3UVRA

Human p38 map kinase in complex with km064
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
347
structure length
331
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
total genus 116
structure length 331
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3uvrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3uvrA01
3ANQA 5HG8A 1FMOE 4WHZA 3MB7A 4D2RA 4NU1A 3EJ1A 1WBPA 4MYGA 4LL0A 3CEKA 4NCTA 1NY3A 2GHMA 3OTVA 4BGGA 2OZAB 2EVAA 2IVVA 4YO4A 4I6HA 5IA2A 3N4VA 4F9CA 4RX8A 2C1BA 3FXXA 4YZBA 2XS0A 1GZKA 4X6QC 3HLLA 4NM3A 3R0TA 3KRXA 4O7WA 3RINA 5IQGA 3EQRA 2XRUA 2YCRA 5DIAA 5KBRA 4I5PA 1QMZA 5CVHA 4KUJA 5EI2A 4YJRA 3W2PA 4DINA 2WQNA 4JRVA 2E9PA 2HZIA 4X2FA 3NS9A 4X6RA 1JKLA 3IDPA 1J7IA 3KXMA 2X6DA 3QAME 3R21A 3JS2A 4F0FA 1Q97A 2WMRA 4FGBA 4UMUA 3T8OA 4BTKA 4FEXA 4FTUA 4ZXTA 3AGLA 2J5EA 4RVMA 4FK6A 4F70A 4AA5A 3DZQA 4IM2A 1OL2A 3VO3A 2J5FA 2WMQA 4FUXA 4FTIA 4KKGA 4CFVA 5IG1A 1TVOA 2NO3A 1ZZLA 4C3PA 3FQHA 4M0YA 5EFQA 5IDNA 2V5QA 2ZOQA 4YO6A 3R30A 3BCEA 4FMQA 4FSYA 2J6MA 1H08A 5CSPA 4JBVA 3Q2JA 2ETMA 2ZMDA 4BR3A 4FTCA 4O0TA 2C5XA 1STCE 2H6DA 3DCVA 3EQBA 3G90X 3GCQA 3NYVA 4XH6A 2DUVA 4EKKA 2BRHA 1EH4A 4RX9A 2C0OA 5J1VA 3MV5A 5CAVA 3LFCA 3NUAA 3Q6UA 2G2FA 5DA3A 2PK9A 1PXOA 4ZS0A 5T6KA 4FC0A 4S2ZA 4CYJA 3ALOA 3MH0A 2FSTX 4I0TA 3SXFA 4E3CA 4X3FC 3TG1A 1RQQA 3C7QA 2YDIA 3OBJA 3TN8A 4D58A 4BICA 2QOLA 2QG7A 1W8CA 3FL4A 3QYZA 1Q61A 3UZTA 4OAUC 3LZBA 4Z9LA 1U5RA 3E5AA 5LCKA 5CEMA 3KXGA 3EFKA 4M7IA 4EH7A 4O2PA 4JDHA 3GUBA 4Z7GA 3QA0A 5CS6A 4ZTNA 4HVGA 3ULZA 4N70A 4XP0A 5CXHA 4HNFA 2VZ6A 2B9FA 2XP2A 4R7IA 3UYTA 4C3FA 4F6WA 4MF0A 4PP9A 3NYXA 4E5AX 4FSTA 2C1AA 4G3FA 3WARA 4ASXA 3FLNC 5D12A 3RVGA 4O2ZA 1WAKA 2IW9A 4F1OA 4FTJA 5DRBA 1UKHA 4D9UA 4KSQA 5EDQA 1H4LA 4RLLA 4U43A 5LMAA 2HWPA 4GCJA 4J1RA 3U54A 2HZ4A 3EN7A 2WTKC 3II5A 4HZRA 1SZMA 2C6IA 3K5VA 1R1WA 3LFBA 4H58A 3LQ5A 4QQCA 4XV2A 5A3XA 4FKTA 3VS3A 1LEWA 4QMPA 2G9XA 4O1PA 3LIJA 5B0XA 3UOLA 2PUNA 3PIYA 3NW5A 4YU2A 3Q60A 3Q5ZA 4BI0A 5KHWA 1OB3A 2I0EA 4KIOA 2PTKA 4FL3A 3EKKA 2J7TA 1DI8A 3QZFA 3V5TA 3TV6A 2HIWA 3C13A 5DR9A 4AN2A 4AT5A 4OLIA 4CFFA 5JGBA 5ANKA 4IJPA 1MP8A 3UOHA 3CBLA 4OTIA 3A8XA 2YDKA 2CGXA 3GVUA 2OIQA 2JKKA 5L2IA 1U46A 1WFCA 3QX2A 2OO8X 4EH8A 4IQ6A 2HAKA 4UXLA 4EKLA 5GIOE 3ZSHA 3QC9A 3VS5A 3QQLA 5I3OA 1Q24A 4BKYA 3G51A 3HAMA 3PVBA 2R0IA 3FI3A 4AE6A 2SRCA 3LQ8A 4RWLA 3DDQA 2B53A 4AW2A 2C3KA 1DI9A 4CT2A 2XNPA 5HKMA 4G2FA 5CZIA 4IAAA 3D83A 3GU6A 3QTQA 3HYHA 4PMSA 4C35A 3HL7A 3PZHA 4GYIA 2V7AA 4YHFA 3FZ1A 4GVJA 5KKRC 5FD2A 2XK9A 4RRVA 4RWKA 3UP2A 2NPQA 2J0LA 2PSQA 2WMBA 3ODYX 3P7AA 3E63A 3OY1A 2J0JA 2W1EA 4ITJA 4HVIA 4NYEA 1ZY4A 4MKCA 3ZLSA 5BUEA 5AWMA 5M44A 3DJ6A 1AD5A 2RFDA 4L7SA 4MK0A 3TCPA 4EOLA 5BVNA 4JDJA 5KNJA 4IX4A 5JQ8A 2DYLA 5ACBC 1ZARA 3QX4A 5BUJA 3S4QA 4YBKA 3PJ1A 5AAEA 2V0DA 2Z8CA 4I94A 5LWMA 2R3PA 4JAJA 5CAOA 3H9FA 3QTZA 4FV9A 1GOLA 2GS7A 4QMTA 5DEWA 4YGAA 1UWJA 2R7BA 1BYGA 3HMPA 2QO7A 3LFDA 1IRKA 2JIVA 4RFYA 4Z3VA 4DFZE 4YPSA 2QC6A 4R5YA 3EZRA 4ALWA 3PJ8A 1U59A 4CFUA 1XO2B 1PMEA 4PWNA 5DT3A 5ACKA 3V5LA 2JDVA 4KB8A 4M0ZA 2C5OA 2WTWA 3ZEPA 4C4GA 3NNUA 4EOJA 1NW1A 5F9EA 5CYIA 5EOBA 3LM0A 1SVEA 3CSVA 1Q8ZA 2IVUA 1H01A 5E8VA 3LCDA 4RIYA 4RBLA 4O7VA 4USDA 5HX6A 2YDJA 2BRNA 3SGCA 4RIXA 2PYWA 3E7VA 4JBQA 4ACDA 4L3LA 4GV1A 1ZYCA 1A9UA 2UV2A 3GOPA 3L1SA 4WO5A 3RK5A 3O0GA 1DM2A 3BLRA 5D7VA 5J9LA 4D2SA 1DAYA 3RCJA 4JBPA 4RA4A 3LFNA 3OF0A 4JOAA 4CVAA 1OPKA 4FTRA 4Y5HA 2W05A 2JDRA 1REKA 4R1VA 4O0XA 5H3QA 5I9UA 4O81A 5J95A 1MRVA 5BNJA 4BTMA 2OH0E 2C69A 2OICA 5AR8A 3PRIA 3TNHA 4S30A 2YABA 3E8NA 4O7NA 3MJ2A 5IQIA 3DY7A 4GFMA 5AUZA 5LMKA 4Q9ZA 2CSNA 4EH6A 2C6MA 3C51A 2BAJA 4KINA 2P55A 4CT1A 1Y6BA 2VWYA 2ITUA 5M4CA 3A7FA 1PRYA 2C5VA 2ZVAA 3QZIA 4I6QA 1HCKA 3GCSA 3WYXA 1R0PA 3H0ZA 4DEGA 3PZEA 4DCAA 5JGDA 5TE0A 4H3PA 2PMLX 4GSBA 4GKHA 3TKHA 4FKGA 3WIKA 4OTFA 3ZSGA 2IO6A 4LOOA 3LAUA 1WZYA 4DGMA 1WCCA 5DFPA 2XVDA 3PP1A 1Q3DA 4XHKB 4EYJA 1FVRA 3FQEA 3KXXA 4BDFA 4RVTA 3IW8A 2QOKA 5CANA 4QTCA 4WNPA 5A4EA 3CQWA 4IWDA 4M84A 5JQ5A 3SW7A 2FUMA 2R3JA 3GNIB 3VUTA 1OITA 5FDXA 2OXYA 3U51A 3UNJA 4AZTA 4XV3A 5B2MA 4BRXA 3DLSA 2RG6A 3R7VA 5KX8A 3NCZA 4ZJIA 1KV1A 5HIDA 4C36A 4TY1A 3MTLA 5EQEA 2WO6A 2BKZA 2GNLA 4GVAA 4AT3A 4TZRA 3DGKA 4ZTLA 3KF7A 1XH8A 4MCVA 4F0IA 3P78A 4FEQA 4S34A 4IB1A 5HGIA 2JC6A 3R71A 2A0CX 4FV3A 1F0QA 3E62A 5AR7A 3DTWA 4Y83A 4GJ2A 4O22A 5G6VA 3P1AA 4LFIA 3O50A 4CG9A 3ANRA 3QRUA 2GTMA 2F7EE 4PV0A 1YDRE 2YACA 4FT3A 4O0SA 3IONA 4EC9A 3EWHA 3FQSA 2OF2A 2WMAA 4GIIA 4AFJA 5EH0A 5IDPA 4IZ5A 3SVVA 2DS1A 3KRWA 1ZOGA 2BCJA 4FSUA 3MDYA 4FV5A 4BFMA 2PVFA 3Q4UA 1KWPA 4TWPA 4O0WA 5LVNA 4YHJA 4BYIA 2EB2A 1LEZA 4HGSA 4EQMA 5HU3A 5AIRA 3VW8A 5HBHA 3R7UA 2X4FA 2IN6A 5TR6A 1FQ1B 2O3PA 4IX6A 3PVUA 4YZ9A 3ZFXA 3UVRA 1YXUA 3PRFA 5ETAA 3BKBA 4UN0C 3KMUA 4B0GA 4I24A 3FZPA 2BRMA 4CCBA 3QQJA 3KN6A 4JQ7A 4FT0A 3ORXA 5HCXA 5IUIA 3QZHA 1H1SA 4YJOA 3ULIA 4AZSA 4KS7A 5DPVA 2QVSE 1XBCA 3C4ZA 3Q9WA 5A4LA 4UYAA 4AXAA 4FI1A 4LRMA 3SAYA 4G5JA 5KMOA 3U8WA 4GRBA 2OG8A 3UG1A 1CTPE 2WMXA 2VGOA 2YLFA 5AR2A 5IH5A 3RWPA 1YXTA 4HGLA 1WVXA 2PVLA 3O71A 5L8JA 3QWJA 1Q62A 3LVPA 3I5ZA 3DQWA 4XMOA 3ZUVA 1TQPA 4LQMA 4DGLC 4LG4A 1R3CA 3DAKA 2E9OA 4YJUA 4DTKA 4PNKA 4FZ6A 4XG2A 3BBWA 4I4EA 4U0IA 3NEWA 4BCMA 2PUPA 2PZYA 4LGGA 3OD6X 4R7HA 3ZXTA 4FR4A 2AC3A 4HGEA 5I9WA 5EYMA 3KCKA 2BZKB 3TTJA 3F7WA 2VAGA 4CFNA 3ORNA 5FEDA 5FQDC 3PPKA 3BQCA 4QP2A 3W8LA 3GT8A 4HZSA 4IM3A 4E8AA 3WE8A 4DGNA 4OTWA 3KFAA 4KNBA 2A2AA 4WKQA 4AG8A 4DH5A 4RT7A 2OI4X 4BF2A 1XKKA 4A9UA 4E26A 3AG9A 4FSMA 4N6ZA 4KBAA 4EOQA 5JKGA 3GOKA 4YZMA 3RGFA 2ITQA 3GU5A 4PQNA 3UNZA 3U9CA 4BDCA 4XBUA 4KKHA 2FSMX 4KIQA 3QUPA 1PYXA 2CN8A 2JKMA 2QOIA 3MTFA 1YWVA 3C4EA 3ZBFA 4QYYA 4O7TA 4XOYA 2YM7A 2ZV7A 4YBJA 1IA9A 4O7RA 1U5QA 2YIYA 5T3QA 1ZYLA 4P4CA 4KBKA 4AGUA 1Q5KA 4U41A 1W83A 4FKVA 2W96B 2BDWA 4FV1A 1S9IA 2I6LA 2IZUA 5E91A 4NIFB 2VO7A 3B2TA 2R3QA 4N4SA 1ZMVA 4PPBA 1YHWA 5E8YA 3TDVA 1OUYA 3FLSA 3OCTA 5BQ0A 4KIKA 4FIGA 3Q04A 4RJ4A 4Y72A 4ZLOA 4FTLA 2ZAZA 4K2RA 3O17A 3VF9A 5LARA 1PKGA 4DLIA 4FKQA 5M4IA 4ZZNA 2WQBA 3FSKA 4EHVA 4FKWA 2I0VA 3AT3A 3QHWA 4FIFA 4WBBB 1H1RA 4JQ8A 4XEYA 2JAMA 1ZYJA 3OWLA 4BCKA 4W8DA 4QMVA 4HVSA 4W4VA 3TNQB 5A54A 3C4CA 4BIEA 1IEPA 3CJGA 3WZDA 4PPAA 5AX9A 4S32A 2Q83A 3E8DA 4EWHA 4K9YA 4II5A 3MA6A 5TOZA 2VTQA 4FTTA 5A6OA 2UW4A 1H8FA 4NM0A 3C4WA 2G15A 3NIZA 4OTPA 5CEKA 4E5BA 5BMSA 3QD2B 4H3BA 1GZNA 2XNEA 3K3JA 5LXMA 1FGKA 3FKLA 3A8WA 3FXZA 5M08A 3UDBA 3GCPA 3BEGA 3NYNA 3MFTA 1YQJA 3AQVA 3RNIA 3DPKA 1H24A 4EK3A 3W18A 5AP4A 5CU3A 4G6OA 2YM8A 4TL0A 3CKXA 3VS0A 5ANGA 3ZLXA 4F65A 4E6AA 3NVKI 2J50A 5JFXA 3P4KA 4JX3A 4XG7A 2IW6A 2PVHA 4AOJA 1M2RA 2OJIA 2RF9A 2VWUA 5F94A 3PDTA 3PLAE 2PVJA 5FG8A 4YC6A 3WZUA 5ETIA 4ZTQA 5L8KA 1MUOA 4C7TA 3AGMA 5HE3A 2BRGA 4BN1A 4E20A 4TNBA 5FP6A 5H8BA 5L6OA 3AC1A 4DN5A 4IM0A 4DYMA 4DBXA 4N6YA 4KIPA 1IA8A 3K2LA 2GDOA 2BVAA 2YERA 4AW5A 4EK8A 3MB6A 3RWQA 5KZIA 4FSNA 2IZTA 4O6EA 2XKDA 4R5SA 1HOWA 2UZOA 3ACJA 1PXKA 1R39A 2WOTA 2YJRA 3JUHA 1K3AA 3CTHA 3QZGA 4HPUE 4D2VA 5A4CA 3VBQA 4F9WA 3QKKA 4QNYA 4EORA 2ITVA 3I4BA 3BV3A 4U5JA 3TI1A 2YWVA 1Y8YA 4X2KA 3ZS5A 4PPCA 2H9VA 3NW7A 3ZFMA 4PX6A 4EONA 3BYVA 3POOA 4FYNA 3QD4A 4TW9A 2ITNA 2QU6A 4A9RA 5HNGA 4QP6A 4U7ZA 1NVQA 2UUEA 4J8MA 4XG3A 3Q4TA 5CVGA 4J8NA 1B6CB 2XM8A 3BHYA 3SOAA 2FVDA 1OM1A 3TT0A 4E73A 2UW7A 3F3ZA 3BWFA 3W33A 4TTHB 4ANLA 2RG5A 4I5HA 3PVWA 4WA9A 2YIWA 4XX9A 3D5VA 2I40A 3QXOA 2OKRA 5AP5A 4LMUA 3FMLA 5DRDA 2OLCA 3FY0A 3LCTA 4RJ5A 5ANDA 1JSTA 4YC8A 2CKOA 3CTQA 3MH3A 3HA8A 2GHLA 4KABA 4MAOA 5HU9A 3SQQA 2A27A 1G3NA 3COIA 5CU6A 3TTIA 3ZZWA 5FEEA 2ITXA 4ITIA 4MQ2A 4EZ7A 5D7AA 5TT7A 3CIKA 1ERKA 2F2CB 3OS3A 4TRLA 3HRCA 4CLJA 5CNNA 4FL2A 3DXQA 1TKIA 3S2PA 2WIPA 4IAKA 3F2RA 3D9VA 5AP6A 3VJOA 4TWNA 5J79A 2ZJWA 5IA1A 3R73A 4CKIA 1P4OA 3KXZA 3FMKA 3G6GA 3LM5A 3V3VA 4A4OA 1YI4A 5B2LA 4QNAA 3W55A 1QPJA 1W98A 2OXXA 2X9EA 4JNWA 1OKVA 4NM5A 3CGFA 3H0YA 4FT7A 5CQUA 4QMUA 4PMMA 5IQFA 3GBZA 1OI9A 2QNJA 4RMZA 1J1CA 5CEIA 1V0OA 2YM6A 3QYWA 4ENYA 4ZJVA 2VTAA 4QMWA 2VO3A 3TV4A 5AUTA 1LP4A 4FG9A 3WE4A 4HGTA 4ZIMA 3QGYA 2VTRA 3COHA 3E8EA 5E8XA 4IB5A 4M15A 3S00A 1ZOHA 4MNEA 3P08A 3TJCA 2J2IB 1FINA 2IZSA 3A4OX 4MNEB 3ZDUA 4PL5A 2QR7A 5BVFA 1V0PA 1Y8GA 4RG0A 3VBWA 2J0KA 1LPUA 3FPQA 4ONAA 4JI9A 1JKKA 3MGYA 4WNMA 4V01A 4MWIA 3R6XA 4RQKA 4APCA 4FF8A 4ALUA 4ZK5A 4KBCA 3BLQA 5I5ZA 5M07A 4EUUA 2Q0NA 3UC3A 3JR1A 4WG3A 4O7LA 2ITTA 3SRVA 3FSFA 3BEAA 4LUEA 4E7WA 1KE7A 2W4OA 2O63A 4O83A 4K33A 3SRVB 5GIPE 4EOIA 2YFXA 2G2IA 2OIBA 3TIZA 4ACHA 1H27A 2BUJA 4HJOA 3QGWA 4RC4A 3ROCA 2XK4A 3TIYA 4ACGA 4FEVA 3BRBA 2AUHA 3FMNA 4A06A 2ITYA 3DJ5A 4IVCA 4NJ3A 3V5WA 5G1XA 3OXIA 1P14A 3FKNA 2OJFE 4GJ3A 3AMAA 5CQWA 2JDTA 3D4QA 3R8ZA 4D0WA 4EYMA 4IJ9A 2W4JA 4TXCA 3B8RA 3QUDA 1VZOA 4UYNA 5BVWA 2W06A 3CLYA 5HNBA 3KC3A 3OY3A 5I3RA 4R1YA 2F4JA 4RVLA 4BCQA 4AQCA 4W8EA 3BHTA 4KKEA 1OECA 3ORZA 4IZ7A 2NRUA 2J9MA 2YLEA 3VBYA 3A4PA 4UEUA 3U9NA 4FZAB 4OUCA 5KMIA 3R02A 2OK1A 4QRCA 5HEZA 3FZTA 4NW5A 5HIEA 4RJ6A 3BE9A 4ZSAA 4ALVA 4IE9A 4FSQA 4ITHA 2VX1A 2C6DA 4BKJA 4CZYB 3QQFA 4QTEA 4PMTA 1YOMA 3B8QA 1OMWA 2PZ5A 5ETCA 3OEZA 2BHHA 1FVTA 3BGPA 2BIYA 3FI4A 3KGAA 3Q32A 3RCDA 5CEOA 4BDAA 4FG7A 5JH6A 4USEA 3QTUA 2R3MA 4QP7A 3NWWA 4RIWA 4AN9A 1O6YA 4IWPA 3VS6A 1KE8A 4IZAA 4DG2E 5KMLA 4U80A 4NL0A 5E1SA 2OJGA 5HI2A 4CMTA 5CEPA 5HBEA 1OBGA 4WG5A 2R9SA 1URCA 4FKPA 5AP0A 3MPMA 3W2RA 1H28A 2O2UA 4FV4A 4BBEA 1MRYA 4ERKA 5EM6A 4YSJA 4N0SA 4ORKA 4XYFA 2HY81 4XUFA 4K77A 5I4NA 4RC3A 4CSVA 4WBOA 2JD5A 4C62A 5HBJA 3GQLA 4JAIA 2BZJA 4K0YA 1ZMWA 4D28A 3FYJX 1SYKA 4XOZA 3Q9XA 2H8HA 1IG1A 4QYHA 3BYMA 3OWKA 5HIBA 3UVPA 4YJVA 3AMYA 3PPZA 4GT3A 4NTTA 4AZVA 4DA5A 4XCUA 3CS9A 3NYOA 2YCQA 5GJGA 2XNGA 3GQIA 1ATPE 4ZSLA 4PL4A 3QQKA 4WIHA 3MY1A 1CM8A 2W1FA 5KZ0A 2VNYA 3KCFA 4CG8A 4AGDA 2VTIA 3KMWA 1H1PA 2G1TA 3O2MA 4UWBA 3PSCA 5AIKA 5K3YA 3EKNA 3OT8A 4FNWA 4IAYA 4MVFA 4ZP5A 4X3FB 1PXPA 3G6HA 3V8WA 4BGHA 5HLNA 4QMLA 5EI6A 4YTCA 4UMPA 1ZYSA 4BDKA 3M42A 2YM4A 4I1ZA 2GCDA 2VTMA 3HZTA 3PXZA 2ETKA 3ELJA 3PTGA 2JEDA 2E9UA 3D2IA 4LV5A 1G5SA 4BCFA 4C02A 4CV9A 4EHZA 5M56A 1IAHA 3KREA 4I6FA 5IA4A 1BKXA 2W9ZB 3PSBA 4FT5A 4PDPA 5K9IA 2AYPA 3PUPA 4AF3A 4ASEA 3TKUA 1SM2A 4BI2A 4DT8A 3C4XA 4FYOA 2VU3A 1ZAOA 4D4YA 1BMKA 2YIRA 4TYIA 3VJNA 2UW5A 5HICA 4BDHA 1Y57A 4BTFA 5M51A 4C58A 4MD9E 3VS1A 5A9UA 4YJQA 3SA0A 1OL5A 3Q6WA 4O7ZA 3MSSA 4FZFB 4NEUA 3VS2A 2C3JA 4ACMA 3QRJA 3OMVA 5DR6A 2Z02A 5CT0A 2BDFA 1GIIA 2UZNA 2WTKB 4BKZA 4EH5A 4FIIA 4CXAA 2W1CA 2JFMA 4TT7A 5HVJA 2UW3A 2QOQA 3VC4A 3RP9A 4B6LA 4ENXA 5IQEA 1XH9A 3HRFA 3ORMA 3ZOSA 1SNXA 2WAJA 3CJFA 3R7GA 5CF5A 2Z7SA 2HENA 2QOCA 3EQPA 3FLYA 4BBMA 3LW0A 5LOHA 2B9HA 4V04A 2PVKA 4BZNA 5K0KA 5LMKC 3ZRMA 2R7IA 4U8ZA 3PXFA 4BDEA 4JG7A 3GU7A 4J96A 3BIZA 4M66A 4F9BA 4K11A 2WQMA 4JJRA 5JFSA 3O7LD 2QO2A 1FBNA 2BRBA 2WD1A 3DZOA 2CPKE 2HOGA 3F66A 3QQHA 4FV6A 5CXZA 5AP2A 4EOMA 5CI6A 3CTJA 3TL8A 4BCJA 2QU5A 3VQUA 5IEXA 4L52A 2XIRA 1G8SA 2HZ0A 5EOLA 5IQCA 4H36A 2WU7A 3BYSA 5CLPA 5AR5A 3OVVA 3FWQA 1SMHA 4DITA 1A48A 3IW6A 1K2PA 4F7SA 4IX5A 1JKTA 3N51A 2OZAA 3FHRA 5HCZA 4YURA 2B7AA 5ANJA 3W2SA 3T9TA 3R9DA 4I0RA 5C26A 4G16A 1JWHA 2PZPA 3HDMA 4RX5A 4FV0A 1H1QA 3Q4CA 1M7NA 1PY5A 3EYGA 2VX0A 3MIAA 3MW1A 3F9NA 4D2TA 4I21A 4IW0A 4IAZA 2XBAA 2GMXA 4M97A 3VUMA 1WBNA 2I7QA 5ICPA 2ZM3A 2GHGA 3DBQA 2CMWA 5DI1A 3H30A 1BX6A 2QOBA 3VUHA 1Q3WA 4I23A 3RPRA 3T3UA 2J0MB 2CGUA 1ND4A 1OL6A 4IWOA 5IQAA 2ITWA 4YJNA 5JRSA 3U55A 1YWRA 3AC2A 2WTVA 2UVZA 1OIRA 3A7GA 4U6RA 3R7YA 5M53A 3DT1A 3N4UA 2H96A 4DFNA 3EMGA 3QCYA 3OW4A 4G34A 3OROA 5HVYA 1WVYA 4AGCA 2B0QA 3NUPA 2JBPA 5K4JA 4FTKA 4PY1A 3D7TA 1FVVA 3PE1A 4QP8A 2YCSA 2OBJA 3G33A 3NCGA 3ID6C 3QRIA 3AC3A 3WF9A 2Z60A 2DQ7X 3GU8A 4KRCA 2UVYA 2WOUA 4EK6A 1XWSA 4USFA 4OW8A 3HVCA 4RZVA 3SD0A 2KULA 4Y95A 4AT4A 2BAQA 3EQHA 3QC4A 2PZRA 4FTMA 4ZSEA 3HV6A 2BDJA 3AMBA 4CYIA 4D4RA 4YLLA 3EQGA 2R3IA 3V04A 5LJJA 2XYUA 4AAAA 5EYCA 4CZUA 4F1MA 5ITAA 4WUNA 3SX9A 4DFUA 4NFNA 2VWZA 2X81A 2BALA 1J1BA 4YZDA 2F2UA 2EXEA 2CNVA 4I4FA 4L3PA 3GB2A 4BDJA 4ZLZA 5HO7A 1PXIA 3I7CA 2CNQA 4Y46A 3P5KA 3FY2A 3QTRA 5FTOA 4TN6A 3F6XA 3MPAA 3RHXA 3LJ2A 3EFLA 3CY3A 5EQPA 3PJ3A 4Q5EA 4MEDA 3UTOA 4QYEA 3Q52A 2HW6A 4I41A 4Z7HA 4FV2A 4FL1A 5F20A 3U4UA 3UZPA 4O38A 5H2UA 3WF7A 3WZEA 3BI6A 3DBDA 3ORPA 3R1NA 4WOVA 4Y73A 1APME 3RPSA 5K5NA 2VX3A 3LFFA 5E90A 4BDIA 2VWBA 2UW0A 4GYGA 5CY3A 2PHKA 4BWXA 4D5HA 3B2WA 4NM7A 2YWPA 4UV0A 2W5HA 3OOMA 3WF5A 3KA0A 3CD8A 1GJOA 4NK9A 2XM9A 2CN5A 4G9RA 1KE6A 4GFGA 4Z16A 2XKFA 2C3IB 4XG6A 3R7IA 4FGRA 4YHTA 4DFLA 4MBJA 3QTSA 4EI4A 5FTQA 4XG8A 1QPDA 5J7HA 2XNOA 4PMPA 3HX4A 1YDTE 2QLUA 5L4QA 3FPMA 2J4ZA 3KKVA 3QCQA 5B2KA 1W0XC 5CSHA 3AC4A 2R3GA 1LUFA 3PFQA 3ZO3A 2FYSA 4F0GA 4EOKA 2BHEA 4FOCA 3CQEA 1RJBA 4TYJA 2VWWA 1CKIA 4BDDA 2YJSA 3MFUA 3PY0A 3EN6A 4B9DA 4M14A 2RL5A 4ANMA 4HNIA 5EM8A 3BYUA 4AWIA 2IVSA 4ZTHA 1JPAA 3E64A 4I22A 2CGWA 2X1NA 4RX7A 4R3PA 4RIYB 5E92A 4YMJA 3SV0A 2PY3A 3UGCA 3LCOA 2W5BA 5DT4A 4C4EA 1V0BA 3CR0A 1OVEA 3KN5A 3SG8A 3KL8A 4H1MA 4AA4A 2XKCA 4BIBA 3D5XA 3R9OA 4EH4A 2YAAA 4L46A 3ZFYA 5KMMA 1H0VA 1WMKA 4FUYA 3S3IA 4R7BA 5LVOA 5GJFA 3U6JA 1UU8A 2QG5A 4D4VA 3OCGA 4RSSA 4UMTA 4I5MA 2BR1A 2X4ZA 2BAKA 3BELA 5DLSA 4HCUA 3QKMA 5AA8A 4FVQA 4O0YA 5CU4A 2R4BA 3Q2MA 3LCSA 4GU6A 4BCHA 3QD3A 5IMEA 3E8CA 3ENHA 4OTRA 3V5PA 1YXXA 5M06A 1IR3A 2GQRA 5M4UA 4JVGA 5BVOA 4O6LA 5IQDA 2QURA 3R1YA 4U40A 2UZDA 4U42A 4E4MA 4JRNA 1OPJA 2QCSA 2YZLA 5FBOA 1B38A 2X2LA 3KVXA 3Q9ZA 5IPJA 4ZS4A 5CF6A 4KD1A 3PG3A 2UZLA 3GCVA 5J1WA 4CD0A 4C37A 4CFWA 5IISA 3UOKA 2HYYA 3OUKA 3UIBA 5I9VA 4AA0A 3G9LX 2Y9QA 5M09A 1WVWA 3EQCA 3Q3BA 3FZOA 4CFMA 1O9UA 4XS2A 2EXCX 5D9HA 3EB0A 3RI1A 4ERWA 5CU0A 3F5UA 4RA5A 1BI8A 3EYHA 4QTBA 1MQBA 1QPCA 3AD6A 3OBGA 3WOWA 4ACCA 4C2WA 2JLDA 2CKPA 2VNWA 3EN5A 3ZU7A 4YZNA 2BFXA 3OXTA 4BWKA 4QMQA 4JIKA 2CLQA 4RGJA 4XV9A 4OBQA 4P90A 5HD7A 1TQIA 2X8IA 3LJ1A 4EWQA 4CTCA 3Q53A 3W2OA 4D5KA 2ZV2A 1Y6AA 3ORLA 2R3RA 4IDTA 5K0XA 4NWMA 1XJDA 1UNHA 4MWHA 3HMOA 5HQ0A 4QPMA 5JZNA 4EC8A 2JDOA 3M11A 2XF0A 4GEOA 4GIHA 2XKEA 3MWUA 2QHNA 4GT5A 2JKQA 3DB6A 3FC1X 5GZ8A 5HTBA 3ZM9A 3IDBA 1KSWA 5AAFA 2VD5A 2XIXA 4MH7A 3NUSA 3DTCA 2G2HA 4FSZA 3GFWA 3CE3A 1VR2A 4FNZA 2Z7LA 3RALA 1BLXA 3COKA 5CF8A 5LVMA 3PA3A 3MVHA 3W10A 1PW2A 3P86A 4K8AA 5HOAA 3ZYAA 3ORIA 2H34A 2OF4A 2W4KA 3NNWA 3EFWA 1H07A 3RAWA 5E8UA 1IASA 3GC7A 5AUXA 4MBIA 4OAVB 3PWYA 2GFSA 3TNPC 3DKCA 4F4PA 1HCLA 4EZ3A 4L7FA 1OL1A 2FSLX 2VRXA 3EN4A 3LFEA 3ATSA 3LMHA 3A62A 3POZA 4QOXA 3OZ6A 3NUNA 4MXXA 4FG8A 4IAIA 3HEGA 4X2NA 3GI3A 4B8LA 4FEWA 3PPJA 1XH6A 1XQZA 2ZB1A 5BX0A 5BUIA 1JLUE 4RQVA 1IAJA 3UQFA 2XNBA 2J51A 3D15A 3NUUA 4LRKA 2HW7A 2ZYBA 3D0EA 1R78A 2JIUA 2ACXA 3DFAA 3MY0A 1UVRA 3V8TA 5DWRA 4DGOA 5JN2A 1P4FA 4YPDA 4GG7A 5ANIA 4CMUA 2Y8OA 4IDVA 2OJ9A 4G5PA 2ONLC 2XJ1A 4EQUA 1REJA 4FODA 3FZSA 2LGCA 2XK8A 5DE2A 3BZ3A 3N4TA 2JBOA 4J97A 4AW1A 3UPXA 4HYSA 2QHMA 4AGWA 3A60A 2PWLA 1GY3A 4E4NA 4IACA 5AP7A 3VBXA 2BKKA 3TWJA 1T45A 1YDSE 4DAWA 1T46A 3ZHPC 2LAVA 5LMBA 4MXOA 5BPYA 3R1QA 3HKOA 3PJ2A 4W9XA 4JQEA 3ZH8A 1JOWB 4DEAA 3OTUA 3UIXA 3DAEA 4MD7E 3FAAA 3Q4ZA 4WUAA 4YC3A 4YLJA 2JDSA 5DT0A 3LXPA 2X0GA 3P7CA 2OXDA 3I0OA 4ZZMA 1RDQE 2GQGA 4FKIA 2OFUA 5JGAA 2C6OA 4FE2A 2C6EA 5DG5A 3HAVA 3PVGA 4EHGA 2WMWA 3FC2A 1W84A 4BCGA 2WMUA 2YCFA 5F4NA 4U9AA 1WBTA 2XMYA 3O23A 1UU9A 5J8IA 5EDRA 4TYHA 3FJQE 5KMJA 3TJDA 5HESA 5J9YA 4LYNA 4O96A 2VN9A 4D4SA 4DEDA 4DHFA 2VTNA 4X2JA 2W1ZA 4BI1A 3RM6A 3QF9A 4MD8E 5J7BA 3LFAA 4EEVA 3C5UA 3D7TB 1JSUA 2W1DA 3DB8A 2VUWA 4R77A 4CRSA 4UZHA 3TM0A 3OWPA 5JT2A 2QOOA 3UIUA 3T9IA 1J91A 2X39A 3GFEA 4L6QA 4PNIA 3CC6A 3BU5A 3RPOA 2BPMA 3RTPA 2PPQA 4FT9A 4AFEA 2C68A 2ITPA 4MXAA 4YJTA 1I44A 5AP3A 2I1MA 3NIEA 4L53A 4BBFA 2UZEA 4GUBA 2HZNA 3D94A 1M52A 2QLQA 4YZCA 3HUBA 5IA5A 5HE2A 5DGZA 4IB3A 3LXLA 4MX9A 4NSTA 5F95A 4ZTSA 3JVSA 4NKAA 5JK3A 3P23A 4W4YA 3GC0A 4RIOA 2WU6A 2Y6MA 4IBMA 1CKPA 2Z7RA 4GK4A 3ZZEA 5DVRA 2OJJA 1XBBA 4DC2A 2WGJA 4QMOA 4CRLA 3WZKA 3F2NA 1YI3A 1OUKA 1AGWA 2Y4IC 4RFMA 1P2AA 3WBLA 2WQOA 3F5XA 5FP5A 1M2PA 3ATTA 5JRQA 5DHJA 2VTOA 4TKSA 1M2QA 5HE1A 3RAHA 3PG1A 4N57A 2WEIA 3KXNA 4QTAA 4IC8A 5BVEA 5JMSA 3DKFA 3NSZA 1JQHA 2JIIA 1OIYA 2ITOA 5EKNA 4A9YA 2VTSA 3WF8A 1H1WA 3V51A 5CF4A 3F82A 4XLVA 3R2BA 3AC8A 2RFEA 1XH5A 3KRLA 4EBWA 4AZEA 4CZTA 4TWCA 4XBRA 4LOQA 4NCTC 4P2KA 5IEYA 4GG5A 5J9ZA 3GC9A 3R8VA 3FE3A 3VRYA 3F61A 2GS6A 3R00A 5D1JA 4YP8A 4O7SA 4RVKA 2PUUA 2PVYA 4YLKA 2FSOX 2YN8A 2BMCA 3R8PA 2WB8A 4B99A 4I20A 2ZMCA 2UVXA 4QMXA 4CGAA 1ZLTA 3NW6A 3OCSA 5EK7A 3F3UA 4O1OA 5CZHA 2Y0AA 5HO6A 5HD4A 3OUNB 3MESA 4BY9E 3C0GA 4R3CA 3OG7A 1JAMA 2UZBA 3CKWA 5FEQA 3VUIA 2C47A 5HO8A 1WBVA 2WHBA 4UALA 3TZ7A 2OSCA 4Y8DA 5H8GA 3VULA 4QQ5A 3K3IA 4CFXA 5E8ZA 3VBTA 3IECA 5C9CA 4D9TA 2XBJA 4HOKA 3VN9A 5ETFA 3TDWA 4X21A 3G15A 5AA9A 1RE8A 3TKIA 3LLTA 5E4HA 3QKLA 2BIKB 5J87A 3NLBA 3PIXA 2O0UA 2QKWB 4IVAA 4ZLYA 1A06A 4P5ZA 5AAGA 5DEYA 2PU8A 5E9EA 4PTGA 4IHPA 5FXSA 3BU6A 4C33A 5DNRA 2VGPA 4KAOA 5DBXA 2C6TA 2PMIA 3OP5A 3PXYA 3R8MA 2F9GA 4ANOA 3G9NA 1JSVA 5K5XA 4AOTA 1VYZA 4HW7A 5IA0A 3SW4A 4YNEA 3VW6A 3UYSA 1OKWA 4DBNA 3IOKA 3QHRA 4BC6A 4CKRA 2VO6A 5HORA 4EJ7A 1Q99A 4BTJA 2IW8A 3ODZX 4NTSA 4W4XA 2X2KA 5C8MA 4OTHA 2ESMA 4ZMEA 2QR8A 3KULB 4DLJA 1UU3A 3WIGA 4X0MA 4YR8A 2P2HA 3IW7A 3ZC6A 4M3QA 5L6PA 4I5CA 2HELA 3KK8A 5EHYA 4LI5A 3LPBA 4Y5QA 1Q8WA 1QCFA 2BTSA 4PP7A 2GNGA 2WZJA 2XIZA 3FI8A 4QQTA 4I93A 4O0RA 2GS2A 2YM3A 4C34A 3A7HA 3IGOA 5FXRA 2WTJA 5AV3A 4XRLA 3HP2A 4U81A 1XHAA 4FNYA 4LOPA 1OPLA 2ZDTA 3H10A 2WXVA 4FICA 4JG6A 3OWJA 3F69A 5L6WL 3HUCA 2DWBA 4JLCA 3QLGA 2OW3A 4ASDA 1Q8UA 2E9VA 2R3OA 2V62A 2R3FA 3DV3A 3CPBA 3HMMA 2EUFB 4MF1A 2XH5A 5HZNA 1OZ1A 3GCUA 1PXNA 4PUZA 3H9RA 4H05A 2C0TA 3A7IA 4IMYA 4FV8A 3ITZA 4H3QA 4UXQA 5BYZA 5BYLA 4ZY6A 5L8LA 2EXMA 3QFVA 5IQHA 2WMSA 4OTQA 4DEIA 1CKJA 5CSWA 4QO9A 4OT6A 5C4KA 3C0IA 2B54A 3TUCA 4IEBA 1K9AA 4FTNA 3C9WA 1NXKA 2F7XE 3KRJA 4EOPA 1YHVA 3SLSA 3UMXA 4CMOA 4ZAUA 2O64A 4E1ZA 5ANEA 2F7ZE 1BUHA 5TF9A 4C38A 3I6UA 3LJ0A 1Z57A 3CXWA 3EQFA 3OHTA 2Y6OA 3R01A 3V8SA 3O51A 1KE9A 2CKEA 3G0FA 3G2FA 4LRJA 4DH1A 5HVKA 2C4GA 3COMA 5GNKA 4G3CA 2QONA 5C4LA 1Y91A 3ZBXA 1BI7A 3SXRA 5D11A 3DXNA 1QPEA 5FM3A 4CLIA 4JL9A 4U79A 1E9HA 2ZDUA 5D41A 4BB4A 3BHUA 4UZDA 3U6HA 3W1FA 3R1SA 3UODA 4FTAA 5BVKA 4FZ7A 1FMKA 2W7XA 5EG3A 3FYKX 4WRGA 3NAXA 5HG7A 2OU7A 2RFSA 1FGIA 3EFJA 3OT3A 3PLSA 5J5SA 4GKIA 1OL7A 2XA4A 4GS6A 3H3CA 4GW8A 2OWBA 5HTCA 4A7CA 1YVJA 2FH9A 2VWIA 2YM5A 5D10A 4IXPA 4U97A 4XP2A 3LMGA 2V22A 4P5QA 3EN9A 4QPSA 4U3ZA 5FLFA 1WBOA 5AM7A 4IANA 5KBQA 5AUVA 3SHEA 5HG5A 2XCHA 3EOCA 3NRMA 3QQUA 3DKOA 3LFSA 2B9JA 3AD5A 3BE2A 3P9JA 3VVHA 4M69A 1KOAA 4QP1A 1YOJA 4WRSA 4B4LA 4FA2A 3VUGA 2WTIA 3V5QA 1PKDA 3VBVA 3R2YA 5KMNA 2CHLA 4AOIA 3V5JA 1OIQA 5AEPA 4F99A 4GU9A 5EI8A 1H26A 3VIDA 5C27A 1ZXEA 3FMJA 3PE2A 4HCTA 3NX8A 3RZBA 4DFBA 4O84A 3D5UA 2O5KA 2XZSA 2PZIA 3JXWA 1KE5A 2W0JA 2X8EA 4ZSGA 4BCIA 1YWNA 3E87A 1UU7A 3DK6A 4IVDA 1YXVA 3AC5A 3R9NA 3VQHA 2A4LA 3ZM4A 1V1KA 4C8BA 4XJ0A 3BYOA 2QQ7A 3UO6A 3JYAA 2A1AB 4TYEA 4CCUA 3CP9A 2PE1A 4TPTA 4ZY5A 3UQCA 4O21A 4E6QA 3DAJA 4E93A 3W2QA 2WPAA 2Y4IB 2C5YA 4YTFA 2C3LA 3TNWA 2JKOA 4HYIA 4PTEA 2W1IA 5DN3A 3G5DA 4QTDA 2Y7JA 5L2TA 5LCJA 3A61A 3NPCA 1Z5MA 1CDKA 4G17A 5IQBA 4RJ3A 2BTRA 4K1BA 3ZUTA 2R3KA 4M68A 5DYJA 4JIAA 3P79A 3BQRA 5AUWA 5IMXA 3LOKA 1E1VA 3HA6A 2E9NA 3A7JA 4WSQA 1PMVA 5JSMA 2C6KA 3OFMA 3R7EA 1W82A 4DH8A 3PXQA 3KQ7A 1J3HA 3PXRA 4EUTA 3QLFA 3LFQA 1W7HA 2F49A 3K54A 1UKIA 4AZFA 4DG0E 4G3DA 4L9IA 4W4WA 4D55A 5CVFA 5L2WA 4R3RA 4FTOA 3ETAA 4BDBA 2B1PA 3ZSIA 4FKLA 4JR7A 4LV8A 3SOCA 4L43A 4PDSA 4F64A 3FXWA 3JPVA 5EKOA 1S9JA 4FKSA 4EQCA 2V7OA 3RBWA 4EH2A 5IH6A 3QXPA 3FEGA 2XYNA 1CSNA 4X7QA 1NVRA 3QALE 4RPVA 3HGKA 3CD3A 2R2PA 4QP4A 5C03A 3PIZA 5IKWA 4KA3A 3F5PA 3LHJA 2P0CA 3VHEA 2XIYA 2YA9A 4ZY4A 2X7OA 2YEXA 4E6DA 5EM5A 4A9SA 2NP8A 1SVHA 2UZTA 4U3YA 3S95A 3NDMA 3UC4A 5HNIX 2WFYA 1JNKA 2ONLA 3E7OA 3TUBA 2WNTA 4C4JA 3NZ0A 3ZXZA 4BHZA 4D2PA 2UW8A 3ET7A 2PE0A 2WMTA 3KU2A 3O8PA 4GL9A 2ZV8A 3MVLA 4OGRA 4QT1A 1P5EA 3F7ZA 3LXKA 4IFCA 1YRPA 3FKOA 2IG7A 2RKUA 3AT4A 3VUKA 4UY9A 5M55A 3ZEWA 3HV7A 3NAYA 5LVPA 4J53A 1H00A 4IZYA 5CSXA 3MH1A 2FB8A 1PMUA 2UZUE 3FZRA 2PVNA 4D1ZA 4DF3A 4X3JA 5C01A 3FLZA 3BHVA 5CSVA 4BCPA 4C59A 2WEVA 5E1EA 1JKSA 3MY5A 5JFVA 3DQXA 4OBOA 2PULA 5AM6A 3ZMMA 4C61A 2I0YA 2J90A 2QD9A 3BX5A 3F2AA 2YAKA 4GMYA 4IADA 4JDIA 3CQUA 4JX7A 4RLKA 4FBXA 2QODA 4MNFA 3TNIA 3PA4A 2WKMA 2XIKA 2W17A 4EOOA 4FNXA 5IEVA 3UPZA 1VEBA 1GZOA 3QWKA 3RPVA 3KY2A 2CLXA 4FEUA 3HDNA 4L45A 2X2MA 3AXWA 4GUEA 4Q9SA 1WBSA 4JDKA 2P33A 3L8XA 3IG7A 1KOBA 5HLPA 4BCNA 5AADA 5CAPA 1NT2A 5E8SA 5AV0A 4LUDA 1U4DA 3DA6A 4XRJA 2OFVA 4IIRA 4WNOA 5AP1A 3RKBA 5L3AA 4L8MA 4JXFA 3WF6A 1M7QA 4FZDB 2RFNA 1AQ1A 4IB0A 2ERZE 5CTPA 1ZOEA 4YTHA 2UZVA 3EIDA 4DH3A 5IUHA 2RIOA 5HLWA 3SKCA 3L8PA 3OCBA 4DE4A 3VUDA 4C57A 3VF8A 1GZ8A 5I9ZA 2X7FA 5CENA 2W1HA 4CNHA 1M17A 5GHVA 3SDJA 3W16A 3TEIA 3HMIA 4XNEA 3KXHA 3S0OA 5AX3A 3ACKA 3VRZA 3FV8A 4FIEA 3V6SA 3GXLA 2X8DA 3RPYA 3JY9A 3MH2A 2X9FA 4NFMA 3ZRKA 3WILA 5A6NA 3FUPA 3KF4A 5A4TA 3LKMA 4KSPA 3L9PA 3DXPA 2BZHB 1ZWSA 3DK7A 3QTIA 4MTAA 3GU4A 1XH4A 4C3RA 4RWJA 5BVDA 2BFYA 2JFLA 5ANOA 3SC1A 4RJ7A 4O27B 5KCVA 4MXZA 5FGKA 4LMNA 2IPXA 5IU2A 4UWYA 4EK4A 2O65A 3NVMB 4ZTMA 3O8TA 4FOBA 1ZYDA 1GAGA 4E4LA 5CX9A 4GFOA 3C4FA 3DLZA 3ROYA 2ERKA 3VHKA 2XNNA 3ZC5A 4ANSA 1BL6A 4APPA 4YTIA 3FMEA 2BROA 3NNXA 4IAFA 2PE2A 3F88A 2G01A 2W9FB 3U87A 3ZUUA 4BWPA 3D2KA 3BWJA 3I7BA 4A4XA 4GT4A 4UMRA 1FOTA 3KVWA 1YXSA 4FV7A 3ZO1A 3EQDA 4RFZA 5L2SA 3TZ8A 4AE9A 4YNOA 2ZV9A 3I79A 4O0UA 5AJQA 2GNJA 2R3NA 4Y85A 5K4IA 4ANNA 1JBPE 5KUPA 3WI6A 4XP3A 4V0GA 2GQSA 4EL9A 4TYGA 4KIKB 5E8TA 4DH7A 3Q9YA 4HVHA 4UMQA 3R83A 4V0GB 5LVLA 3QTXA 3RAKA 4K6ZA 5CAQA 3UIMA 4ZTRA 2VTTA 4BVUA 4WT6A 3MJ1A 4M67A 5J5TA 3GEQA 4D2WA 3FI2A 4HYHA 4CQGA 3I60A 3OOGA 4WSYA 4A4LA 3CY2A 5M57A 4HYUA 3EZVA 1I09A 4RZWA 3KB7A 3IS5A 2JGZA 4AW0A 4C0TA 4NJDA 4TYHB 3OXZA 4BL1A 1L8TA 5L2QA 4ANQA 3R9HA 4C4IA 3A2CA 3FMMA 5FM2A 1RW8A 4L01A 1M14A 5FWKK 4FKJA 2XK7A 5EM7A 2C30A 4A07A 5LQFA 3QA8A 4G9CA 2R3LA 4F08A 3UO5A 4BYJA 1MRUA 2WQEA 4F1TA 3I6WA 4G6LA 1YI6A 4LL5A 2CKQA 4O86A 4FIHA 4F63A 4PRJA 3VAPA 4J95A 3E92A 1SNUA 4AX8A 4JG8A 3QD0A 5I0BA 1R0EA 2GSFA 4WNKA 5E8WA 4MBLA 4YUQA 2GNFA 4BCOA 5FBNC 3DU8A 4EH3A 3KK9A 4LGDA 3C0HA 5AUYA 5KHXA 2EB3A 3TV7A 3GGFA 2QOHA 4FVRA 4JT3A 3QCSA 1LR4A 4DGGA 1OIUA 5HG9A 2HWOA 4X3FA 4CV8A 4NUSA 1ZRZA 4JBOA 4DTAA 3NMUF 3QQGA 4FX3A 2ITZA 3LQ3A 2C6LA 5BMMA 5HX8A 5EQYA 3OEFX 3LMIA 3HNGA 3I5NA 3ZO2A 3NUXA 3ERKA 3IGGA 3O7LB 2UW6A 5GINE 3ORKA 1H25A 1UNLA 1XH7A 1PF8A 3VNTA 1E1XA 1J7UA 3CPCA 5FXQA 4AZWA 5BYYA 4DEEA 4IH8A 4L67A 4LM5A 1L3RE 5AV1A 3SXSA 3IOPA 5CI7A 5FTGA 5GZAA 4AU8A 3RK7A 3BGZA 4KS8A 4QMZA 4JR3A 3ZCLA 3GC8A 2GU8A 2PMOX 4EZ5A 3MIYA 4CKJA 4H39A 4QYFA 2GFCA 3I0QA 4S33A 3AT2A 5KO1A 4PDYA 2C0IA 2VWVA 3W32A 2PVMA 3M2WA 4ARKA 5HCYA 2XUUA 4D0XA 3QBNA 2WELA 5EDPA 5C8NA 4PF4A 3TACA 3UMWA 1JVPP 2QI8A 3IKAA 4Q5HA 5FUTA 1OGUA 3UOJA 4F9AA 5EW8A 2Y4PA 4QP9A 4RWIA 1PXMA 5C1QB 3ORTA 3ZO4A 3H4JA 4L44A 4ZJJA 1Q41A 4F09A 3PY3A 2B9IA 3KULA 3UO4A 5E7RA 3HV3A 4JS8A 1NVSA 1X8BA 3NNVA 2YITA 5IUGA 2B55A 4Q2AA 1ZZ2A 3Q5IA 4TWOA 5CT7A 2C5NA 2GNHA 4AUAA 3LCKA 3HV5A 3I1AA 3V6RA 1O6KA 5H8EA 4WD5A 2BILB 1ZMUA 4I6BA 4YJSA 2CCHA 4C4HA 3V01A 5A14A 4W9WA 1G8AA 2FO0A 3L9NA 3MS9A 3F3TA 4OTDA 4XLIA 3QCXA 2XB7A 3ZTXA 5CU2A 3NGAA 1DS5A 3K5UA 3RK9A 4CEGA 4D1XA 5DR2A 2PUIA 4RIXB 4TNDA 5AMNA 2HXLA 3DBCA 4I3ZA 3MVJA 4J52A 2VO0A 4L3JA 3PY1A 1PJKA 2VTLA 3WZJA 5CEQA 3THBA 5KMKA 4DFYA 2WTCA 2Z7QA 4L68A 1Q8YA 2KTYA 4FVPA 4KWPA 4UX9A 5FRIA 2QOFA 3UQGA 3FDNA 3EL7A 3FHIA 3CGOA 3MBLA 3CCNA 3E3PA 3RMFA 2O8YA 1GIJA 1TQMA 2ZM1A 4ANBA 3OW3A 4EJNA 4O82A 3F3WA 3HP5A 5IH4A 4P7EA 5AFVA 1FPUA 2IWIA 3QUEA 1O6LA 4LGHA 1UNGA 5AR4A 3UP7A 1Z9XA 3FLQA 2RGPA 3D7ZA 5JFWA 1SVGA 2P2IA 3O96A 5FDPA 3FL5A 3TZMA 4G3GA 3PJCA 4AACA 4J7BA 2B4SB 4IVBA 4NW6A 3N9XA 2NNWB 2RSVA 1WBWA 3AOXA 4OBPA 2YIQA 2P3GX 5EW3A 2XEYA 1MQ4A 3JVRA 3L9LA 4HCVA 3WYYA 2VV9A 3DK3A 4R8QA 3EQIA 3ZLYA 3QTWA 4AS0A 2OH4A 2GTNA 2IZRA 4YJPA 4OT5A 5CAUA 3BU3A 4FKRA 4NT4A 2R0UA 3R04A 1YW2A 3RJCA 1XR1A 4BGQA 2XEZA 3BLHA 3ENMA 3IW5A 4QMSA 3FBVA 3D14A 3KMMA 4OTGA 2XK6A 3MI9A 3MFRA 4S31A 1Q8TA 4ZSJA 2BZIB 2OZOA 4GK2A 3UVQA 1PXJA 4M12A 3C1XA 4GK3A 4QMMA 5HHWA 4EBVA 5H9BA 1U54B 4FSRA 3DOGA 1F5QA 1CMKE 1YOLA 3P0MA 4XG9A 3IQ7A 5CWZA 4UB7A 3MVMA 1U54A 4QMNA 2J0IA 2WTDA 3HECA 4IWQA 3M1SA 3BBTB 4X2GA 3SG9A 3GP0A 3DJ7A 3MN3A 4C2VA 2R64A 1UWHA 2YHVA 1URWA 2HY0A 4FSWA 3R63A 4M69B 4QD6A 3S1HA 2V55A 4U45A 4F7LA 4NH1A 4EHEA 4GH2A 3ZLWA 3BHHA 4ZZOA 1OKZA 2PVRA 3RNYA 4FKOA 3FMHA 3IDCA 2EWAA 3FLWA 3QRKA 3VS4A 5A46A 1GIHA 1VYWA 5IF1A 4DEBA 5EHLA 3DFCB 3JY0A 4F7NA 5AV2A 4G3EA 4F6SA 3G0EA 4PDOA 1KV2A 3BPRA 1YKRA 2FGIA 3AD4A 5GJDA 3R8LA 3PYYA 4E5WA 5DMZA 5HTIA 2HCKA 4EK5A 4QPAA 3MA3A 3L8VA 3TUDA 2XJ2A 3UG2A 4IX3A 3C5IA 4O7YA 2XJ0A 4QMYA 4F6UA 2W5AA 4F7JA 4BDGA 1PMNA 4RIWB 5DH3A 2YISA 2NRYA 3IK3A 4O0VA 1YHSA 2X6EA 3VS7A 4RJ8A 4I92A 3I81A 2X7GA 2ETRA 3A99A 4BHNA 2PL0A 5A4QA 2VTPA 5LWNA 3L9MA 3QU0A 4I0SA 4XV1A 4HVDA 2XK3A 5C8KA 3DNDA 3UJGA 5TKDA 4FIJA 3RHKA 5IZFA 4DT9A 5EYDA 3IO7A 1H0WA 5TO8A 5HE0A 3R9RA 3HRBA 3HMNA 1NA7A 2VWXA 3E3BX 4EOSA 2UZWE 4QP3A 3E93A 4NZWB 5T68A 5EYKA 4ID7A 2ZM4A 4FKUA 2PMNX 3PXKA 4IC7A 4QYGA 5B7VA 4RC2A 4UBAA 4R6VA 3RZFA 3E88A 3P7BA 2P4IA 2GPHA 1PYEA 2FA2A 4QQJA 3MPTA 1VJYA 4B7TA 2F57A 3NUYA 3EL8A 1BL7A 4BIDA 1OBDA 5KE0A 2VTJA 3QL8A 4G31A 4UWCA 3UNKA 2QKRA 1XBAA 3LLAA 2JAVA 4J99A 2B52A 2IVTA 3LXNA 3RAIA 1DAWA 3R28A 4M8TA 4NIFA 3UBDA 4E6CA 1KUTA 2EU9A 2CJMA 4DG3E 3R7OA 2CDZA 3KRRA 4MXCA 1Q4LA 1J7LA 2WIHA 2QO9A 2XRWA 3DBFA 3ZRLA 4AP7A 5JEBA 2JITA 4K18A 4C4FA 4XG4A 3Q96A 4L42A 4A9TA 4DTBA 5AUUA 3F5GA 3U6IA 3EH9A 2HXQA 3NR9A 4MXYA 4J71A 2R5TA 2WMVA 3W8QA 4DFXE 4E4XA 5KKRB 1F3MC 1PHKA 2I0HA 4FK3A 3HV4A 2W1GA 4NKSA 3TXOA 2CCIA 4L00A 5CNOA 3ZDIA 2A19B 5I9XA 1ZY5A 3FMDA 3KEXA 3OC1A 4PL3A 1B39A 4YSMA 2Q0BA 4HPTE 2R3HA 3DDPA 5GZ9A 5EHOA 2CNUA 3ALNA 4G1WA 4MHAA 2XCKA 4OR5A 4DCEA 5CALA 4ZMFA 3C50A 2HK5A 5F1ZA 4ASZA 3UZRA 4F9YA 4EH9A 2UW9A 3H9OA 3IW4A 2IJMA 3DBEA 3MFSA 4H1JA 5EW9A 5CASA 3TZ9A 4V05A 3IPHA 3DNEA 2OIDA 3BV2A 2YZAA 3O8UA 3QRTA 4BZDA 3GENA 3EHAA 1QL6A 5IA3A 5M4FA 5DOSA 1GNGA 3UE4A 4R78A 2CGVA 2OGVA 4O91A 4CQEA 3PP0A 4B8MA 3R22A 5AR3A 3T3VA 2XNMA 4IFGA 4M13A 2YIXA 3RM7A 4MQ1A 2ZB0A 2E2BA 4ZEGA 1UA2A 3PWDA 4FTQA 4DEHA 4ZOGA 1PXLA 2AC5A 3U4WA 3MYGA 3R8UA 3L8SA 3DS6A 4AN3A 3BGQA 3PSDA 5I9YA 4G6NA 3F3VA 4WG4A 2VTHA 4D1SA 2Z2WA 2REIA 3DKGA 4U44A 4CTBA 3VWAA 2W99B 3REPA 3PA5A 3LE6A 3D5WA 4Z55A 5AV4A 3ZONA 3W2CA 5JZJA 1OKYA 4BZOA 2GNIA 1UV5A 4PTCA 4J98A 4KRDA
chains in the Genus database with same CATH superfamily
3ANQA 5HG8A 1FMOE 4WHZA 3MB7A 4D2RA 4NU1A 3EJ1A 1WBPA 3UDTA 4MYGA 4LL0A 1W2FA 3CEKA 4NCTA 1NY3A 2GHMA 3OTVA 4BGGA 2OZAB 2EVAA 2IVVA 4YO4A 4I6HA 5IA2A 1TFFA 4F9CA 4RX8A 3N4VA 2C1BA 3FXXA 4YZBA 2XS0A 1GZKA 4X6QC 3HLLA 4NM3A 3R0TA 3KRXA 4O7WA 3RINA 5IQGA 3EQRA 2XRUA 2YCRA 5DIAA 5KBRA 4I5PA 1QMZA 5CVHA 4KUJA 5EI2A 4YJRA 3W2PA 4DINA 2WQNA 4JRVA 2E9PA 2HZIA 4X2FA 3NS9A 4X6RA 1JKLA 3IDPA 1J7IA 3KXMA 2X6DA 3QAME 4AQKA 3R21A 3JS2A 4F0FA 1Q97A 2WMRA 4FGBA 4UMUA 3T8OA 4BTKA 4FEXA 4FTUA 4ZXTA 3AGLA 2J5EA 4FJVA 4RVMA 4FK6A 4F70A 4AA5A 3DZQA 1OGYA 4IM2A 1OL2A 3VO3A 2J5FA 2WMQA 4FUXA 4FTIA 4KKGA 2NYAA 4CFVA 5IG1A 1TVOA 2NO3A 1ZZLA 4C3PA 3FQHA 4M0YA 5EFQA 5IDNA 2V5QA 2ZOQA 4YO6A 3R30A 3BCEA 4FMQA 4FSYA 2J6MA 1H08A 5CSPA 4JBVA 3Q2JA 2ETMA 2ZMDA 4BR3A 4FTCA 4O0TA 2C5XA 1STCE 2H6DA 3DCVA 3EQBA 3G90X 3GCQA 3NYVA 4XH6A 2DUVA 4EKKA 2BRHA 1EH4A 4RX9A 2C0OA 5J1VA 3MV5A 5CAVA 3LFCA 3NUAA 3Q6UA 2G2FA 5DA3A 2PK9A 1PXOA 4ZS0A 5T6KA 4FC0A 4S2ZA 4CYJA 3ALOA 3MH0A 2FSTX 4I0TA 3SXFA 4E3CA 4X3FC 3TG1A 1RQQA 3C7QA 2YDIA 3OBJA 3TN8A 4D58A 4BICA 2QOLA 2QG7A 1W8CA 3FL4A 3QYZA 1Q61A 3UZTA 4OAUC 3LZBA 4Z9LA 1U5RA 3E5AA 5LCKA 5CEMA 3KXGA 3EFKA 4M7IA 4EH7A 4O2PA 4JDHA 3GUBA 4Z7GA 3QA0A 5CS6A 4ZTNA 4HVGA 3ULZA 4N70A 4XP0A 5CXHA 4HNFA 2VZ6A 4QDVA 2B9FA 2XP2A 4R7IA 3UYTA 4C3FA 4F6WA 4MF0A 3AKKA 4PP9A 3NYXA 4E5AX 4FSTA 2C1AA 4G3FA 3WARA 4ASXA 3FLNC 5D12A 3RVGA 4O2ZA 1WAKA 2IW9A 4F1OA 4FTJA 5DRBA 1UKHA 4D9UA 4KSQA 5EDQA 1H4LA 4RLLA 4U43A 5LMAA 2HWPA 4GCJA 4J1RA 3U54A 2HZ4A 3EN7A 2WTKC 3II5A 4HZRA 1SZMA 2C6IA 3K5VA 1R1WA 3LFBA 4H58A 3LQ5A 4QQCA 4XV2A 5A3XA 4FKTA 3VS3A 1LEWA 4QMPA 2G9XA 4O1PA 3LIJA 5B0XA 3UOLA 2PUNA 3PIYA 3NW5A 4YU2A 3Q60A 3Q5ZA 4BI0A 5KHWA 1OB3A 2I0EA 4KIOA 2PTKA 4FL3A 3EKKA 2J7TA 1DI8A 3QZFA 3V5TA 3TV6A 2HIWA 3C13A 5DR9A 4AN2A 4AT5A 4OLIA 4CFFA 5JGBA 5ANKA 4IJPA 1MP8A 3UOHA 3CBLA 4OTIA 3A8XA 2YDKA 2CGXA 3GVUA 2OIQA 2JKKA 5L2IA 1U46A 1WFCA 3QX2A 2OO8X 4EH8A 4IQ6A 2HAKA 4UXLA 4EKLA 5GIOE 3ZSHA 3QC9A 3VS5A 3QQLA 5I3OA 1Q24A 4BKYA 3G51A 3HAMA 3PVBA 2R0IA 3FI3A 4AE6A 2SRCA 3LQ8A 4RWLA 3DDQA 2B53A 4AW2A 2C3KA 1DI9A 4CT2A 2XNPA 5HKMA 4G2FA 5CZIA 4IAAA 3D83A 3GU6A 3QTQA 3HYHA 4PMSA 4C35A 3HL7A 3PZHA 4GYIA 2V7AA 4YHFA 3FZ1A 4GVJA 5KKRC 5FD2A 2XK9A 4RRVA 4RWKA 3UP2A 2NPQA 2J0LA 2PSQA 2WMBA 3ODYX 3P7AA 3E63A 3OY1A 2J0JA 2W1EA 4ITJA 4HVIA 4NYEA 1ZY4A 4MKCA 3ZLSA 5BUEA 5AWMA 5M44A 3DJ6A 1AD5A 2RFDA 4L7SA 4MK0A 3TCPA 4EOLA 5BVNA 4JDJA 5KNJA 4IX4A 5JQ8A 2DYLA 5ACBC 1ZARA 3QX4A 5BUJA 3S4QA 4YBKA 3PJ1A 5AAEA 2V0DA 2Z8CA 4I94A 5LWMA 2R3PA 4JAJA 5CAOA 3H9FA 3QTZA 4FV9A 1GOLA 2GS7A 4QMTA 5DEWA 4YGAA 4DHIB 1UWJA 2R7BA 1BYGA 3HMPA 2QO7A 3LFDA 1IRKA 2JIVA 4RFYA 4Z3VA 4DFZE 1ST4A 3UDZA 4YPSA 2QC6A 4R5YA 3EZRA 4ALWA 3PJ8A 1U59A 4CFUA 1XO2B 1PMEA 4PWNA 5DT3A 5ACKA 3V5LA 2JDVA 4KB8A 4M0ZA 2C5OA 2WTWA 3ZEPA 4C4GA 3NNUA 4EOJA 1NW1A 5F9EA 5CYIA 5EOBA 3LM0A 1SVEA 3CSVA 1Q8ZA 2IVUA 1H01A 5E8VA 3LCDA 4RIYA 4RBLA 4O7VA 4USDA 5HX6A 2YDJA 2BRNA 3SGCA 4RIXA 2PYWA 3E7VA 4JBQA 4ACDA 4L3LA 4GV1A 1ZYCA 1A9UA 2UV2A 3GOPA 3L1SA 4WO5A 3RK5A 3O0GA 1DM2A 3BLRA 5D7VA 5J9LA 4D2SA 1DAYA 3RCJA 4JBPA 4O4EA 4RA4A 3LFNA 3OF0A 4JOAA 4CVAA 1OPKA 4FTRA 4Y5HA 2W05A 2JDRA 1REKA 4R1VA 4O0XA 5H3QA 5I9UA 4O81A 5J95A 1MRVA 5BNJA 4BTMA 2OH0E 2C69A 2OICA 5AR8A 3PRIA 3TNHA 4S30A 2YABA 3E8NA 4O7NA 3MJ2A 5IQIA 3DY7A 4GFMA 5AUZA 5LMKA 4Q9ZA 2CSNA 4EH6A 2C6MA 3C51A 2BAJA 4KINA 2P55A 4CT1A 1Y6BA 2VWYA 2ITUA 5M4CA 3A7FA 1PRYA 2C5VA 2ZVAA 3QZIA 4I6QA 1HCKA 3GCSA 3WYXA 1R0PA 3H0ZA 4DEGA 3PZEA 4DCAA 5JGDA 5TE0A 4H3PA 2PMLX 4GSBA 4GKHA 3TKHA 4FKGA 3WIKA 4OTFA 3ZSGA 2IO6A 4LOOA 4QEBA 3LAUA 1WZYA 4DGMA 1WCCA 5DFPA 2XVDA 3PP1A 1Q3DA 4XHKB 4EYJA 1FVRA 3FQEA 3KXXA 4BDFA 4RVTA 3IW8A 2QOKA 5CANA 4QTCA 4WNPA 5A4EA 3CQWA 4IWDA 4M84A 5JQ5A 3SW7A 2FUMA 2R3JA 3GNIB 3VUTA 1OITA 5FDXA 2OXYA 3U51A 3UNJA 4AZTA 4XV3A 5B2MA 4BRXA 3DLSA 2RG6A 3R7VA 5KX8A 3NCZA 4ZJIA 1KV1A 5HIDA 4C36A 4TY1A 3MTLA 5EQEA 2WO6A 2BKZA 2GNLA 4GVAA 4AT3A 4TZRA 3DGKA 4ZTLA 3PUFC 3KF7A 1XH8A 4MCVA 4F0IA 3P78A 4FEQA 4S34A 4IB1A 5HGIA 2JC6A 3R71A 2A0CX 4FV3A 1F0QA 3E62A 5AR7A 3DTWA 4Y83A 4GJ2A 4O22A 5G6VA 3P1AA 4LFIA 3O50A 4CG9A 3ANRA 3QRUA 2GTMA 2F7EE 4PV0A 1YDRE 2YACA 4FT3A 4O0SA 3IONA 4EC9A 3EWHA 3FQSA 2OF2A 2WMAA 4GIIA 4AFJA 5EH0A 5IDPA 4IZ5A 3SVVA 2DS1A 3KRWA 4AXCA 1ZOGA 2BCJA 4FSUA 3MDYA 4FV5A 4BFMA 2PVFA 3Q4UA 1KWPA 4TWPA 4O0WA 5LVNA 4YHJA 4BYIA 2EB2A 1LEZA 4HGSA 4EQMA 5HU3A 5AIRA 3VW8A 5HBHA 3R7UA 2X4FA 2IN6A 5TR6A 1FQ1B 2O3PA 4IX6A 3PVUA 4YZ9A 3ZFXA 3UVRA 1YXUA 3PRFA 5ETAA 3BKBA 4UN0C 3KMUA 4B0GA 4I24A 3FZPA 2BRMA 4CCBA 3QQJA 3KN6A 4JQ7A 4FT0A 3ORXA 5HCXA 5IUIA 3QZHA 1H1SA 4YJOA 3ULIA 4AZSA 4KS7A 5DPVA 2QVSE 1XBCA 3C4ZA 3Q9WA 5A4LA 4UYAA 4AXAA 4FI1A 4LRMA 3SAYA 4G5JA 1XMLA 5KMOA 3U8WA 4GRBA 2OG8A 3UG1A 1CTPE 2WMXA 2VGOA 2YLFA 5AR2A 5IH5A 3RWPA 1YXTA 4HGLA 1WVXA 2PVLA 3O71A 5L8JA 3QWJA 1Q62A 3LVPA 3I5ZA 3DQWA 4XMOA 3ZUVA 1TQPA 4LQMA 4DGLC 4LG4A 1R3CA 3DAKA 2E9OA 4YJUA 4DTKA 4PNKA 4FZ6A 4XG2A 3BBWA 4I4EA 4U0IA 3NEWA 4BCMA 2PUPA 2PZYA 4LGGA 3OD6X 4R7HA 3ZXTA 4FR4A 2AC3A 4HGEA 5I9WA 5EYMA 3KCKA 2BZKB 3TTJA 3F7WA 2VAGA 4CFNA 3ORNA 5FEDA 5FQDC 3PPKA 3BQCA 4QP2A 3W8LA 3GT8A 4HZSA 4IM3A 4E8AA 3WE8A 3AKLA 4DGNA 4OTWA 3KFAA 4KNBA 2A2AA 4WKQA 4AG8A 4DH5A 4RT7A 2OI4X 4BF2A 1XKKA 4A9UA 4E26A 3AG9A 4FSMA 4N6ZA 4KBAA 4EOQA 5JKGA 3GOKA 4YZMA 3RGFA 2ITQA 3GU5A 4PQNA 3UNZA 3U9CA 4BDCA 4XBUA 1W2DA 4KKHA 2FSMX 4KIQA 3QUPA 1PYXA 2CN8A 2JKMA 2QOIA 3MTFA 1YWVA 3C4EA 3ZBFA 4QYYA 4O7TA 4XOYA 2YM7A 2ZV7A 4YBJA 1IA9A 4O7RA 1U5QA 2YIYA 5T3QA 1ZYLA 4P4CA 4KBKA 4AGUA 1Q5KA 4U41A 1W83A 4FKVA 2W96B 2BDWA 4FV1A 1S9IA 2I6LA 2IZUA 5E91A 4NIFB 2VO7A 3B2TA 2R3QA 4N4SA 1ZMVA 4PPBA 1YHWA 5E8YA 3TDVA 1OUYA 3FLSA 3OCTA 5BQ0A 4KIKA 4FIGA 3Q04A 4RJ4A 4Y72A 4ZLOA 4FTLA 2ZAZA 4K2RA 3O17A 3VF9A 5LARA 1PKGA 4DLIA 4FKQA 5M4IA 4ZZNA 2WQBA 3FSKA 4EHVA 4FKWA 2I0VA 3AT3A 3QHWA 4FIFA 4WBBB 1H1RA 4JQ8A 4XEYA 2JAMA 1ZYJA 3OWLA 4BCKA 4W8DA 4QMVA 4HVSA 4W4VA 3TNQB 5A54A 3C4CA 4BIEA 1IEPA 3CJGA 3WZDA 4PPAA 5AX9A 4S32A 2Q83A 3E8DA 2XALA 4EWHA 4K9YA 4II5A 3MA6A 5TOZA 2VTQA 4FTTA 5A6OA 2UW4A 1H8FA 4NM0A 3C4WA 2G15A 3NIZA 4OTPA 5CEKA 4E5BA 5BMSA 3QD2B 4H3BA 1GZNA 2XNEA 3K3JA 5LXMA 1FGKA 3FKLA 3A8WA 3W0QA 3FXZA 5M08A 3UDBA 3GCPA 3BEGA 3NYNA 3MFTA 1YQJA 3AQVA 1VLRA 3RNIA 3DPKA 1H24A 4EK3A 3W18A 5AP4A 5CU3A 4G6OA 2YM8A 4TL0A 3CKXA 3VS0A 5ANGA 3ZLXA 4F65A 4E6AA 3NVKI 2J50A 5JFXA 3P4KA 4JX3A 4XG7A 2IW6A 2PVHA 4AOJA 1M2RA 2OJIA 2RF9A 2VWUA 5F94A 3PDTA 3PLAE 2PVJA 5FG8A 4YC6A 3WZUA 5ETIA 4ZTQA 5L8KA 1MUOA 4C7TA 3AGMA 5HE3A 2BRGA 4BN1A 4E20A 4TNBA 5FP6A 5H8BA 5L6OA 3AC1A 4DN5A 4IM0A 4DYMA 4DBXA 4N6YA 4KIPA 1IA8A 3K2LA 2GDOA 2BVAA 2YERA 4AW5A 4EK8A 3MB6A 3RWQA 5KZIA 4FSNA 2IZTA 4O6EA 2XKDA 4R5SA 1HOWA 2UZOA 3ACJA 1PXKA 1R39A 2WOTA 2YJRA 3JUHA 1K3AA 3CTHA 3QZGA 4HPUE 4D2VA 5A4CA 3VBQA 4F9WA 3QKKA 4QNYA 4EORA 2ITVA 3I4BA 3BV3A 4U5JA 2XAOA 3TI1A 2YWVA 1Y8YA 3W0SA 4X2KA 3ZS5A 4PPCA 2H9VA 3NW7A 3ZFMA 4PX6A 4EONA 3BYVA 3POOA 4FYNA 3QD4A 4TW9A 2ITNA 2QU6A 4A9RA 5HNGA 4QP6A 4U7ZA 1NVQA 2UUEA 4J8MA 4XG3A 3Q4TA 5CVGA 4J8NA 1B6CB 2XM8A 3BHYA 3SOAA 2FVDA 1OM1A 3TT0A 4E73A 2UW7A 3F3ZA 3BWFA 3W33A 4TTHB 4ANLA 2RG5A 4I5HA 3PVWA 4WA9A 2YIWA 4XX9A 3D5VA 2I40A 3QXOA 2OKRA 5AP5A 4LMUA 3FMLA 5DRDA 2OLCA 4BJJB 3FY0A 3LCTA 4RJ5A 5ANDA 1JSTA 4YC8A 2CKOA 3CTQA 3MH3A 3HA8A 2GHLA 4KABA 4MAOA 5HU9A 3SQQA 4AXFA 2A27A 1G3NA 3COIA 1TZDA 5CU6A 3TTIA 3ZZWA 5FEEA 2ITXA 4ITIA 4MQ2A 4EZ7A 5D7AA 5TT7A 3CIKA 1ERKA 2F2CB 3OS3A 4TRLA 3HRCA 4CLJA 5CNNA 4FL2A 3DXQA 1TKIA 3S2PA 2WIPA 4IAKA 3F2RA 3D9VA 5AP6A 3VJOA 4TWNA 5J79A 2ZJWA 5IA1A 3R73A 4CKIA 1P4OA 3KXZA 3FMKA 3G6GA 3LM5A 3V3VA 4A4OA 1YI4A 5B2LA 4QNAA 3W55A 1QPJA 1W98A 2OXXA 2X9EA 4JNWA 1OKVA 4NM5A 3CGFA 3H0YA 4FT7A 5CQUA 4QMUA 4PMMA 5IQFA 3GBZA 1OI9A 2QNJA 4RMZA 1J1CA 5CEIA 1V0OA 2YM6A 3QYWA 4ENYA 4ZJVA 2VTAA 4QMWA 2VO3A 3TV4A 5AUTA 1LP4A 4FG9A 3WE4A 4HGTA 4ZIMA 3QGYA 2VTRA 3COHA 3E8EA 5E8XA 4IB5A 4M15A 3S00A 1ZOHA 4MNEA 3P08A 3TJCA 2J2IB 1FINA 2IZSA 3A4OX 4MNEB 3ZDUA 4PL5A 2QR7A 5BVFA 1V0PA 1Y8GA 4RG0A 3VBWA 2J0KA 1LPUA 3FPQA 4ONAA 4JI9A 1JKKA 3MGYA 4WNMA 4V01A 4MWIA 3R6XA 4RQKA 4APCA 3ML1A 4FF8A 4ALUA 4ZK5A 4KBCA 2ZFYA 3BLQA 5I5ZA 5M07A 4EUUA 2Q0NA 3UC3A 3JR1A 4WG3A 4O7LA 2ITTA 3SRVA 3FSFA 3BEAA 4LUEA 4E7WA 1KE7A 2W4OA 2O63A 4O83A 4K33A 3SRVB 5GIPE 4EOIA 2YFXA 2G2IA 2OIBA 3TIZA 4ACHA 1H27A 2BUJA 4HJOA 3QGWA 4RC4A 3ROCA 2XK4A 3TIYA 4ACGA 4FEVA 3BRBA 2AUHA 3FMNA 4A06A 2ITYA 3DJ5A 4IVCA 4NJ3A 3V5WA 5G1XA 3OXIA 1P14A 3FKNA 2OJFE 4GJ3A 3AMAA 5CQWA 2JDTA 3D4QA 3R8ZA 4D0WA 4EYMA 4IJ9A 2W4JA 4TXCA 3B8RA 3QUDA 1VZOA 4UYNA 5BVWA 2W06A 3CLYA 5HNBA 3KC3A 3OY3A 5I3RA 4R1YA 2F4JA 4RVLA 4BCQA 4AQCA 4W8EA 3BHTA 4KKEA 1OECA 2XANA 3ORZA 4IZ7A 2NRUA 2J9MA 2YLEA 3VBYA 3A4PA 4UEUA 3U9NA 4FZAB 4OUCA 5KMIA 3R02A 2OK1A 4QRCA 5HEZA 3FZTA 4NW5A 5HIEA 4RJ6A 3BE9A 4ZSAA 4ALVA 4IE9A 4FSQA 4ITHA 2VX1A 2C6DA 4BKJA 4CZYB 3QQFA 4QTEA 4PMTA 1YOMA 3B8QA 1OMWA 2PZ5A 5ETCA 3OEZA 2BHHA 1FVTA 3BGPA 2BIYA 3FI4A 3KGAA 3Q32A 3RCDA 5CEOA 4BDAA 4FG7A 5JH6A 4USEA 3QTUA 2R3MA 4QP7A 3NWWA 4RIWA 4AN9A 1O6YA 4IWPA 3VS6A 1KE8A 4IZAA 4DG2E 5KMLA 4U80A 4NL0A 5E1SA 2OJGA 5HI2A 4CMTA 5CEPA 5HBEA 1OBGA 4WG5A 2R9SA 1URCA 4FKPA 5AP0A 3MPMA 3W2RA 1H28A 2O2UA 4FV4A 4BBEA 1MRYA 4ERKA 5EM6A 4YSJA 4N0SA 4ORKA 4XYFA 2HY81 4XUFA 4K77A 5I4NA 4RC3A 4CSVA 4WBOA 2JD5A 4C62A 5HBJA 3GQLA 4JAIA 2BZJA 4K0YA 1ZMWA 4D28A 3FYJX 1SYKA 4XOZA 3Q9XA 2H8HA 1IG1A 4QYHA 3BYMA 3OWKA 5HIBA 3UVPA 4YJVA 3AMYA 3PPZA 4GT3A 4NTTA 4AZVA 4DA5A 4XCUA 3CS9A 3NYOA 2YCQA 5GJGA 2XNGA 3GQIA 1ATPE 4ZSLA 4PL4A 3QQKA 4WIHA 3MY1A 1CM8A 2W1FA 5KZ0A 2VNYA 3KCFA 4CG8A 4AGDA 2VTIA 3KMWA 1H1PA 2G1TA 3O2MA 4UWBA 3PSCA 5AIKA 5K3YA 3EKNA 3OT8A 4FNWA 4IAYA 4MVFA 4ZP5A 4X3FB 1PXPA 3G6HA 3V8WA 4BGHA 5HLNA 4QMLA 5EI6A 4YTCA 4UMPA 1ZYSA 4BDKA 3M42A 2YM4A 4I1ZA 2GCDA 2VTMA 3HZTA 3PXZA 2ETKA 3ELJA 3PTGA 2JEDA 2E9UA 3D2IA 4LV5A 1G5SA 4BCFA 4C02A 4CV9A 4EHZA 5M56A 1IAHA 3KREA 4I6FA 5IA4A 1BKXA 2W9ZB 3PSBA 4FT5A 4PDPA 5K9IA 2AYPA 3PUPA 4AF3A 4ASEA 3TKUA 1SM2A 4BI2A 4DT8A 3C4XA 4FYOA 2VU3A 1ZAOA 4D4YA 1BMKA 2YIRA 4TYIA 3VJNA 2UW5A 5HICA 4BDHA 1Y57A 4BTFA 5M51A 4C58A 4MD9E 3VS1A 5A9UA 4YJQA 3SA0A 1OL5A 3Q6WA 4O7ZA 3MSSA 4FZFB 4NEUA 3VS2A 2C3JA 4ACMA 3QRJA 3OMVA 5DR6A 2Z02A 5CT0A 2BDFA 1GIIA 2UZNA 2WTKB 4BKZA 4EH5A 4FIIA 4CXAA 2W1CA 2JFMA 4TT7A 5HVJA 2UW3A 2QOQA 3VC4A 3RP9A 4B6LA 4ENXA 5IQEA 1XH9A 3HRFA 3ORMA 3ZOSA 1SNXA 2WAJA 3CJFA 3R7GA 5CF5A 2Z7SA 2HENA 2QOCA 3EQPA 3FLYA 4BBMA 3LW0A 5LOHA 2B9HA 4V04A 2PVKA 4BZNA 5K0KA 5LMKC 3ZRMA 2R7IA 4U8ZA 3PXFA 4FRFA 4JG7A 3GU7A 4J96A 3BIZA 4M66A 4BDEA 4F9BA 4K11A 2WQMA 4JJRA 5JFSA 3O7LD 2QO2A 1FBNA 2BRBA 2WD1A 3DZOA 2CPKE 2HOGA 3F66A 3QQHA 4FV6A 5CXZA 5AP2A 4EOMA 5CI6A 3CTJA 3TL8A 4BCJA 2QU5A 3VQUA 5IEXA 4L52A 2XIRA 1G8SA 2HZ0A 5EOLA 5IQCA 4H36A 2WU7A 3BYSA 5CLPA 5AR5A 3OVVA 3FWQA 1SMHA 4DITA 1A48A 3IW6A 1K2PA 4F7SA 4IX5A 1JKTA 3N51A 2OZAA 3FHRA 5HCZA 4YURA 2B7AA 5ANJA 3W2SA 3T9TA 3R9DA 4I0RA 5C26A 4G16A 1JWHA 2PZPA 3HDMA 4RX5A 4FV0A 1H1QA 3Q4CA 1M7NA 1PY5A 3EYGA 2VX0A 3MIAA 3MW1A 3F9NA 4D2TA 4I21A 4IW0A 4IAZA 2XBAA 2GMXA 4M97A 3VUMA 1WBNA 2I7QA 5ICPA 2ZM3A 2GHGA 3DBQA 2CMWA 5DI1A 3H30A 1BX6A 2QOBA 2IEWA 3VUHA 1Q3WA 4I23A 3RPRA 3T3UA 2J0MB 2CGUA 1ND4A 1OL6A 4IWOA 5IQAA 2ITWA 4YJNA 5JRSA 3U55A 1YWRA 3AC2A 2WTVA 2UVZA 1OIRA 3A7GA 4U6RA 3R7YA 5M53A 1G8JA 3DT1A 3N4UA 2H96A 4DFNA 3EMGA 3QCYA 3OW4A 4G34A 3OROA 5HVYA 1WVYA 4AGCA 2B0QA 3NUPA 2JBPA 5K4JA 4FTKA 4PY1A 3D7TA 1FVVA 3PE1A 4QP8A 2YCSA 2OBJA 3G33A 3NCGA 4F78A 3ID6C 3QRIA 3AC3A 3WF9A 2Z60A 2DQ7X 3GU8A 4KRCA 2UVYA 2WOUA 4EK6A 1XWSA 4USFA 4OW8A 3HVCA 4RZVA 3SD0A 2KULA 4Y95A 4AT4A 2BAQA 3EQHA 3QC4A 2PZRA 4FTMA 4ZSEA 3HV6A 2BDJA 3AMBA 4CYIA 4D4RA 4YLLA 3EQGA 2R3IA 3V04A 5LJJA 2XYUA 4AAAA 5EYCA 4CZUA 4F1MA 5ITAA 4WUNA 3SX9A 2AEGA 4DFUA 4NFNA 2VWZA 2X81A 2BALA 1J1BA 4YZDA 2F2UA 2EXEA 2CNVA 4I4FA 4L3PA 3GB2A 4BDJA 4ZLZA 5HO7A 1PXIA 3I7CA 2CNQA 4Y46A 3P5KA 3FY2A 3QTRA 5FTOA 4TN6A 4MUQA 3F6XA 3MPAA 3RHXA 3LJ2A 3EFLA 3CY3A 5EQPA 3PJ3A 4Q5EA 4MEDA 3UTOA 4QYEA 3Q52A 2HW6A 4I41A 4Z7HA 4FV2A 4FL1A 5F20A 3U4UA 3UZPA 4O38A 5H2UA 3WF7A 3WZEA 3BI6A 3DBDA 3ORPA 3R1NA 4WOVA 4Y73A 1APME 3RPSA 5K5NA 2VX3A 3LFFA 5E90A 4BDIA 2VWBA 2UW0A 4GYGA 5CY3A 2PHKA 4BWXA 4D5HA 3B2WA 4NM7A 2YWPA 4UV0A 2W5HA 3OOMA 3WF5A 3KA0A 3CD8A 1GJOA 4NK9A 2XM9A 2CN5A 4G9RA 1KE6A 4GFGA 4Z16A 2XKFA 2C3IB 4XG6A 3R7IA 4FGRA 4YHTA 4DFLA 4MBJA 3QTSA 4EI4A 5FTQA 4XG8A 1QPDA 5J7HA 2XNOA 4AAYA 4PMPA 3HX4A 1YDTE 2QLUA 5L4QA 3FPMA 2J4ZA 3KKVA 3QCQA 5B2KA 1W0XC 4O4FA 3AC4A 2R3GA 1LUFA 3PFQA 5CSHA 2FYSA 3ZO3A 4EOKA 4F0GA 2BHEA 4FOCA 3CQEA 1RJBA 4TYJA 2VWWA 1CKIA 4BDDA 2YJSA 3MFUA 3PY0A 3EN6A 4B9DA 4JMQA 4M14A 2RL5A 4ANMA 4HNIA 5EM8A 3BYUA 4AWIA 2IVSA 4ZTHA 1JPAA 3E64A 4I22A 2CGWA 2X1NA 4RX7A 4R3PA 4RIYB 3NFGB 5E92A 4YMJA 3SV0A 2PY3A 3UGCA 3LCOA 2W5BA 5DT4A 4C4EA 1V0BA 3CR0A 1OVEA 3KN5A 3SG8A 3KL8A 4H1MA 4AA4A 2XKCA 4BIBA 3D5XA 3R9OA 4EH4A 2YAAA 4L46A 3ZFYA 5KMMA 1H0VA 1WMKA 4FUYA 3S3IA 4R7BA 5LVOA 5GJFA 3U6JA 1UU8A 2QG5A 4D4VA 3OCGA 4RSSA 4UMTA 4I5MA 2BR1A 2X4ZA 2BAKA 3BELA 5DLSA 4HCUA 3QKMA 5AA8A 4FVQA 4O0YA 5CU4A 2R4BA 3Q2MA 3LCSA 4GU6A 4BCHA 3QD3A 5IMEA 3E8CA 4DHZA 3ENHA 4OTRA 3V5PA 1YXXA 5M06A 1IR3A 2GQRA 4AXDA 5M4UA 4JVGA 5BVOA 4O6LA 5IQDA 2QURA 3R1YA 4U40A 2UZDA 4U42A 4E4MA 4JRNA 1OPJA 2QCSA 2YZLA 5FBOA 1B38A 2X2LA 3KVXA 3Q9ZA 5IPJA 4ZS4A 5CF6A 4KD1A 3PG3A 3W0OA 2UZLA 3GCVA 5J1WA 4CD0A 4C37A 4CFWA 5IISA 3UOKA 2HYYA 3OUKA 3UIBA 5I9VA 4AA0A 3G9LX 2Y9QA 5M09A 1WVWA 3EQCA 3Q3BA 3FZOA 4CFMA 1O9UA 4XS2A 2EXCX 5D9HA 3EB0A 3RI1A 4ERWA 5CU0A 3F5UA 4RA5A 1BI8A 3EYHA 4QTBA 1MQBA 1QPCA 3AD6A 3OBGA 3WOWA 4ACCA 4C2WA 2JLDA 2CKPA 2VNWA 3EN5A