3UVRA

Human p38 map kinase in complex with km064
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
347
structure length
331
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 116
structure length 331
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3uvrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3uvrA01
3QA0A 4IZ7A 2WMWA 3O0GA 5CU6A 4BYIA 3FV8A 4UWBA 4ZY4A 1YQJA 4BIDA 3G90X 5L6WL 3E8CA 3HMNA 1XJDA 4N70A 5DR2A 4EOSA 2AC3A 3G6GA 5E8UA 2HW6A 3UOHA 4C57A 2VN9A 3F3VA 4FEUA 3OOMA 4IEBA 4FTQA 2C47A 2PE0A 4JQ7A 4OTRA 5AR8A 4C3FA 4O22A 3TIZA 2YCRA 5IQBA 4O7YA 2EXEA 2VTPA 3QTWA 2PTKA 2UVZA 2EXMA 2G2HA 1YXTA 2B53A 2W4JA 3PIYA 1Q5KA 4M7IA 4ZS0A 4EOJA 3QD0A 3W2QA 5M56A 3WZEA 2R3HA 2WQEA 3P78A 3RM7A 4F6SA 4PDSA 5FGKA 1V0OA 4D4VA 4E6AA 4IQ6A 5AIRA 3AC1A 1WAKA 2QO7A 2QR8A 2ZMDA 2E9OA 3ET7A 5J5SA 4KRDA 2WEIA 4G9CA 4UALA 2WZJA 4DH5A 3F5XA 4HW7A 2XCKA 3PP0A 4BTMA 2R3GA 4X0MA 3VBXA 4ID7A 3SVVA 2E9NA 2YIRA 1J1CA 3MTLA 3QCXA 4E6DA 3BGPA 3HX4A 2VWBA 2HWOA 4O0SA 5FQDC 5LCKA 4IAAA 3OW3A 4YURA 5A4LA 1UNGA 3UQCA 2VTRA 4YZBA 2AYPA 2W05A 3HMOA 5BPYA 5BUJA 3EN4A 2F7EE 3MFSA 4AAAA 5L3AA 3FKLA 1KE8A 4EH6A 4K33A 2OU7A 4TWNA 4PL3A 4TYIA 2PMLX 5KMLA 2UW3A 3TKUA 2VRXA 2C3IB 2PUNA 4X2KA 5KKRB 2GTMA 5CTPA 3C1XA 4MQ1A 4O7ZA 2AC5A 3FSFA 3KCFA 2V0DA 3VUTA 4DTKA 2RKUA 4QQTA 2BRBA 3TIYA 4WSYA 4V05A 4CFXA 5HX8A 3D9VA 1REJA 2P3GX 4YTFA 5C8NA 1L3RE 3UO5A 3P7BA 4WOVA 4FTAA 3QD2B 2VTNA 3ZHPC 3R8ZA 4ASXA 1OL7A 3PRFA 3FZPA 4IVAA 2C6LA 3VUGA 4R7HA 2XKEA 3I0QA 4GT3A 1GZNA 4EZ7A 5K9IA 1WVXA 4JX7A 4TYEA 3SW4A 4L44A 2B52A 4PF4A 4GW8A 2IVTA 3SG8A 2CMWA 3MA3A 3ZLYA 3MFTA 1NT2A 1YXXA 4QTCA 5DA3A 1NY3A 4AA4A 4MXYA 2UZWE 2FO0A 5C26A 5HG7A 4KNBA 3TEIA 5IA5A 2HY0A 2J0IA 4GG5A 2XK8A 4LOPA 3FQEA 2WTVA 1MRYA 3NRMA 3QRIA 3RHXA 1GNGA 1YXVA 4BCIA 4MH7A 2GTNA 2WTWA 4IHPA 4MNEB 4BN1A 2WEVA 4EWQA 4AT3A 2B54A 4NYEA 5IQCA 4DG3E 2QU6A 3JY0A 3NUPA 3FLZA 2C5OA 2ITZA 5CEPA 4HYSA 3QTXA 4IWPA 4IJPA 3BKBA 4JRVA 4N4SA 2YITA 4U5JA 4H36A 1G8AA 3PJ2A 5CT7A 2QURA 2C6OA 5ANEA 3G2FA 4AF3A 5LVNA 3D5WA 1M14A 2IO6A 4EH2A 2I0YA 1BL7A 3GOPA 2B9FA 5C03A 2JIIA 3KFAA 1E1VA 4LMNA 3P9JA 5F4NA 1KSWA 3RALA 4ACMA 4AG8A 4AN2A 4EEVA 2CGXA 2WMAA 5IA3A 1SZMA 2OFUA 4X3FA 4O7NA 4BZOA 3D7TA 3EB0A 3K54A 4U0IA 4YJRA 3PXFA 3NMUF 1PMUA 1VR2A 1Y8YA 4M69B 3HMPA 2UVXA 4KAOA 4LOQA 4DEHA 4QP2A 5A9UA 4EWHA 3R28A 2QG5A 4YHFA 1ZYDA 4YJQA 3S2PA 4CTCA 4HGEA 4E5WA 5J5TA 1QCFA 2WQBA 4JBOA 4TY1A 2HZIA 4E8AA 3GU5A 4KIKA 3ORIA 5AUYA 3O8TA 3WF8A 2YM8A 3DFCB 2Z7LA 3ENHA 2C6MA 3ZLSA 5L6OA 2QKRA 2R9SA 2BKKA 4FIIA 4D5KA 1ZMWA 1VEBA 4L7SA 5BVNA 4FKVA 2Y6MA 5AADA 5H8GA 4QYGA 4YJTA 3R7GA 5HE1A 2J7TA 4NL0A 3NR9A 4FL1A 4ZEGA 5KUPA 4EH4A 4FKWA 4P2KA 2ITYA 1UU8A 3P7CA 3R01A 4HOKA 5CS6A 5HHWA 2RG5A 4DH1A 4LQMA 1R1WA 4HCTA 1EH4A 5A46A 4DH8A 4RIYA 5AAGA 3FPMA 2VX0A 4F70A 2Y8OA 5KKRC 4PDPA 4AW2A 4CT1A 4DLIA 3WIGA 4FZ6A 4PPBA 4QRCA 4FTIA 4O96A 5FDPA 4M66A 3DXPA 3DNEA 3ALNA 3Q4CA 3R22A 4NM0A 1NVQA 5AP7A 4L45A 3R02A 4R7BA 4LGDA 2PWLA 2VGPA 5CENA 2OI4X 5BUEA 5IMEA 5KMOA 1S9JA 4RC4A 3LAUA 3OHTA 1UU3A 3EKKA 4PNIA 5FBNC 4E5BA 2WFYA 2X0GA 4RBLA 4CG9A 4WUAA 3FMEA 3C5IA 4ITIA 4F65A 4ZTRA 4GK4A 2X6DA 2W1HA 2HW7A 4WRGA 4YHTA 4ALWA 4BCOA 4CFVA 5B2MA 3DJ5A 5C27A 2IJMA 3QLFA 1XH6A 3V8WA 2VX3A 4RFYA 5DMZA 1PYXA 4S2ZA 3LZBA 4F9YA 2OK1A 3DJ7A 1ZARA 3CPCA 4M68A 4OBOA 4EOMA 4EBWA 3I4BA 3RAKA 3A2CA 1Y6AA 2ITXA 3BI6A 3EQRA 3PJ8A 4GFGA 1ZYJA 1U5QA 4FKQA 1BI8A 4RX9A 4O7TA 1PXOA 4AN3A 4FNWA 3OBJA 4CFNA 4FV8A 4ANQA 3D14A 3DB6A 3I81A 3V5LA 2RSVA 3QALE 2HZ0A 4CFMA 2OFVA 3EQCA 3IOKA 4XG4A 4FKJA 2R5TA 5M4UA 2R3MA 4WRSA 3F2RA 4L6QA 1OPJA 3F69A 1WBWA 2C5XA 2QONA 4X21A 3PZEA 3B8RA 5FTOA 5HTBA 2IZRA 2QOKA 3R71A 5EHLA 4EOQA 2ITTA 5HLNA 4Z7HA 5TO8A 5CYIA 3D83A 3QX2A 4RC2A 4IIRA 3V5WA 3WZKA 4GT4A 2C5YA 4NTTA 3BQRA 4KKGA 5GZAA 4I5HA 3DPKA 1G8SA 3ZEWA 3TM0A 3IS5A 4O91A 3SLSA 3SV0A 4CEGA 4WNPA 3MH0A 2UZTA 3SX9A 4EC9A 2P2HA 3TZ9A 4FKUA 3LMGA 5CI7A 1I44A 5TF9A 3R7VA 3W33A 3BYMA 2VWYA 3OS3A 4YO6A 3CGOA 4ANMA 3ZOSA 3Q9ZA 3NYOA 4LV5A 3OD6X 2B9HA 3DFAA 4QMYA 3MN3A 4BGHA 1OUKA 5IEVA 2PVLA 4JDKA 1OIYA 2J6MA 5HCXA 2CCHA 3ACKA 4P4CA 2Q0NA 3RPRA 2HXLA 2FSLX 3CKXA 4PUZA 2XS0A 3VS1A 5IA1A 2UZOA 4KIQA 4QQJA 4EORA 3TV6A 1SMHA 2UW8A 3NGAA 2YCQA 4PRJA 2BDFA 3GCSA 4J1RA 3FSKA 3OEZA 4DEDA 3A99A 3KL8A 5JN2A 4FV5A 4YC3A 3ZBFA 1OBDA 5C01A 1REKA 2JDVA 4E4NA 5GJGA 3M42A 4FIHA 2FYSA 5AUZA 3AOXA 1PXNA 3LLTA 5DLSA 3EQIA 3QTZA 4HYHA 4IVDA 3LCKA 5GHVA 4RG0A 4FK3A 4NUSA 4ZSJA 2EVAA 4CFFA 3ZC6A 5BNJA 4E4XA 2ERKA 4YZ9A 2R0UA 3C7QA 1TVOA 4F1MA 3VVHA 4KINA 2ZV2A 4CT2A 1FVVA 2YIYA 1PJKA 3FBVA 4J7BA 4YUQA 3R21A 3RPSA 1STCE 3O71A 3TN8A 2Z7QA 2XVDA 3P4KA 4FL2A 4Y5QA 2ACXA 5J7HA 4R5YA 2W1GA 2HZNA 1MP8A 2IZTA 2X7GA 3PY3A 4KRCA 5EG3A 3ZO2A 3OUKA 4S30A 5BVEA 3UYTA 1OKVA 3LPBA 4K1BA 3KGAA 3H0ZA 5J9ZA 4QMQA 4DFUA 2BFXA 1BLXA 4B8MA 1JQHA 3EFKA 4DEAA 2YAKA 4LYNA 4WD5A 4FF8A 3PP1A 3UC4A 3QTUA 3IDBA 3BHUA 3FMLA 1GZKA 5JQ8A 2WD1A 2R3QA 1PKGA 3VRYA 1QL6A 4AGDA 2C6TA 5AP3A 4BCHA 4CSVA 2WTCA 2YCSA 4J52A 5E92A 3LQ3A 3RNYA 2GS7A 3UNJA 4QMWA 3A7FA 2VTMA 3QZHA 2W96B 3Q3BA 3RPOA 1OPKA 4G3DA 2FUMA 3FZOA 3S4QA 3EZRA 4AZSA 4BL1A 3FLQA 3K3IA 3WARA 4RJ5A 5K0KA 4BDFA 5HBEA 2B9IA 3T3VA 2XEZA 3C0IA 3E8EA 3EFJA 3F66A 4IBMA 1VZOA 2PVRA 5BMMA 4Z55A 4JT3A 3TNHA 5A54A 1KWPA 4IADA 3MFUA 2J4ZA 2V62A 4BBFA 3V04A 1BKXA 2RFSA 4F0GA 4TYJA 4RWKA 2ETMA 3ORLA 5AR5A 4YGAA 2QI8A 4APCA 2Y7JA 4QNAA 5HIEA 2BAKA 3F88A 4D1ZA 3NUUA 4YZCA 3PIZA 4V01A 2X39A 4GYIA 5TOZA 3C13A 3H9OA 4DYMA 5A6NA 1YI4A 5J95A 2GHLA 3GUBA 3EL8A 4NZWB 3OBGA 5J9YA 5CVFA 5KE0A 2ZOQA 5M57A 4IX3A 3FWQA 5AUWA 4C62A 4B99A 4EI4A 3QGWA 4L43A 2WTKB 2UW9A 5HE0A 5E8XA 4KA3A 4PDOA 3TV7A 1XH5A 4QP7A 3EOCA 3OMVA 1Y91A 5AA9A 3TV4A 4CKRA 1ATPE 4I1ZA 4TYHA 1SM2A 4CTBA 2PZIA 4FTKA 5BVKA 3QQKA 4GIIA 2OIQA 5CNNA 3F2AA 5CWZA 1PY5A 1P14A 1HOWA 4QP9A 2OIBA 3C4WA 4MK0A 2ITPA 3IG7A 3MDYA 2W0JA 3FI4A 2IWIA 3TZ7A 3KQ7A 2YABA 3OXIA 2GNLA 3E92A 4F7JA 3BHTA 5F95A 4BKJA 4W8DA 3BU6A 3ATSA 5AFVA 3CY3A 4OTDA 4DFYA 5M51A 3DBCA 1KOBA 5ANIA 5AAEA 5IH5A 3SGCA 2DWBA 4G3FA 2I7QA 2YIWA 4K8AA 4R1VA 4B0GA 4JJRA 4AGWA 4PMMA 3G9LX 4JR3A 3BE2A 1CSNA 4FIGA 4XRJA 3ORMA 2JAVA 4UMTA 1R0EA 2UUEA 3UO4A 4USEA 3GT8A 3MH3A 4FOCA 4GT5A 1LUFA 2SRCA 4ONAA 3CQUA 4C3PA 4ZY5A 4RVKA 2X81A 2WIHA 2XRWA 4DINA 4X6RA 3SKCA 1J91A 2CKOA 3A61A 1J3HA 5HESA 5L8LA 4FEXA 4I6FA 4O21A 5A3XA 2YN8A 4NFNA 4RWIA 4KBAA 5AP5A 1WBTA 4GVJA 3IW5A 3OY3A 4ZXTA 2QOBA 4FC0A 2PMOX 4A4OA 3D5UA 4BDCA 2RG6A 2VWVA 4UV0A 3C51A 2IVSA 2BIYA 1PXKA 4ACDA 3CR0A 4C0TA 4JQEA 2ZAZA 4BCNA 4M67A 3UIXA 4EJ7A 3SXFA 3VJOA 1MQBA 2JKMA 3PA5A 3RWPA 3PE1A 4JXFA 4QMUA 4UMPA 2JKQA 4MYGA 5EHOA 5HVKA 3AMAA 2VWXA 4V0GA 5TE0A 3FPQA 5EYDA 4F1OA 4QP8A 1FGKA 2YDJA 4MKCA 3PSDA 2WMVA 2E9PA 2O5KA 3KB7A 5C8KA 2YM4A 5LARA 3HECA 3QHWA 4ASZA 2WMSA 5J7BA 3VULA 2BAJA 2VWUA 4UMQA 1OL2A 4IW0A 5A6OA 3W8QA 3ZS5A 1JBPE 2BPMA 3PTGA 2ZDTA 3ALOA 5FUTA 4A9RA 4LI5A 2BVAA 3R04A 3PIXA 2IVUA 2XJ0A 5M09A 5IH6A 3TZMA 5DH3A 1QPCA 4QTBA 3SG9A 4C4IA 2WHBA 4G16A 3RAWA 1IAHA 2I1MA 3LLAA 3NAYA 4F9CA 1YWNA 2C1BA 4FODA 3UTOA 4BGGA 4XS2A 4A9YA 1BUHA 2BKZA 2QNJA 2WTKC 4H1MA 5K5NA 2DUVA 5HKMA 3FXWA 1WBNA 3VUIA 5LVOA 1IEPA 3OROA 2KULA 4FIFA 4GUEA 2A0CX 5E8SA 3Q5ZA 3NYNA 4RVMA 3KULB 4CMTA 4IAKA 5KZIA 4HJOA 1JKKA 3IQ7A 4L53A 5TKDA 4PMPA 3Q60A 4U3YA 5CF6A 2OGVA 1ZLTA 1H1QA 2FSMX 4FIJA 3ACJA 3R1NA 3GGFA 4DF3A 4EZ5A 4O6LA 4UZHA 2H8HA 3T3UA 2QO2A 1FQ1B 4FVPA 3DLSA 3S1HA 4QP1A 4OTWA 4AACA 1JWHA 1Q4LA 2GQSA 2XBAA 2QOOA 5I9UA 2Z8CA 5IEYA 2BRHA 3F9NA 4L7FA 4F99A 5T68A 4FKLA 5L8KA 2AUHA 5HNBA 3RHKA 3MS9A 3NSZA 5DN3A 4UX9A 4YJOA 5BYLA 1Q62A 4D1XA 1PF8A 1Q41A 2GU8A 3NUSA 4MWIA 4PTCA 3UGCA 3EQDA 4RGJA 3BV2A 4AGUA 4D2SA 1M7NA 3JPVA 3NNVA 5E8YA 4KIPA 4ZTQA 4XHKB 3MY0A 3BBWA 3DNDA 5DRDA 4QTEA 2XIKA 2P55A 5EW9A 3VS3A 2IG7A 4FT7A 4JNWA 3FJQE 3CLYA 1K3AA 3S0OA 5DVRA 2YIXA 4U41A 5T3QA 4DGGA 1YDRE 3QLGA 3QTRA 1B39A 3RPVA 5E8TA 5CXHA 4I92A 4UMUA 4EBVA 1WCCA 3R73A 4YJNA 5KMMA 2RFNA 2X8DA 3FMJA 3NW6A 3NUYA 5I5ZA 3LM0A 3QAME 5L2TA 3FC2A 4AS0A 2WIPA 4AU8A 2QOIA 3AC8A 4BTJA 5KZ0A 4HCVA 3GEQA 4FBXA 3HDNA 4OLIA 1R39A 3RCJA 4L01A 4BDBA 4E73A 3BQCA 3OOGA 1OKWA 4GH2A 4MCVA 4E26A 3GCVA 2OIDA 4FGRA 2DS1A 3R8PA 3RAHA 2J50A 4FSMA 1LR4A 4CQGA 3KY2A 4D2VA 4BRXA 4BWPA 4ZAUA 1XH8A 3IGGA 4GS6A 4AGCA 3CKWA 4F63A 5AJQA 4ZTHA 5FD2A 2BUJA 4ZIMA 1QPEA 4J8MA 4DBNA 4DLJA 3KXMA 1ZXEA 5CVHA 4YMJA 1PMNA 2YCFA 3JYAA 3BX5A 3WILA 4ZP5A 1U46A 4CD0A 2O64A 3DS6A 4EK6A 3KRJA 1JKTA 4OW8A 4Y5HA 4HZSA 2QKWB 3FI3A 3EQHA 3FL4A 4TL0A 1BMKA 4BZNA 1UU9A 1XQZA 5E7RA 1FMOE 4YSJA 4CZUA 4FZDB 4EH7A 3KU2A 4D9UA 4UMRA 2YISA 2OZOA 3PRIA 2C1AA 2PK9A 4HNIA 2W5HA 3O50A 2W1IA 5K3YA 4ZTNA 5E8ZA 4FTOA 3F3TA 3ZMMA 5EKOA 2G1TA 4C36A 1RW8A 5E1EA 5FXRA 3PJ3A 4H39A 3VUDA 4FL3A 4CKJA 1H01A 4ENYA 4E1ZA 3PWDA 2VWWA 4IANA 3FUPA 4AP7A 3AGLA 4FKSA 5ANDA 4BC6A 3ZSGA 3CTQA 4AN9A 3KF7A 4UEUA 3RNIA 4TT7A 4WA9A 2JIVA 2C6DA 4HGSA 5HO6A 4C35A 3RBWA 4TWOA 4ZTLA 5JFSA 1FVRA 3DB8A 2BTSA 3IPHA 3DQWA 4F6UA 2X1NA 3L9LA 4XJ0A 5HU9A 2B55A 4MX9A 4M0ZA 4EJNA 2VTHA 5J87A 1YXUA 3VF9A 3ITZA 4I5MA 2B7AA 2J90A 4XEYA 4EOIA 3BGQA 4EL9A 2WNTA 3ORXA 2JBOA 4D28A 1DM2A 2X4FA 3CQWA 1NXKA 3V5JA 3TUCA 4GJ2A 5E1SA 2V22A 3N4VA 3C4CA 3VUMA 4AT4A 5JZNA 4XUFA 3PVUA 2XJ1A 3H0YA 3QXPA 3PG3A 3O96A 4EOOA 3IO7A 4NW5A 2WMTA 4M0YA 3JS2A 1X8BA 2Q0BA 4P5QA 3QRTA 3R8MA 4G9RA 3UNKA 5JKGA 3TI1A 2CNUA 1URCA 5J9LA 3NCGA 4C7TA 4GKIA 5CY3A 3QC4A 4MF0A 3OFMA 1WBSA 3BZ3A 3UOKA 2IZSA 3Q6WA 1XBCA 2UVYA 4GKHA 5CF8A 3DY7A 2I40A 5JGDA 5IUGA 4TNDA 3WOWA 5EQYA 4BDJA 4RVTA 4YLKA 3W2SA 3MJ2A 4D55A 4JAIA 2W1FA 3S3IA 4DGOA 4XG3A 3U87A 3ZFXA 4ZMEA 2QOLA 2A1AB 4JVGA 4FSRA 4E3CA 1Q61A 4H3QA 4B6LA 3F7ZA 4QTDA 1JSVA 4OAUC 2HOGA 2RF9A 3EFWA 4L67A 2WTJA 3NZ0A 3LOKA 3GU7A 3OY1A 4JQ8A 5LVLA 3QU0A 2VTLA 5JFXA 1PW2A 3GOKA 3KRLA 5HBJA 3BBTB 5FXQA 4CMOA 5CQUA 1APME 4PWNA 3DAKA 4YO4A 1Q24A 1AQ1A 2G2FA 2ITOA 2RIOA 3U55A 3PXKA 3PLAE 5I9YA 2ZV9A 2V5QA 5E8VA 2FVDA 3HKOA 2VO0A 4QT1A 5HIBA 4D0XA 4N57A 3TDWA 3ZFMA 4AXAA 4IC7A 4QPMA 5EI8A 5AP2A 2PVMA 1IA9A 3ODYX 3W16A 3ZDUA 3C4EA 5KO1A 2WQOA 3E93A 3IECA 4DGNA 1J7LA 2HWPA 4ALVA 4I3ZA 4A4LA 3O8UA 4I41A 1TKIA 4IX4A 2OF4A 2YM7A 5ANGA 3HLLA 3FMHA 5EYMA 4BGQA 5KMKA 3MI9A 4ALUA 2W7XA 1GZOA 4QQCA 5EI2A 4APPA 3E63A 4IAFA 4AW5A 3FMNA 4LFIA 2OKRA 4MXOA 4EH5A 3V5QA 3OTUA 4FSTA 4G3CA 5L2QA 5E4HA 1Q99A 5IQIA 2I0HA 5HZNA 5I9VA 3NUAA 2VWZA 5H8EA 3SC1A 3II5A 4YPSA 5CEMA 3ZO1A 4IH8A 1ZMUA 3R8LA 5HO7A 3NYXA 3OCBA 4FVRA 5AR4A 4XLIA 2PZRA 3GQIA 4IB3A 4YC6A 5DE2A 4RVLA 2X9EA 1SVHA 1W7HA 1FVTA 4J96A 3DT1A 4EK5A 1F0QA 3FAAA 3NCZA 3FKNA 3NIZA 4KBKA 5EW3A 4F4PA 5IH4A 1RDQE 3E7VA 3MY1A 4DH7A 4FV0A 3GENA 3PVWA 2XMYA 5CEKA 3IDCA 3L8XA 4HYUA 5L2SA 3RCDA 3R7UA 2KTYA 2JKKA 4Z16A 1YOLA 3GCUA 4U42A 5BVWA 4F64A 3CEKA 3DXNA 4Y85A 3MESA 4RLKA 1ZYCA 3O51A 4L3LA 4NWMA 4OTQA 4Y73A 5E8WA 3BEAA 3TNPC 3CD8A 3VBVA 5EM8A 4DA5A 3KKVA 4RFMA 3FZ1A 3S00A 4L52A 3RM6A 3FMKA 4BTKA 2JEDA 3PJCA 5CAOA 2BAQA 1JVPP 3QKKA 2ZDUA 4MBIA 5IU2A 2PZ5A 3MTFA 5JEBA 2OH0E 3RVGA 5F20A 5CVGA 1H27A 4MEDA 4UY9A 3FQSA 4H3BA 4Q9ZA 2C3KA 1U59A 2YDIA 3VUHA 3NW5A 3GU8A 4EK8A 3AT3A 2BMCA 4FTMA 3S95A 4YJUA 5E91A 4BI2A 4F0IA 2Z02A 3ZXZA 4K6ZA 4R7IA 4U3ZA 1J7UA 5KX8A 2ZB1A 1CKIA 4RQKA 2JITA 3ORZA 4UZDA 5D9HA 4FEWA 4E4LA 4FSNA 4DTBA 2X2LA 4TWCA 3MY5A 1WBPA 2GNHA 4NFMA 2O8YA 1W82A 4RJ6A 1WZYA 3WF7A 2J0KA 3EL7A 3A7JA 4FUXA 5TR6A 3TNWA 3VRZA 4AFJA 3I60A 2XK9A 4NM7A 1UU7A 4OUCA 3VS7A 3O7LD 4CV8A 3PVBA 3LFCA 3QCSA 5L6PA 1UKIA 3TCPA 1YHWA 4HZRA 3UC3A 2C6EA 3EYHA 1JOWB 3LJ1A 1YW2A 5DNRA 5HBHA 3RWQA 5K4JA 4CG8A 3DK3A 3U51A 4BICA 1OL6A 1GOLA 5JRQA 2BTRA 3LCTA 4HVGA 4KB8A 4WNKA 4A9SA 4O81A 4I24A 3FLWA 5IUIA 1VYWA 1ZAOA 2EUFB 3NUNA 4MD8E 5ETAA 3LFSA 1OL5A 3F82A 4IZ5A 2QQ7A 4HYIA 4P90A 4O27B 1W8CA 3LCSA 4R5SA 4Z3VA 4F1TA 3MVMA 2XZSA 3RMFA 4CMUA 4F0FA 4BCPA 4IDVA 4XV1A 1M17A 1WFCA 1RJBA 5GIPE 3Q53A 2WQNA 5EFQA 4O0XA 4I6HA 5EDPA 5HU3A 1O9UA 3H3CA 4W9XA 4YPDA 4NSTA 5FTQA 4QD6A 5LMKC 3DJ6A 2GS2A 4BWKA 3R8UA 4IMYA 4CKIA 4O7WA 3COMA 4G6NA 5J8IA 5HTIA 2LAVA 1OVEA 3U9NA 1P4FA 4TRLA 3TL8A 4PX6A 4XRLA 4OAVB 4K2RA 5HCYA 5M4FA 2R3JA 3QQHA 4U97A 3AC5A 3ENMA 4NU1A 4P5ZA 3B2TA 3DKFA 1PHKA 3P23A 5M4IA 1Q3DA 3HNGA 3MPMA 4NKAA 4XH6A 3WI6A 4JIKA 4DTAA 5DT4A 4Q2AA 5HE3A 3FL5A 2F2CB 4FV6A 4FZFB 2CNQA 5CEIA 4JDJA 4I4EA 3F5UA 4RFZA 4ASEA 4JDIA 5LMBA 5JK3A 3OT8A 4NW6A 3DZQA 3TXOA 4ANBA 1KOAA 5IA0A 4M15A 4MXXA 5FDXA 4MXAA 4E20A 1R78A 2P33A 3IW8A 4E7WA 4JBPA 4WT6A 2W9ZB 3UVRA 4BY9E 2GS6A 3L9PA 3MYGA 4FZ7A 3LXNA 3DCVA 4O0TA 3FC1X 2ZVAA 4LG4A 5AV4A 2GMXA 3P5KA 4ZZMA 2ZJWA 3G15A 4AOIA 3ZC5A 2OJ9A 3VBQA 3R9OA 2JDTA 1XH9A 3JUHA 2P4IA 1GIHA 2VWIA 4OT5A 3NWWA 4GSBA 4LOOA 3SOAA 4DFNA 2X6EA 3LIJA 4XG8A 3SAYA 4HCUA 2JC6A 4O0WA 5HG5A 5HI2A 4RA4A 3ZLXA 4C4FA 4EYJA 5HLWA 1TQPA 5IZFA 3PPJA 3O7LB 2OXYA 4QMNA 4LL0A 4C4JA 3HRCA 4GYGA 2UZVA 4S33A 1FINA 5HO8A 4RPVA 1S9IA 3Q2MA 2RGPA 5M55A 4RIXB 2R3IA 2PVNA 3MFRA 4F7NA 4B9DA 2UZBA 4ZLOA 3DBFA 5K4IA 3TUBA 2FGIA 3CBLA 4GUBA 4NH1A 2XYUA 5A4CA 4JG7A 4FTLA 4G5JA 4DEGA 4MF1A 5KMNA 5D7AA 3GP0A 3I7BA 4LM5A 3QBNA 4ZS4A 1Q8WA 3FDNA 3IDPA 5FEEA 5J1VA 3ZLWA 3ZUTA 3WE8A 2BCJA 3GCPA 4Y72A 2PVFA 3POOA 4A9UA 3ZUVA 5JGBA 2NRUA 3QD4A 3QZFA 4DGMA 3BELA 4LGGA 1CDKA 3COKA 2OBJA 3CE3A 3HA8A 3KK9A 3L8SA 4W9WA 5CAQA 1M2QA 4G3EA 3UDBA 3WYYA 5DT3A 1WBVA 5HCZA 3F7WA 3E3PA 3IW6A 4YP8A 4ITHA 3EHAA 3ZTXA 1OM1A 5D41A 5K0XA 4TN6A 1FOTA 2XIZA 4TZRA 4Y95A 4I0SA 4AZFA 1XBAA 2IW8A 2UV2A 4WUNA 3C0HA 2BZIB 3VC4A 1H25A 3NEWA 2VNWA 2O3PA 2WU7A 3E87A 5CEQA 2C6IA 3BHYA 4S34A 2UW5A 2ZYBA 3GI3A 2A19B 4HPUE 1DS5A 5ANKA 3VS6A 4ACGA 4ZSGA 4BI1A 1FGIA 3CJGA 1OIQA 3E8NA 3HP5A 3QXOA 3CJFA 4CCUA 3F5GA 3C4FA 4C38A 1Z9XA 4Y46A 3FYJX 5B0XA 5ACKA 4NCTC 3SDJA 2BIKB 3BE9A 3QUEA 3ERKA 2R3NA 3CQEA 3HL7A 3BLHA 3SRVB 3VS0A 2PVYA 4YBJA 1BYGA 4ZLYA 3VW8A 3K5UA 3ORTA 4AFEA 2W17A 5JSMA 1JSUA 3I6UA 5BVDA 3TUDA 5A4TA 5KMIA 5DYJA 2YZLA 2XNBA 3KVWA 3CS9A 3UG2A 4D4YA 4L9IA 1Q8UA 2XNOA 5DRBA 3NIEA 2XNNA 2Y4PA 1YRPA 2GHGA 2OICA 2QR7A 2WELA 3Q9WA 1NVSA 4FG9A 4W4VA 3UZPA 4YZNA 2H96A 4UBAA 5FXSA 4ZY6A 4FIEA 1SNUA 4U8ZA 2BHHA 3OWJA 4RX5A 2XKDA 3FYKX 3KMUA 3DTCA 3KN5A 3R1QA 4FI1A 3BCEA 3P0MA 5ACBC 5LOHA 1PXIA 3I6WA 5EQPA 1H00A 3M2WA 2BFYA 4R3RA 4A7CA 3NX8A 3AGMA 3PXRA 4CV9A 3DDPA 4KSPA 4YC8A 1H28A 4JRNA 5HG8A 4ZSEA 4WSQA 3TT0A 3MW1A 4MNFA 1XBBA 1CM8A 3TKHA 1FMKA 5DHJA 4ANNA 5BVFA 5LCJA 3OWPA 3DDQA 4L46A 4QP3A 3UG1A 1YDTE 4QYHA 5C1QB 3SXRA 4L68A 1B6CB 3QQJA 4JR7A 2VTSA 3D2IA 5EDRA 2HZ4A 5HG9A 3E62A 4FTJA 3PXYA 4I5CA 3UODA 4D2TA 1Q8TA 2Y6OA 1DAYA 3RAIA 2W4OA 4PY1A 2VO6A 4AOJA 3AC2A 2QCSA 2CLQA 1U4DA 4JBQA 2JBPA 4BB4A 5KBRA 2YERA 4QMLA 5ETIA 4OTHA 3GNIB 3Q4TA 2QLQA 4DH3A 2EB2A 1URWA 2W06A 2WAJA 5GJDA 4AE9A 4DFXE 1ZYLA 4R3PA 4RIWB 3W1FA 4U45A 1M2PA 1ZRZA 2XA4A 4BHZA 2RFEA 3W8LA 3OXTA 3NVKI 3VW6A 2OJJA 2OXXA 4G6OA 4BIEA 4FSYA 5HD7A 4AW1A 3QKLA 2RFDA 4M13A 1V0PA 4WKQA 2CLXA 5AWMA 4I0TA 4A07A 4C33A 2XRUA 4X3JA 5IQDA 4BBMA 2HXQA 2VTAA 3HEGA 2WB8A 1XO2B 1YHVA 4QMVA 3ZU7A 4XP2A 3EZVA 4J8NA 4DEEA 3QQUA 1OUYA 4OGRA 3R8VA 2FSTX 3R1SA 3TNQB 3MWUA 3V51A 5M07A 5IQFA 1PXLA 1OKZA 4NJ3A 4O82A 2VAGA 4UWCA 2NO3A 1YDSE 3BRBA 3QX4A 3VHKA 4PDYA 2HK5A 3N9XA 3CP9A 3R2YA 3OW4A 5B7VA 1E9HA 2C30A 4X2FA 2JAMA 3OP5A 4PP7A 2EB3A 2JDRA 3D7TB 2XUUA 4XG7A 4RC3A 3QRJA 2WTDA 4BCMA 4C4EA 5A4EA 4BDEA 2C69A 1CKJA 3MSSA 4IACA 2PPQA 3RZBA 3JY9A 4QMPA 5AP0A 5C4LA 4DFBA 1M2RA 3UMWA 1AGWA 4X2NA 2XNMA 5JFWA 3BIZA 3O23A 4FX3A 4FT9A 4QP6A 2OW3A 4WBBB 4FSZA 5AV3A 4CNHA 4U81A 4KIKB 3Q9XA 4FTNA 3GC0A 2F4JA 3U4UA 3TTIA 5LQFA 2BRNA 2Q83A 3KXZA 4C3RA 3ZEPA 4XNEA 4Y83A 2XYNA 1Q8YA 4R77A 1UV5A 2YLEA 2Z2WA 3IW4A 4KBCA 3ULZA 3KXNA 5LMKA 4DEIA 5CSPA 3HV5A 4MNEA 4C58A 2GQGA 2BR1A 3NLBA 4OBPA 4IM2A 1ERKA 1GIIA 1KV1A 3W32A 1YKRA 3EN7A 5DG5A 3G0EA 1PXPA 5EM6A 3ZBXA 4U7ZA 2ONLC 4YBKA 4AWIA 3I0OA 4BWXA 3GC9A 3LQ5A 3NW7A 4BDKA 3VQHA 3QQLA 2C0IA 4UYNA 3GCQA 2BROA 1PMVA 1CMKE 4CYJA 1W0XC 3THBA 4EHZA 4D2RA 2F57A 3BYVA 1O6YA 4XCUA 3UPXA 4D2PA 2QC6A 4QYYA 4RJ3A 5B2LA 5I9WA 2XIRA 3R9DA 2C5VA 4I5PA 5H2UA 4ERWA 1ZMVA 4M69A 5GJFA 2J51A 1O6KA 5JQ5A 4RRVA 5CAVA 2OZAB 4HVSA 2VNYA 3WF5A 4ACHA 5KHWA 2WMUA 2F9GA 4EK4A 1CTPE 2F2UA 3A8WA 3VS2A 3V3VA 1U5RA 1Y57A 3A7HA 3IONA 1SNXA 4LUDA 4XG9A 3DXQA 3KCKA 4ZOGA 3CTJA 4IFCA 3ORKA 2OXDA 4ARKA 4IFGA 2DYLA 1JKSA 5AR3A 5K5XA 5M44A 2W1ZA 3BHHA 4BKZA 3F5PA 3C5UA 2PUIA 2CHLA 2R2PA 5FRIA 2VX1A 4EC8A 1MUOA 1W83A 1Y8GA 4FVQA 1F5QA 2ITWA 1R3CA 5FEQA 4N6ZA 4X7QA 4YLLA 4RA5A 3H4JA 4FG7A 3QQGA 4GU6A 4O86A 3ZUUA 3BGZA 1CKPA 3TJCA 5I0BA 3PFQA 3FZSA 3IW7A 4DT8A 2OG8A 4JAJA 4QP4A 4O6EA 1I09A 2O65A 4QYFA 3V6RA 5GZ8A 2VO3A 4R6VA 4IB5A 3W10A 5CALA 1GJOA 4F7LA 2WOUA 5E90A 5AX9A 3L9NA 1PRYA 2I6LA 5DOSA 3WZUA 3ZRMA 4C37A 3P1AA 3IKAA 1H24A 4M84A 4BKYA 4K11A 4R1YA 1K9AA 4O0VA 4WG4A 1HCKA 5CI6A 4MXCA 5TT7A 1H1PA 4BFMA 5ANOA 4IX5A 5CNOA 4F08A 3EQBA 4QQ5A 3BWJA 3A4PA 4A4XA 2C6KA 3ATTA 3PUPA 4WHZA 3E88A 3LFQA 4E6CA 1KUTA 3I5ZA 2FH9A 2OLCA 4EUTA 3PSCA 5CEOA 4CFUA 4FSQA 2YIQA 2PVHA 4DAWA 1V1KA 2XBJA 4IC8A 1UKHA 3QGYA 2VTTA 3MJ1A 4JBVA 1IAJA 3QHRA 1GAGA 1ZZ2A 3C50A 3DK7A 2F7XE 4GMYA 4IM0A 4UXLA 2IN6A 4O7VA 2WGJA 3ORNA 2CNVA 4AZEA 4ANLA 5AV0A 1QMZA 1YWVA 2CCIA 2R0IA 4O0YA 3Q04A 3AQVA 3ORPA 3LXKA 4AW0A 3QZIA 2GNJA 4JX3A 5ETCA 3WYXA 4NCTA 3OT3A 4FMQA 4OBQA 4CRSA 1XHAA 3QRKA 5AM6A 2PVJA 3UOJA 1H08A 2W1CA 4L8MA 2VTQA 2XM9A 3K2LA 3HA6A 3T9IA 2GQRA 4FUYA 3UNZA 1MQ4A 3D2KA 5F9EA 4QMOA 3PVGA 3OTVA 2XKFA 3HRBA 4QMSA 5GNKA 5IUHA 2XK3A 2XH5A 3E7OA 2NP8A 4BDHA 4MD7E 2QODA 3I7CA 3P79A 3JR1A 3U8WA 2ZM4A 3LFEA 3AC3A 3MIAA 2PZYA 1A48A 4KSQA 5BUIA 4GJ3A 1FBNA 3M1SA 5FG8A 3FMDA 4RLLA 3OWKA 5EYCA 3VUKA 4JI9A 1O6LA 3E64A 3W2RA 4HVIA 5CU3A 2E9VA 5JH6A 4U43A 1H0VA 3GQLA 2X2MA 4WNOA 3O17A 5IA2A 1J1BA 5IPJA 1ZWSA 3KRRA 5AAFA 4EKLA 3AXWA 1NA7A 3QC9A 3OZ6A 3WZJA 4XBRA 1WVYA 2XP2A 2QG7A 2JFLA 5D1JA 2OJGA 5FP5A 3ID6C 4PTEA 4U40A 4ZJJA 4FT3A 2BDJA 5AV1A 4FKTA 3HRFA 3ROYA 5HEZA 4L3JA 3FZRA 4RIXA 4DEBA 2W4KA 3RPYA 3Q4UA 5ETFA 1YI6A 2YZAA 5LWNA 2X7OA 3U9CA 3UP2A 5I9ZA 5KHXA 5C8MA 3ZM9A 1OECA 3PXZA 2EWAA 2YWPA 2B4SB 3CTHA 3A60A 3GC8A 3OEFX 3VNTA 4BCJA 3HV6A 4CLIA 3CSVA 3B2WA 4BDAA 4RX7A 4E4MA 3UZTA 3Q52A 3QQFA 3HZTA 4EOKA 3ANQA 2P2IA 2CJMA 3MV5A 4GFMA 4YLJA 2PL0A 3W2CA 3TTJA 4IB1A 5DR6A 3F3UA 3AMYA 5HNIX 3I1AA 1IG1A 4ZK5A 2F49A 4M97A 4F7SA 3QRUA 4FKGA 2HYYA 3DKOA 4MBLA 3D7ZA 3QTIA 2A27A 4NIFB 3EQPA 4FR4A 3R30A 3UQFA 4JDHA 2WOTA 4FOBA 4IJ9A 4XP3A 1OPLA 3EN9A 3P7AA 4EONA 4Q5EA 4TKSA 1H07A 5FTGA 2PMIA 3R9HA 3PDTA 2JDSA 2QOFA 4NEUA 3KA0A 5BQ0A 4YTIA 3F61A 4GV1A 3FHRA 3A62A 3Q5IA 3G5DA 5IDPA 3LJ2A 1BX6A 3QKMA 3A8XA 5AMNA 1RE8A 4ZJVA 4H05A 4W4WA 2PYWA 3LW0A 1UVRA 3BYUA 3GVUA 2WMRA 2Y4IB 1ZOGA 3GU6A 1Z57A 4WNMA 3HV3A 2JD5A 3COIA 2GCDA 2W5BA 4GEOA 3D15A 4FEVA 1YHSA 3SRVA 1OITA 1GY3A 2IZUA 4J53A 3U6IA 1H8FA 3AMBA 4I4FA 2BALA 3PZHA 3LXLA 4U80A 4YNEA 3VAPA 2YAAA 4TYHB 4HVHA 3LJ0A 4NT4A 4Z7GA 4YJVA 1M7QA 5JFVA 2A4LA 5DT0A 4K9YA 2UW0A 4I22A 1PMEA 2PMNX 4UXQA 4CLJA 3NNWA 5IQEA 2IW9A 4OR5A 4UYAA 4TNBA 4ZMFA 4PNKA 4FNYA 5HE2A 5CXZA 3OVVA 3DV3A 3MGYA 4WO5A 2J5FA 3LFAA 4IWQA 2J5EA 5D12A 2XF0A 5AP4A 3UIMA 3UVQA 5H3QA 1JSTA 1BL6A 4UN0C 3VBYA 4XX9A 3DBDA 3A7GA 2ONLA 3FZTA 1ZY4A 2ITNA 2WTIA 4O2ZA 5CX9A 5EQEA 4MXZA 2XIYA 2YHVA 2YFXA 5FLFA 5B2KA 2GPHA 2GSFA 4EZ3A 3UJGA 4QMTA 3OCSA 5HNGA 1YOJA 1W84A 1A06A 5AX3A 5HTCA 5E9EA 4J98A 2ETKA 4LL5A 3V6SA 1ND4A 5I3OA 2PUUA 3E8DA 4BCGA 4EQMA 1NVRA 1KE7A 4BDDA 4L00A 3RZFA 3C0GA 4IWDA 4YNOA 4ANOA 4FV4A 4HGTA 2C3JA 2C0TA 4EYMA 3HAMA 2PULA 4O7SA 2YDKA 3TNIA 3PLSA 4FZAB 4B8LA 1NW1A 4ERKA 4J99A 1XR1A 5CZHA 2R3KA 3CD3A 3R7OA 4V04A 1YVJA 1K2PA 3HMMA 2W5AA 3FY0A 2PY3A 3BU5A 2VO7A 4F9BA 1DI9A 4I6QA 5AUXA 3W2PA 5DI1A 5DBXA 3KXGA 3VBTA 4RIWA 4DFLA 2J2IB 5A4QA 3DU8A 3TWJA 2OJIA 4IM3A 1H1WA 1OGUA 3ZXTA 4ZSLA 3PYYA 5BX0A 4RJ8A 3NAXA 4EH8A 4ZTSA 4C2VA 2HAKA 2W1EA 4D5HA 5BMSA 2UW7A 3P08A 3UMXA 4USDA 3ZM4A 3Q9YA 4V0GB 3OF0A 4Q5HA 5D10A 3SHEA 4AZTA 4AX8A 5LJJA 5AIKA 4O84A 2R4BA 4RMZA 4D9TA 1IRKA 3VO3A 4FA2A 4XV3A 4RT7A 2GNGA 3BU3A 2QO9A 5HICA 3V8TA 3R0TA 3ZH8A 3ANRA 4JG6A 4IVBA 5F1ZA 1PXJA 3F3WA 3OCGA 3VS5A 4TWPA 2QOCA 4ANSA 4USFA 4BCKA 3DZOA 5L2IA 2X8IA 4X2GA 2C3LA 1GIJA 4EQCA 4DG0E 2VU3A 1KE5A 2Y4IC 3HDMA 5AUVA 5J79A 3HUCA 3PWYA 2J9MA 4AOTA 3R7EA 3R83A 2HCKA 2P0CA 3P86A 3N51A 3F6XA 4G31A 4U79A 4D58A 4DITA 1H1SA 4KS8A 3SOCA 4TPTA 2OF2A 1L8TA 3LMIA 2OO8X 4QPSA 2R3RA 5IMXA 2O2UA 1U54B 3CGFA 3ZYAA 3ZFYA 5ANJA 5L4QA 2YACA 4N6YA 3JXWA 5EOBA 4EH3A 3DTWA 3MA6A 3C4XA 2CKQA 4FT5A 5F94A 5DFPA 3FKOA 3BV3A 4N0SA 1OIRA 2QHMA 2REIA 3BYSA 4XP0A 2OJFE 3QYZA 4Y8DA 2VTJA 5JT2A 4FV1A 4XV2A 2G15A 2GDOA 4F9AA 1XWSA 3FLNC 4RIOA 3KF4A 3RI1A 1WMKA 3H9FA 3MBLA 3TJDA 2Y0AA 4D0WA 4KS7A 3GC7A 4CQEA 5CASA 4S31A 2QLUA 4U44A 4DBXA 3ZO3A 3C4ZA 3V01A 2GNIA 3BWFA 3IK3A 3RGFA 4O83A 5FM3A 5CU0A 2XK7A 4IXPA 2IPXA 4ORKA 2IVVA 3FI2A 4AA0A 3A4OX 5GZ9A 2FSOX 3AG9A 3KMWA 4ITJA 4C61A 3GXLA 2XJ2A 3D0EA 3EJ1A 4KWPA 5H9BA 2R3LA 1UNHA 4F9WA 5M4CA 3U6JA 4O7RA 2R3FA 1ZOHA 5LXMA 3FXXA 4CZTA 2OZAA 2R3PA 3R7YA 2E2BA 4E6QA 2PE2A 1P4OA 3BHVA 4FYOA 5FBOA 4ZTMA 3E5AA 1IR3A 5I9XA 4HGLA 3KULA 2Y9QA 4FKPA 4IAYA 3RK7A 2BZKB 3N4TA 4PL5A 5AEPA 3HP2A 3MVHA 4XYFA 2YM3A 4FKOA 2ZM1A 4JIAA 4PPAA 2UZDA 4BBEA 3WE4A 4PPCA 5C4KA 1TQMA 1RQQA 3R9NA 3IOPA 3RTPA 4O1OA 4D4SA 2DQ7X 5A14A 1OL1A 2CPKE 2PVKA 5DEYA 1OIUA 3R1YA 1M52A 4QMXA 3SD0A 2CKPA 3NVMB 3VWAA 3PPKA 4MQ2A 2I0EA 2QVSE 4W4YA 5HVYA 3DBQA 4OTIA 1LEZA 3L8VA 4C4GA 4QPAA 3LFFA 4KKEA 3LHJA 3DOGA 4JL9A 2UZUE 5DIAA 4BDIA 4RSSA 2YLFA 3DKCA 3U6HA 5J1WA 3IGOA 5HVJA 3AT2A 2C0OA 1QPDA 4NK9A 2X9FA 1JLUE 2NPQA 5DGZA 5DPVA 3POZA 3UIUA 3G0FA 2WMXA 4DT9A 4FE2A 4FTRA 4M3QA 3HMIA 4ENXA 4WIHA 4TW9A 5IISA 2G2IA 3HV7A 1SYKA 3NNUA 2FB8A 4FTUA 4QMMA 1PXMA 4ASDA 3VBWA 4YR8A 5CF4A 3R9RA 4BYJA 3NNXA 5CSXA 4YZDA 2WPAA 1VYZA 5CAUA 3KRWA 4LRJA 4EHVA 5AA8A 4AA5A 3HV4A 4I93A 3EKNA 3PE2A 3VHEA 5HD4A 3G33A 3SQQA 4XLVA 3QWKA 5CLPA 3KEXA 1A9UA 1P2AA 1R0PA 4GIHA 4M14A 1DI8A 3ZSIA 1UWJA 3SA0A 3QF9A 2WMQA 4JS8A 4MD9E 4PMTA 2LGCA 3PY1A 4OT6A 3NDMA 2YWVA 3FE3A 4FSUA 4K0YA 4XBUA 1KE6A 3UVPA 2NNWB 3U4WA 1JAMA 2C5NA 5AP6A 3QYWA 4NJDA 4DHFA 4F6WA 4IVCA 3GFWA 2VZ6A 3ELJA 4MVFA 4QTAA 5EW8A 3DAJA 4R3CA 3ZONA 1Q8ZA 4BVUA 2XIXA 5EDQA 5AUUA 2XM8A 3FQHA 4CYIA 1H26A 1HCLA 4A9TA 1H0WA 3PJ1A 4FGBA 1ZY5A 4P7EA 2O63A 3FMMA 4YTCA 3JVRA 2WU6A 3NYVA 4FICA 2UZEA 2GNFA 3MPAA 2HELA 5M08A 5IG1A 4I0RA 2ZB0A 1IASA 4IDTA 1Y6BA 4ZLZA 3PSBA 3ZDIA 2PZPA 2QD9A 3EN5A 3V5PA 2PUPA 5IEXA 4BCQA 3O2MA 4CZYB 4FEQA 3DLZA 3MB6A 1AD5A 1DAWA 2UW6A 3MVLA 4EK3A 1P5EA 4GK3A 5AUTA 5DWRA 3UPZA 1MRVA 2VTIA 3L1SA 2CGUA 4FTCA 4MTAA 3RKBA 2ESMA 1BI7A 2ITVA 4PV0A 2V55A 2R7BA 4GG7A 3AD6A 5IQAA 2XCHA 3GBZA 4BDGA 4HVDA 3G51A 4EHGA 3RINA 5EOLA 3EH9A 4F09A 3DGKA 5D7VA 3EIDA 3EN6A 2QOHA 4G1WA 2X7FA 4OTPA 2V7AA 2ZV8A 1YXSA 1T45A 2B9JA 4FSWA 4Q9SA 4CRLA 4LGHA 3N4UA 3QUDA 4DE4A 3VS4A 3ETAA 2UW4A 3LCOA 5D11A 4C2WA 2PU8A 2JLDA 4G6LA 3ZO4A 2I0VA 2PSQA 3JVSA 3BLQA 4YSMA 5ICPA 3VF8A 4E5AX 2VD5A 3WZDA 2XB7A 4C4HA 5M53A 4U9AA 3UIBA 2BRMA 4IWOA 2JGZA 4GVAA 4QMZA 4FKIA 3T8OA 3I79A 4R8QA 4JG8A 5L8JA 3CC6A 5EH0A 1WVWA 2Z7SA 4NIFA 4J71A 4C02A 4PQNA 3KVXA 3MVJA 4EOPA 1UWHA 1XH4A 4XMOA 4H3PA 4PL4A 4W8EA 4L42A 4KUJA 3U54A 1KE9A 1QPJA 1OMWA 2A2AA 3LM5A 1WBOA 3R63A 3LQ8A 3EQFA 5EHYA 5KMJA 5LVPA 2JIUA 4YJPA 3ZRKA 5HX6A 3MPTA 3OC1A 4YJSA 4II5A 4YZMA 2GHMA 4M8TA 4EUUA 4GK2A 4D2WA 4BIBA 2JDOA 4FT0A 3KK8A 1YWRA 2NRYA 2H9VA 4X6QC 5CU2A 1TQIA 3PA3A 4JLCA 3BPRA 2QHNA 1Q97A 4ZSAA 3AT4A 2F7ZE 3MH2A 3LMHA 2WKMA 2XKCA 1LEWA 5JZJA 5ITAA 4I21A 4D1SA 2WMBA 1XKKA 5CAPA 2WXVA 3ZZEA 2ZM3A 3QWJA 3ZRLA 1OB3A 1FPUA 2BRGA 4CVAA 3PG1A 1G5SA 5IKWA 4K18A 4EKKA 4FK6A 2EU9A 4OTFA 3QTQA 4R78A 4H1JA 1B38A 3QFVA 1G3NA 2VUWA 5FWKK 1ZYSA 5C9CA 2GFSA 3I5NA 4BR3A 5I3RA 2VTOA 4C34A 3UP7A 5JRSA 3LE6A 3Q32A 1YOMA 4U6RA 4C8BA 3M11A 4DGLC 4AT5A 3G6HA 5KCVA 3DA6A 4X3FB 4RX8A 4AUAA 3O8PA 3FLSA 5CSHA 4MWHA 2GFCA 2BILB 3DQXA 5LWMA 2XEYA 3DBEA 3PPZA 3CXWA 5FP6A 4YHJA 3ULIA 2G9XA 3CCNA 5LMAA 2HY81 4J97A 2CKEA 4A06A 4XG2A 3FHIA 3UO6A 2W99B 2YJSA 2R64A 3AD5A 3QL8A 4NM5A 3W18A 4XOYA 1Z5MA 4M12A 4IB0A 1T46A 2CN8A 3GU4A 3OG7A 1UNLA 2C4GA 3OXZA 3D94A 4CCBA 4EHEA 1IA8A 2PHKA 3B8QA 5FM2A 2B1PA 3E3BX 3F2NA 4UWYA 3GB2A 3TACA 2X4ZA 3BEGA 2UZLA 3DK6A 4IAIA 4YU2A 4FV3A 1OBGA 4ZJIA 1VJYA 4B7TA 4NKSA 4FTTA 4FNZA 5HGIA 2J0MB 5CT0A 3CIKA 3AC4A 4RIYB 3ZSHA 3LVPA 2CSNA 2OH4A 4RWJA 5L2WA 4TTHB 4W4XA 3UYSA 2R3OA 5IDNA 4DCAA 3HGKA 3EYGA 2YEXA 2ERZE 5AV2A 4KABA 2J0LA 4B4LA 3OUNB 3EMGA 3SXSA 4CFWA 2BZJA 3T9TA 4QOXA 4Z9LA 4GL9A 4J95A 2JFMA 4AZVA 5AR2A 2QOQA 2WO6A 2XNGA 4G3GA 4RZVA 4DG2E 2CDZA 2HIWA 4LUEA 5HQ0A 4FNXA 4G5PA 4CXAA 5EYKA 4O1PA 1MRUA 4G2FA 5LVMA 3LFBA 2O0UA 4I23A 4AZWA 4D4RA 3D4QA 1JPAA 4TXCA 2OSCA 5GINE 3EQGA 4EOLA 3EFLA 1ZOEA 3MB7A 4LV8A 4I20A 5IA4A 4G34A 1GZ8A 2ETRA 3UBDA 2EXCX 3TZ8A 3BLRA 3ODZX 3R00A 1JNKA 4C59A 3R2BA 3KRXA 5EM5A 3HAVA 4AQCA 5CU4A 4WBOA 1OI9A 3W55A 5HOAA 4LRMA 4I94A 3QCQA 4RWLA 4DC2A 1PKDA 4GFOA 5EI6A 4H58A 4GCJA 3KXXA 1YI3A 2JKOA 4FG8A 2R7IA 4L3PA 4AE6A 4S32A 1U54A 2CGVA 1LP4A 4HPTE 4TYGA 3FLYA 4EH9A 3QZGA 3Q4ZA 5H8BA 2Z60A 2X2KA 4FKRA 4MAOA 4XOZA 4EQUA 5HIDA 3UZRA 5FEDA 3UE4A 4DN5A 4LMUA 3D5XA 4O38A 2XNPA 1ZZLA 1LPUA 3VJNA 3H30A 4X3FC 2XK6A 5JMSA 3NUXA 4YTHA 4BF2A 3D5VA 5CANA 1V0BA 3HVCA 5AM7A 3L8PA 3FI8A 5IQHA 3PXQA 3F3ZA 3KC3A 4WG3A 2J0JA 4IAZA 3WF9A 2VGOA 4E93A 4BI0A 2ITQA 3WIKA 5IF1A 3A7IA 2CN5A 3LFNA 5CQWA 5BVOA 4FV7A 2E9UA 3TDVA 2ZMCA 4BHNA 4IZAA 3QA8A 2ITUA 3Q96A 5KNJA 3Q2JA 4RJ7A 4O7LA 4PMSA 1E1XA 2ZV7A 4FV2A 3GFEA 3MIYA 3RK9A 5G6VA 3ROCA 2W9FB 3CY2A 3K3JA 3REPA 2QU5A 2WQMA 3LCDA 5HORA 4RQVA 3RP9A 2UZNA 4IZYA 1SVGA 3HYHA 3QD3A 4FV9A 4X2JA 4MBJA 1OKYA 1KV2A 3TG1A 5T6KA 4FYNA 5HLPA 4DCEA 2RL5A 5CSWA 4PP9A 5GIOE 4WG5A 1PYEA 2FA2A 3R6XA 1H1RA 2HENA 1OZ1A 1W98A 2BZHB 4QNYA 3Q6UA 5JGAA 5M06A 3QCYA 5EKNA 3G9NA 4GU9A 4ZZOA 3LKMA 5AR7A 3QTSA 3LFDA 3LXPA 2YM5A 4KIOA 3CPBA 3KMMA 4NTSA 3COHA 3ZZWA 4KD1A 2YJRA 4JOAA 5EK7A 3RJCA 4DFZE 2YA9A 5BYYA 2CGWA 4ZZNA 4IX6A 1UA2A 2H34A 4PTGA 3PY0A 3PA4A 5I4NA 2XNEA 1XH7A 4MHAA 3BYOA 4BTFA 3K5VA 2VV9A 2C68A 3V8SA 3DKGA 3HUBA 4KKHA 4UB7A 3RK5A 4XG6A 4QYEA 3SW7A 3VN9A 3DAEA 4I6BA 3WF6A 3H9RA 5AP1A 5G1XA 3QUPA 3UOLA 4BZDA 2BDWA 2B0QA 4RJ4A 5CSVA 3VQUA 2IW6A 2W1DA 3NPCA 5DR9A 5KBQA 3FXZA 5BYZA 4BCFA 3W2OA 2H6DA 5CZIA 4CGAA 1SVEA 2V7OA 4G17A 3V5TA 4XV9A 3EWHA 5EM7A 2PE1A 3KXHA 5DEWA 3UQGA 4OTGA 5IQGA 3OWLA 2XK4A 4O2PA 1H4LA 4IE9A 1F3MC 4RZWA 2X8EA 4HNFA 3C9WA 3VIDA 1J7IA 2BHEA 3H10A 2Z7RA 2OWBA 3KREA 3WBLA 3R7IA 4NM3A 1Q3WA 1JKLA 2G01A 4GRBA 3TKIA 3FY2A 3AD4A 4O0RA 5CF5A 4K77A 4LRKA 4ACCA 3OCTA 3NS9A 3KN6A 2YM6A 3L9MA 3MH1A 4O0UA 4QO9A 3FEGA 3ZCLA
chains in the Genus database with same CATH superfamily
3QA0A 4IZ7A 2WMWA 3O0GA 5CU6A 4BYIA 3FV8A 4UWBA 4ZY4A 1YQJA 4BIDA 3G90X 5L6WL 3E8CA 3HMNA 1XJDA 4N70A 5DR2A 4EOSA 2AC3A 3G6GA 5E8UA 2HW6A 3UOHA 4C57A 2VN9A 3F3VA 4FEUA 3OOMA 4IEBA 4FTQA 2C47A 2PE0A 4JQ7A 4OTRA 5AR8A 4C3FA 4O22A 3TIZA 2YCRA 5IQBA 4O7YA 2EXEA 2VTPA 3QTWA 4QDEA 2PTKA 2UVZA 2EXMA 2G2HA 1YXTA 2B53A 2W4JA 3PIYA 1Q5KA 4M7IA 4ZS0A 4EOJA 3QD0A 3W2QA 5M56A 3WZEA 2R3HA 2WQEA 3P78A 3RM7A 4F6SA 4PDSA 5FGKA 1V0OA 4D4VA 4E6AA 4IQ6A 5AIRA 3AC1A 1WAKA 2QO7A 2QR8A 2ZMDA 2E9OA 3ET7A 5J5SA 4KRDA 2WEIA 4G9CA 4UALA 2WZJA 4DH5A 3F5XA 4HW7A 2XCKA 3PP0A 4BTMA 2R3GA 4X0MA 3VBXA 4ID7A 3SVVA 2E9NA 2YIRA 1J1CA 3MTLA 3QCXA 4E6DA 3BGPA 3HX4A 2VWBA 2HWOA 4O0SA 5FQDC 5LCKA 4IAAA 3OW3A 4YURA 5A4LA 1UNGA 3UQCA 2VTRA 4YZBA 2AYPA 2W05A 3HMOA 5BPYA 5BUJA 3EN4A 2F7EE 3MFSA 4AAAA 5L3AA 3FKLA 1KE8A 4EH6A 4K33A 2OU7A 4TWNA 4PL3A 4TYIA 2PMLX 5KMLA 2UW3A 3TKUA 2VRXA 2C3IB 2PUNA 4X2KA 5KKRB 2GTMA 5CTPA 3C1XA 4MQ1A 4O7ZA 2AC5A 3FSFA 3KCFA 2V0DA 3VUTA 4DTKA 4BJJA 2RKUA 4QQTA 2BRBA 3TIYA 4WSYA 4AXEA 4V05A 4CFXA 5HX8A 3D9VA 1REJA 2P3GX 4YTFA 5C8NA 1L3RE 3UO5A 3P7BA 4WOVA 4FTAA 3QD2B 2VTNA 3ZHPC 3R8ZA 4ASXA 1OL7A 3PRFA 3FZPA 4IVAA 2C6LA 3VUGA 4R7HA 2XKEA 3I0QA 4GT3A 1GZNA 4EZ7A 5K9IA 1WVXA 4JX7A 4TYEA 3SW4A 4L44A 2B52A 4PF4A 4GW8A 2IVTA 3SG8A 2CMWA 3MA3A 3ZLYA 3MFTA 1NT2A 1YXXA 4AQKA 4QTCA 5DA3A 1NY3A 4AA4A 4MXYA 2UZWE 2FO0A 5C26A 5HG7A 4KNBA 3TEIA 5IA5A 2HY0A 2J0IA 4GG5A 2XK8A 4LOPA 3FQEA 2WTVA 1MRYA 3NRMA 3QRIA 3RHXA 1GNGA 1YXVA 4BCIA 4MH7A 2GTNA 2WTWA 4IHPA 4MNEB 4BN1A 2WEVA 4EWQA 4AT3A 2B54A 4NYEA 5IQCA 4DG3E 2QU6A 3JY0A 3NUPA 3FLZA 2C5OA 2ITZA 5CEPA 4HYSA 3QTXA 4IWPA 4IJPA 3BKBA 4JRVA 4N4SA 2YITA 4U5JA 4H36A 1G8AA 3PJ2A 5CT7A 2QURA 2C6OA 5ANEA 3G2FA 4AF3A 5LVNA 3D5WA 1M14A 2IO6A 4EH2A 2I0YA 1BL7A 3GOPA 2B9FA 5C03A 2JIIA 3KFAA 1E1VA 4LMNA 3P9JA 5F4NA 1KSWA 3RALA 4ACMA 4AG8A 4AN2A 4EEVA 2CGXA 2WMAA 5IA3A 1SZMA 2OFUA 4X3FA 4O7NA 4BZOA 3D7TA 3EB0A 3K54A 4U0IA 4YJRA 3PXFA 3NMUF 1PMUA 1VR2A 1Y8YA 4M69B 3HMPA 2UVXA 4KAOA 4LOQA 4DEHA 4QP2A 5A9UA 4EWHA 3R28A 2QG5A 4YHFA 1ZYDA 4YJQA 3S2PA 4CTCA 4HGEA 4E5WA 5J5TA 1QCFA 2WQBA 4JBOA 4TY1A 2HZIA 4E8AA 3GU5A 4KIKA 3ORIA 5AUYA 3O8TA 3WF8A 2YM8A 3DFCB 2Z7LA 3ENHA 2C6MA 3ZLSA 5L6OA 2QKRA 2R9SA 2BKKA 4FIIA 4D5KA 1ZMWA 1VEBA 4L7SA 5BVNA 4FKVA 2Y6MA 5AADA 5H8GA 4QYGA 4YJTA 3R7GA 5HE1A 2J7TA 4NL0A 3NR9A 4FL1A 4ZEGA 5KUPA 4EH4A 4FKWA 4P2KA 2ITYA 1UU8A 3P7CA 3R01A 4HOKA 5CS6A 5HHWA 2RG5A 4DH1A 4LQMA 1R1WA 4HCTA 1EH4A 5A46A 4DH8A 4RIYA 5AAGA 3FPMA 2VX0A 4F70A 2Y8OA 5KKRC 4PDPA 4AW2A 4CT1A 4DLIA 3WIGA 4FZ6A 4PPBA 4QRCA 4FTIA 4O96A 5FDPA 4M66A 3DXPA 3DNEA 3ALNA 3Q4CA 3R22A 4NM0A 1NVQA 5AP7A 4L45A 3R02A 4R7BA 4LGDA 2PWLA 2VGPA 5CENA 2OI4X 5BUEA 5IMEA 5KMOA 1S9JA 4RC4A 3LAUA 3OHTA 1UU3A 3EKKA 4PNIA 5FBNC 4E5BA 2WFYA 2X0GA 4RBLA 4CG9A 4WUAA 4O4CA 3FMEA 3C5IA 4ITIA 4F65A 4ZTRA 4GK4A 2X6DA 2W1HA 2HW7A 4WRGA 4YHTA 4ALWA 4BCOA 4CFVA 5B2MA 3DJ5A 5C27A 2IJMA 3QLFA 1XH6A 3V8WA 2VX3A 4RFYA 5DMZA 1PYXA 4S2ZA 3LZBA 4F9YA 2OK1A 3DJ7A 1ZARA 3CPCA 4M68A 4OBOA 4EOMA 4EBWA 3I4BA 3RAKA 3A2CA 1Y6AA 2ITXA 3BI6A 3EQRA 3PJ8A 4GFGA 1ZYJA 1U5QA 4FKQA 1BI8A 4RX9A 4O7TA 1PXOA 4AN3A 4FNWA 3OBJA 4CFNA 4FV8A 4ANQA 3D14A 3DB6A 3I81A 3V5LA 2RSVA 3QALE 2HZ0A 4CFMA 2OFVA 3EQCA 3IOKA 4XG4A 4FKJA 2R5TA 5M4UA 2R3MA 4WRSA 3F2RA 4L6QA 1OPJA 3F69A 1WBWA 2C5XA 2QONA 4X21A 3PZEA 3B8RA 5FTOA 5HTBA 2IZRA 2QOKA 3R71A 5EHLA 4EOQA 2ITTA 5HLNA 4Z7HA 5TO8A 5CYIA 3D83A 3QX2A 4RC2A 4IIRA 3V5WA 3WZKA 4GT4A 2C5YA 4NTTA 3BQRA 4KKGA 5GZAA 4I5HA 3DPKA 1G8SA 3ZEWA 3TM0A 3IS5A 4O91A 3SLSA 3SV0A 4CEGA 4WNPA 3MH0A 2UZTA 3SX9A 4EC9A 2P2HA 3TZ9A 4FKUA 3LMGA 5CI7A 1I44A 5TF9A 3R7VA 3W33A 3BYMA 2VWYA 3OS3A 4YO6A 3CGOA 4ANMA 3ZOSA 3Q9ZA 3NYOA 4LV5A 3OD6X 2B9HA 3DFAA 4QMYA 3MN3A 4BGHA 1OUKA 5IEVA 2PVLA 4JDKA 1OIYA 2J6MA 5HCXA 2CCHA 3ACKA 4P4CA 2Q0NA 3RPRA 2HXLA 2FSLX 3CKXA 4PUZA 2XS0A 3VS1A 5IA1A 2UZOA 4KIQA 4QQJA 4EORA 3TV6A 2XAOA 1SMHA 2UW8A 3NGAA 2YCQA 4PRJA 2BDFA 3GCSA 4J1RA 3FSKA 3OEZA 4DEDA 3A99A 3KL8A 5JN2A 4FV5A 4YC3A 3ZBFA 1OBDA 5C01A 1REKA 2JDVA 4E4NA 5GJGA 3M42A 4FIHA 2FYSA 5AUZA 3AOXA 1PXNA 3LLTA 5DLSA 3EQIA 3QTZA 4HYHA 4IVDA 3LCKA 5GHVA 4RG0A 4FK3A 4NUSA 4ZSJA 2EVAA 4CFFA 3ZC6A 5BNJA 4E4XA 2ERKA 4YZ9A 2R0UA 3C7QA 1TVOA 4F1MA 3VVHA 4KINA 2ZV2A 4CT2A 1FVVA 2YIYA 1PJKA 3FBVA 4J7BA 4YUQA 3R21A 3RPSA 1STCE 3O71A 3TN8A 2Z7QA 2XVDA 3P4KA 4FL2A 4Y5QA 2ACXA 5J7HA 4R5YA 2W1GA 2HZNA 1MP8A 2IZTA 2X7GA 3PY3A 4KRCA 5EG3A 3ZO2A 3OUKA 4S30A 5BVEA 3UYTA 1OKVA 3LPBA 4K1BA 3KGAA 3H0ZA 5J9ZA 4QMQA 4DFUA 2BFXA 1BLXA 4B8MA 1JQHA 3EFKA 4DEAA 2YAKA 4LYNA 4WD5A 4FF8A 3PP1A 3UC4A 3QTUA 3IDBA 3BHUA 3FMLA 1GZKA 5JQ8A 2WD1A 2R3QA 1PKGA 3VRYA 1QL6A 4AGDA 2C6TA 5AP3A 4BCHA 4CSVA 2WTCA 2YCSA 4J52A 5E92A 3LQ3A 3RNYA 2GS7A 3UNJA 4QMWA 3A7FA 2VTMA 3QZHA 2W96B 3Q3BA 3RPOA 1XMLA 1OPKA 4G3DA 2FUMA 3FZOA 2ZFYA 3S4QA 3EZRA 3P5JC 4AZSA 4BL1A 3FLQA 3K3IA 3WARA 4RJ5A 5K0KA 4BDFA 5HBEA 2B9IA 3T3VA 2XEZA 3C0IA 3E8EA 3EFJA 3F66A 4IBMA 1VZOA 2PVRA 5BMMA 4Z55A 4JT3A 3TNHA 5A54A 1KWPA 4IADA 3MFUA 2J4ZA 2V62A 4BBFA 3V04A 1BKXA 2RFSA 4F0GA 4TYJA 4RWKA 2ETMA 3ORLA 5AR5A 4YGAA 2QI8A 4APCA 2Y7JA 4QNAA 5HIEA 2BAKA 3F88A 4D1ZA 3TMOA 3NUUA 4YZCA 3PIZA 4V01A 2X39A 1G8JA 1TZDA 4GYIA 5TOZA 3C13A 2XANA 3H9OA 3O5AA 4DYMA 5A6NA 1YI4A 5J95A 2GHLA 3GUBA 3EL8A 4NZWB 3OBGA 5J9YA 5CVFA 5KE0A 2ZOQA 5M57A 4IX3A 3FWQA 5AUWA 4C62A 4B99A 4EI4A 3UDZA 3QGWA 4L43A 2WTKB 2UW9A 5HE0A 5E8XA 4KA3A 4PDOA 3TV7A 1XH5A 4QP7A 3EOCA 3OMVA 1Y91A 5AA9A 3TV4A 4CKRA 1ATPE 4I1ZA 4TYHA 1SM2A 4CTBA 2PZIA 4FTKA 5BVKA 3QQKA 4GIIA 2OIQA 5CNNA 3F2AA 5CWZA 1PY5A 1P14A 1HOWA 4QP9A 2OIBA 3C4WA 4MK0A 2ITPA 3IG7A 3MDYA 2W0JA 3FI4A 2IWIA 3TZ7A 3KQ7A 2YABA 3OXIA 2GNLA 3E92A 4F7JA 3BHTA 5F95A 4BKJA 4W8DA 3BU6A 3ATSA 5AFVA 3CY3A 4OTDA 4DFYA 5M51A 3DBCA 1KOBA 5ANIA 5AAEA 5IH5A 3SGCA 2DWBA 4G3FA 2I7QA 2YIWA 4K8AA 4R1VA 4B0GA 4JJRA 4AGWA 4PMMA 3G9LX 4JR3A 3BE2A 1CSNA 4FIGA 4XRJA 3ORMA 2JAVA 4UMTA 1R0EA 2UUEA 3UO4A 4USEA 3GT8A 3MH3A 4FOCA 4GT5A 1LUFA 2SRCA 4ONAA 3CQUA 4C3PA 4ZY5A 4RVKA 2X81A 2WIHA 2XRWA 4DINA 4X6RA 3SKCA 1J91A 2CKOA 3A61A 1J3HA 5HESA 5L8LA 4FEXA 4I6FA 4O21A 5A3XA 2YN8A 4NFNA 4RWIA 4KBAA 5AP5A 1WBTA 4GVJA 3IW5A 3OY3A 4ZXTA 2QOBA 4FC0A 2PMOX 4A4OA 3D5UA 4BDCA 2RG6A 2VWVA 4UV0A 3C51A 2IVSA 2BIYA 1PXKA 4ACDA 3CR0A 4C0TA 4JQEA 2ZAZA 4BCNA 4M67A 3UIXA 4EJ7A 3SXFA 3VJOA 4O4DA 1MQBA 2JKMA 3PA5A 3RWPA 3PE1A 4JXFA 4QMUA 4UMPA 2JKQA 4MYGA 5EHOA 5HVKA 3AMAA 2VWXA 4V0GA 5TE0A 3FPQA 5EYDA 4F1OA 4QP8A 1FGKA 2YDJA 4MKCA 3PSDA 2WMVA 2E9PA 2O5KA 3KB7A 5C8KA 2YM4A 5LARA 3HECA 3QHWA 4ASZA 2WMSA 5J7BA 3VULA 2BAJA 2VWUA 4UMQA 1OL2A 4IW0A 5A6OA 3W8QA 3ZS5A 1JBPE 2BPMA 3PTGA 2ZDTA 3ALOA 5FUTA 4A9RA 4LI5A 2BVAA 3R04A 3PIXA 2IVUA 2XJ0A 5M09A 5IH6A 3TZMA 5DH3A 1QPCA 4QTBA 3SG9A 4C4IA 2WHBA 4G16A 3RAWA 1IAHA 2I1MA 3LLAA 3NAYA 4F9CA 1YWNA 4FJVA 2C1BA 4FODA 3UTOA 4BGGA 4XS2A 4A9YA 1BUHA 2BKZA 2QNJA 2WTKC 4H1MA 5K5NA 2DUVA 5HKMA 3FXWA 1WBNA 3VUIA 5LVOA 1IEPA 3OROA 2KULA 4FIFA 4GUEA 2A0CX 5E8SA 3Q5ZA 3NYNA 4RVMA 3KULB 4CMTA 4IAKA 5KZIA 4HJOA 1JKKA 3IQ7A 4L53A 5TKDA 4PMPA 3Q60A 4U3YA 5CF6A 2OGVA 1ZLTA 1H1QA 2FSMX 4FIJA 3ACJA 3R1NA 3GGFA 4DF3A 4EZ5A 4O6LA 4UZHA 2H8HA 3T3UA 2QO2A 1FQ1B 4FVPA 3DLSA 3S1HA 4QP1A 4OTWA 4AACA 1JWHA 1Q4LA 2GQSA 2XBAA 2QOOA 5I9UA 2Z8CA 5IEYA 2BRHA 3F9NA 4L7FA 4F99A 5T68A 4FKLA 5L8KA 2AUHA 5HNBA 3RHKA 3MS9A 3NSZA 5DN3A 4UX9A 4YJOA 5BYLA 1Q62A 4D1XA 1PF8A 1Q41A 2GU8A 3NUSA 4MWIA 4PTCA 3UGCA 3EQDA 4RGJA 3BV2A 4AGUA 4D2SA 1M7NA 3JPVA 3NNVA 5E8YA 4KIPA 4ZTQA 4XHKB 3MY0A 3BBWA 3DNDA 5DRDA 4QTEA 2XIKA 2P55A 5EW9A 3VS3A 2IG7A 4FT7A 4JNWA 3FJQE 3CLYA 1K3AA 3S0OA 5DVRA 2YIXA 4U41A 5T3QA 4DGGA 1YDRE 3QLGA 3QTRA 1B39A 3RPVA 5E8TA 5CXHA 4I92A 4UMUA 4EBVA 1WCCA 3R73A 4YJNA 5KMMA 2RFNA 2X8DA 3FMJA 3NW6A 3NUYA 5I5ZA 3LM0A 3QAME 5L2TA 3FC2A 4AS0A 2WIPA 4AU8A 2QOIA 3AC8A 4BTJA 5KZ0A 4HCVA 3GEQA 4FBXA 3HDNA 4OLIA 1R39A 3RCJA 4L01A 4BDBA 4E73A 3BQCA 3OOGA 1OKWA 4GH2A 4MCVA 4E26A 3GCVA 2OIDA 4FGRA 2DS1A 3R8PA 3RAHA 2J50A 4FSMA 1LR4A 4CQGA 3KY2A 4D2VA 4BRXA 4BWPA 4ZAUA 1XH8A 3IGGA 4GS6A 4AGCA 3CKWA 4F63A 5AJQA 4ZTHA 5FD2A 2BUJA 4ZIMA 1QPEA 4J8MA 4DBNA 4DLJA 3KXMA 1ZXEA 5CVHA 4YMJA 1PMNA 2YCFA 3JYAA 3BX5A 3WILA 4ZP5A 1U46A 4CD0A 2O64A 3DS6A 4EK6A 3KRJA 1JKTA 4OW8A 4Y5HA 4HZSA 2QKWB 3FI3A 3EQHA 3FL4A 4TL0A 1BMKA 4BZNA 1UU9A 1XQZA 5E7RA 1FMOE 4YSJA 4CZUA 4FZDB 4EH7A 3KU2A 4D9UA 4UMRA 2YISA 2OZOA 3W0OA 3PRIA 2C1AA 2PK9A 4HNIA 2W5HA 3O50A 2W1IA 5K3YA 4ZTNA 5E8ZA 4DDIA 4FTOA 3F3TA 3ZMMA 5EKOA 2G1TA 4C36A 1RW8A 5E1EA 5FXRA 3PJ3A 4H39A 3VUDA 4FL3A 4CKJA 1H01A 4ENYA 4E1ZA 3PWDA 2VWWA 4IANA 3FUPA 4AP7A 3AGLA 4FKSA 5ANDA 4BC6A 3ZSGA 3CTQA 4AN9A 3KF7A 4UEUA 3RNIA 3W0NA 4TT7A 4WA9A 4DDGA 2JIVA 2C6DA 4HGSA 5HO6A 4C35A 3RBWA 4TWOA 4ZTLA 5JFSA 1FVRA 3DB8A 2BTSA 3AKJA 3IPHA 3DQWA 4F6UA 2X1NA 3L9LA 4XJ0A 5HU9A 2B55A 4MX9A 4M0ZA 4EJNA 2VTHA 5J87A 1YXUA 3VF9A 3ITZA 4I5MA 2B7AA 2J90A 4XEYA 4EOIA 3BGQA 4EL9A 2WNTA 3ORXA 2JBOA 4D28A 1DM2A 2X4FA 3CQWA 1NXKA 3V5JA 3TUCA 4GJ2A 5E1SA 2V22A 3N4VA 3C4CA 3VUMA 4AT4A 5JZNA 4XUFA 3PVUA 2XJ1A 3H0YA 3QXPA 3PG3A 3O96A 4EOOA 3IO7A 4NW5A 2WMTA 4M0YA 3JS2A 1X8BA 2Q0BA 4P5QA 3QRTA 3R8MA 4G9RA 3UNKA 5JKGA 3TI1A 2CNUA 1URCA 5J9LA 3NCGA 4C7TA 4GKIA 5CY3A 3QC4A 4MF0A 3OFMA 1WBSA 3BZ3A 3UOKA 2IZSA 3Q6WA 1XBCA 2UVYA 4GKHA 5CF8A 3DY7A 2I40A 5JGDA 5IUGA 4TNDA 3WOWA 5EQYA 4BDJA 4RVTA 4YLKA 3W2SA 3MJ2A 4D55A 4JAIA 2W1FA 3S3IA 4DGOA 4XG3A 3U87A 3ZFXA 4ZMEA 2QOLA 2A1AB 4JVGA 4FSRA 4E3CA 1Q61A 4H3QA 4B6LA 3F7ZA 4QTDA 1JSVA 4OAUC 2HOGA 2RF9A 3EFWA 4L67A 2WTJA 3NZ0A 3LOKA 3GU7A 3OY1A 4JQ8A 5LVLA 3QU0A 2VTLA 5JFXA 1PW2A 3GOKA 3KRLA 5HBJA 3BBTB 5FXQA 4CMOA 5CQUA 1APME 4PWNA 3DAKA 4YO4A 1Q24A 1AQ1A 2G2FA 2ITOA 2RIOA 3U55A 3PXKA 3PLAE 5I9YA 2ZV9A 2V5QA 5E8VA 2FVDA 3HKOA 2VO0A 4QT1A 5HIBA 4D0XA 4N57A 3TDWA 3ZFMA 4AXAA 4IC7A 4QPMA 5EI8A 5AP2A 2PVMA 1IA9A 3ODYX 2IF8A 3W16A 3ZDUA 3C4EA 5KO1A 2WQOA 3E93A 3IECA 4DGNA 2X0QA 1J7LA 2HWPA 4ALVA 4I3ZA 4A4LA 3O8UA 4I41A 1TKIA 4IX4A 2OF4A 2YM7A 5ANGA 3HLLA 3FMHA 5EYMA 4BGQA 5KMKA 3MI9A 4ALUA 2W7XA 1GZOA 4QQCA 5EI2A 4APPA 3E63A 4IAFA 4AW5A 3FMNA 4LFIA 2OKRA 4MXOA 4EH5A 3V5QA 3OTUA 4FSTA 4G3CA 5L2QA 5E4HA 1Q99A 5IQIA 2I0HA 5HZNA 5I9VA 3NUAA 2VWZA 5H8EA 3SC1A 3II5A 4YPSA 5CEMA 3ZO1A 4IH8A 1ZMUA 3R8LA 5HO7A 3NYXA 3OCBA 4FVRA 5AR4A 4XLIA 2PZRA 3GQIA 4IB3A 4YC6A 5DE2A 4RVLA 2X9EA 1SVHA 1W7HA 1FVTA 4J96A 3DT1A 4EK5A 1F0QA 3FAAA 3NCZA 3FKNA 3NIZA 4KBKA 5EW3A 4F4PA 5IH4A 1RDQE 3E7VA 3MY1A 4DH7A 4FV0A 3GENA 3PVWA 2XMYA 5CEKA 3IDCA 3L8XA 4HYUA 5L2SA 3RCDA 3R7UA 2KTYA 2JKKA 4Z16A 1YOLA 3GCUA 4U42A 5BVWA 4F64A 3CEKA 3DXNA 4Y85A 3MESA 4RLKA 1ZYCA 3O51A 4L3LA 4NWMA 4OTQA 4Y73A 5E8WA 3BEAA 3TNPC 3CD8A 3VBVA 5EM8A 4DA5A 3KKVA 4RFMA 3FZ1A 3S00A 4L52A 3RM6A 3FMKA 4BTKA 2JEDA 3PJCA 5CAOA 2BAQA 1JVPP 3QKKA 2ZDUA 4MBIA 5IU2A 2PZ5A 3MTFA 5JEBA 2OH0E 3W0MA 3RVGA 5F20A 5CVGA 1H27A 4MEDA 4UY9A 3FQSA 4H3BA 4Q9ZA 2C3KA 1U59A 2YDIA 3VUHA 1ST0A 3NW5A 3GU8A 4EK8A 1TFFA 3AT3A 2BMCA 4FTMA 3S95A 4YJUA 5E91A 4BI2A 4F0IA 2Z02A 3ZXZA 4K6ZA 4R7IA 4U3ZA 1J7UA 5KX8A 2ZB1A 1CKIA 4RQKA 2JITA 3ORZA 4UZDA 5D9HA 4FEWA 4E4LA 4FSNA 4DTBA 2X2LA 4TWCA 3MY5A 1WBPA 2GNHA 4NFMA 2O8YA 1W82A 4RJ6A 1WZYA 3WF7A 2J0KA 3EL7A 3A7JA 4FUXA 5TR6A 3TNWA 3VRZA 4AFJA 3I60A 2XK9A 4NM7A 1UU7A 4OUCA 3VS7A 3O7LD 4CV8A 3PVBA 3LFCA 3QCSA 5L6PA 1UKIA 3TCPA 1YHWA 4HZRA 3UC3A 2C6EA 3EYHA 1JOWB 3LJ1A 1YW2A 5DNRA 4O4FA 5HBHA 3RWQA 5K4JA 4CG8A 3DK3A 3U51A 2NYAA 4BICA 1OL6A 1GOLA 5JRQA 2BTRA 3LCTA 4HVGA 4KB8A 4DHZA 4WNKA 4A9SA 4O81A 4I24A 3FLWA 5IUIA 1VYWA 1OGYA 1ZAOA 2EUFB 3NUNA 4MD8E 5ETAA 3LFSA 1OL5A 3F82A 4IZ5A 2QQ7A 4HYIA 4P90A 4O27B 1W8CA 3LCSA 4R5SA 4Z3VA 4F1TA 3MVMA 4AAYA 2XZSA 3RMFA 4CMUA 4F0FA 4BCPA 4IDVA 4XV1A 1M17A 1WFCA 1RJBA 5GIPE 3Q53A 2WQNA 1W2CA 5EFQA 4O0XA 4I6HA 5EDPA 5HU3A 1XMMA 1O9UA 3H3CA 4W9XA 4YPDA 4NSTA 5FTQA 4QD6A 5LMKC 3DJ6A 2GS2A 4BWKA 3R8UA 4IMYA 4CKIA 4O7WA 3COMA 4G6NA 5J8IA 5HTIA 2LAVA 1OVEA 3U9NA 1P4FA 4TRLA 3TL8A 4PX6A 4XRLA 4OAVB 4K2RA 5HCYA 5M4FA 2R3JA 3QQHA 4U97A 3AC5A 3ENMA 4NU1A 4P5ZA 3B2TA 3DKFA 1PHKA 3P23A 5M4IA 1Q3DA 3HNGA 3MPMA 4NKAA 4XH6A 3WI6A 4JIKA 4DTAA 5DT4A 4Q2AA 5HE3A 3FL5A 2F2CB 4FV6A 4FZFB 2CNQA 3NFGB 4F78A 5CEIA 4JDJA 4I4EA 3F5UA 4RFZA 4ASEA 4JDIA 5LMBA 5JK3A 3OT8A 4NW6A 3DZQA 3TXOA 4ANBA 1KOAA 5IA0A 4M15A 4MXXA 5FDXA 4MXAA 4E20A 1R78A 2P33A 3IW8A 4E7WA 4JBPA 4WT6A 2W9ZB 3UVRA 4BY9E 4O4BB 2GS6A 3L9PA 3MYGA 4FZ7A 3LXNA 3DCVA 4O0TA 3FC1X 2ZVAA 4LG4A 5AV4A 2GMXA 3P5KA 4ZZMA 2ZJWA 3G15A 4AOIA 3ZC5A 2OJ9A 3VBQA 3R9OA 2JDTA 1XH9A 3JUHA 2P4IA 1GIHA 2VWIA 4OT5A 3NWWA 4GSBA 4LOOA 3SOAA 4DFNA 2X6EA 3LIJA 4XG8A 3SAYA 4HCUA 2JC6A 4O0WA 5HG5A 5HI2A 4RA4A 3ZLXA 4C4FA 4EYJA 5HLWA 2XARA 1TQPA 5IZFA 3PPJA 3O7LB 2OXYA 4QMNA 4LL0A 4C4JA 3HRCA 4GYGA 2UZVA 4S33A 1FINA 5HO8A 4RPVA 1S9IA 3Q2MA 2RGPA 5M55A 4RIXB 4JMQA 2R3IA 2PVNA 3MFRA 4F7NA 4B9DA 2UZBA 4ZLOA 3DBFA 5K4IA 3TUBA 2FGIA 3CBLA 4GUBA 4NH1A 2XYUA 5A4CA 4JG7A 4FTLA 4G5JA 4DEGA 4MF1A 5KMNA 5D7AA 3GP0A 3I7BA 4LM5A 3QBNA 4ZS4A 1Q8WA 3FDNA 3IDPA 5FEEA 5J1VA 3ZLWA 3ZUTA 3WE8A 4AXDA 2BCJA 3GCPA 4Y72A 2PVFA 3POOA 4A9UA 3ZUVA 5JGBA 2NRUA 3QD4A 3QZFA 4DGMA 3BELA 4LGGA 1CDKA 3COKA 2OBJA 3CE3A 3HA8A 3KK9A 3L8SA 4W9WA 5CAQA 1M2QA 4G3EA 3UDBA 3WYYA 5DT3A 1WBVA 5HCZA 3F7WA 3E3PA 3IW6A 4YP8A 4ITHA 3EHAA 3ZTXA 1OM1A 5D41A 5K0XA 4TN6A 1FOTA 2XIZA 4TZRA 4Y95A 4I0SA 4AZFA 1XBAA 2IW8A 2UV2A 4WUNA 3C0HA 2BZIB 3VC4A 1H25A 3NEWA 2VNWA 2O3PA 2WU7A 3E87A 5CEQA 2C6IA 3BHYA 4S34A 2UW5A 2ZYBA 3GI3A 2A19B 4HPUE 1DS5A 5ANKA 3VS6A 4ACGA 4ZSGA 4BI1A 1FGIA 3CJGA 1OIQA 3E8NA 3HP5A 3QXOA 3CJFA 4CCUA 3F5GA 3C4FA 4C38A 1Z9XA 4Y46A 3FYJX 5B0XA 5ACKA 4NCTC 3SDJA 2BIKB 3BE9A 3QUEA 3ERKA 3BLAA 2R3NA 3CQEA 3HL7A 3BLHA 3SRVB 3VS0A