HKMA 3REPA 4UWYA 4AGWA 3MH0A 4I94A 3SD0A 3FWQA 2GFSA 5AP6A 4UX9A 4KINA 2IZSA 5E92A 4A9SA 4FC0A 5M4CA 3OZ6A 3OFMA 4TYHB 1J1CA 3QQGA 2W4JA 3DT1A 3MY1A 4G9CA 4JIAA 5D7VA 5AR2A 4BYJA 5M09A 2ZV9A 4DINA 4TT7A 1VYWA 4NCTA 3EN6A 3GENA 4IB5A 1XH6A 2I6LA 4YZCA 3L9LA 1YDSE 2QO2A 2Y8OA 1F0QA 5L2SA 3P0MA 4JL9A 2ITVA 4YU2A 3RPVA 3QLFA 4D2RA 2OXDA 3QX4A 4FIHA 4DEGA 3WF7A 3TACA 3H0YA 4FV4A 5J1WA 2OXYA 1W7HA 3MB7A 5C8MA 2B55A 3R8VA 3MIAA 4ZSAA 3UOHA 3CQEA 3KCFA 3IDCA 1XKKA 2G2FA 2XK7A 4O2PA 4ZY5A 4C59A 3D5WA 4BKJA 4FZDB 3OT3A 4DC2A 2VV9A 1H1QA 5DE2A 3CTHA 4OTRA 5C9CA 3V5LA 3LMIA 2P4IA 3V6RA 4FK6A 4F70A 4M69B 3HMIA 4CG8A 2UVYA 2OJFE 4QYFA 5HTBA 3W2CA 3ZXZA 3DGKA 3K5VA 4LYNA 4AT3A 2ITTA 2F7XE 4ITJA 4YLKA 5EKOA 4ZSJA 4BIEA 1YKRA 3F9NA 5HVKA 3VS2A 1RE8A 2GHLA 2YM5A 5BQ0A 5I9VA 3ZLYA 1Q8YA 4AQCA 3R30A 5L4QA 4RSSA 3OXIA 4LMUA 3R21A 2J0IA 1YHWA 5HHWA 3QRJA 3CCNA 3DJ7A 4IHPA 3CXWA 4NH1A 3SOCA 4FKGA 5BNJA 2YCFA 5CAVA 5D1JA 1SVHA 1Q41A 4FKPA 4B4LA 4R5SA 5LJJA 3FSFA 4PWNA 4ACCA 5E1SA 2EXCX 3FL5A 4QP2A 2X2MA 2YA9A 4AN9A 3GCSA 5AM7A 2WEVA 2WMUA 4M0YA 4RX7A 4S31A 4N4SA 4D28A 3BKBA 3NX8A 4I0TA 4FK3A 3ODYX 3QTSA 2XIYA 2A1AB 2CLXA 4BCGA 3NW5A 3R9HA 4V0GA 5IQEA 2PE0A 3Q6WA 3FPMA 3AC8A 4QP6A 4WRGA 5HU3A 3N51A 4IVDA 4J97A 3FMEA 3RCDA 3WIGA 3Q32A 4IE9A 1W0XC 4FV9A 5JQ5A 5HIEA 5LXMA 2CLQA 3ORIA 4A9UA 3HNGA 2QD9A 3DXQA 5EI2A 4JXFA 5KHXA 5CLPA 3ZRKA 1ZY5A 3KFAA 2BFYA 2GPHA 2Y4IB 3LE6A 4RIYB 2V55A 1OI9A 1OPKA 2VWZA 2C1BA 4WNMA 1YXVA 5EG3A 2HXLA 4J71A 1JQHA 4ID7A 5AJQA 2ZDUA 1XWSA 3GOKA 4O0RA 2YN8A 3NCGA 2F4JA 4EC9A 3FMNA 4I4EA 2ITQA 1MRUA 3M11A 3A7HA 4MVFA 1P14A 5HEZA 2BROA 3UVPA 4QO9A 2C68A 4FKSA 5TT7A 1NW1A 5HVYA 2OLCA 3U4WA 3VHKA 5GINE 2VNWA 2HOGA 1WBNA 3PVBA 4CVAA 3P78A 1UU9A 4FKWA 4GU6A 4BF2A 3BELA 1M2RA 4R78A 3GU4A 4XH6A 4F7JA 3VW6A 3UOJA 3EL7A 3LFBA 3FBVA 2WTJA 3A62A 4RVLA 3W2QA 3AD6A 4FTLA 4U7ZA 4QMLA 4W9WA 3ZCLA 3NUAA 4K77A 2X7OA 5F94A 2PVRA 4BTKA 1SYKA 2ZDTA 2HXQA 3PJ2A 5JRQA 3A4PA 4RJ5A 1OIYA 1QPDA 3R71A 4FSNA 4KIQA 2XEZA 3LFFA 3QD3A 5FEQA 5K0KA 4FKTA 4IM3A 3OW4A 3SHEA 3ZUVA 3IG7A 3ANQA 3C5UA 3OXTA 1Q5KA 1JKSA 4I3ZA 2PUPA 4JBQA 3MPTA 3HGKA 4XV9A 5A14A 3UOLA 1AQ1A 1YWNA 3HYHA 2IO6A 2W1ZA 4O7YA 4IANA 2BFXA 4YHTA 3OWJA 2VD5A 3PRIA 2PVHA 4AOJA 4NCTC 4XCUA 4BI1A 1J7IA 4PDSA 4MD8E 2R3RA 2ITWA 5AV1A 4ARKA 4C37A 3FZPA 2UZTA 2AC5A 3OUKA 4RX8A 3FZOA 2F2UA 4ALVA 5DR9A 4HVDA 4H3PA 1U54B 2VTSA 4ITHA 4PTGA 3HMOA 4QD6A 4QTAA 3LCOA 4FV8A 5KO1A 1PY5A 4EH6A 4FSMA 3BBTB 4FEWA 3PSBA 2OGVA 3CR0A 3E8DA 1Y57A 3CKXA 3JPVA 3ZFXA 2JIIA 4IC8A 3C0HA 3DS6A 4BI2A 2X81A 3FYJX 3PFQA 4E3CA 3ZDUA 4EZ3A 3R7VA 3BYUA 4KRCA 4BBEA 3TV6A 2Q0BA 2HY81 1AGWA 3DAEA 2W06A 3FLQA 2HZ4A 3T3VA 5E4HA 4TNDA 2BTRA 4CFFA 4D4SA 3DB6A 4NW6A 4EUUA 3W10A 2XH5A 1Q24A 2F9GA 3CE3A 2HYYA 2IVSA 4BBMA 2R3OA 1H07A 5ANDA 3DKGA 4IDVA 2QR7A 2X8DA 3PA4A 5CEQA 4A06A 2NP8A 3EFKA 2PMOX 3RGFA 5EW3A 3BHUA 4AF3A 3QUDA 1K2PA 3JUHA 4G3FA 3I4BA 3W55A 4RIXB 3EN7A 3R8LA 4NKAA 5J7BA 3IQ7A 2WD1A 3ZONA 4MQ1A 2BCJA 2PMLX 2XKFA 3F7WA 3UQCA 4KSQA 3CS9A 5ANKA 3SLSA 2R3IA 2OIBA 4P7EA 5HCXA 4RLKA 4FX3A 1GIIA 4IQ6A 4Q5EA 2EB3A 2R3FA 5G1XA 2CNQA 2DUVA 3ULIA 4LOOA 4C8BA 2WQMA 3QRKA 4OGRA 3ZEWA 2YM7A 1WZYA 4FG7A 1WVXA 2YAKA 3CD3A 2XIZA 3GNIB 4Y8DA 2YFXA 2PPQA 2YJSA 4QMWA 4PMMA 3GQIA 4PPCA 4EYJA 2R3QA 3PY3A 2BZKB 2DWBA 4XG2A 4DT8A 5HOAA 3NUYA 4I41A 1H25A 1QPJA 4I92A 3A7IA 3A8XA 4EWQA 4FTAA 2VO7A 4DH7A 4FSQA 3NCZA 2OW3A 5GZ8A 2QOHA 1NVRA 2HK5A 4UMTA 5ETIA 1H27A 2C5YA 5HGIA 1BUHA 2XZSA 2UZEA 4RBLA 3ZO4A 2ZVAA 4AGUA 3PLAE 4RC2A 3DLZA 5L3AA 2H96A 2XRWA 4NM5A 3R9RA 1EH4A 2G01A 3VJOA 3BI6A 2C6EA 2C5OA 3GQLA 2VN9A 3E3BX 1ZMWA 3IW8A 3VS1A 4O2ZA 2PVFA 4F09A 2WXVA 5CNOA 5HICA 4DTBA 4B8MA 5JSMA 4I5MA 1H4LA 2O2UA 3LFEA 4AW5A 3FE3A 2XUUA 5TF9A 3EQIA 4YHJA 4BWXA 3FLNC 4PP7A 4G3DA 4S33A 2V7OA 1BKXA 4A4XA 2PUIA 3JXWA 3R02A 5AMNA 2IW9A 3TNPC 4A9RA 5CEIA 4BCFA 3RK9A 2VTHA 2W1HA 2XK6A 1OIRA 1ATPE 1SM2A 3LFNA 4QYEA 5G6VA 4C61A 3HP5A 4D2VA 2CKPA 2PVNA 1DS5A 3RJCA 3NGAA 3PVUA 4RG0A 3CEKA 3QTUA 5EYMA 4BDCA 1ZMVA 3ZEPA 3F3WA 3NNUA 3UYSA 2UW4A 3PE2A 3RM6A 4EKKA 3ULZA 5FQDC 1GY3A 1K3AA 2QR8A 2CGUA 4HGEA 3CTJA 3RTPA 4DEHA 2CKQA 2VWXA 1O6KA 2OFVA 2PE1A 1MUOA 4X2NA 4AG8A 3KN5A 2A4LA 3SVVA 2UZVA 2ZB1A 4NFNA 5DIAA 3GFWA 2X9FA 4XG6A 5CAPA 5M4FA 3TWJA 4BCPA 1OBDA 3WZUA 2UW6A 3F3ZA 3PVWA 3MW1A 4CTBA 5IUHA 3CPBA 3PPJA 3BLQA 3ID6C 2O3PA 4FF8A 3QC4A 4DLIA 4O7VA 4FSUA 3WBLA 3KU2A 4IZYA 4F1TA 4ZTRA 4GFOA 1PMNA 5JKGA 2GNIA 3GUBA 4EORA 4QMZA 4ZTSA 4IZ7A 2GHGA 4FIEA 4RMZA 2J5FA 2OWBA 2PYWA 3SV0A 4AUAA 2XNPA 4GT4A 3DTCA 2J0MB 4J53A 1M7NA 3ZH8A 4FKLA 1OKVA 4GS6A 3BGPA 3F82A 1XQZA 4NTSA 5HD4A 4PMSA 5H3QA 5EM5A 4HCTA 4NJ3A 5E8XA 4JDHA 4C3FA 2FSLX 3E88A 3NYXA 1GZ8A 3IS5A 3QFVA 2WU7A 4FBXA 3F7ZA 3COIA 2IPXA 4XG3A 3FQHA 3NPCA 3GCPA 4KSPA 3EB0A 4AW2A 3QD0A 4DYMA 2FGIA 1FGKA 2CGWA 3PTGA 4FTCA 3FKLA 3ZO2A 1Q97A 5CF8A 4U42A 5KBRA 2QOQA 4N0SA 2HELA 3FI4A 4C36A 3QZFA 5IPJA 1M14A 4NYEA 3VF8A 1PXIA 5I0BA 3LM5A 1YOJA 5LVLA 4V0GB 3S3IA 3FKOA 3EQCA 5HNGA 2F57A 4FTKA 3UQGA 3DFAA 4WUAA 5E1EA 1T46A 5D9HA 3G0FA 4O7SA 2HW7A 3NUNA 4ERWA 2WGJA 3AOXA 4XLVA 4YGAA 3BV3A 3H0ZA 4GVJA 4QTEA 4O0SA 1YRPA 2R3PA 3UODA 3R6XA 1H08A 3WYYA 4E26A 4PL5A 4YZBA 3C50A 4TNBA 5EI8A 1YOMA 2QLUA 1MQBA 3OG7A 4M84A 2X9EA 1OVEA 3DBQA 3FMDA 4CZUA 3O2MA 3PG1A 3KXMA 3VUDA 4BFMA 4EYMA 1KE7A 4YJUA 2YLEA 3PG3A 3QL8A 5FBOA 3PDTA 2A19B 3MH3A 1Q8ZA 4KS8A 3B2WA 4TWPA 2YIQA 5CI7A 2CNUA 3CP9A 1LR4A 4XBRA 5AV2A 5H8BA 3C51A 3V5JA 5AUXA 2CGXA 4O22A 4D0WA 4PV0A 5FD2A 3AT3A 5AUUA 3PA3A 5A4TA 4ZTLA 3H9FA 4DGNA 3HX4A 5AP2A 4AS0A 3PE1A 4L68A 4U43A 2PWLA 4KB8A 5ETFA 5KMLA 3A8WA 2QURA 4LFIA 3QQUA 4FICA 4KNBA 4M12A 1O6LA 3FMHA 4AA5A 4F64A 3ENMA 4YC3A 3Q4TA 3LXKA 2Z7QA 4FUXA 5LCKA 5A4CA 2C47A 5GIPE 2OJ9A 2C1AA 4FKVA 4FOCA 5HE2A 3ZBFA 4EOOA 4F7NA 4YTHA 4F63A 1GIHA 1HOWA 2BRGA 3FC2A 4K0YA 3FI8A 4M68A 5IQFA 3EFJA 3OTUA 4DG3E 1OKYA 3QD4A 3VUHA 4ZY6A 4GCJA 3F6XA 5EW8A 3KRXA 3TZ8A 2CKOA 4IAAA 3V5TA 1M7QA 3LPBA 5LOHA 2WMQA 3RHKA 5T3QA 4QPMA 2ITXA 2WTCA 5JFXA 4H39A 5JGBA 2EUFB 3D7TB 2XNBA 3KRJA 4HNIA 3FZRA 4MF1A 3HDMA 4RFMA 4Y46A 4YURA 3WARA 3BHTA 3KEXA 3PA5A 3QHWA 3UNKA 3Q4CA 4EH8A 3TL8A 3C4FA 3CQUA 3OWKA 1TVOA 3E3PA 4PPAA 2XRUA 1BL7A 2YCRA 3QKMA 4FNYA 4YJQA 3OHTA 5EM6A 4ITIA 4ANQA 5AA9A 3CY2A 4G9RA 4WNPA 5HZNA 2VO0A 4XMOA 3C0GA 2JD5A 5CSXA 1JBPE 4PDOA 2IVUA 4BDGA 4YTCA 5L2TA 3HA8A 2VGOA 4CLJA 5IQBA 4FTTA 4U6RA 4YHFA 3ZOSA 4X2GA 4YJPA 3WZDA 2BDFA 2DS1A 3A61A 3KXHA 3PSCA 1XO2B 5JMSA 4BDHA 4DGLC 4DG0E 3F2RA 4L9IA 3LCDA 5KCVA 3BGZA 4AU8A 2O5KA 5LVMA 5M56A 4FEXA 1YWVA 4FYNA 3AG9A 4MF0A 5CQWA 5GJDA 4ZK5A 2OO8X 4M97A 3UBDA 4E93A 5JGDA 3DCVA 5J95A 3MTLA 3CGFA 3V6SA 2IJMA 3JS2A 1YOLA 5A4EA 3R1QA 3R00A 4IFGA 4KWPA 4MBIA 2FSMX 4RIWA 2QI8A 3FV8A 4MBLA 2JIUA 4O0TA 2YM3A 3IDPA 4OT6A 4S2ZA 2OK1A 2UZLA 1A9UA 2B4SB 3MA6A 3QQKA 3NR9A 3C0IA 2REIA 4HVGA 2BAKA 3W33A 3DJ5A 3OEFX 3G6GA 3D15A 3BIZA 4B9DA 3S00A 4L6QA 3W2OA 2VX0A 4TXCA 4W4XA 4MK0A 4Y5HA 3ZFYA 4E6DA 3EZVA 3Q4UA 4Z3VA 3TKHA 3HRBA 3TZMA 4FVQA 4AE6A 4HCVA 4GSBA 2C69A 3SDJA 4I6FA 4O7LA 4TTHB 4F0IA 1J7LA 3KVWA 1A48A 2VTMA 5IQDA 3QYWA 4I5CA 2GNLA 5CXHA 4XV3A 4ACGA 4PUZA 5KMNA 4D5HA 2OSCA 5L6OA 4NEUA 2F2CB 4EH9A 3LFQA 4QPSA 1KE9A 4K8AA 5CVGA 2UZBA 1XBAA 4QMNA 5EDQA 2WTVA 1IA8A 4CSVA 3OS3A 3RWPA 1U5QA 4NM7A 4TWNA 5DYJA 3H3CA 2E9VA 5HU9A 5H8GA 5IQHA 2CGVA 4LMNA 1ZZLA 2NRYA 2VO6A 5CQUA 4FOBA 5IA4A 4UEUA 1BI8A 1H1PA 4FEUA 4WG4A 4V05A 3DAJA 4KUJA 3CTQA 5CT0A 4ZMFA 1UNLA 1FBNA 5BYLA 3LM0A 3PJ3A 3V5QA 4S30A 4XJ0A 2WNTA 1WMKA 4YNEA 2I1MA 4IVCA 4D2PA 4RT7A 4E1ZA 2JEDA 1OL1A 1WBPA 3QGYA 1FMOE 2QOFA 3OC1A 4P5QA 3MV5A 2X0GA 4BCQA 3GC0A 3NNXA 4OTHA 4OBPA 1NY3A 3PJCA 3S0OA 4G6NA 4RVKA 1Q3WA 3W2PA 4BIDA 4QRCA 4V01A 3QTZA 2XNOA 1VR2A 2C6OA 4D4RA 2BAQA 2V22A 4AN3A 4G3EA 3ORMA 1NXKA 4MNFA 4XP2A 4X3FA 5D11A 3V01A 4EEVA 4L3JA 2ETMA 5L2WA 3EWHA 4K6ZA 3ODZX 5HX8A 5J79A 2QQ7A 4FSRA 3EQFA 2QHMA 4G3CA 3TNQB 2X8IA 3R9NA 2VWWA 4L42A 3U87A 5IQAA 2XCHA 1BYGA 3JR1A 4FKQA 3O8UA 4BZDA 3U55A 2J90A 3GEQA 5AP5A 4XG7A 3FSKA 3R8PA 5CTPA 4H3BA 4IZ5A 4KD1A 3R7IA 5CF5A 3JY0A 1BI7A 3DBCA 4C57A 3SXSA 3Q2JA 3I6UA 4AZFA 4DEEA 4EL9A 4JLCA 4U97A 3TT0A 2XVDA 2GSFA 4HNFA 2OI4X 5CAQA 2PVKA 4MXOA 2CKEA 2W0JA 3EH9A 3HL7A 4IB3A 2QOKA 2J51A 5E8YA 4C7TA 3BYSA 1G8AA 3KXGA 3HV6A 1CKPA 3AMYA 4G5PA 3VAPA 3OCBA 1S9IA 2YDJA 2J0JA 2OJGA 3C4CA 3FC1X 3I6WA 5ANJA 3F5UA 4UXQA 3E87A 1REKA 5IDPA 4O27B 5F4NA 4ZJJA 2YEXA 2X39A 4RJ4A 2WKMA 4AFEA 4ZTMA 5HCZA 5HESA 2YIYA 4FV3A 4L43A 4RJ8A 3QQLA 4RGJA 3T8OA 1P4FA 3FPQA 5A4LA 4FG9A 3MVHA 4IM2A 1P5EA 4UY9A 3W16A 4BB4A 1SMHA 3UIMA 2W99B 3LCSA 4FT3A 3V8WA 1J3HA 2BIYA 2GTMA 2WO6A 4RZVA 5CWZA 3Q9WA 3RPOA 3ANRA 1UNGA 4ZTQA 4B0GA 2J7TA 3POOA 4FODA 5HX6A 4D58A 3UIXA 2G2IA 2UUEA 2E9OA 3W8QA 3ZDIA 4AA0A 4F08A 5KBQA 4JR7A 4LG4A 5TKDA 2RKUA 3MFRA 3DZOA 4G1WA 3EFLA 4Q2AA 4FG8A 2W9FB 3VRZA 2WTKC 4U5JA 4PQNA 2WPAA 3FDNA 3CLYA 5EH0A 4QMXA 2ESMA 2FSTX 2R0UA 4QQTA 4M14A 1H1SA 4BDEA 3G15A 3MVMA 4ZSGA 5M4UA 4O81A 4OTWA 5AP1A 5BMSA 4HYSA 4CRLA 4CT2A 3BYOA 5L2IA 4HPTE 4ZS0A 4YO4A 2DYLA 5BUEA 4AGCA 1WAKA 4GG7A 4O7WA 5AR7A 2XYNA 2LAVA 4EKLA 3CY3A 4YUQA 3FUPA 4IC7A 4ACMA 4DITA 5T68A 4HCUA 4QNAA 3BEAA 3QX2A 4EK4A 2VU3A 2YLFA 4UB7A 3LXLA 4BDKA 2ZV8A 4WA9A 4ZOGA 3WF5A 5L6WL 1OPJA 3ELJA 3SW7A 2PUUA 3TUBA 3WE8A 5CVFA 2F49A 3I5NA 5IQIA 1PXPA 3QZIA 5I3RA 3GU7A 5DNRA 4CD0A 1G5SA 1YXSA 3MY5A 4XOZA 5BVEA 3EKKA 3FMLA 4USEA 4L67A 3VBQA 4DGMA 2CCIA 4F0FA 5DR6A 4P2KA 4C34A 3KK8A 1XBCA 4HZSA 3UGCA 4BCHA 3MFTA 5IG1A 4AZWA 3RAKA 4WUNA 4IEBA 2WOTA 4WRSA 5CU6A 4CXAA 3DBFA 4LGHA 2XJ0A 4LOQA 2QHNA 4FEQA 1YW2A 3EQRA 4BCNA 3H9RA 4DT9A 1KV2A 3OXZA 2XYUA 4L45A 3V3VA 4BTMA 4CG9A 4ZEGA 4IZAA 4MXYA 4RWIA 4FKIA 4YTFA 5BVDA 1M17A 5JRSA 4BL1A 1W83A 1XH9A 4EH5A 2IVTA 2X4FA 4R7IA 3QYZA 5K4IA 4X3FC 3SXFA 4IWDA 1H0VA 1FOTA 4N6YA 1OECA 5EYKA 3GC7A 2VZ6A 4ANMA 5AR4A 2B54A 3NAXA 2QVSE 4EH3A 3R7UA 5C27A 3Q53A 3UJGA 1PXKA 4IVAA 4D55A 1QPEA 3LFCA 5JH6A 5EHOA 1K9AA 3F61A 5DRBA 3SXRA 2J50A 2FYSA 5CU4A 2BHEA 4O86A 3V51A 3NWWA 3KL8A 3MFSA 4FTMA 5CSWA 1Y8GA 3EIDA 5AUTA 3PVGA 3ROYA 4WD5A 1CKIA 2XB7A 2ZM3A 3R7YA 3PY1A 4GMYA 3DAKA 3GCQA 3I1AA 4BBFA 2YDIA 4D2SA 4TY1A 4DFZE 5A46A 5AV4A 2RG6A 4CEGA 5IQGA 5IMXA 4NJDA 4Y5QA 5BPYA 3IW4A 3MDYA 5FTOA 3WZEA 2AYPA 4XNEA 5JFVA 3HRFA 2OG8A 1OGUA 2PY3A 3I0OA 5C8KA 4CMUA 3KREA 5J5SA 1YXUA 4ZXTA 1ZOGA 5ETAA 3WE4A 4NWMA 4QMVA 5CX9A 4ALWA 2W1IA 3RI1A 4DFBA 2UVXA 4KKEA 4FL3A 1PXNA 2XBAA 3SC1A 4HVSA 5GJGA 4YLLA 4OTPA 2OKRA 4QNYA 3GT8A 2F7ZE 3AGMA 5LMBA 5E8ZA 2NNWB 3Q04A 3EYGA 5JZNA 3VQUA 4CLIA 4ANNA 5FWKK 3FY2A 3KY2A 4UXLA 4HVIA 3Q6UA 3QTIA 3DQWA 4QPAA 4CYJA 1P4OA 3JVRA 3NUXA 4TN6A 4NIFB 5IH6A 2W1DA 3KQ7A 4K11A 3FZSA 2WQOA 4J8NA 4NTTA 4QTBA 4W4VA 5HE0A 4QQJA 3R7EA 4P4CA 4C3RA 4FI1A 5EQYA 3AC3A 4TYIA 1BL6A 2OXXA 3OD6X 3D9VA 5DMZA 4ASXA 2WMWA 4YLJA 3U54A 3KF4A 2ZMCA 3S4QA 4BCJA 4G5JA 4PDPA 1H0WA 1PYXA 1VZOA 3KK9A 4EOSA 4DN5A 4KRDA 2QOOA 3QHRA 3OTVA 4HYHA 4X6QC 2ZJWA 4MEDA 3ORXA 3TNWA 5ACKA 4I5PA 5AAEA 3NUSA 4D9TA 3RVGA 2Y7JA 4KS7A 4R1VA 3SA0A 4L3LA 4QMSA 4IAIA 3E93A 1NT2A 4D1ZA 4R3PA 4LQMA 4FKJA 4MXCA 1OB3A 3LVPA 3BYMA 3WF6A 5M08A 5LMAA 3DNEA 3R7GA 3MFUA 4WIHA 5CU0A 4BKZA 4DE4A 3NRMA 3SX9A 1VYZA 5DR2A 2OBJA 2JKKA 4FKUA 4K9YA 5DBXA 3KRLA 1XBBA 4CMTA 2BZIB 3PP1A 4W4YA 2JLDA 3NAYA 2XNEA 5I5ZA 2ZV2A 2PMIA 3W32A 3HUBA 4M13A 3L9MA 2OIQA 3AC4A 4IX5A 3EOCA 4D0XA 4RC4A 4YZ9A 3CJFA 3AC5A 4OAUC 2WAJA 4DFNA 2GQRA 3MYGA 4EK5A 3A7GA 2I0HA 3BQRA 3HV3A 1PMEA 3ZU7A 4E5BA 3DPKA 4I20A 4O7RA 2QG7A 4GH2A 1A06A 5AFVA 3COKA 1OUYA 3LXNA 2IVVA 5L6PA 2BALA 3BYVA 3LMGA 4FSYA 3L9PA 2P0CA 3FMJA 4MWIA 5H8EA 1NVQA 4XX9A 2R3NA 1FQ1B 2B7AA 3FHRA 2IZRA 4FMQA 5DEWA 3FY0A 4KIKA 4S32A 2XJ1A 2ZYBA 4O0YA 4A9TA 5GHVA 4JG6A 5CSVA 1IR3A 2FO0A 5HE1A 1YQJA 4ZZMA 4FUYA 2EXMA 5AAGA 3M42A 2P33A 1KE8A 2BHHA 5F9EA 2CN5A 3HMMA 3F3UA 1PKDA 4L8MA 4A4OA 3SGCA 5JFSA 3P79A 4CTCA 4JVGA 5IDNA 2GTNA 3VUIA 2C3KA 2C0TA 4JAIA 4YNOA 3WOWA 4C38A 5JGAA 3R04A 5JZJA 3MESA 2C5NA 1WCCA 1B38A 3ZUUA 4RWJA 3KF7A 3OT8A 3SOAA 3OBGA 2QOLA 3C4EA 4L01A 3UO6A 1ND4A 3CBLA 5C4KA 3FLZA 3GCUA 4WNOA 3LIJA 3R73A 4BDJA 3PPZA 3QRIA 3UC4A 3VBYA 4E7WA 4BKYA 3QA0A 4ZZNA 5CF6A 1IAJA 4DCAA 3C9WA 2YAAA 2WMTA 4IM0A 1FINA 2GNFA 3BEGA 4C2WA 4XP0A 5F95A 4MNEA 5J87A 4BZNA 5BVOA 1IRKA 3OVVA 1OIUA 3H30A 3P5KA 3OCGA 3AGLA 4YJTA 2UW8A 3FI2A 2J9MA 4FV0A 3RALA 4L3PA 3KULA 2RFDA 4FT7A 3E8NA 2Z7SA 3BCEA 4EOMA 3UG2A 3HKOA 4DFLA 4BWPA 3QCXA 4EOIA 4NL0A 2CSNA 4ORKA 3TM0A 4Z7GA 4EJ7A 4E6QA 3MS9A 3LW0A 2X8EA 1ZZ2A 4KIPA 2W1FA 2PZPA 4U81A 3IECA 1TQPA 3AMBA 4I5HA 3K3JA 4M15A 4BCOA 3DXNA 3R0TA 4D1XA 1U5RA 5IA0A 4FIFA 4CT1A 2B52A 4J99A 3O0GA 4FV5A 1OKZA 5J9ZA 5CVHA 1CDKA 3MSSA 2XMYA 3ZHPC 2O8YA 3QXOA 2AUHA 2X2KA 4RWKA 2QO9A 3LLAA 4QTDA 5BVKA 4CCUA 1Z9XA 4F9YA 3ORLA 1FVVA 4ENYA 5D12A 4PDYA 4EOJA 2BAJA 2I0YA 5TE0A 5FM3A 5LVOA 2J6MA 3IONA 4YZMA 5BVNA 3VBWA 3KGAA 1T45A 2BKKA 4I22A 1RDQE 3BWJA 3Q52A 4GJ3A 2XK4A 4P5ZA 2W17A 3PZEA 3ZO1A 3DLSA 4X3JA 4M7IA 3TI1A 2ZM1A 1GZNA 4U80A 1ZY4A 4FT5A 1W8CA 1O9UA 3Q9YA 4RJ7A 4AW1A 1GZKA 3UNZA 3MI9A 4TYGA 1E1XA 5ANIA 2DQ7X 4NT4A 3VC4A 3VHEA 1F5QA 3QZGA 3TXOA 3SG9A 4M0ZA 3LCKA 4E6AA 4I1ZA 2KTYA 3Q9XA 4XEYA 3I5ZA 3FXWA 1URWA 2WOUA 3D5VA 1STCE 4F6SA 5K0XA 5IA5A 1DM2A 1U4DA 3E64A 3MN3A 3ATSA 2PZIA 2X6DA 3R1NA 3ZC6A 5I9WA 3R1SA 5FXRA 4MD7E 2PZ5A 3ZC5A 3KN6A 1ZOEA 3MPMA 3QUEA 1CTPE 4RJ3A 4JDIA 4PP9A 4X2KA 3ZSIA 5CENA 1KOBA 3RAHA 4DGOA 1OUKA 3GP0A 4F65A 1KWPA 2X7GA 4HZRA 3UC3A 4I6HA 4RJ6A 4AW0A 3EKNA 2WMAA 1FGIA 2HIWA 1DI9A 5JT2A 3LKMA 5DH3A 3WIKA 1H00A 3NUUA 4OTIA 4UALA 4L7SA 4U9AA 3UMWA 1IG1A 3DOGA 3QWKA 1PYEA 2OJIA 5KZIA 3VWAA 3R63A 4CMOA 4D9UA 4WKQA 4PPBA 5LARA 5DT0A 3RZFA 4EBVA 2C0OA 1SZMA 4WO5A 4CFUA 2JKOA 4F6WA 3N4TA 5B0XA 4IWQA 4I6BA 2XK3A 4RC3A 4BGHA 4RFYA 3A7FA 4JX3A 3FXZA 4UN0C 3V04A 4E6CA 2CDZA 3F5GA 5CEKA 2ZV7A 4WBBB 2B9FA 2VTPA 2C0IA 4E20A 2CPKE 5AUZA 5L2QA 5FG8A 1GAGA 3OROA 3QGWA 4Y72A 4B6LA 4DTKA 2RFEA 2UW3A 4K33A 3MH1A 3C13A 4PX6A 3UQFA 1H24A 4OTDA 3UO4A 2YIXA 1LEWA 2NPQA 4YC6A 3NUPA 2JDTA 4PTEA 5HTCA 5CYIA 2WHBA 4YC8A 3F2AA 4DGGA 1YHVA 1ZXEA 2UW7A 3LFSA 2Z7RA 3E62A 2XBJA 2JAMA 3UIBA 1CSNA 3HEGA 3TIYA 4MX9A 3IO7A 4YR8A 4ZY4A 3ZMMA 5H9BA 1WBVA 3VS0A 1OL5A 1JVPP 4JQEA 4JT3A 4O0VA 2R7BA 4J96A 1BLXA 1PKGA 4AE9A 5IA3A 4DBXA 2EWAA 1CMKE 3TUDA 2QONA 3P7BA 3D2IA 1UWJA 4IFCA 4UYNA 2OIDA 3F66A 5E90A 4LL0A 3WI6A 3GC9A 3ZYAA 2XJ2A 5BUIA 3IPHA 4FYOA 4XLIA 3F3VA 3MH2A 3OWPA 3LZBA 4YZNA 3WF8A 2XS0A 4MXAA 3UDBA 5FUTA 4TL0A 1RW8A 4OLIA 3TEIA 5AIKA 3PIYA 5EKNA 2GS2A 2YWPA 3ORNA 4APPA 3T9TA 4EWHA 4GW8A 4UMUA 4APCA 1DAWA 3DK6A 5B2KA 3BBWA 2C3IB 4XBUA 5LVPA 5CAOA 3CQWA 5HG7A 3MBLA 1F3MC 4LOPA 3KB7A 2VTAA 4DCEA 4EI4A 2C6TA 4O7TA 4G6LA 3A7JA 2WQBA 3QZHA 3TDWA 4JAJA 2CN8A 2X4ZA 4XG9A 1UNHA 3RNYA 3E7OA 4J1RA 4FT0A 3ORKA 3V8TA 2XKCA 4EH7A 3OCSA 5CF4A 3II5A 5EOBA 3UZTA 2HZIA 3FLWA 2Y6OA 4BI0A 5C26A 3PYYA 4GFMA 2B9JA 4RFZA 2GQGA 1W98A 5K5NA 4DH1A 3BHYA 5KKRC 1OKWA 5BYZA 2BZJA 5EM7A 4TYEA 3HMPA 4F1OA 3TKIA 2YISA 2VNYA 2YZAA 5LWNA 4TZRA 3UNJA 5HBEA 3RBWA 5BUJA 3LFAA 4K2RA 5HG8A 3O7LB 3QUPA 1OITA 4M8TA 3QQFA 5AP4A 4O7ZA 4CZYB 4BCIA 2I40A 3FZ1A 5IZFA 1IEPA 2Y4PA 1CM8A 2ITYA 1GJOA 3FJQE 3KXZA 2AC3A
chains in the Genus database with same CATH superfamily
5I9XA 3QQJA 4RWLA 3HLLA 1Q8WA 3R8UA 3P9JA 2JDSA 3W18A 2HY0A 5IUIA 4AT4A 3MIYA 5FGKA 2J4ZA 1G8KA 4O6EA 4ALUA 2R3JA 3RPSA 1REJA 1S9JA 2JFMA 4KIKB 5IUGA 3BU3A 1TQMA 3HVCA 5HNBA 1YI6A 2C5VA 1JSVA 4KKHA 4FVRA 4M66A 5HBJA 4EHGA 1X8BA 2IW6A 3POZA 3O71A 4IDTA 3V5WA 4BRXA 3DB8A 3NLBA 1U59A 2OZOA 2YM8A 5K9IA 3Q96A 4BDAA 3NVMB 5HLPA 4EK8A 1VJYA 4M67A 1FPUA 2JDRA 2UW9A 3BHHA 2PL0A 1PRYA 3FLSA 5KNJA 3QKKA 4EQUA 3QTXA 1Q8TA 2GHMA 3E63A 4O38A 3R9OA 4DBNA 1R78A 2P55A 4JBVA 3BRBA 2PUNA 2ZMDA 1GOLA 2G1TA 2JKMA 3NIZA 4L46A 3HUCA 2JC6A 5EOLA 3VS7A 4WOVA 4CV9A 3JYAA 4GYIA 4OBOA 4L00A 4C58A 3Q4ZA 1QMZA 4A7CA 2BRMA 2FUMA 5KMKA 2QLQA 4BDDA 4GFGA 5E8WA 4W8DA 1YI3A 2UZWE 4GUBA 3S95A 4BYIA 5CEPA 4R7BA 3IW5A 4FT9A 4LL5A 3VS6A 2O64A 4HW7A 4GKIA 5DFPA 4DEAA 3SG8A 5C8NA 2Z8CA 4MNEB 3PSDA 4BICA 3ZSHA 3BL9A 2BILB 3KKVA 4N6ZA 4YJRA 3U4UA 2C3LA 4O4EA 2B9HA 1G3NA 2O65A 4C4HA 5GIOE 3LQ3A 4A07A 3NNVA 1LUFA 2VTNA 4JNWA 4A9YA 3L1SA 4FTUA 1JSTA 3COHA 3SRVA 3ZRMA 4CYIA 4Q5HA 5CEOA 3RWQA 2XKEA 4MCVA 4PTCA 2JDOA 3OY3A 5FDXA 2XANA 2W05A 3A2CA 4GK4A 4FSTA 5DVRA 2GDOA 4G6OA 4FJVA 4D4YA 4O82A 3HZTA 5C4LA 4RVMA 2WMVA 3JY9A 4WSQA 5EFQA 4YSMA 4BCMA 2WTWA 4OR5A 4Y85A 5E8SA 3N9XA 1OIQA 2R4BA 1WBTA 2UV2A 4PNIA 4FIGA 2X7FA 4R3CA 3ZO3A 3F3TA 1OL2A 1JLUE 3EFWA 2QOCA 4RQKA 5KHWA 1PHKA 2C6LA 5EDPA 1OL7A 3PUPA 3BE9A 4ONAA 3ZBXA 3RP9A 4K1BA 2G9XA 2PVMA 3BPRA 3QCYA 4OW8A 5ANGA 4IW0A 2IWIA 3TUCA 2QODA 4F1MA 1APME 5CY3A 4I24A 5E7RA 3NMUF 2QCSA 3TCPA 3NIEA 4ASEA 3FLYA 3PY0A 1ZAOA 4CFNA 4WBOA 3AKKA 4YTIA 4R1YA 5GZ9A 3NSZA 2GS6A 4MD9E 4U3ZA 3VO3A 2R9SA 3FAAA 2BUJA 3ZLSA 2VWBA 4IJ9A 4NM0A 4Y73A 5KZ0A 3IDBA 5M4IA 3PZHA 2WU6A 4RA5A 3L9NA 3S2PA 4XV2A 3DKFA 1WBSA 2BVAA 3K5UA 1UU7A 2W1EA 3LFDA 1MRYA 3M2WA 1MRVA 5IKWA 5ACBC 4CCBA 2GMXA 2Z60A 5FLFA 3DFCB 5ANOA 5FRIA 5J9LA 2W96B 4AFJA 2P2HA 2X0QA 1TFFA 3VUKA 5DWRA 1ZRZA 2FA2A 3Q5IA 4JQ8A 4BIBA 2E9UA 5I9YA 4C33A 5LCJA 3HV4A 3BWFA 4PMPA 2GQSA 4JBOA 3G5DA 4J98A 1SNUA 2JGZA 3D94A 1Q61A 1KE6A 5FBNC 1KOAA 1UVRA 1XMLA 3TIZA 3BLHA 2YERA 4AXAA 1YI4A 3EQGA 4AZTA 4J7BA 3VUTA 3FEGA 5CAUA 4ZJVA 2PVLA 5HI2A 2VTJA 1URCA 2VTTA 5BVWA 3K54A 4Z7HA 2C6MA 5HBHA 4C4FA 4UWBA 3OF0A 4WHZA 3TV7A 3GI3A 3F2NA 4B7TA 2XNGA 3UYTA 2EU9A 3ENHA 4E4LA 2Y4IC 2WZJA 2NRUA 1PMUA 4NW5A 2IG7A 4J95A 5AR3A 5AP7A 3P08A 1V0OA 3O96A 2GNGA 3VW8A 3HAMA 5JEBA 1ZLTA 2JFLA 2I0VA 4G17A 3EQDA 1DI8A 5DI1A 4F7SA 4E4XA 2JBPA 2BMCA 2YZLA 3G90X 3QTRA 4UV0A 3FXXA 3LQ8A 2JBOA 5M44A 2YACA 1JNKA 3SKCA 3TG1A 3H10A 4GG5A 1XH7A 3TNHA 1IA9A 2BRBA 3AT4A 4YMJA 4O96A 3ZM9A 3R1YA 2BDWA 3OBJA 3TZ9A 4X2JA 5HORA 4ACDA 1H1WA 3QRUA 4CZTA 3UVQA 2LGCA 3RNIA 1ERKA 2V0DA 3I79A 3PXYA 4YPSA 4M3QA 1TQIA 3QC9A 4RX9A 4FTRA 5KMJA 2WQNA 2W7XA 4U79A 1VLRA 4BDIA 5DGZA 2WQEA 3ACKA 3QQHA 2P3GX 4FTIA 2XNMA 5HQ0A 3R2BA 3ORTA 5L8LA 1KSWA 3W1FA 4FVPA 3R28A 3U6HA 4FNXA 4X2FA 3QF9A 2XAMA 3IKAA 4TPTA 4MKCA 4V04A 2YM6A 3SQQA 3UPXA 1OL6A 4CGAA 4J52A 1UWHA 2ERKA 4W8EA 4Z9LA 5I3OA 2W5AA 1Q99A 4A4LA 3BU5A 4ANSA 3VVHA 2B0QA 4BDBA 1JSUA 3SW4A 4O84A 3FYKX 2R3GA 3W2RA 1KUTA 4GUEA 3KRWA 3D2KA 4C4EA 2B1PA 2R3KA 3TJDA 2A27A 1Q3DA 1JKLA 2IN6A 3QD2B 2Z7LA 3KMMA 2QOIA 4AT5A 4BY9E 3D0EA 4FZ6A 2R3LA 5K5XA 5JN2A 1J1BA 5TR6A 2RL5A 3LCTA 3PXZA 1XJDA 4O0XA 3QALE 5CASA 4XRJA 3UDSA 3EHAA 5CSHA 3W0SA 5HVJA 3U8WA 1SNXA 2ITUA 4RIOA 5ANEA 5M51A 2YIRA 4ZLYA 5EHLA 3ACJA 1J91A 3NW6A 4QOXA 1UKHA 1QPCA 2QOBA 4QYGA 2FVDA 4BWKA 5M06A 4QTCA 5FDPA 1OM1A 4I93A 4FKOA 2RGPA 3BU6A 2RFNA 2A98A 5EHYA 3OW3A 4Q9ZA 5KUPA 3MGYA 3DU8A 4RZWA 5AUYA 1E9HA 5HO7A 2IF8A 2R5TA 4NKSA 4BN1A 2XM9A 1M52A 4YJVA 5AUWA 5I9UA 1UA2A 3QTWA 4H3QA 5EQPA 4NK9A 4JRNA 3IK3A 3UIUA 4UBAA 4QMOA 2F7EE 5B2MA 3DBEA 4EHZA 4PL4A 2GFCA 4YBJA 3L8PA 4WG5A 2W1CA 4DH3A 4FV2A 2BRNA 3Q5ZA 4TYJA 4I21A 4EONA 2PE2A 5F20A 5T6KA 1ZYDA 1J7UA 2YM4A 3IW6A 2VTOA 1WBOA 2YJRA 1H28A 4RIWB 5E91A 4USFA 4QYYA 2VO3A 3E8EA 4O91A 1I44A 5HIBA 2OZAA 4CFXA 4CV8A 1GIJA 3HA6A 2PTKA 2R64A 4IVBA 4X6RA 3E7VA 4J8MA 2WTKB 4O83A 3PRFA 3KCKA 4NM3A 3N4UA 1MQ4A 4ANLA 2XK8A 2R2PA 4R6VA 4C02A 4O0WA 5A54A 5IA2A 2BPMA 1JKTA 4QMPA 5IEVA 4C4GA 3DY7A 1JKKA 4F6UA 3NYOA 4EZ5A 1XHAA 4RRVA 1YDRE 3U9CA 2I0EA 3U6JA 1Y6BA 3MTFA 4ZZOA 4G3GA 4P90A 5AP3A 4CQGA 3MJ1A 3EMGA 1YWRA 3DDPA 3EYHA 3I81A 4LI5A 1JWHA 1YVJA 4FL2A 4ZP5A 5IQCA 3ZZEA 4IMYA 2VWIA 4YP8A 2PVYA 1O6YA 5C01A 5AADA 5FEEA 4AN2A 5TOZA 4JDJA 2CJMA 4U0IA 4W4WA 5HLNA 3K2LA 3QRTA 1BX6A 1PXLA 5EK7A 3FI3A 4E73A 5E8TA 2W5BA 3F88A 3PJ1A 3L8XA 4EC8A 4E4MA 4XV1A 4DG2E 4XG4A 4LV7A 4QMTA 3B8QA 2VRXA 1W84A 1R0PA 2O63A 4JOAA 3QU0A 2IW8A 1JAMA 4QMYA 1QCFA 1PMVA 2PZRA 2BZHB 3PP0A 3IGOA 3SRVB 3ZM4A 5KMOA 2QC6A 1L3RE 3VS5A 2H6DA 2GS7A 2A2AA 1IAHA 1CKJA 2PHKA 4C3PA 3E92A 3C4XA 3VNTA 5LMKA 3PXRA 2WMRA 3ZLWA 2E2BA 2RFSA 4LGDA 4E8AA 1I09A 2J2IB 2YCSA 4ZIMA 1H1RA 3PXKA 3UZRA 3D7TA 4UZHA 5CXZA 1RQQA 4I23A 1M2QA 4N57A 3VUMA 5CT7A 3VF9A 1YDTE 4UMRA 2XARA 1YXXA 2OU7A 4KABA 4E5WA 3ML1A 2V7AA 5EYDA 4F99A 1H01A 3N4VA 5IA1A 3TTIA 4DFUA 2OF4A 4LRKA 2C6IA 3RM7A 3H4JA 4X3FB 5CS6A 2G15A 4N70A 3P86A 4GEOA 5GJFA 4DA5A 4GV1A 4XP3A 3OOMA 4TW9A 4U45A 1XH5A 2QO7A 3LQ5A 4OBQA 3I60A 3PWDA 2UZNA 3R8ZA 1YXTA 4H1JA 1OZ1A 4GRBA 5DEYA 4JI9A 4X0MA 3CGOA 4F9BA 3ATTA 2JKQA 2RG5A 4F7LA 3LLTA 4WG3A 3P7AA 3MWUA 3NZ0A 5KMMA 2Y6MA 3GU6A 4BDFA 3RHXA 4Z55A 4DTAA 2Q83A 4KBCA 4O7NA 2OH0E 4RQVA 4I6QA 4AAAA 2HCKA 3DNDA 4CKJA 2C3JA 4XYFA 2YCQA 3ORZA 4FKRA 3DBDA 4TKSA 2UW5A 3R83A 4DEDA 4EJNA 1KE5A 4TRLA 3WYXA 1LPUA 3NYVA 5K4JA 3C4WA 3PJ8A 4HOKA 4WSYA 3R9DA 1Q4LA 1B6CB 4FTOA 5DPVA 4F4PA 5CSPA 3O50A 4IIRA 3UP7A 3G9LX 4AAYA 3D83A 2VUWA 3QLGA 2R3MA 4QP9A 5B2LA 5J1VA 5DHJA 2VTIA 2CHLA 4IAFA 4QQCA 5TO8A 5M53A 3DZQA 5HIDA 5ETCA 3CD8A 4ZTNA 1Q8UA 3ITZA 4IX4A 5H2UA 4GT3A 4DHFA 3DDQA 4QYHA 4CKIA 4ZS4A 4EQMA 3FMKA 3VBTA 3CSVA 2XA4A 3BLRA 5A9UA 2Z2WA 4F9WA 1W82A 1ZYCA 5JQ5A 4R7HA 1AD5A 3PPKA 4QP3A 1UU3A 3HRCA 3QAME 1ZYJA 2IZUA 5AEPA 5HTIA 3D7ZA 2PVJA 2VTRA 2WB8A 5HE3A 3TJCA 3VUGA 3TKUA 5BVFA 5HO6A 3DK7A 3CIKA 4X7QA 5CU2A 3TDVA 3ERKA 4RPVA 4BGGA 3GOPA 3EN5A 2EVAA 4HGTA 4C4JA 4CNHA 4IAYA 3D5XA 3EQHA 4QP4A 2EXEA 2YDKA 3FMMA 2X6EA 3E5AA 3P7CA 3MA3A 4L53A 4G34A 4XS2A 5JQ8A 2XIKA 3LAUA 2BRHA 3W8LA 3QTQA 3DTWA 2YWVA 4BHZA 4MXXA 1YHSA 3PXQA 4YJNA 4DF3A 4LGGA 1ZARA 4C62A 3B8RA 4QP1A 4IB1A 2VTLA 2B9IA 3BGQA 4YJSA 3D5UA 4GJ2A 4QP7A 1QL6A 4JBPA 1VEBA 3PXFA 4FZFB 5F1ZA 4D4VA 5AWMA 2X1NA 4EZ7A 4FGRA 2QNJA 2XP2A 2WMSA 4KBAA 1XR1A 4CKRA 5LQFA 2Z02A 4F0GA 4IAKA 4PF4A 5KE0A 3MJ2A 2W4KA 4LRMA 3BX5A 5ICPA 4U41A 3ZFMA 3GXLA 2HZ0A 3C5IA 5JFWA 4AXEA 2ITOA 2Q0NA 4DEBA 3PIZA 4BGQA 2HENA 4FIJA 4C0TA 3HV5A 4U44A 5EQEA 2E9NA 5B7VA 4NZWB 4DLJA 4F9AA 1ZYSA 3UZPA 5CALA 3RZBA 4ZMEA 3K3IA 4FNWA 4OTQA 2ZB0A 4LRJA 4MTAA 5M07A 2ACXA 2JAVA 5LMKC 5E9EA 4O6LA 2FB8A 5IMEA 4AACA 4FV6A 4MAOA 4NU1A 1PXOA 2XF0A 2BKZA 4W9XA 2HZNA 5AAFA 4PL3A 2BR1A 4D5KA 4FV7A 4ZSEA 3TN8A 3R01A 3A99A 5E8VA 2QKRA 4YZDA 3Q9ZA 3KRRA 5CZIA 3I0QA 1BMKA 2PULA 3W0RA 3ZUTA 1G8SA 3TMOA 3FZTA 2ITNA 3GCVA 2YHVA 3E8CA 3Q2JA 5FP5A 4FSZA 4JR3A 4AZVA 5IF1A 3TV4A 2Y0AA 3WZKA 3QCSA 2G2HA 3EN9A 3HP2A 3O51A 3QXPA 4QMUA 3AC1A 4EBWA 4RLLA 2XAOA 1ZWSA 3F5PA 5FEDA 4FTQA 2VWVA 4HYIA 5C1QB 4GK2A 1PXMA 2OFUA 3R8MA 4UMPA 3IOKA 4G31A 3GU8A 1LEZA 1MP8A 3KXNA 3AD5A 3FHIA 4IB0A 1WVYA 4USDA 3ZZWA 2YIWA 4BR3A 4IBMA 1FMKA 4L7FA 4LV5A 3KA0A 3QA8A 4LM5A 4YSJA 5GZAA 4IX6A 3ROCA 1NA7A 3P23A 1ZMUA 4UMQA 1LP4A 2FH9A 2R3HA 2VGPA 3OY1A 4O4FA 4QQ5A 3TYKA 3ORPA 4R5YA 3MVJA 4OUCA 2O0UA 2BIKB 4QMQA 3UG1A 2V5QA 3DKCA 4FSWA 4G16A 3RINA 1U46A 4FZAB 2UW0A 3AXWA 4JS8A 3G2FA 4YJOA 1WFCA 1H26A 4IXPA 4MBJA 4RA4A 3BHVA 3P1AA 3RAWA 2OZAB 2X2LA 2YITA 3G33A 4MQ2A 3ZRLA 4GL9A 4IJPA 5FP6A 1SVGA 2OF2A 3PLSA 3RK5A 3L8VA 3S1HA 2B53A 1WBWA 4H58A 3PWYA 4TYHA 4PNKA 5HNIX 4AX8A 3AT2A 1XH4A 3NW7A 5D7AA 5ITAA 5DT3A 3WILA 3NVKI 4EK6A 3ZTXA 1M2PA 5DOSA 5L8KA 4NFMA 4DEIA 3MY0A 1OPLA 3QWJA 2VTQA 3SAYA 4BZOA 5EDRA 5DT4A 4ERKA 4U40A 2XM8A 4AOTA 3RK7A 2PSQA 3Q60A 2GCDA 4DAWA 4KA3A 4AA4A 5A4QA 2C6DA 4EH4A 3EN4A 2ZAZA 1E1VA 3FQSA 3HDNA 5BX0A 4EOKA 4Q9SA 2Y9QA 3ZSGA 1R3CA 2FSOX 3ETAA 2ITPA 2J5EA 3M1SA 3DK3A 5CEMA 3L8SA 5IISA 4AOIA 4CFWA 3BQCA 2BTSA 5C03A 1P2AA 2VX1A 1PW2A 5CU3A 3PFYA 3BE2A 4JG8A 4C2VA 1R39A 2J0KA 2JIVA 5FM2A 4GIIA 4I0SA 5AP0A 1V0PA 3O8PA 3UTOA 2WTIA 4PY1A 3R2YA 4M69A 2C5XA 2PK9A 4GVAA 5A3XA 5M55A 4FGBA 4UWCA 4AZEA 2QU6A 3NFFB 3QCQA 2UZOA 4OTGA 3F5XA 2W4OA 3VJNA 4FTJA 4FTNA 5D10A 1B39A 1KV1A 4OT5A 3CPCA 2GNJA 5EW9A 3GU5A 3NEWA 3UP2A 2WFYA 3GC8A 4MHAA 3V5PA 2RIOA 3GGFA 2ZM4A 3B2TA 3CC6A 3LJ0A 4I0RA 3HMNA 3KVXA 4EOQA 4ZAUA 4OTFA 2CCHA 2R0IA 3CKWA 5DLSA 5HG9A 2ONLA 3V8SA 3C1XA 4XHKB 2H8HA 4YPDA 3FL4A 4ZTHA 1Y8YA 2GU8A 2IZTA 5JK3A 4NUSA 4TWOA 4WNKA 5L8JA 2JDVA 2WMBA 3TNIA 4YBKA 3R22A 3WF9A 3NS9A 3EQPA 4IACA 4ZLOA 4QMMA 1UKIA 4D1SA 2W9ZB 1PF8A 3DA6A 3UMXA 3MB6A 4F9CA 3DXPA 1R1WA 2WELA 1SVEA 3T9IA 5IEXA 1PJKA 4JRVA 3LJ1A 3VBXA 2H9VA 4AZSA 4MH7A 4CRSA 5I4NA 2VAGA 3A60A 4X21A 4DFYA 2QU5A 3AMAA 4H05A 2C6KA 4LUDA 1ZYLA 3KMUA 3Q3BA 2ERZE 4JX7A 4XRLA 4O21A 5A6OA 3OMVA 5FXSA 4AP7A 4FEVA 3MPAA 1OBGA 1H8FA 5AM6A 3RAIA 2WTDA 4BVUA 4RIYA 1FVTA 3C4ZA 5HLWA 3UVRA 5AV0A 1UV5A 5CI6A 3O23A 3OCTA 4ZLZA 5LVNA 4GYGA 1L8TA 3C7QA 2P2IA 2SRCA 4KBKA 2WMXA 4EOPA 3I7CA 2EB2A 3CJGA 1TKIA 4U3YA 4ZSLA 5M57A 2GNHA 4BCKA 3EL8A 5DA3A 1OMWA 4YO6A 3RPRA 5IU2A 4KKGA 4Z16A 4H1MA 4IWOA 2V62A 2PMNX 4GK3A 2HWPA 5AR5A 3QKLA 5HG5A 5EYCA 1R0EA 3G9NA 4FR4A 5BMMA 4KAOA 1DAYA 4FA2A 5J9YA 3OWLA 4IH8A 3AD4A 3P4KA 4JQ7A 3RMFA 4GT5A 5D41A 5CZHA 4EQCA 4K18A 3HECA 3LXPA 1WVWA 3U51A 4GKHA 5K3YA 5AV3A 2VX3A 3VS3A 3OUNB 2A0CX 3QBNA 3UE4A 2I7QA 4R8QA 4XG8A 4IADA 3VULA 1JOWB 2W1GA 4BTJA 1RJBA 3KC3A 5KMIA 3D14A 1FVRA 2R7IA 3KULB 3KXXA 4NIFA 5HD7A 2HW6A 4JIKA 3GB2A 3BV2A 2PZYA 4PRJA 4PMTA 3ALNA 4U8ZA 4Y83A 1IASA 3DV3A 3LOKA 2ITZA 4CQEA 3AC2A 4O0UA 4O1PA 5FTQA 4DFXE 5J7HA 3AKLA 4D2WA 2XKDA 4FV1A 1Z57A 4BTFA 3EQBA 3IOPA 3EJ1A 4QP8A 4ANOA 3RPYA 2ETRA 2UZUE 3ET7A 4GU9A 1JPAA 3I7BA 4MWHA 4WT6A 3AQVA 4XUFA 4XOYA 5FXQA 5KX8A 2CNVA 4OAVB 4HJOA 5AA8A 1XH8A 3ZXTA 2VWUA 3O8TA 3UPZA 1Y6AA 2OH4A 5HO8A 2XEYA 5LWMA 4HYUA 1U54A 3COMA 3VIDA 4C35A 4E4NA 1Z5MA 3NYNA 3VRYA 5FTGA 3DKOA 3O7LD 5EM8A 3TZ7A 3VBVA 5CNNA 3WZJA 3A4OX 3PIXA 4IWPA 5J5TA 2HWOA 3IGGA 4D2TA 4MXZA 3Q2MA 4II5A 2BDJA 4ANBA 5IH4A 1NVSA 5E8UA 2W5HA 3LMHA 5BYYA 3UOKA 1HCLA 3OP5A 5AUVA 4EUTA 3NNWA 4IAZA 1PXJA 4L44A 2WEIA 5KKRB 2WIPA 4JG7A 3IW7A 4AGDA 4BHNA 4FIIA 2PU8A 3H9OA 4MYGA 5DN3A 4EK3A 4HVHA 2XIRA 3G6HA 5IH5A 3ZS5A 4RIXA 3O17A 3KMWA 3MVLA 1ZOHA 4H36A 2YABA 3NDMA 3LJ2A 4FZ7A 2ETKA 3RKBA 4JJRA 4L52A 3VN9A 4EHVA 3DJ6A 4EH2A 5A6NA 4DH8A 2ONLC 1HCKA 3W2SA 2OJJA 3G0EA 4B99A 4G2FA 4QT1A 2XCKA 5HCYA 3GVUA 4KIOA 3RCJA 5DG5A 5GNKA 4RVTA 4B8LA 4BC6A 5AR8A 2HAKA 4O1OA 3GBZA 2CMWA 4RX5A 3U9NA 3OEZA 3UO5A 4JDKA 4UZDA 4LUEA 3THBA 3BL7A 2H34A 4R3RA 4ASZA 3VQHA 4AWIA 4UYAA 4HGSA 2QKWB 3ZLXA 5AX9A 4CFMA 3DQXA 2E9PA 3GFEA 3U6IA 2ZOQA 4NSTA 2JITA 4ACHA 2J0LA 3VS4A 2WIHA 4S34A 2UZDA 4DH5A 3G51A 2VWYA 1GNGA 3F69A 4I4FA 2XIXA 2XNNA 3JVSA 2RSVA 4IX3A 2QG5A 4EHEA 5CANA 2KULA 3OOGA 4GIHA 5AIRA 5IEYA 3HV7A 4EOLA 5J8IA 3FKNA 3LHJA 4FL1A 4FNZA 4Y95A 5EI6A 4LV8A 1Q62A 3TTJA 2C30A 3EZRA 5DRDA 1UU8A 2RF9A 3ALOA 4HPUE 4HGLA 3BZ3A 2UVZA 4TWCA 3D4QA 4FE2A 4C4IA 2XK9A 1Y91A 4ZJIA 1GZOA 3FQEA 1V0BA 4CFVA 3T3UA 3R7OA 4E5AX 5I9ZA 1V1KA 5AX3A 3HAVA 4BJJA 4ASDA 4R77A 2NO3A 4ENXA 2OICA 2C4GA 5HKMA 3REPA 4UWYA 4AGWA 3MH0A 4I94A 3SD0A 3FWQA 2GFSA 5AP6A 4UX9A 4QDEA 4KINA 2IZSA 5E92A 4A9SA 4FC0A 5M4CA 3OZ6A 3OFMA 4TYHB 1J1CA 3QQGA 2W4JA 3DT1A 3MY1A 4G9CA 4JIAA 5D7VA 5AR2A 4BYJA 5M09A 2ZV9A 4DINA 4TT7A 1VYWA 4NCTA 3EN6A 3GENA 4IB5A 1XH6A 2I6LA 4YZCA 3L9LA 1YDSE 2QO2A 2Y8OA 1F0QA 5L2SA 3P0MA 4JL9A 2ITVA 4YU2A 3RPVA 3QLFA 4D2RA 2OXDA 3QX4A 4FIHA 4DEGA 3WF7A 3TACA 3H0YA 4FV4A 5J1WA 2OXYA 1W7HA 3MB7A 5C8MA 2B55A 3R8VA 3MIAA 4ZSAA 3UOHA 3CQEA 3KCFA 3IDCA 1XKKA 2G2FA 2XK7A 4O2PA 4ZY5A 4C59A 3D5WA 4BKJA 4FZDB 3OT3A 4DC2A 2VV9A 1H1QA 5DE2A 3CTHA 4OTRA 5C9CA 3V5LA 3LMIA 2P4IA 3V6RA 4FK6A 4F70A 4M69B 3HMIA 4CG8A 2UVYA 2OJFE 4QYFA 5HTBA 3W2CA 3ZXZA 3DGKA 3K5VA 4LYNA 4AT3A 2ITTA 2F7XE 4ITJA 4YLKA 5EKOA 4ZSJA 4BIEA 1YKRA 3F9NA 5HVKA 3VS2A 1RE8A 2GHLA 2YM5A 5BQ0A 5I9VA 3ZLYA 3W0OA 1Q8YA 4AQCA 3R30A 5L4QA 4RSSA 3OXIA 4LMUA 3R21A 2J0IA 1YHWA 5HHWA 3QRJA 3CCNA 3DJ7A 4IHPA 3CXWA 4NH1A 3SOCA 4FKGA 5BNJA 2YCFA 5CAVA 5D1JA 1SVHA 1Q41A 4FKPA 4B4LA 4R5SA 5LJJA 3FSFA 4PWNA 4ACCA 5E1SA 2EXCX 3FL5A 4QP2A 2X2MA 2YA9A 4AN9A 3GCSA 5AM7A 2WEVA 2WMUA 4M0YA 4RX7A 4S31A 4N4SA 4D28A 3BKBA 3NX8A 4I0TA 4FK3A 3ODYX 3QTSA 2XIYA 2A1AB 2CLXA 4BCGA 3NW5A 3R9HA 4V0GA 5IQEA 2PE0A 3Q6WA 3FPMA 3AC8A 4QP6A 4WRGA 5HU3A 4F78A 3N51A 4IVDA 4J97A 3FMEA 3RCDA 3WIGA 3Q32A 4IE9A 1W0XC 4FV9A 4O4BB 5HIEA 5LXMA 2CLQA 3ORIA 4A9UA 3HNGA 2QD9A 3DXQA 5EI2A 4JXFA 5KHXA 5CLPA 3ZRKA 1ZY5A 3KFAA 2BFYA 2GPHA 2Y4IB 3LE6A 4RIYB 2V55A 3W0QA 1OI9A 1OPKA 2VWZA 2C1BA 4WNMA 1YXVA 5EG3A 2HXLA 4J71A 1JQHA 4ID7A 5AJQA 2ZDUA 1XWSA 3GOKA 4O0RA 2YN8A 3NCGA 2F4JA 4EC9A 3FMNA 4I4EA 2ITQA 1MRUA 3M11A 3A7HA 4MVFA 1P14A 5HEZA 2BROA 3UVPA 4QO9A 2C68A 4FKSA 5TT7A 1NW1A 5HVYA 2OLCA 3U4WA 3VHKA 5GINE 2VNWA 2HOGA 1WBNA 3PVBA 4CVAA 3P78A 1UU9A 4FKWA 4GU6A 4BF2A 3BELA 1M2RA 4R78A 3GU4A 4XH6A 4F7JA 3VW6A 3UOJA 3EL7A 3LFBA 3FBVA 2WTJA 3A62A 4RVLA 3W2QA 3AD6A 4FTLA 4U7ZA 4QMLA 4W9WA 3ZCLA 3NUAA 4K77A 2X7OA 5F94A 2PVRA 4BTKA 1SYKA 2ZDTA 2HXQA 3PJ2A 5JRQA 3A4PA 4RJ5A 1OIYA 1QPDA 3R71A 4FSNA 4KIQA 2XEZA 3LFFA 3QD3A 5FEQA 5K0KA 4FKTA 4IM3A 3OW4A 3SHEA 3ZUVA 3IG7A 3ANQA 3C5UA 3OXTA 1Q5KA 1JKSA 4I3ZA 2PUPA 4JBQA 3MPTA 3HGKA 4XV9A 5A14A 3UOLA 1AQ1A 4AQKA 1YWNA 3HYHA 2IO6A 2W1ZA 4FRFA 4IANA 2BFXA 4O7YA 4YHTA 3OWJA 2VD5A 3PRIA 2PVHA 4AOJA 4NCTC 4XCUA 4BI1A 1J7IA 4PDSA 4MD8E 2R3RA 2ITWA 5AV1A