3UVRA

Human p38 map kinase in complex with km064
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
347
structure length
331
Chain Sequence
b'RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 116
structure length 331
sequence length 347
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3uvrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3uvrA01
4YC8A 5BVWA 4EWHA 5CYIA 2Z7LA 4FT5A 4AW1A 4WT6A 4PPBA 4IZ5A 5EQPA 3IDCA 2GS6A 5AMNA 3EQCA 3G0EA 3C4ZA 3OY1A 2BHHA 3R22A 1KE5A 3QRKA 4LV8A 5D7VA 4E7WA 4QQCA 4UV0A 4BYIA 4UYNA 3PJCA 4YJQA 5DNRA 5KKRB 3WF9A 2WIHA 2E9VA 4ANSA 5L2SA 2YAKA 3C4CA 3GC9A 4U43A 2OF4A 4X2KA 2V0DA 2XBAA 1U46A 5CVFA 5HNGA 3WZUA 3RAKA 3HA6A 4QMOA 1UU9A 2HW6A 3LLAA 2ZV8A 4IVDA 5FRIA 2I7QA 4HOKA 4L3LA 5I3OA 3HAMA 2W9FB 2CCIA 2J5EA 2YIYA 4MXXA 4TYIA 5HESA 2OICA 2HZ0A 4YC3A 4TNBA 4JRNA 4FG9A 2QQ7A 5M55A 3R7EA 3GNIB 3ZSIA 1KOBA 2X2LA 3CTJA 4UXQA 4A9RA 4D58A 1JSTA 5B2LA 4PP7A 2YIXA 2PVHA 2J6MA 4P7EA 3LCOA 4CFUA 2R3HA 5CEKA 2XNGA 3FMKA 1H1RA 4MTAA 3F2AA 4KSPA 3DY7A 3G0FA 2JAMA 1CTPE 3GCSA 4YLLA 5AA9A 3OWJA 5FLFA 5EW8A 2FVDA 5DI1A 4F9AA 4ZOGA 4ANLA 2ITVA 5TOZA 4RLLA 4WHZA 3UQCA 4RIXB 2VWUA 3KVXA 1YXXA 4DA5A 3V5JA 3QLGA 4FT0A 3R7OA 4FTAA 4DEEA 5C26A 4HPTE 4EUUA 3UP2A 2WTJA 5B2MA 3KRLA 3DAKA 4ZTNA 3OXTA 5B0XA 4BCIA 5CU0A 4G6NA 1K3AA 3PTGA 2WTWA 4FV0A 4QMYA 4R5YA 4QYHA 1YXTA 3OOMA 3RPYA 4AX8A 2CNQA 1PXOA 3OOGA 2AUHA 5FBOA 4DFZE 2W06A 2VX0A 4FTRA 5DIAA 3UNZA 3RI1A 3DKOA 4I4FA 2CNVA 3IG7A 3Q2JA 4DGGA 5TT7A 5CF4A 1Q24A 2V55A 5HCXA 5M44A 2CKPA 2QO7A 2R64A 5DPVA 2VV9A 4PMPA 3NNWA 2ZVAA 4QTAA 4CV9A 3FXWA 4WA9A 3D9VA 3OW3A 5E8TA 4C2VA 3KC3A 3KULA 5DEWA 4JBOA 3R00A 5ACKA 2HCKA 1W98A 4FGBA 1Q8WA 5JFWA 5FGKA 3S2PA 2QOBA 5M07A 2I40A 4UMTA 3AD5A 3SDJA 2R3NA 5KUPA 4N4SA 2A19B 4RVLA 3Q9ZA 2H8HA 4E1ZA 2XK3A 5D9HA 3MFRA 3KREA 3GOPA 4BCOA 3TT0A 2R4BA 2OJGA 3DNDA 3KRWA 2PZYA 3IDPA 4MF0A 3F66A 2WXVA 3VJOA 4GKHA 1OUKA 3K2LA 4HVSA 2UZWE 3LM5A 5EH0A 2WQEA 1JAMA 5J95A 2ZMDA 1KSWA 1P4OA 3PJ2A 5AFVA 4QO9A 4S34A 5AADA 4IB1A 3TUDA 1OBDA 1S9JA 4D4RA 1RQQA 3NW7A 4FSRA 5AAGA 1WBNA 4TPTA 3NCZA 2BPMA 2BHEA 2F49A 3R28A 2XEZA 4R8QA 4TYHA 3GB2A 3IKAA 1WBVA 2ONLC 3HA8A 1Q8UA 3DZOA 3Q52A 2BTSA 2PMLX 1MQBA 3QD0A 1U5QA 3W8LA 4JAJA 3EN5A 5KMMA 2XNPA 4ALUA 2C4GA 4CTCA 4KIOA 2I1MA 4J95A 2H6DA 3FI3A 1M2QA 2W1IA 3LFCA 5DRBA 3K3JA 5EW3A 4LOPA 5K0XA 2PUPA 3EFKA 5BYZA 1UVRA 4FV1A 4KBAA 3FHRA 3BZ3A 4YPDA 3UQFA 3QA8A 3ORZA 5AP0A 5A6NA 5DFPA 2XNOA 4UXLA 5J8IA 3TN8A 4NFNA 4DN5A 3F7WA 3OS3A 4OTQA 1SYKA 2V7OA 5AR7A 3RMFA 2P0CA 4I6BA 2CDZA 4IHPA 2J0KA 4L44A 2B9HA 2BCJA 2C3KA 4Y5HA 4E6CA 5IEXA 1T45A 3CS9A 4IX5A 5ICPA 5IPJA 3VO3A 5IQBA 4C58A 3F2NA 4J7BA 4ZMEA 4DFYA 4FKJA 4GJ3A 3KXMA 3QKLA 5E92A 3NSZA 5KNJA 3UO5A 3FPMA 4IVAA 1H0VA 4Q9SA 2PZIA 3SX9A 4AE6A 4IFCA 5T6KA 2R3OA 3ZOSA 3ZSHA 3TG1A 3GXLA 3VW8A 3MH1A 5EI8A 4EZ3A 1YWRA 4XV2A 4F0GA 1ZYCA 2VTMA 1STCE 3F69A 4EHGA 4FTNA 5EHOA 2QU5A 3S1HA 4JR7A 2OZAA 2YA9A 4QD6A 5D10A 3L8SA 2YIQA 4A07A 3E92A 3HDNA 3UC4A 5AEPA 4D9UA 4LI5A 1XH7A 2JAVA 4FIEA 3WYYA 4YLJA 4LMNA 4X2FA 1O6YA 3A7IA 4O96A 4XEYA 4Y5QA 4CFVA 4GSBA 2FUMA 3QC9A 3ZEPA 4BBFA 1J91A 4QTEA 1P2AA 2C3LA 3BLRA 3ENHA 3GT8A 3R83A 2CJMA 5IQFA 2DUVA 4FR4A 4F9WA 3F5XA 2BRNA 4YTCA 4IM0A 2NO3A 2WMXA 4Y73A 3FKNA 4R6VA 4YMJA 5FD2A 4OBOA 1H1SA 2RIOA 4AACA 4UMPA 1CMKE 4YP8A 3LCSA 3OTVA 3EQIA 3CD8A 1BL7A 3Q9YA 4KB8A 5JT2A 3HV4A 2JC6A 3OCTA 1UV5A 1GY3A 3OCSA 3C4EA 3KRXA 4JBQA 5FEQA 3UNJA 2KTYA 4AA4A 4FTKA 3RZFA 2FSOX 4AGWA 3L8VA 5I9ZA 3KB7A 4BDEA 5A3XA 2HY0A 4BKJA 4C3FA 4XRLA 4MQ1A 4GG7A 4JDIA 4DFUA 5AJQA 2OJJA 4GG5A 5LCJA 3L9PA 2BIYA 2G1TA 5F1ZA 3R8UA 2IO6A 1U54A 2XH5A 2XIZA 1KE9A 2ZV9A 4M7IA 2XJ1A 4ASDA 3C1XA 4E5WA 3G5DA 4OT6A 4ZZMA 3BGZA 1QPDA 3U51A 1E1VA 5LWNA 1GNGA 1T46A 5BYLA 3GU7A 4H39A 4IEBA 4DTAA 2C1BA 5L2IA 4H3PA 4QP7A 3D0EA 4DH5A 3NUUA 1H1PA 3KXGA 4BDHA 2NP8A 4OR5A 2PZ5A 3I5NA 2PVNA 2C6OA 4R1VA 4ACDA 4EHEA 3V5QA 4C4IA 2XS0A 2XZSA 2WTKC 1XBAA 4LM5A 1PKGA 2C3JA 1JSUA 4NCTA 4V01A 3ULZA 2RFDA 4CKJA 3EN6A 1Q8YA 1ZXEA 3IW7A 3P7CA 4RVMA 1H8FA 3U9NA 5JGBA 4ZTHA 3KXZA 4R7BA 2O8YA 4V04A 3PIZA 4JL9A 5EKNA 3FZRA 4FKGA 4O7LA 3R7YA 5AP6A 1UWHA 4C57A 3LZBA 4YJRA 3P79A 3QWKA 5DHJA 1TQIA 4FEQA 5A4QA 3EN4A 2J7TA 2C5YA 3COIA 4MNFA 2WMWA 4TRLA 5C01A 2Y6OA 1OB3A 5HLWA 2PVLA 2EB2A 3EQGA 3FQHA 4BL1A 5AUZA 4USFA 3AD4A 1CSNA 3TZ7A 4D55A 5M56A 2R0IA 3TDWA 4FSUA 3NUSA 5JMSA 4ZY4A 5KMKA 5DBXA 2VTHA 2UZTA 5K3YA 4F64A 1V0OA 4M84A 2J0IA 1REJA 2W1FA 4IM3A 2QURA 4RIYA 4RWIA 3WBLA 3ENMA 3LQ8A 5JZNA 4ZY5A 3PLSA 3RWPA 3O2MA 3AC8A 1QPCA 1UWJA 1XQZA 3A7FA 3T8OA 5ANKA 4ASEA 3H9OA 3VN9A 4PPCA 4IMYA 3KKVA 2Z7RA 4NK9A 1GIHA 2WHBA 4PX6A 2WAJA 4AGDA 4CRSA 1M2PA 4D5HA 3ETAA 2WOTA 3FC1X 1ZRZA 1ERKA 3KEXA 5M53A 5CSPA 2IWIA 4F6UA 3OCBA 1VJYA 4PMMA 4YZCA 5AWMA 5J7HA 4MYGA 4IFGA 2XKDA 5ANDA 3TI1A 2P3GX 4Q5HA 1YKRA 4W4VA 1S9IA 4WD5A 1ZMUA 2B52A 4JDJA 5L6PA 3HV3A 2YCRA 4GFOA 3E88A 3P23A 4QRCA 5E1SA 5EYDA 5BVOA 4QTBA 3AT4A 3FJQE 5HG8A 1TQMA 4F0IA 5GIPE 5DR6A 3QQKA 4Z7GA 1FBNA 3UG1A 5DR9A 2ZV7A 1XH6A 3FLQA 2OIBA 3AC5A 3ERKA 5M08A 4YZMA 3LFEA 3NCGA 5HE2A 3WE4A 5JGAA 5AUWA 4LOQA 4FTQA 5CZHA 4L9IA 4RIWA 4RQKA 3SRVA 4M69B 4C3RA 4U79A 4BGGA 3JPVA 4CQEA 3FLSA 5IEVA 2WO6A 5IQEA 3OUKA 3GOKA 3H4JA 5LMKA 5A9UA 2Y9QA 5F9EA 1OGUA 4YZDA 4NIFA 3SXRA 2VO0A 4C4JA 1R78A 3IW8A 4YR8A 4CZYB 4N0SA 4M8TA 4B9DA 2X2MA 3NW5A 1R3CA 3IONA 4O7ZA 3LMGA 2RFNA 3BQCA 4BZDA 4C4FA 1SVEA 1JKSA 5DR2A 3VAPA 2J9MA 4LRKA 2E9OA 5AV4A 4L43A 1UU7A 3QRJA 2HENA 3NUYA 3TZMA 4XH6A 2UZNA 1KE8A 3BKBA 3DK7A 4IAAA 5DWRA 5TKDA 3MA6A 1I44A 1CKPA 3BHUA 4X2JA 2C47A 4ZS4A 4IBMA 4ZEGA 4PL5A 3F88A 1PYEA 4EK3A 3FLNC 2BFYA 4BTMA 2FGIA 3AC4A 4DC2A 2YM6A 4CMUA 1JSVA 1KWPA 3QUPA 2W0JA 4DF3A 3QUDA 3EH9A 4N6ZA 3A7GA 3VS1A 4O0RA 3ORMA 4YPSA 1H27A 4E20A 3BV3A 3DS6A 4YNEA 3JXWA 3QRIA 4IAFA 4JX3A 3GCVA 3LFBA 3PXRA 4EOMA 3UG2A 3SGCA 5IKWA 2UW4A 3CKXA 4EWQA 4DTKA 2VTAA 4D4VA 4NUSA 4UX9A 3HMIA 2ZB1A 2BRMA 1FVVA 3W2PA 2YWVA 3LJ1A 4XNEA 2BVAA 4JR3A 5AUTA 4L01A 2C0IA 3LXLA 1Y6BA 1H24A 4QP9A 4YJTA 4AGUA 4LGGA 4RRVA 5HIEA 5K5NA 3C0HA 2IVTA 2QR8A 4W8EA 4E5AX 1OUYA 3LW0A 2PMOX 5CEMA 4C4HA 1OIQA 2J2IB 4GFMA 5DYJA 2EUFB 3DGKA 3VUGA 2XMYA 5JQ8A 2YWPA 4M14A 3HEGA 4Y85A 3DT1A 4ZZOA 3R63A 3HAVA 2WMVA 2DYLA 2JIUA 1YWVA 4W9WA 4TWNA 5HKMA 1KUTA 5EQYA 1APME 4ARKA 3KU2A 1NVRA 1PMEA 1A9UA 3QHRA 4S31A 5H8EA 5CU6A 1J7UA 1GIIA 3JVRA 3QTXA 4FODA 5E8YA 2WB8A 2XKFA 2AC5A 4GKIA 3O23A 2BDFA 5IQCA 2J90A 4DCAA 1OL6A 5BUIA 2WTCA 2IZUA 5KZ0A 2OU7A 5KHWA 4FK3A 4DEBA 4FIJA 2J0JA 2GDOA 4W4XA 4L68A 2QOKA 3MWUA 3RTPA 4L67A 5CY3A 3AC3A 2JLDA 4GIIA 3QTUA 3QBNA 4FKIA 3VUKA 4FKLA 3BEAA 4IACA 5J7BA 2C0OA 3UO4A 4AZVA 4MXAA 1NA7A 2WTIA 4XS2A 4NM0A 3C4FA 2Y4IC 2YLEA 3P86A 3OMVA 2XK9A 3KMMA 3MSSA 4HYIA 4K11A 3RALA 3E3BX 4RWJA 1LR4A 1OL5A 3WI6A 5EOLA 3S00A 3PRFA 2HWOA 3D7ZA 2GFSA 4DBNA 2O2UA 4PV0A 5LCKA 4MX9A 3BHTA 4ZSGA 1YXSA 5DA3A 5HG5A 4CZTA 3KK9A 4WRSA 2VTLA 1UKIA 4BDGA 4Q9ZA 4QT1A 1CKJA 2CLXA 3WARA 2QLUA 1GJOA 1JVPP 3VUDA 4YTHA 3P5KA 4ZAUA 3P78A 4JDKA 5CU2A 1UKHA 4IAKA 4ZZNA 2C0TA 2JIVA 3P0MA 4X6RA 4K77A 4FK6A 4BDFA 3RAHA 4KS8A 4IXPA 3VS6A 5L3AA 4FICA 4K18A 1URWA 2PZPA 3V8WA 2JDVA 1VZOA 5CNOA 3G33A 2VAGA 3V04A 5DLSA 2P55A 4HGEA 5M4IA 2BKZA 3A7HA 2B53A 3FDNA 3MY0A 1NXKA 4U0IA 2BMCA 3CPBA 2EXEA 5E8SA 5I9UA 3SAYA 5E8XA 3RM7A 2QONA 2FSTX 4IB0A 2FYSA 1JWHA 3LCKA 3BWJA 4J1RA 3PDTA 3FAAA 3ZFYA 2KULA 4DYMA 2NPQA 4QMZA 3U6IA 3EQFA 3MV5A 5FTOA 4DHFA 1BMKA 2E2BA 5I9XA 3VS4A 3E8NA 4ZTQA 3R1NA 4FV8A 4FTTA 3ZDUA 3I4BA 4NJ3A 4DE4A 4KS7A 4ZLYA 4D1XA 4RA4A 3DBCA 5DMZA 2OO8X 3FZOA 2UZBA 3IOKA 3Q9WA 2C6TA 4FSYA 4JT3A 1OKWA 3RHXA 2B9FA 4HVGA 5A46A 4F9CA 3LFSA 4IJPA 4X3FA 2IVSA 1Q61A 2X2KA 3QX4A 3R04A 5CASA 3SG8A 3BPRA 3BQRA 2XIXA 3UPZA 2ZJWA 4IWQA 3ZM9A 1XH8A 4UWYA 5HU9A 3UDBA 3CE3A 3KCFA 3NW6A 3LFQA 3DKCA 3LAUA 4JVGA 4N6YA 5GZ8A 2VWXA 3IECA 5K9IA 4U80A 3VUHA 3I6UA 2WOUA 3KK8A 1RW8A 3C4XA 3II5A 4HVHA 5FTGA 3OCGA 5F95A 2ZDUA 3DJ7A 4BFMA 3C13A 4DG3E 4ZJIA 4XG7A 4XP2A 3TIZA 4DEDA 4TXCA 4EOPA 2CGXA 3RAIA 3R1QA 3NZ0A 4G3EA 3ZEWA 4NFMA 4CSVA 4BZOA 3OF0A 4PP9A 2YHVA 4EH8A 4G34A 3ID6C 2JIIA 2V7AA 2Z8CA 3TM0A 2BAQA 2QCSA 2E9NA 1KV1A 4OUCA 1FINA 3ALOA 2Y0AA 3CD3A 3CY2A 4FSMA 4MH7A 1OPKA 1QMZA 1UU8A 3MVMA 4NWMA 4XUFA 5JSMA 4EK4A 1H00A 4NH1A 4AN2A 4H36A 4F6SA 2YABA 1YDRE 2ZYBA 1ZY5A 1OITA 1YXUA 4Z9LA 4O84A 4FGRA 4GUBA 4MEDA 3IDBA 4TNDA 1KE6A 4FOCA 1IEPA 4E6QA 2X8DA 3GBZA 1H28A 4MVFA 2CLQA 4FT9A 4YU2A 4BY9E 4ITJA 4NKAA 3O7LB 4O86A 4I0RA 1OBGA 3LKMA 4M0YA 2C3IB 3DK3A 5CT0A 5FEEA 2QVSE 4O0WA 4D1SA 3MVJA 3IS5A 2JKOA 2R0UA 3CP9A 4DFBA 2WELA 4I22A 4PMTA 2Y6MA 4H1MA 3U87A 1CM8A 3PPKA 4IH8A 2QOFA 2CN8A 2UVXA 3PXYA 3U9CA 1U4DA 4ALWA 4U41A 4I5MA 3F7ZA 2C5XA 2WMRA 4XG4A 5L8JA 3CSVA 4O27B 3HMNA 4LGDA 4AFJA 4C33A 5IZFA 3KRRA 2OFUA 3DB8A 5CSVA 5J79A 1MRVA 3AC1A 3DU8A 4WNPA 1L8TA 4HGTA 4BGQA 2W5AA 3ORLA 2DQ7X 3L8XA 4PL3A 4EI4A 5IUGA 4UWBA 1UNGA 3JYAA 5FXSA 3QD3A 4FIGA 2QU6A 5EDPA 3GI3A 4FEXA 3BX5A 1Y8YA 2H96A 3ZFMA 3MJ2A 3W2OA 3O8TA 1J3HA 4XV1A 3ORTA 4FV9A 4QPAA 2G01A 4HW7A 3NYXA 5AV1A 4IIRA 5CU4A 3UIXA 4ONAA 4FZ7A 5HVYA 2XF0A 3UNKA 3ROYA 3UMWA 2SRCA 1Z57A 3MFSA 3CXWA 4DT9A 3TNQB 3COKA 4DEAA 3IK3A 4FI1A 2OJIA 1TQPA 3KXXA 4PPAA 4J8MA 4YJUA 4PRJA 4MWIA 3PYYA 1NVQA 3ANRA 3KF4A 2A4LA 2R3GA 3DLZA 4RIXA 2EB3A 2R3KA 5AX9A 4AZTA 2WZJA 2PVRA 3EQDA 4FNYA 1PHKA 5L2QA 3ZO3A 3OW4A 5FTQA 4BVUA 3R6XA 4U3YA 4CG9A 3UOHA 3JR1A 4FIIA 5GIOE 4FV4A 1ZZLA 2VX3A 3OZ6A 2ERKA 2UW7A 5HCZA 4D4SA 2A27A 4NW6A 4H58A 4WIHA 1OIUA 4AT4A 5LXMA 3EFLA 5IUIA 5L6OA 1TKIA 3AGLA 5CEOA 5C8MA 5LVLA 3NEWA 3SKCA 2G2HA 3D7TB 3QGYA 4RFMA 4A7CA 5H3QA 4DH8A 3ITZA 3RPVA 3EB0A 4JLCA 5I4NA 3NRMA 2OBJA 3U6JA 2JFMA 3QQHA 4ZXTA 3O8PA 4BCPA 3JVSA 3MPTA 2PE0A 3NVMB 4FSNA 5M4FA 1OM1A 3E93A 3K3IA 3QF9A 1RE8A 3W16A 4IX4A 1H07A 2I0HA 2VWVA 3FY0A 2C5NA 4O0VA 1YI3A 3HUBA 3TDVA 2PULA 2WTDA 4A4XA 3UIMA 4IDVA 4JG6A 2I0EA 3NGAA 3G15A 4I6FA 1OI9A 3ORNA 3BHYA 2AC3A 4GMYA 5CANA 3FMNA 4K0YA 4EC9A 4O82A 4G5PA 3BE9A 3OG7A 3S4QA 2HZ4A 2Y8OA 3ZUUA 3KA0A 3VHKA 4WG4A 4R77A 2EU9A 3ZC5A 2WTKB 4MBIA 4RVKA 1J7IA 3FHIA 4L7SA 4N70A 4DFLA 4ACCA 1JBPE 4O21A 5JK3A 3F61A 4L42A 5AP4A 5LVNA 2GCDA 1TVOA 1K2PA 3RINA 2WQMA 4GV1A 5KBQA 3Q32A 2ESMA 4YZ9A 4BIBA 3R8LA 1BI7A 3N51A 4HZSA 3SOAA 4CFFA 3OHTA 4OLIA 4BHNA 4FE2A 4I41A 5KMLA 5AIRA 1M52A 2W5BA 3BI6A 1Q97A 2RFSA 3DFAA 4XG2A 2GHLA 1FMKA 4XG3A 5IQGA 2R7IA 3TKUA 3R2YA 5LMBA 5CQWA 3NNUA 4Z16A 4II5A 4EOLA 2JDTA 4APCA 3PY0A 1IA9A 1KE7A 2VTJA 2OSCA 2VWBA 5H9BA 2WTVA 3R02A 2PSQA 4GT5A 5A4EA 1XH4A 3LJ0A 3E8CA 2VO7A 4HYUA 4MAOA 5EYMA 3CKWA 4CT1A 5K0KA 3W10A 4ZTSA 5GINE 1Q62A 5HGIA 2B4SB 2NRYA 4I5CA 4OTGA 3FSFA 4KD1A 4E6DA 2XYUA 4F09A 2JKQA 2YDIA 3FZPA 4BDDA 4EK5A 4ENYA 4Z55A 2BZHB 4S33A 3E62A 1YW2A 1OVEA 3HZTA 4P5QA 3SXSA 4U7ZA 3KFAA 4IADA 5AP5A 4QMPA 5CEIA 2Y7JA 3MTFA 2F2CB 3NX8A 4XRJA 4A9TA 3GQLA 5L2TA 4HCUA 1GZ8A 3EZVA 5HTCA 3F3TA 2QOCA 2IVVA 4FL3A 3LXKA 5HE0A 3AXWA 4JS8A 2PE2A 4U42A 4JQ7A 3HLLA 4X0MA 3ZLYA 4AW5A 3COHA 4HNFA 5KX8A 1ND4A 4GEOA 3P1AA 2XYNA 4PNKA 2PMIA 5B7VA 1W84A 2YZAA 3TZ9A 4MF1A 2I0YA 4RFYA 4MHAA 1QPEA 5CF5A 5AP7A 3T3VA 2WEIA 4KKHA 4OTFA 4KIPA 4OAUC 2FSMX 5CEQA 3EFWA 2AYPA 4HZRA 3WIGA 2UZVA 2ZAZA 3NUNA 4C38A 4EQCA 4EORA 5HBHA 4ZSEA 2Z7SA 3NIEA 1SVGA 3WOWA 5HICA 5HG7A 5IQDA 2OGVA 4JXFA 5IQIA 5HD4A 4HNIA 3BYUA 3NWWA 2R9SA 4IWOA 3QA0A 5DT0A 3CGFA 2YACA 5T3QA 1YOJA 2B7AA 2Q0BA 4BTKA 3F5UA 4JAIA 4YSJA 2P33A 4FYNA 5AIKA 2XRWA 4XYFA 3WZEA 3HUCA 4FMQA 5JQ5A 3H30A 5HTBA 4J52A 4RJ4A 4DH7A 3RGFA 3DBQA 3DQXA 4PUZA 2QO9A 3RNIA 5DVRA 4QMNA 4IE9A 5HOAA 1BL6A 3QTWA 5EDRA 3GQIA 3PY1A 5L8KA 2GQGA 3R9OA 1IR3A 3DCVA 4JBPA 5DT4A 2GHMA 4C61A 2JDSA 2YJRA 4JNWA 5L2WA 1JKTA 4FA2A 5IH6A 5FM2A 3H9RA 3ZUTA 4YHFA 3IGOA 3R8VA 4DH3A 3PA3A 2QODA 3WILA 4F7SA 2PVFA 2IW8A 3LCTA 3TCPA 3QL8A 3D2IA 3RJCA 5HQ0A 3ZRKA 3GUBA 4E4XA 3NNVA 5E9EA 3DJ5A 4I1ZA 4ID7A 2XJ0A 3A60A 5DT3A 4L6QA 5J5SA 1GOLA 4FTUA 4QPSA 5ANGA 2HK5A 2FA2A 3FLWA 3UTOA 4W4YA 5DEYA 2UW0A 5HO8A 2GNLA 2OXXA 4P5ZA 3MH2A 4WG3A 3FLZA 3BGQA 1Y6AA 4TTHB 3QTSA 2BRGA 4IAZA 1DM2A 5EG3A 2W4OA 4DFNA 1WBPA 3BLHA 4AXAA 4MXOA 1KV2A 4WUAA 4AP7A 4QMVA 3QGWA 3QFVA 4YZBA 3GU6A 4CZUA 3V01A 2HZIA 5ANIA 3RPRA 3V5LA 4FEUA 3L9NA 1PXPA 5KMIA 3Q6WA 4O22A 4FKPA 5AV2A 4F70A 4EONA 5HD7A 4I3ZA 1IAHA 1ZYJA 3C5UA 1OPJA 2G2IA 5CNNA 4LL5A 5FP5A 1GIJA 3I60A 2UZDA 2ITOA 3W2RA 3DXQA 4UZDA 4OTHA 3MB7A 4R78A 4FBXA 2Y4IB 3EL7A 4GVJA 4FUYA 4IWPA 3SG9A 5M09A 3IO7A 4RPVA 4PF4A 2OLCA 3PIXA 4BI0A 1F0QA 4KRDA 5CX9A 4IZ7A 4M15A 3SV0A 5M4UA 1YHSA 2A2AA 5F4NA 4O7WA 4XG6A 4FSZA 3H0ZA 4ZK5A 3Q4ZA 3UZTA 4BCJA 2BTRA 3MA3A 4L46A 4P90A 3VS3A 3AG9A 5CSWA 3KRJA 2BZIB 3MVLA 1E9HA 4BKYA 2F7EE 3DAEA 3OWKA 4J53A 4U40A 3NMUF 5H2UA 2VTSA 1MRUA 4QMUA 1NW1A 4FV6A 2C6IA 4XG9A 2O0UA 3AOXA 3O51A 4YJVA 3RZBA 4QMQA 2PPQA 3QYZA 4RMZA 1BYGA 4M69A 4AUAA 4D5KA 1UU3A 3DTWA 5C27A 3QKKA 2Z7QA 3E63A 5EI2A 5EM5A 4GIHA 4CFWA 4HYHA 4C4GA 1F3MC 2VRXA 4TYEA 1W83A 2B54A 4G5JA 3EIDA 3S0OA 3ZBXA 3FMEA 4BDKA 4AZEA 3R71A 4O0TA 4D2SA 4EL9A 5FWKK 1G5SA 4WBBB 3EN9A 1V1KA 3RHKA 2YEXA 4FZAB 3QQUA 1NVSA 3BU6A 2V62A 2IZRA 4JIKA 4M0ZA 3ORXA 5BVNA 2C5VA 3G90X 4TKSA 3R7IA 1RJBA 1XH5A 4IDTA 1QPJA 5AP2A 3EKKA 4FKWA 2FB8A 2UVYA 1H1WA 3ZONA 2R3QA 2BKKA 2GNJA 3ZC6A 2W1HA 3OFMA 5AR8A 4B4LA 5AR2A 2VUWA 3QKMA 3O50A 3KY2A 3R7GA 3FL5A 4AFEA 2QO2A 2W7XA 3IOPA 4E6AA 5JEBA 5FBNC 3ZO1A 4AQCA 3A7JA 2PUNA 1SZMA 4EK6A 4WNKA 4RJ8A 4KIKB 5CXZA 3OROA 3LXPA 5GJFA 2H34A 2JKMA 3P08A 3FI8A 1BX6A 4GJ2A 2QOIA 3HV6A 4IW0A 3EJ1A 4JDHA 5JGDA 3RCJA 3LIJA 1JOWB 3QWJA 2R3MA 4FTJA 3ZHPC 4CFNA 4F1OA 4RC2A 5M06A 4CYJA 5M57A 5C9CA 1BI8A 4XJ0A 2PY3A 3NIZA 4JRVA 3PA5A 5BMMA 5KMOA 4R3CA 5LWMA 3TIYA 1RDQE 4ASXA 4BI2A 3DXNA 3F2RA 3RK9A 3UVPA 3PVWA 1M7NA 4KSQA 4L53A 4QMLA 3PPJA 2VN9A 4OTIA 4J96A 4EOOA 3DOGA 3QTRA 3Q6UA 4R5SA 4FKSA 3UO6A 4ZLZA 5IEYA 4G3GA 3SW7A 4TW9A 2Z60A 3A99A 3F6XA 4N57A 2VTQA 4BWKA 5BUEA 3C5IA 4D2WA 3UOJA 3DKFA 2JDRA 3D14A 3BYVA 5FQDC 3P4KA 3QQJA 2IW9A 4C62A 3BELA 3EFJA 3FZTA 4ZSLA 4AGCA 2X4FA 5J1VA 4LQMA 4FVPA 3TNPC 3W2QA 2UZUE 4EH9A 2UZEA 2XP2A 2PVKA 4YJPA 2OJFE 1IA8A 5T68A 4JQEA 5IQAA 5EHYA 3FKOA 1ZOHA 5IA0A 3R30A 3PFQA 2YZLA 5EI6A 2PVJA 5I5ZA 5GNKA 4BCFA 4IQ6A 3MB6A 4D9TA 2R3FA 3SD0A 4AT3A 4LL0A 4OBQA 2Z02A 3VQHA 4FX3A 4CGAA 5DN3A 3NVKI 3VF8A 4B0GA 4EKKA 4NL0A 5IA3A 4X2NA 1OIYA 5HTIA 3ZRLA 5ETCA 5BUJA 4GS6A 1R39A 4EC8A 1XBBA 4I21A 4AOJA 5E8UA 5E8WA 4ZJJA 2QOHA 4EYJA 3R9DA 3DV3A 3K54A 4BRXA 5AA8A 5ETFA 4U3ZA 4CQGA 2WMSA 3VW6A 4Z7HA 4I20A 4S2ZA 2HYYA 3Q96A 3PP1A 3O8UA 5EKOA 3U8WA 3V3VA 4CG8A 3QCXA 2PU8A 3KMWA 2ETKA 3ZO2A 4D4YA 3LCDA 2F2UA 3VS5A 2X9FA 3MTLA 4JOAA 4QPMA 2H9VA 2UVZA 5CT7A 3ZCLA 5HX6A 2BZKB 4QYEA 2WEVA 4BTJA 2ZM1A 2BRBA 4NSTA 3V8SA 2GFCA 3R21A 2R3PA 4UZHA 4EH6A 3BHHA 3DAJA 4DEGA 4MD8E 3C4WA 3GP0A 3UQGA 2CN5A 2XK7A 4XX9A 4C8BA 2JBPA 3ORIA 2XBJA 5J9LA 3FWQA 5CXHA 4YTIA 4LRMA 3OEZA 5KMJA 3MDYA 3MN3A 3MVHA 3Q5ZA 4B99A 4QQTA 4HCTA 2O64A 3QC4A 4ITHA 4BKZA 1UA2A 3DZQA 1LEWA 5GJGA 3RWQA 3EYGA 4MBJA 2PZRA 3HMPA 4GH2A 3VS2A 4WNOA 2BDWA 3MBLA 3R2BA 3TNIA 2DS1A 4XCUA 4ANQA 1ZY4A 2YM5A 3TJDA 4QP6A 4NW5A 3DB6A 5CU3A 3H10A 3VBWA 5BVDA 3GVUA 2XKEA 3WYXA 4TWOA 3F5PA 3K5VA 1VYWA 4FZ6A 4H3QA 3VUMA 3RAWA 2YM4A 4GU9A 2HXQA 5LMAA 5E7RA 5CWZA 3LQ5A 2XVDA 1YRPA 5LQFA 5IA2A 2ITTA 2QG7A 4BCNA 5BMSA 1XWSA 2HW7A 3MJ1A 5D1JA 3EWHA 1G8SA 4FSQA 4O0XA 2QOOA 2F57A 4YJOA 3EQRA 3R7VA 5BNJA 4UMQA 2YCQA 3E5AA 4ASZA 3FMMA 3I5ZA 4FEWA 1IASA 1OMWA 3FLYA 3NS9A 3WF5A 4ANBA 4DLIA 4RJ5A 4A4LA 2RF9A 4QYFA 4FV2A 3LHJA 2O5KA 4F7NA 4EOSA 1MP8A 4I4EA 3A61A 4KABA 1SNUA 3E87A 3EZRA 2XNMA 4HCVA 4O6EA 4EZ5A 2VWZA 2C6KA 3BYOA 4RLKA 3FXZA 4KRCA 2GSFA 1ZAOA 4G3CA 4RIOA 4FT3A 2GPHA 3EN7A 3UP7A 1DAWA 4IX6A 2NNWB 2C69A 2YJSA 4AOTA 4CD0A 2VTOA 3DTCA 4RG0A 4GK4A 4IANA 3ZH8A 1B38A 1OKYA 3FL4A 4OTDA 5HCYA 4HVIA 2ONLA 2RSVA 3A8XA 3WF7A 4M97A 4WSYA 2WD1A 4ZP5A 5FXQA 2PHKA 2VTIA 2VU3A 2XJ2A 3PSBA 5EM7A 5LARA 3RPSA 3TTIA 3U54A 2J5FA 3C50A 4FTLA 4YJSA 4GFGA 3RM6A 5D11A 4ZY6A 4WSQA 4CYIA 3BYMA 4RX8A 2QD9A 2WMAA 2QG5A 5E1EA 2J0MB 3PRIA 2ZDTA 3GCQA 4DEIA 4X3JA 4Y72A 2X81A 2HWPA 3K5UA 4I23A 4XBUA 5CAVA 2VX1A 1PXJA 4F1TA 4FNXA 3ZLWA 2WNTA 1ZYSA 3AMYA 5HBEA 3ZZWA 5BYYA 2P4IA 4O7SA 3VIDA 1AGWA 3I1AA 2J51A 2VTTA 1E1XA 4PL4A 3ULIA 3VUIA 3MH0A 4QP3A 4BDAA 2UW8A 4QNYA 4EZ7A 4KKGA 2O3PA 1FVRA 3CCNA 4ZTMA 4RT7A 2DWBA 3D2KA 4FKTA 3TNWA 4BI1A 3A4OX 1YHWA 4BIDA 4M67A 3EKNA 5BPYA 4NM5A 3PVUA 2HAKA 1GZOA 4PQNA 4WBOA 2W99B 5D41A 3JY0A 4NEUA 5J1WA 1KOAA 2ZB0A 4I5HA 1SNXA 3PWYA 3PSDA 3PSCA 2CPKE 2J0LA 4XG8A 3QQFA 2IG7A 4BIEA 4YSMA 2YLFA 4NCTC 4C3PA 4BR3A 4CCBA 3PIYA 4CFXA 5HG9A 4FTMA 2ITQA 4KWPA 4QMWA 3VWAA 3FI2A 4EOIA 3V5TA 4XBRA 4J98A 2C1AA 5ANEA 3EOCA 1LPUA 1GAGA 4ZS0A 3H9FA 5EK7A 4C2WA 2PE1A 5IDPA 3Q04A 4RX9A 2BDJA 4U44A 3ZMMA 4O1OA 4NKSA 4BDCA 1W0XC 3I6WA 2IW6A 3PA4A 3ZZEA 5HO6A 3Q4TA 1CKIA 1WCCA 1ZARA 1HCLA 4O91A 1WMKA 3L9LA 4UEUA 5IISA 4O0UA 3ZXTA 4FT7A 1PW2A 5HLPA 3D5UA 5L4QA 2R2PA 5IH4A 2JKKA 2IPXA 3H3CA 5A4CA 4F7LA 2IZSA 4TYGA 3QYWA 4KBKA 4J71A 4ZSAA 3LLTA 2WU7A 1BKXA 5EOBA 3VQUA 1PF8A 3D7TA 4BN1A 4G6LA 2XB7A 4O6LA 4E93A 4F7JA 3FI4A 3LMIA 4K1BA 5TE0A 2PWLA 4LYNA 4Q2AA 3R9HA 3TACA 3TV4A 4YUQA 2UZLA 2C6EA 2WMUA 2YDJA 4F1MA 3DKGA 4G3DA 4IAIA 2PVYA 1H25A 3W32A 3R73A 4CCUA 3HP5A 4MKCA 4MK0A 4HJOA 4KINA 3NR9A 2HIWA 2OJ9A 4MD9E 4NM3A 2PVMA 5EFQA 4DCEA 4Y95A 3CTHA 4DBXA 3Q9XA 1PRYA 3L8PA 1MUOA 4AW2A 3ALNA 4BDIA 2WU6A 4F9YA 4NJDA 2P2HA 5AX3A 4EOJA 1WBSA 1REKA 2VGPA 4V0GB 3ACJA 5AR3A 4ENXA 4H3BA 4I93A 2VWIA 3BIZA 4RWLA 3FQSA 5CSXA 4EOKA 4ZJVA 4ITIA 3GC7A 3ZBFA 4DGNA 4R7IA 4C37A 4I24A 3ZLSA 1FQ1B 2X4ZA 4D2VA 4O38A 4QP1A 4A9YA 4OTWA 2ZV2A 3HRCA 1YOMA 3FBVA 4GYGA 3VBYA 3ZLXA 5HEZA 3VBXA 4UB7A 4MNEB 5IA1A 3ZXZA 2GNFA 4I94A 4BCGA 5LMKC 1ZOGA 4ERKA 4CVAA 3HX4A 3POOA 4P4CA 3I0OA 4GCJA 3SOCA 3TWJA 3ZUVA 2XKCA 2XK8A 5F20A 4AW0A 2OFVA 5ACBC 3DQWA 3W1FA 5GHVA 4EEVA 4B8MA 3FE3A 4IVBA 2JGZA 1QL6A 3RKBA 3DPKA 2B0QA 4AN9A 3UYSA 5I9YA 1YDSE 2W1DA 4L52A 4QNAA 2YN8A 2R5TA 5KBRA 4DLJA 2W1GA 4K33A 1H4LA 3EQPA 5C4LA 3IW5A 1Y8GA 1H01A 5DGZA 3W33A 3JS2A 2BFXA 4EHZA 5I0BA 1Z9XA 2YISA 3WZKA 5CAPA 2J50A 4AA0A 4TN6A 4FSTA 4ZTRA 2X1NA 1WVXA 3VBQA 3UOKA 4Z3VA 1P4FA 1OECA 4NTSA 5AAEA 4WUNA 5DRDA 1J1CA 2XUUA 4DAWA 2HOGA 4I0TA 4O2PA 3UVQA 3GFWA 1ZYLA 3R9NA 1OKVA 3W55A 3VC4A 3A4PA 3HV7A 3BGPA 3QD2B 3BBWA 4GUEA 4U97A 3EHAA 3O17A 4G1WA 3NDMA 5C8KA 2EXMA 4MQ2A 4RJ3A 4PDYA 3TEIA 1DAYA 2W17A 4QMTA 3KXHA 3RNYA 3DBEA 4C02A 2CNUA 5JH6A 3PE2A 3M42A 3R01A 5HVKA 4FVRA 3N9XA 4G16A 4IB3A 4F9BA 3D5XA 2VTPA 3PXKA 4PY1A 3AT2A 4O7TA 3GCPA 1OL2A 1H08A 3BRBA 4AAAA 3DBFA 4EUTA 4KIQA 3R7UA 2PUIA 2CGUA 1YXVA 5E8VA 3V51A 3WE8A 3QU0A 3LQ3A 2GNGA 2ITNA 2XK6A 1Q5KA 3PZHA 4AZFA 1NT2A 3U55A 1VYZA 3OWLA 3QRTA 1YHVA 3V8TA 3SXFA 3G51A 4BCKA 3FPQA 4E8AA 5FEDA 2GNIA 1UNLA 5CSHA 3TJCA 3DJ6A 4FKOA 1J1BA 1ZZ2A 2X8EA 3W18A 3HMMA 5ETAA 3GFEA 2FO0A 2YCFA 3HNGA 3QALE 3VS7A 5EM6A 3FMHA 3R1YA 2BRHA 3HP2A 2F7ZE 2WKMA 2E9UA 4Y8DA 2GNHA 3ZSGA 4NM7A 4DINA 4IX3A 4OT5A 3KQ7A 1M7QA 3JY9A 4YBJA 3SC1A 3SQQA 4ORKA 4FIHA 4RQVA 3MYGA 3P9JA 4B8LA 4E5BA 5F94A 3POZA 4BZNA 4AZSA 1QCFA 1PXKA 1Y57A 4BHZA 1Q4LA 4FUXA 5DH3A 1F5QA 1WZYA 2B9IA 2EWAA 2YAAA 4GK3A 5J5TA 5FDPA 5EQEA 5AR5A 2ERZE 2BILB 1OKZA 4MWHA 5E90A 4GK2A 5JFVA 4ANMA 4F4PA 4DGOA 2GTNA 3F82A 3TZ8A 2YIRA 3NYVA 5CAUA 3ZM4A 3LE6A 3HRFA 4QMXA 2F9GA 2ITPA 3NLBA 4K2RA 3ZS5A 4CNHA 4CRLA 4TL0A 2I0VA 4IB5A 3LPBA 2UW9A 5HI2A 5LOHA 5IUHA 5IF1A 3QUEA 1PXIA 3QQLA 4QYGA 1ATPE 2ITWA 1Y91A 1K9AA 2WFYA 4HYSA 3VS0A 3B2WA 3GU8A 3MY5A 4GU6A 1YQJA 4RZVA 3VNTA 3P7AA 2G2FA 3ZTXA 4BCHA 4BWPA 3LVPA 2OK1A 2UUEA 1PKDA 4RZWA 5CS6A 5CAOA 3WZDA 3QTZA 3OEFX 4I0SA 4TYJA 4USEA 4M12A 3QD4A 4DEHA 4DG2E 4PTCA 5BVEA 4YURA 3HRBA 4JI9A 4O7RA 2RGPA 3EQBA 3F5GA 4F99A 3D4QA 1OZ1A 4X3FC 4YBKA 4RGJA 4YHJA 2ETMA 4A9UA 1OPLA 3COMA 4IJ9A 1H1QA 5HIBA 3MPAA 4L00A 3OT8A 4F63A 2CHLA 3F3UA 2IJMA 2W9ZB 4B7TA 1WFCA 4YHTA 3NUAA 4B6LA 2GHGA 1PXMA 1SMHA 2XIKA 4IZAA 3QX2A 1DI9A 1FVTA 3BU3A 3M1SA 2ETRA 3KULB 3OTUA 2GS2A 2ZM3A 2CKQA 4UY9A 2YITA 4K6ZA 4DGLC 1PMVA 2QHNA 5BVKA 2XEYA 5H8GA 4YZNA 3CTQA 3G2FA 3QCYA 4AOIA 4EKLA 3OD6X 3ET7A 2XNBA 1M2RA 2ITYA 2RL5A 4QTDA 3ODZX 4RVTA 1AQ1A 3P7BA 4CLIA 2VO6A 2R3JA 5K4IA 4ZMFA 3LFNA 4L7FA 4RWKA 3WF8A 1WBTA 3T9TA 5CALA 1PY5A 1XR1A 2WGJA 3Q3BA 4IAYA 2W05A 2XK4A 5AAFA 3CY3A 4ERWA 3TUBA 1DI8A 5HBJA 2IVUA 3TTJA 1A06A 2UW5A 5KMNA 2VTNA 5C8NA 1WBOA 5HU3A 2C6MA 5AUUA 2NRUA 2Z2WA 4E4MA 5K5XA 3RCDA 3DDQA 3HL7A 3NUPA 3QXPA 5EDQA 4BCMA 4C0TA 4O83A 4E73A 3PVGA 5ITAA 4TT7A 2UW3A 5H8BA 3QAME 2VO3A 2VWWA 3DFCB 3EYHA 4RJ7A 2WPAA 2WMTA 3PLAE 4M66A 4LG4A 3ZFXA 5CAQA 2GQSA 4TYHB 3M2WA 3WIKA 3VF9A 5LVPA 2LGCA 3ROCA 1LP4A 4DH1A 4G6OA 4YJNA 3RK7A 2VTRA 2XCHA 3I79A 2HXLA 3AD6A 3ANQA 5ANOA 4UMUA 3KCKA 5LVMA 5JFSA 4IC7A 1O6LA 4HVDA 3U4WA 5BX0A 4BCQA 3E8DA 4BBMA 4KIKA 2OXDA 3Q60A 3RK5A 3FV8A 5FG8A 4G17A 5KKRC 4FTOA 3LXNA 4X7QA 4AU8A 4LFIA 1VR2A 3GC8A 3Q2MA 5HNBA 4IC8A 4FKUA 5LVOA 4L3PA 3PJ1A 4PMSA 3H0YA 5IDNA 3TUCA 2F7XE 1XKKA 4LUEA 3CPCA 4K8AA 4UALA 2ACXA 2OH0E 4XV9A 5I9WA 2ZM4A 5FDXA 3A62A 3UC3A 5EM8A 3DA6A 1WVYA 3ZYAA 4CKIA 3CBLA 4JBVA 4FKRA 3R8MA 2UW6A 4EJ7A 2Q0NA 5AV3A 2W1EA 3OC1A 1PYXA 2FSLX 3DDPA 3JUHA 5CEPA 2BZJA 2G9XA 2YM3A 4D1ZA 4GW8A 2HELA 3CIKA 2YM8A 4RC3A 2VD5A 4L45A 2PUUA 2GMXA 3AT3A 4I92A 4AT5A 4BGHA 3NAXA 3PP0A 5IQHA 2C5OA 1EH4A 3LFAA 3RP9A 1Q99A 2FH9A 4XP3A 5A4LA 2X7OA 3BE2A 2OZAB 4H05A 2B9JA 4CXAA 3V6RA 5LJJA 3UZRA 2B1PA 3EQHA 3FXXA 5AV0A 4D0WA 3AGMA 3O71A 3HGKA 4KA3A 3ATSA 3G6GA 5D7AA 4TWPA 3PY3A 2R3LA 3W2CA 3DK6A 3CQUA 3OT3A 5FXRA 5FUTA 3A2CA 4PDOA 4QP8A 4F6WA 5HLNA 3PPZA 3C51A 4G9CA 3PXQA 5IU2A 4ANOA 3OBGA 4FNZA 2J4ZA 4GT3A 5HHWA 4X21A 4UMRA 3N4VA 1GZKA 2BALA 2W5HA 5DE2A 5FP6A 4AG8A 4BB4A 3GEQA 4CTBA 4AS0A 5G1XA 4C4EA 4IZYA 4R7HA 4WRGA 4EH2A 1L3RE 2CGVA 4YGAA 3BU5A 3LMHA 4TY1A 1JKKA 2PTKA 4YNOA 2B55A 3OVVA 3GC0A 2OZOA 4USDA 3Q5IA 2QR7A 4L8MA 4CMTA 4E4LA 4HGSA 5AP3A 3F3ZA 3VUTA 4FVQA 5HE1A 2YDKA 1MQ4A 3U6HA 4EH5A 5EYKA 4V05A 5IA5A 3VBVA 1U54B 4QP4A 5JZJA 4FIFA 4RA5A 2R3RA 3PG3A 4OGRA 3F9NA 3VRZA 3CEKA 3FMJA 3Q53A 3THBA 1OIRA 2R3IA 3O96A 2W4JA 4LOOA 3NYOA 2VNWA 3QZFA 4BF2A 4MXYA 2YCSA 3EL8A 4PWNA 5CI7A 4BBEA 4QTCA 4D0XA 4G9RA 3VBTA 3PG1A 4FG8A 4GYIA 5ANJA 3V5PA 5A4TA 4W8DA 4KNBA 1XBCA 3R8PA 4FKQA 1FGKA 2ZMCA 4R3RA 2Q83A 4O0SA 3QQGA 4AE9A 2OG8A 3BYSA 4C59A 2QLQA 2REIA 4UN0C 3HYHA 5JFXA 3MS9A 3BEGA 4PDSA 4LGHA 1FMOE 1ZLTA 2OF2A 3CQWA 3MFUA 2OIQA 4UWCA 3V5WA 5JKGA 3EMGA 4LUDA 3HECA 3LFDA 4DTBA 1FGIA 4ACGA 5JRSA 3HDMA 5AP1A 4F65A 1MRYA 3V6SA 1M14A 4FSWA 4CV8A 4O7VA 1G3NA 4GL9A 2OH4A 3SA0A 3UVRA 3I7BA 1GZNA 4D28A 1AD5A 2JBOA 2RG6A 4F0FA 1FPUA 5JN2A 5C03A 2W96B 3ACKA 2W1ZA 2OWBA 2YFXA 4WOVA 5IG1A 1Z5MA 4FZDB 4G31A 1Q3DA 2WMQA 1X8BA 3KVWA 3TKIA 4ALVA 4C7TA 4U81A 1LEZA 4K9YA 4AF3A 1FOTA 4O2ZA 2A1AB 4BYJA 4DFXE 3C0GA 2HY81 3OUNB 3ORPA 3FZSA 5KCVA 4FKVA 4RIYB 5J87A 4FOBA 1BLXA 2WMBA 3TNHA 2QC6A 2QKRA 2R7BA 3G6HA 3I7CA 3PVBA 4FTIA 4W4WA 2BAJA 3BV2A 2GU8A 3UYTA 1W7HA 3OXZA 5E4HA 4C36A 5KO1A 4ZLOA 5CVHA 2VNYA 3BLQA 3BWFA 3OBJA 2OIDA 4KUJA 4Y83A 4M68A 1HCKA 2BIKB 2VZ6A 5HORA 1O9UA 5D12A 3FY2A 3BCEA 1YWNA 4BDJA 4DT8A 4BICA 2C6DA 4QMMA 5JRQA 4FL2A 2IN6A 2WQOA 4MBLA 2ITZA 5IMXA 3QLFA 3QZGA 3MGYA 4OTRA 3CQEA 2ITUA 1JPAA 3MFTA 2E9PA 4LMUA 2G15A 3QTIA 4CKRA 5HNIX 4DITA 3HV5A 5KZIA 4EJNA 3UMXA 4Q5EA 1JLUE 4EK8A 5IA4A 2RG5A 4I6QA 1ZWSA 1U59A 3UGCA 4IM2A 1XHAA 2YERA 3QCQA 4OW8A 4RIWB 3SRVB 4I6HA 4ZSJA 1J7LA 5G6VA 3UODA 3AC2A 3U4UA 2Y4PA 3C0IA 4NIFB 1DS5A 3VJNA 4NZWB 4EOQA 2X7GA 3N4TA 4BWXA 3FMLA 5L6WL 3UE4A 4TZRA 4LV5A 3CC6A 1NY3A 3BBTB 4WO5A 1ZYDA 2WQNA 2XNNA 4ZTLA 4AZWA 3ZO4A 2OKRA 3CR0A 4CMOA 3AMAA 5BVFA 1OL1A 3OWPA 1R0EA 2C30A 2V5QA 3IW4A 5M51A 2JFLA 3FUPA 2CCHA 3QZIA 2UZOA 1PXLA 3G9LX 4OTPA 3HKOA 4RSSA 3SHEA 4JQ8A 4PTGA 3ZDIA 3CGOA 3E7VA 3GGFA 4H1JA 4XOYA 1XO2B 4G3FA 3RPOA 2W4KA 1URCA 4CT2A 2V22A 2QKWB 4M3QA 4F08A 2GTMA 4MD7E 4U6RA 4S32A 4Y46A 5HZNA 1JQHA 2X9EA 4R3PA 5IH5A 4U9AA 1V0PA 2OI4X 4O0YA 4JX7A 4CEGA 2RFEA 4QP2A 4FEVA 3F3VA 1IG1A 3VRYA 4E3CA 3PZEA 2CKOA 2ZOQA 1B6CB 3FYKX 4FTCA 2WIPA 3C9WA 1IAJA 4EQUA 4FV5A 4BC6A 3QCSA 4WG5A 4EBVA 3N4UA 3FYJX 4JIAA 3OY3A 1Q8ZA 2I6LA 3UJGA 4EH4A 1JNKA 5CF8A 2YM7A 4NYEA 3FKLA 3UIBA 5AUXA 4E26A 4W9XA 2P2IA 3PWDA 4OBPA 2QHMA 1LUFA 3QXOA 4QOXA 4O7YA 4M13A 3ZU7A 2X7FA 4ACMA 1U5RA 2GS7A 4ZIMA 4C34A 4XLIA 1A48A 4QQJA 3FZ1A 4DGMA 4E4NA 2BAKA 1BUHA 2X8IA 3G9NA 2CMWA 2JDOA 4FNWA 4X6QC 3KN5A 4J99A 3UBDA 4KAOA 3CJGA 5AM6A 1W82A 3F3WA 4BTFA 1SVHA 2EXCX 4MXZA 4IWDA 3UIUA 5HO7A 4NU1A 3D94A 3REPA 2QOQA 3Q4CA 2CKEA 2W1CA 3E3PA 3O7LD 2EVAA 4EYMA 4XP0A 3CLYA 4APPA 2XNEA 3KF7A 3PXZA 1JKLA 3AMBA 1YDTE 3RBWA 4QQ5A 3UOLA 3QHWA 2CSNA 5CQUA 3FSKA 2XA4A 4U45A 1V0BA 4D2PA 4GVAA 3NUXA 2XIRA 3B2TA 3NNXA 3E64A 3E7OA 3FMDA 4FG7A 2VGOA 4XV3A 5ETIA 3HVCA 4P2KA 3GENA 3ORKA 3UZPA 1O6KA 4RX5A 3ODYX 5BQ0A 1ZMVA 3QZHA 3LOKA 4FF8A 3WF6A 4FV3A 1IRKA 3BHVA 3LJ2A 4HGLA 1I09A 2OXYA 1PMNA 4HPUE 4XOZA 1SM2A 2BROA 5DOSA 4RBLA 4CLJA 2JEDA 5E8ZA 4DG0E 1XH9A 1HOWA 5KHXA 2YIWA 4TWCA 3IGGA 1PJKA 3QTQA 3B8QA 2GQRA 3KN6A 4O81A 4XLVA 5FM3A 3D15A 4MXCA 4CFMA 5M4CA 4X2GA 4JG7A 1Q41A 2VWYA 2X6DA 3OXIA 2BUJA 4V0GA 4D2TA 3FC2A 1W8CA 5A54A 5HIDA 2O65A 2F4JA 2QNJA 3UPXA 5IMEA 1Q3WA 1WAKA 2UV2A 3B8RA 5CVGA 1YVJA 4ANNA 3W8QA 4UBAA 3I0QA 3O0GA 3IQ7A 4PDPA 3TXOA 3DXPA 4O1PA 3VVHA 4MNEA 1Q8TA 4WNMA 3KXNA 3MIAA 1PXNA 4EHVA 5L8LA 4J8NA 4RFZA 5TO8A 4A4OA 4FV7A 4AN3A 4YO6A 3LM0A 1ZOEA 4G2FA 5CENA 4YO4A 4I5PA 5AM7A 3SVVA 1OL7A 4LRJA 2A0CX 4GRBA 5GJDA 3ZRMA 2PK9A 4PTEA 1B39A 5E91A 3GU5A 3RVGA 3VHEA 3DBDA 1YOLA 3IPHA 4WKQA 3NPCA 2JITA 5CTPA 3MI9A 3NYNA 3GU4A 2XCKA 2PYWA 1YI4A 3GCUA 4QMSA 2C68A 3OP5A 3KGAA 5CF6A 3KMUA 1UNHA 1VEBA 4AA5A 3QRUA 3L1SA 5EYCA 1WBWA 2IZTA 4FC0A 5A14A 4X3FB 4YTFA 1R0PA 1M17A 3A8WA 4EQMA 3PXFA 1G8AA 3D5VA 3R0TA 3MESA 4QYYA 3NAYA 4NTTA 3TV7A 5HX8A 3S3IA 4RC4A 5J9YA 4R1YA 4MCVA 1H26A 5B2KA 4O7NA 5EHLA 4JJRA 2QOLA 2LAVA 2ITXA 3W2SA 3DLSA 2XIYA 2O63A 2XRUA 5HE3A 4J97A 5I3RA 5CI6A 4FYOA 1WVWA 4EH3A 5C1QB 2XM8A 1PMUA 2X39A 3M11A 4D2RA 3CJFA 4UYAA 3IW6A 3D83A 2JD5A 3T3UA 4A06A 4YC6A 3TL8A 4EBWA 4EH7A 4RX7A 4RJ6A 5I9VA 5C4KA 3C7QA 3L9MA 4IVCA 5EW9A 5KE0A 4XHKB 2X0GA 3PE1A 3KL8A 5GZ9A 5HVJA 3VULA 3ATTA 2HZNA 3MIYA 3E8EA 3MPMA 5A6OA 3HMOA 2WQBA 5CZIA 2QI8A 3R1SA 5TR6A 4A9SA 3T9IA 4NT4A 3SW4A 1CDKA 3PJ3A 3R9RA 4FL1A 4BDBA 4OAVB 1P5EA 5AUVA 4FZFB 3Q4UA 2C6LA 4AWIA 5TF9A 3WZJA 4ACHA 3MW1A 4JG8A 4KBCA 2X6EA 2BR1A 2RKUA 3DNEA 4KKEA 3I81A 3PUPA 4XMOA 5AR4A 3MY1A 5GZAA 1ZMWA 2OW3A 3ELJA 2PMNX 3R8ZA 4L3JA 3FEGA 5DG5A 4U8ZA 3TKHA 5K4JA 1H0WA 4S30A 5CLPA 1P14A 3LFFA 3PJ8A 2PL0A 5J9ZA 3AQVA 3SLSA 4U5JA 3FQEA 1XJDA 1YI6A 4YLKA 1R1WA 3TV6A 3MH3A 4PNIA 5AUYA 3D5WA 3S95A 2CGWA 2XM9A 4GT4A 4C35A
chains in the Genus database with same CATH superfamily
4YC8A 2X0OA 5BVWA 4EWHA 5CYIA 2Z7LA 4FT5A 4AW1A 4WT6A 4PPBA 4IZ5A 5EQPA 3IDCA 2GS6A 5AMNA 3EQCA 3G0EA 3C4ZA 3OY1A 2BHHA 3R22A 1KE5A 3QRKA 4LV8A 5D7VA 4E7WA 4QQCA 4UV0A 4BYIA 4UYNA 3PJCA 4YJQA 5DNRA 5KKRB 3WF9A 2WIHA 2E9VA 4ANSA 5L2SA 2YAKA 3C4CA 3GC9A 4U43A 2OF4A 4X2KA 2V0DA 2XBAA 1U46A 5CVFA 5HNGA 3WZUA 3RAKA 3HA6A 4QMOA 1UU9A 1OGYA 2HW6A 3LLAA 2ZV8A 4IVDA 5FRIA 2I7QA 4HOKA 4L3LA 5I3OA 3HAMA 2W9FB 2CCIA 2J5EA 2YIYA 4MXXA 4TYIA 5HESA 2OICA 2HZ0A 4YC3A 4TNBA 4JRNA 4FG9A 2QQ7A 5M55A 3R7EA 3GNIB 3ZSIA 1KOBA 2X2LA 3CTJA 4UXQA 4A9RA 4D58A 1JSTA 5B2LA 4PP7A 2YIXA 2PVHA 2J6MA 4P7EA 3LCOA 4CFUA 2R3HA 5CEKA 2XNGA 3FMKA 1H1RA 4MTAA 3F2AA 4KSPA 3DY7A 3G0FA 2JAMA 1CTPE 3GCSA 4YLLA 5AA9A 3OWJA 5FLFA 5EW8A 2FVDA 5DI1A 4F9AA 4ZOGA 4ANLA 2ITVA 5TOZA 4RLLA 4WHZA 1VLRA 3UQCA 4RIXB 2VWUA 3KVXA 1YXXA 4DA5A 3V5JA 4O4DA 3QLGA 4FT0A 3R7OA 4FTAA 4DEEA 5C26A 4HPTE 4EUUA 3UP2A 2WTJA 5B2MA 3KRLA 3DAKA 4ZTNA 3OXTA 5B0XA 4BCIA 5CU0A 4G6NA 1K3AA 3PTGA 2WTWA 4FV0A 4QMYA 4R5YA 4QYHA 1YXTA 3OOMA 3RPYA 4AX8A 2CNQA 1PXOA 3OOGA 2AUHA 5FBOA 4DFZE 2W06A 2VX0A 4FTRA 5DIAA 3UNZA 3RI1A 3DKOA 4I4FA 2CNVA 3IG7A 3Q2JA 4DGGA 5TT7A 5CF4A 1Q24A 2V55A 5HCXA 5M44A 2CKPA 2QO7A 2R64A 5DPVA 2VV9A 4PMPA 3NNWA 2ZVAA 4QTAA 4CV9A 3FXWA 4WA9A 3D9VA 3OW3A 5E8TA 4C2VA 3KC3A 3KULA 5DEWA 4JBOA 3R00A 5ACKA 2HCKA 1W98A 4FGBA 1Q8WA 5JFWA 5FGKA 3S2PA 2QOBA 5M07A 2I40A 4UMTA 3AD5A 3SDJA 2R3NA 5KUPA 4AXFA 4N4SA 2A19B 4RVLA 3Q9ZA 2H8HA 4E1ZA 2XK3A 5D9HA 3MFRA 3KREA 3GOPA 4BCOA 3TT0A 2R4BA 2OJGA 3DNDA 3KRWA 2PZYA 3IDPA 4MF0A 3F66A 2WXVA 3VJOA 4GKHA 1OUKA 3K2LA 4HVSA 2UZWE 3LM5A 5EH0A 2WQEA 1JAMA 5J95A 2ZMDA 1KSWA 1P4OA 3PJ2A 5AFVA 4QO9A 4S34A 5AADA 4IB1A 3TUDA 1OBDA 1S9JA 4D4RA 1RQQA 3NW7A 4FSRA 5AAGA 1WBNA 4TPTA 3NCZA 2BPMA 4FRFA 2BHEA 2F49A 3R28A 2XEZA 4R8QA 4TYHA 3GB2A 3IKAA 1WBVA 2ONLC 3HA8A 1Q8UA 3DZOA 3Q52A 2BTSA 2PMLX 1MQBA 3QD0A 1U5QA 3W8LA 4JAJA 3EN5A 5KMMA 2XNPA 4ALUA 2C4GA 4CTCA 4KIOA 2I1MA 4J95A 2H6DA 3FI3A 1M2QA 2W1IA 3LFCA 5DRBA 3K3JA 5EW3A 4LOPA 5K0XA 2PUPA 3EFKA 5BYZA 1UVRA 4FV1A 4KBAA 3FHRA 3BZ3A 4YPDA 3UQFA 3QA8A 3ORZA 5AP0A 5A6NA 5DFPA 2XNOA 4UXLA 5J8IA 3TN8A 4NFNA 4DN5A 3F7WA 3OS3A 4OTQA 1SYKA 2V7OA 5AR7A 3RMFA 2P0CA 4I6BA 2CDZA 4IHPA 2J0KA 4L44A 2B9HA 2BCJA 2C3KA 4Y5HA 4E6CA 5IEXA 1T45A 3CS9A 4IX5A 5ICPA 5IPJA 3VO3A 5IQBA 4C58A 3F2NA 4J7BA 4ZMEA 4DFYA 4FKJA 4GJ3A 3KXMA 3QKLA 5E92A 3NSZA 5KNJA 3UO5A 3FPMA 4IVAA 1H0VA 4Q9SA 2PZIA 3SX9A 4AE6A 4IFCA 5T6KA 2R3OA 3ZOSA 3ZSHA 3TG1A 3O5AA 3GXLA 3VW8A 3MH1A 5EI8A 4EZ3A 1YWRA 4XV2A 4F0GA 1ZYCA 2VTMA 1STCE 3F69A 4EHGA 4FTNA 5EHOA 2QU5A 3S1HA 4JR7A 2OZAA 2YA9A 4QD6A 5D10A 3L8SA 2YIQA 4A07A 3E92A 3HDNA 3UC4A 5AEPA 4D9UA 4LI5A 1XH7A 2JAVA 4FIEA 3WYYA 4YLJA 4LMNA 4X2FA 1O6YA 3A7IA 4O96A 4XEYA 4Y5QA 4CFVA 4GSBA 2FUMA 3QC9A 3ZEPA 4BBFA 1J91A 4QTEA 1P2AA 2C3LA 3BLRA 3ENHA 3GT8A 3R83A 2CJMA 5IQFA 2DUVA 4FR4A 4F9WA 3F5XA 2BRNA 4YTCA 4IM0A 2NO3A 2WMXA 4Y73A 3FKNA 4R6VA 4YMJA 5FD2A 4OBOA 1H1SA 2RIOA 4AACA 4UMPA 1CMKE 4YP8A 3LCSA 3OTVA 3EQIA 3CD8A 1BL7A 3Q9YA 4KB8A 5JT2A 3HV4A 2JC6A 3OCTA 1UV5A 1GY3A 3OCSA 3C4EA 3KRXA 4JBQA 5FEQA 3UNJA 2KTYA 4AA4A 4FTKA 3RZFA 2FSOX 4AGWA 3L8VA 5I9ZA 3KB7A 4BDEA 5A3XA 2HY0A 4BKJA 4C3FA 4XRLA 4MQ1A 3P5JC 4GG7A 4JDIA 4DFUA 5AJQA 2OJJA 4GG5A 5LCJA 3L9PA 2BIYA 2G1TA 5F1ZA 3R8UA 2IO6A 1U54A 2XH5A 2XIZA 1KE9A 2ZV9A 4M7IA 2XJ1A 4ASDA 3C1XA 4E5WA 3G5DA 4OT6A 4ZZMA 3BGZA 1QPDA 3U51A 1E1VA 5LWNA 4LDTA 1GNGA 1T46A 5BYLA 3GU7A 4H39A 4IEBA 4DTAA 2C1BA 5L2IA 4H3PA 4QP7A 3D0EA 4DH5A 3NUUA 1H1PA 3KXGA 4BDHA 2NP8A 4OR5A 2PZ5A 3I5NA 2PVNA 2C6OA 4R1VA 4ACDA 4EHEA 3V5QA 4C4IA 2XS0A 2XZSA 2WTKC 1XBAA 4LM5A 1PKGA 2C3JA 1JSUA 4NCTA 4V01A 3ULZA 2RFDA 4CKJA 3EN6A 1Q8YA 1ZXEA 3IW7A 3P7CA 4RVMA 1H8FA 3U9NA 5JGBA 4ZTHA 3KXZA 4R7BA 2O8YA 4V04A 3PIZA 4JL9A 5EKNA 3FZRA 4FKGA 4O7LA 3R7YA 5AP6A 1UWHA 4C57A 3LZBA 4YJRA 3P79A 3QWKA 5DHJA 1TQIA 4FEQA 5A4QA 3EN4A 2J7TA 2C5YA 3COIA 4MNFA 2WMWA 4TRLA 5C01A 2Y6OA 1OB3A 5HLWA 2PVLA 2EB2A 3EQGA 3FQHA 4BL1A 5AUZA 4USFA 3AD4A 1CSNA 3TZ7A 4D55A 5M56A 2R0IA 3TDWA 4FSUA 3NUSA 5JMSA 4ZY4A 5KMKA 5DBXA 2VTHA 2UZTA 5K3YA 4F64A 1V0OA 4M84A 2J0IA 1REJA 2W1FA 4IM3A 2QURA 4RIYA 4RWIA 3WBLA 3ENMA 3LQ8A 5JZNA 4ZY5A 3PLSA 3RWPA 3O2MA 3AC8A 1QPCA 1UWJA 1XQZA 3A7FA 3T8OA 5ANKA 2AQXA 4ASEA 3H9OA 3VN9A 4PPCA 4IMYA 3KKVA 2Z7RA 4NK9A 1GIHA 2WHBA 4PX6A 2WAJA 4AGDA 4CRSA 1M2PA 4D5HA 3ETAA 2WOTA 3FC1X 1ZRZA 1ERKA 3KEXA 5M53A 5CSPA 2IWIA 4F6UA 3OCBA 1VJYA 4PMMA 4YZCA 5AWMA 5J7HA 4MYGA 4IFGA 2XKDA 5ANDA 3TI1A 4QDEA 2P3GX 4Q5HA 1YKRA 4W4VA 1S9IA 4WD5A 1ZMUA 2B52A 4JDJA 5L6PA 3HV3A 2YCRA 4GFOA 3E88A 3P23A 4QRCA 5E1SA 5EYDA 5BVOA 4QTBA 3AT4A 3FJQE 5HG8A 1TQMA 4F0IA 5GIPE 5DR6A 3QQKA 4Z7GA 1FBNA 3UG1A 5DR9A 2ZV7A 1XH6A 3FLQA 2OIBA 3AC5A 3ERKA 5M08A 4YZMA 3LFEA 3NCGA 5HE2A 3WE4A 5JGAA 5AUWA 4LOQA 4FTQA 5CZHA 4L9IA 4RIWA 4RQKA 3SRVA 4M69B 4C3RA 4U79A 4BGGA 3JPVA 4CQEA 3FLSA 5IEVA 2WO6A 5IQEA 3OUKA 3GOKA 3H4JA 5LMKA 5A9UA 2Y9QA 5F9EA 1OGUA 4YZDA 4NIFA 3SXRA 2VO0A 4C4JA 1R78A 3IW8A 4YR8A 4CZYB 4N0SA 4M8TA 4B9DA 2X2MA 3NW5A 1R3CA 3IONA 4O7ZA 3LMGA 2RFNA 3BQCA 4BZDA 4C4FA 1SVEA 1JKSA 5DR2A 3VAPA 2J9MA 4LRKA 2E9OA 5AV4A 4L43A 1UU7A 3QRJA 2HENA 3NUYA 3TZMA 4XH6A 2UZNA 1KE8A 3BKBA 3DK7A 4IAAA 5DWRA 3PFYA 5TKDA 3MA6A 1I44A 1CKPA 3BHUA 4X2JA 2C47A 4ZS4A 4IBMA 4ZEGA 4PL5A 3F88A 1W2DA 1PYEA 4EK3A 3FLNC 2BFYA 4BTMA 2FGIA 3AC4A 4DC2A 2YM6A 4CMUA 1JSVA 1KWPA 3QUPA 2W0JA 4DF3A 3QUDA 3EH9A 4N6ZA 3A7GA 3VS1A 4O0RA 3ORMA 4YPSA 1H27A 4E20A 3BV3A 3DS6A 4YNEA 3JXWA 3QRIA 4IAFA 4JX3A 3GCVA 3LFBA 3PXRA 4EOMA 3UG2A 3SGCA 5IKWA 2UW4A 3CKXA 4EWQA 4DTKA 2VTAA 4D4VA 4NUSA 4UX9A 3HMIA 2ZB1A 2BRMA 1FVVA 3W2PA 2YWVA 3LJ1A 4XNEA 2BVAA 4JR3A 5AUTA 4L01A 2C0IA 3LXLA 1Y6BA 1H24A 4QP9A 4YJTA 4AGUA 4LGGA 4RRVA 5HIEA 5K5NA 3C0HA 2IVTA 2QR8A 4W8EA 4E5AX 1OUYA 3LW0A 2PMOX 5CEMA 4C4HA 1OIQA 2J2IB 4GFMA 5DYJA 2EUFB 3DGKA 3VUGA 2XMYA 5JQ8A 2YWPA 4M14A 3HEGA 4Y85A 3DT1A 4O4CA 3R63A 4ZZOA 3HAVA 2WMVA 2DYLA 2JIUA 1YWVA 4W9WA 4TWNA 5HKMA 1KUTA 5EQYA 1APME 4ARKA 3KU2A 1NVRA 1PMEA 1A9UA 3QHRA 4S31A 5H8EA 5CU6A 1J7UA 1GIIA 3JVRA 3QTXA 4FODA 5E8YA 2WB8A 2XKFA 2NYAA 2AC5A 4GKIA 3O23A 4QEBA 2BDFA 5IQCA 2J90A 4DCAA 1OL6A 5BUIA 2WTCA 2IZUA 5KZ0A 2OU7A 5KHWA 4FK3A 4DEBA 4FIJA 2J0JA 2GDOA 4W4XA 3NFGB 4L68A 2QOKA 3MWUA 3RTPA 4L67A 5CY3A 3AC3A 2JLDA 4GIIA 3QTUA 3QBNA 4FKIA 3VUKA 4FKLA 3BEAA 4IACA 5J7BA 2C0OA 3UO4A 4AZVA 4MXAA 1NA7A 2WTIA 4XS2A 4NM0A 3C4FA 2Y4IC 2YLEA 3P86A 3OMVA 2XK9A 3KMMA 3MSSA 4HYIA 4K11A 3RALA 3E3BX 4JMQA 4RWJA 1LR4A 1OL5A 3WI6A 5EOLA 3S00A 3PRFA 2HWOA 3D7ZA 2GFSA 4DBNA 2O2UA 4PV0A 5LCKA 4MX9A 3BHTA 4ZSGA 1YXSA 5DA3A 5HG5A 4CZTA 1XMLA 3KK9A 4WRSA 2VTLA 1UKIA 4BDGA 4Q9ZA 4QT1A 1CKJA 2CLXA 3WARA 2QLUA 1GJOA 1JVPP 3VUDA 4YTHA 3P5KA 4ZAUA 3P78A 4JDKA 5CU2A 1UKHA 4IAKA 4ZZNA 2C0TA 2JIVA 3P0MA 4X6RA 4K77A 4FK6A 4BDFA 3RAHA 4KS8A 4IXPA 5BV3A 3VS6A 5L3AA 4FICA 4K18A 1URWA 2PZPA 3V8WA 2JDVA 1VZOA 5CNOA 3G33A 2VAGA 3V04A 5DLSA 2P55A 4HGEA 5M4IA 2BKZA 3A7HA 2B53A 3FDNA 3MY0A 1NXKA 4U0IA 2BMCA 3CPBA 2EXEA 5E8SA 5I9UA 3SAYA 5E8XA 4AXCA 3RM7A 2QONA 2FSTX 4IB0A 2FYSA 1JWHA 3LCKA 3BWJA 4J1RA 3PDTA 3FAAA 3ZFYA 2KULA 4DYMA 2NPQA 4QMZA 3U6IA 3EQFA 3MV5A 5FTOA 4DHFA 1BMKA 2E2BA 5I9XA 3VS4A 3E8NA 4ZTQA 3R1NA 4FV8A 4FTTA 3ZDUA 3I4BA 4NJ3A 4DE4A 4KS7A 4ZLYA 4D1XA 4RA4A 3DBCA 5DMZA 2OO8X 3FZOA 2UZBA 3IOKA 3Q9WA 2C6TA 4FSYA 4JT3A 1OKWA 3RHXA 2B9FA 4HVGA 5A46A 4F9CA 3LFSA 4IJPA 4X3FA 2IVSA 1Q61A 2X2KA 3QX4A 3R04A 5CASA 3SG8A 3BPRA 3BQRA 2XIXA 3UPZA 2ZJWA 4IWQA 3ZM9A 1XH8A 4UWYA 5HU9A 3UDBA 3CE3A 3KCFA 3NW6A 3LFQA 3DKCA 3LAUA 4JVGA 4N6YA 5GZ8A 2VWXA 3IECA 5K9IA 4U80A 3VUHA 3I6UA 2WOUA 3KK8A 1RW8A 3C4XA 3II5A 4HVHA 5FTGA 3OCGA 5F95A 2ZDUA 3DJ7A 4BFMA 3C13A 4DG3E 4ZJIA 4XG7A 4XP2A 3TIZA 4DEDA 4TXCA 4EOPA 2CGXA 3RAIA 2A98A 3NZ0A 3R1QA 4G3EA 3ZEWA 4NFMA 4CSVA 4BZOA 3OF0A 4PP9A 2YHVA 4EH8A 4G34A 3ID6C 2JIIA 2V7AA 2Z8CA 3TM0A 2BAQA 2QCSA 2E9NA 3AKKA 1KV1A 4OUCA 1FINA 3ALOA 2Y0AA 3CD3A 3CY2A 4FSMA 4MH7A 1OPKA 1QMZA 1UU8A 3MVMA 4NWMA 4XUFA 5JSMA 4EK4A 1H00A 4NH1A 2IF8A 4H36A 4AN2A 2YABA 1YDRE 4F6SA 2ZYBA 1ZY5A 1OITA 1YXUA 4Z9LA 4O84A 4FGRA 4GUBA 4MEDA 3IDBA 4TNDA 1KE6A 4FOCA 1IEPA 4E6QA 2X8DA 3GBZA 1H28A 4MVFA 2CLQA 4FT9A 4YU2A 4BJJA 4ITJA 4NKAA 3O7LB 4O86A 4BY9E 4I0RA 1OBGA 3LKMA 4M0YA 2C3IB 3DK3A 5CT0A 5FEEA 2QVSE 4O0WA 4D1SA 3MVJA 3IS5A 2JKOA 2R0UA 3CP9A 4DFBA 2WELA 4I22A 4PMTA 2Y6MA 4H1MA 3U87A 1CM8A 3PPKA 4IH8A 2QOFA 2CN8A 2UVXA 3PXYA 3U9CA 1U4DA 4ALWA 4U41A 4I5MA 3F7ZA 2C5XA 2WMRA 4XG4A 5L8JA 3CSVA 4O27B 3HMNA 4LGDA 4AFJA 4C33A 5IZFA 3KRRA 2OFUA 3DB8A 5CSVA 5J79A 1MRVA 3AC1A 3DU8A 4WNPA 1L8TA 4HGTA 4BGQA 2W5AA 3ORLA 2DQ7X 3L8XA 4PL3A 4EI4A 5IUGA 4UWBA 1UNGA 3JYAA 5FXSA 3QD3A 4FIGA 2QU6A 5EDPA 3GI3A 4FEXA 3BX5A 1Y8YA 2H96A 3ZFMA 3MJ2A 3W2OA 3O8TA 1J3HA 4XV1A 3ORTA 4FV9A 4QPAA 2G01A 4HW7A 3NYXA 5AV1A 4IIRA 5CU4A 3UIXA 4ONAA 4FZ7A 5HVYA 2XF0A 3UNKA 3ROYA 3UMWA 2SRCA 1Z57A 3MFSA 3CXWA 4DT9A 3TNQB 3COKA 4DEAA 3IK3A 4FI1A 2OJIA 1TQPA 3KXXA 4PPAA 4J8MA 4YJUA 4PRJA 4MWIA 3PYYA 1NVQA 3ANRA 3KF4A 2A4LA 2R3GA 3DLZA 4RIXA 2EB3A 2R3KA 5AX9A 4AZTA 2WZJA 2PVRA 3EQDA 4FNYA 1PHKA 5L2QA 3ZO3A 3OW4A 5FTQA 4BVUA 3R6XA 4U3YA 4CG9A 3UOHA 3JR1A 4FIIA 5GIOE 4FV4A 1ZZLA 2VX3A 3OZ6A 2ERKA 2UW7A 5HCZA 4D4SA 2A27A 4NW6A 4H58A 4WIHA 1OIUA 4AT4A 5LXMA 3EFLA 5IUIA 5L6OA 1TKIA 3AGLA 5CEOA 5C8MA 5LVLA 3NEWA 3SKCA 2G2HA 3D7TB 3QGYA 4RFMA 4A7CA 5H3QA 4DH8A 3ITZA 3RPVA 3EB0A 4JLCA 5I4NA 3NRMA 2OBJA 3U6JA 2JFMA 3QQHA 4ZXTA 3O8PA 4BCPA 3JVSA 3MPTA 2PE0A 3NVMB 4FSNA 5M4FA 1OM1A 3E93A 3K3IA 3QF9A 1RE8A 3W16A 4IX4A 1H07A 2I0HA 2VWVA 3FY0A 2C5NA 2ZFYA 4O0VA 1YI3A 3HUBA 2X0QA 2PULA 3TDVA 2WTDA 4A4XA 3UIMA 4IDVA 4JG6A 2I0EA 3UDTA 3NGAA 3G15A 4I6FA 1OI9A 3ORNA 3BHYA 2AC3A 4GMYA 5CANA 3FMNA 4K0YA 4EC9A 2XAMA 4O82A 4DHIB 4G5PA 3BE9A 3OG7A 3S4QA 2HZ4A 2Y8OA 3ZUUA 3KA0A 3VHKA 4WG4A 4R77A 2EU9A 3ZC5A 2WTKB 4MBIA 4RVKA 1J7IA 3FHIA 4L7SA 4N70A 4DFLA 4ACCA 1JBPE 4O21A 5JK3A 3F61A 4L42A 5AP4A 5LVNA 2GCDA 4AQKA 1TVOA 1K2PA 3RINA 2WQMA 4GV1A 5KBQA 3Q32A 2ESMA 4YZ9A 4BIBA 3R8LA 1BI7A 3N51A 4HZSA 3SOAA 4CFFA 3OHTA 4OLIA 4BHNA 4FE2A 4I41A 5KMLA 5AIRA 1M52A 2W5BA 3BI6A 1Q97A 2RFSA 3DFAA 4XG2A 2GHLA 1FMKA 4XG3A 5IQGA 2R7IA 3TKUA 3R2YA 5LMBA 5CQWA 3NNUA 4Z16A 4II5A 4EOLA 2JDTA 4APCA 3PY0A 1IA9A 1KE7A 2VTJA 2OSCA 2VWBA 5H9BA 2WTVA 3R02A 2PSQA 4GT5A 5A4EA 1XH4A 3LJ0A 3E8CA 2VO7A 4HYUA 4MAOA 5EYMA 3CKWA 4CT1A 5K0KA 3W10A 4ZTSA 5GINE 1Q62A 5HGIA 2B4SB 2NRYA 4I5CA 4OTGA 3FSFA 4KD1A 4E6DA 2XYUA 4F09A 2JKQA 2YDIA 3FZPA 4BDDA 4EK5A 4ENYA 4Z55A 2BZHB 4S33A 3E62A 1YW2A 1OVEA 3HZTA 4P5QA 3SXSA 4U7ZA 3KFAA 4IADA 5AP5A 4QMPA 5CEIA 2Y7JA 3MTFA 2F2CB 3NX8A 4XRJA 4A9TA 3GQLA 5L2TA 4HCUA 1GZ8A 3EZVA 5HTCA 3F3TA 2QOCA 2IVVA 4FL3A 3LXKA 5HE0A 3AXWA 4JS8A 2PE2A 4U42A 4JQ7A 3HLLA 4X0MA 3ZLYA 4AW5A 3COHA 4HNFA 5KX8A 1ND4A 4GEOA 3P1AA 1ST4A 2XYNA 4PNKA 2PMIA 5B7VA 1W84A 2YZAA 3TZ9A 4MF1A 2I0YA 4RFYA 4MHAA 1QPEA 5CF5A 5AP7A 3T3VA 2XAOA 2WEIA 4KKHA 4OTFA 4KIPA 4OAUC 2FSMX 5CEQA 3EFWA 2AYPA 4HZRA 3WIGA 2UZVA 2ZAZA 3NUNA 4C38A 4EQCA 4EORA 5HBHA 4ZSEA 2Z7SA 3NIEA 1SVGA 3WOWA 5HICA 5HG7A 5IQDA 2OGVA 4JXFA 5IQIA 5HD4A 4HNIA 3BYUA 3NWWA 2R9SA 4IWOA 3QA0A 5DT0A 3CGFA 2YACA 5T3QA 1YOJA 2B7AA 2Q0BA 4BTKA 3F5UA 4JAIA 4YSJA 2P33A 4FYNA 5AIKA 2XRWA 4XYFA 3WZEA 3HUCA 4FMQA 5JQ5A 3H30A 5HTBA 4J52A 4RJ4A 4DH7A 3RGFA 3DBQA 3DQXA 4PUZA 2QO9A 3RNIA 5DVRA 4QMNA 4IE9A 5HOAA 1BL6A 3QTWA 5EDRA 3GQIA 3PY1A 5L8KA 2GQGA 3R9OA 1IR3A 3DCVA 4JBPA 5DT4A 2GHMA 4C61A 2JDSA 2YJRA 4JNWA 5L2WA 1JKTA 4FA2A 5IH6A 5FM2A 3H9RA 3ZUTA 4YHFA 3IGOA 3R8VA 4DH3A 3PA3A 2QODA 3WILA 4F7SA 2PVFA 2IW8A 3LCTA 3TCPA 3QL8A 3D2IA 3RJCA 5HQ0A 3ZRKA 3GUBA 4E4XA 3NNVA 5E9EA 3DJ5A 4I1ZA 4ID7A 2XJ0A 3A60A 5DT3A 4L6QA 5J5SA 1GOLA 4FTUA 4QPSA 5ANGA 2HK5A 2FA2A 3FLWA 3UTOA 4W4YA 5DEYA 2UW0A 5HO8A 2GNLA 2OXXA 4P5ZA 3MH2A 4WG3A 3FLZA 3BGQA 1Y6AA 4TTHB 3QTSA 2BRGA 4IAZA 1DM2A 5EG3A 2W4OA 4DFNA 1WBPA 3BLHA 4AXAA 4MXOA 4F78A 1KV2A 4WUAA 4AP7A 1XMMA 4QMVA 3QGWA 3QFVA 4YZBA 3GU6A 4CZUA 3V01A 2HZIA 5ANIA 3RPRA 3V5LA 4FEUA 3L9NA 1PXPA 5KMIA 3Q6WA 4O22A 4FKPA 5AV2A 4F70A 4EONA 5HD7A 4I3ZA 1IAHA 1ZYJA 3C5UA 1OPJA 2G2IA 5CNNA 4LL5A 5FP5A 1GIJA 3I60A 2UZDA 2ITOA 3W2RA 3DXQA 4UZDA 4OTHA 3MB7A 4R78A 4FBXA 2Y4IB 3EL7A 4GVJA 4FUYA 4IWPA 3SG9A 5M09A 3IO7A 4RPVA 4PF4A 2OLCA 3PIXA 4BI0A 1F0QA 4KRDA 5CX9A 4IZ7A 4M15A 3SV0A 5M4UA 1YHSA 2A2AA 5F4NA 4O7WA 4XG6A 1ST0A 4FSZA 3H0ZA 4ZK5A 3Q4ZA 3NFFB 3UZTA 4BCJA 2BTRA 3MA3A 4L46A 4P90A 3VS3A 3AG9A 5CSWA 3KRJA 2BZIB 3MVLA 3BLAA 1E9HA 4BKYA 2F7EE 3DAEA 3OWKA 4J53A 4U40A 3NMUF 5H2UA 2VTSA 1MRUA 4QMUA 1NW1A 3KIOC 4FV6A 2C6IA 4XG9A 2O0UA 3AOXA 3O51A 4YJVA 3RZBA 4QMQA 2PPQA 3QYZA 4RMZA 1BYGA 4M69A 4AUAA 4D5KA 1UU3A 3DTWA 5C27A 3QKKA 3W0SA 2Z7QA 3E63A 5EI2A 5EM5A 4GIHA 4CFWA 4HYHA 4C4GA 1F3MC 2VRXA 4TYEA 1W83A 2B54A 4G5JA 3EIDA 3S0OA 3ZBXA 3FMEA 3W0QA 4BDKA 4AZEA 3R71A 4O0TA 4D2SA 4EL9A 5FWKK 1G5SA 4WBBB 3EN9A 1V1KA 3RHKA 2YEXA 4FZAB 3QQUA 1NVSA 3BU6A 2V62A 2IZRA 4JIKA 4M0ZA 3ORXA 5BVNA 2C5VA 3G90X 4TKSA 3R7IA 1RJBA 1XH5A 4IDTA 1QPJA 5AP2A 3EKKA 4FKWA 2FB8A 2UVYA 1H1WA 3ZONA 2R3QA 2BKKA 2GNJA 3ZC6A 2W1HA 3OFMA 5AR8A 4B4LA 3TMOA 5AR2A 2VUWA 3QKMA 3O50A 3KY2A 3R7GA 3FL5A 4AFEA 2QO2A 2W7XA 3IOPA 4E6AA 5JEBA 5FBNC 3ZO1A 4AQCA 3A7JA 2PUNA 1SZMA 4EK6A 4WNKA 4RJ8A 4KIKB 5CXZA 3OROA 3LXPA 5GJFA 2H34A 2JKMA 3P08A 3FI8A 1BX6A 4GJ2A 2QOIA 3HV6A 4IW0A 3EJ1A 4JDHA 5JGDA 3RCJA 3LIJA 1JOWB 3QWJA 2R3MA 4FTJA 3ZHPC 4CFNA 4F1OA 4RC2A 5M06A 4CYJA 5M57A 5C9CA 1BI8A 4XJ0A 2PY3A 3NIZA 4JRVA 3PA5A 5BMMA 5KMOA 4R3CA 5LWMA 3TIYA 1RDQE 4ASXA 4BI2A 3DXNA 3F2RA 3RK9A 3UVPA 3PVWA 1M7NA 4KSQA 4L53A 4QMLA 3PPJA 2VN9A 4OTIA 4J96A 4EOOA 3DOGA 3QTRA 3Q6UA 4R5SA 4FKSA 3UO6A 4ZLZA 5IEYA 4G3G