3ZU7A

Crystal structure of a designed selected ankyrin repeat protein in complex with the map kinase erk2
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
344
structure length
344
Chain Sequence
EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 1
publication title Structural and Functional Analysis of Phosphorylation-Specific Binders of the Kinase Erk from Designed Ankyrin Repeat Protein Libraries.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/de novo protein
total genus 102
structure length 344
sequence length 344
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zu7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zu7A01
3Q32A 2FUMA 4MWHA 5EHOA 5EHYA 3NNWA 3V5PA 2A4LA 2JBPA 3EYGA 4X0MA 4O7YA 3LCDA 3PXYA 3OCGA 1WVXA 3ZXTA 5JMSA 4NJ3A 3SHEA 3NW6A 3PYYA 5L8KA 1ZRZA 2W1IA 5JKGA 2QHNA 2BZKB 4IC8A 3GFEA 4QMVA 4XOZA 4DH1A 3UNZA 3T8OA 4I93A 3DJ5A 3PJ8A 3MDYA 2BAKA 5C8MA 3V5QA 3PPZA 2GCDA 2R64A 4DYMA 3KRXA 5AMNA 5HE3A 4F0FA 4IM2A 4RMZA 2ITNA 2RG5A 4CKIA 5DLSA 3MVMA 2W1HA 5DOSA 1CKIA 3WYXA 4R5SA 5EYKA 1OKVA 4HYUA 4OTGA 1KWPA 3ORKA 5AP2A 3VUIA 4AF3A 4FKPA 1FVVA 4BTMA 3FXWA 5AP7A 4B4LA 2H8HA 2AC5A 2NP8A 4F9YA 4DTBA 1JAMA 2UVYA 4O7WA 4BCOA 4QP6A 4ANOA 4GRBA 5G1XA 1URWA 4AZVA 3QA8A 4H39A 4AN3A 4FYNA 5CU0A 4ZZOA 5IU2A 3H3CA 3BCEA 1YXSA 4J53A 4LFIA 4FR4A 3PIXA 2ZJWA 2KTYA 2QLQA 1LP4A 2X2MA 3DBQA 4TYJA 3EKKA 4FTRA 5HTBA 4K2RA 3L9MA 4W4VA 5D41A 4FG9A 1TVOA 4XP3A 3ZC6A 2R3JA 2C30A 4FV8A 4XG4A 2QG7A 2J5FA 4MD9E 2UZOA 5K5XA 2YZLA 4GV1A 4C58A 2C0IA 2VN9A 4DC2A 2ITZA 3MI9A 3CQWA 3QGWA 3PXQA 1GZ8A 2WOUA 4KKGA 4YZDA 3OVVA 2C5YA 4C37A 3F3UA 5J5SA 1SNXA 2XK4A 4BKZA 4F6WA 3R8ZA 3D5VA 3IECA 3POZA 3R9RA 3FEGA 4NL0A 4U44A 2GNIA 4M12A 5KMLA 3BHUA 4YURA 3CQUA 3PE2A 3KK9A 4GS6A 2CN8A 4L00A 4K0YA 2NO3A 3Q04A 4IVBA 3REPA 4RJ3A 1DS5A 1YOJA 5AADA 3E8NA 4QP4A 2BIYA 4JNWA 3HUBA 2C3KA 4ALWA 3UIBA 2EB3A 3K3IA 3PY3A 1TQMA 2C0TA 4QMSA 2VUWA 1WBNA 3I4BA 4BVUA 4M66A 3MPTA 3QZFA 5CI7A 5EDPA 4CNHA 3ORMA 1Z9XA 4KAOA 5AAEA 3KKVA 5M4IA 2YIXA 1BI7A 4V0GA 4W8EA 2WQEA 1Q3WA 4F7JA 2YDKA 3EFJA 1CKJA 4IEBA 5IQCA 2YCQA 3HECA 3WE4A 3GCUA 4HCTA 1OBDA 4GYIA 5K3YA 3LOKA 4N6ZA 3QTIA 5FM2A 4NT4A 1IG1A 5DMZA 1NVSA 3CGFA 4MXAA 4YNOA 3JVSA 1ZXEA 4AZEA 2OZOA 2WEVA 3PVBA 4WIHA 4OAUC 2IJMA 3QQJA 3KXNA 2GQSA 4FSWA 3MH0A 3PLSA 5FXSA 3WYYA 4ZEGA 4H3BA 1PXJA 3WE8A 4BKYA 4X2JA 4C59A 3G0EA 2OKRA 2JDSA 4C4IA 1CKPA 4ZTNA 2QOCA 4QOXA 3RKBA 5GINE 1NVRA 5FBNC 3RK7A 3TV4A 4R3PA 4IB0A 3MJ2A 3O8UA 3QUPA 4G1WA 5IA1A 3ANRA 4NJDA 3W55A 4IAZA 4CQEA 3KN5A 2UZWE 4FT3A 4NCTA 3QYZA 4XG7A 4G5JA 5B2KA 2AYPA 2J4ZA 2IW8A 3LVPA 4C4FA 3TKHA 4G3EA 4YJNA 3ZHPC 2PMOX 3EQCA 4A9SA 1H1PA 3M42A 5CEOA 3R2YA 3VQHA 3TTJA 4JS8A 3AXWA 3MYGA 5H3QA 3RPVA 1FOTA 5JQ8A 1IA9A 3C5IA 3KA0A 5JZNA 4O0XA 3EMGA 4AZWA 2UZLA 3I6UA 1FMOE 4FEWA 5IEXA 4ALUA 4FZFB 3VW8A 4GUEA 4LGDA 3LFCA 3QTWA 5CZIA 1ZAOA 4AN2A 4G9CA 1Q41A 4DFBA 3OWPA 3OUNB 2XMYA 4PTCA 2O64A 2YCRA 4R1YA 4AZTA 1H4LA 3PG1A 1ZY5A 2ZV8A 2W1ZA 2YA9A 3LFSA 4W9XA 3RPYA 4YBJA 5HD7A 3P86A 5CVFA 2X7OA 4E4XA 3VO3A 2CGXA 2KULA 4QMYA 3TKUA 5I3RA 4KIOA 3ZLSA 5AUWA 3KXZA 4L9IA 4LI5A 3OCBA 2DS1A 5EI6A 3ENHA 3E62A 1QMZA 4JX7A 4OGRA 2OJGA 4PL5A 1E1XA 4RZVA 5HIDA 3R9DA 3V01A 2W96B 3DFCB 4IX6A 5DNRA 2FYSA 3OXZA 5IQGA 3ALNA 3GQIA 5A4CA 1OPJA 4FKJA 3F61A 3LM0A 1Q8YA 5AR5A 1Q61A 2Y9QA 3R7GA 4QP1A 2BDFA 3S3IA 3VS1A 1J7LA 4DGLC 4KIPA 5HGIA 3RPSA 4D55A 4DG2E 3PWYA 4BCPA 3NLBA 5IKWA 5FP5A 3R7IA 3ZUTA 4AW2A 3V5TA 3DZOA 4XV9A 3Q2JA 3UIXA 4TWPA 1ZYCA 3N51A 4EC8A 5A9UA 3Q2MA 3WIGA 4GG5A 2JKQA 5AEPA 4L7FA 5E8UA 4LOQA 4TZRA 3EQGA 3IW5A 1U54B 3MFUA 5CAUA 2Z7QA 2J0JA 3DNEA 3R22A 1XH5A 3NX8A 1FMKA 3ORIA 5E8TA 4OBPA 2XIYA 5FM3A 4ZMEA 5I4NA 1SVEA 2XS0A 3KCFA 5LARA 5JT2A 2ZM1A 4RC4A 3L1SA 1JBPE 4WG5A 1VYWA 3DS6A 5ETAA 3UQFA 3OG7A 5DT3A 2JAVA 2UW4A 2PZ5A 3G90X 5A4EA 3NCGA 4IM0A 2F7ZE 4JG7A 2PZYA 4AP7A 3MH3A 4NWMA 4PMTA 3T9IA 1CTPE 2C68A 4UEUA 4LGGA 5E7RA 4BDKA 4MAOA 3QQHA 3UIMA 3DKFA 4G6NA 2A0CX 4C2WA 4WRSA 4XG6A 2A19B 3VC4A 5EQPA 2WTKB 4BB4A 3AC8A 4F64A 1GJOA 3I7BA 3SA0A 4QMMA 1XH4A 3HMIA 2WQOA 5IQDA 3S4QA 2LAVA 3FDNA 3L9NA 4UY9A 3LFNA 3QKKA 4FNWA 5E90A 5T6KA 4AS0A 4DEIA 2BFXA 5LMKC 4BGGA 4L3JA 3G2FA 3OEZA 3LAUA 2YAKA 4FZDB 4EH7A 1Q8ZA 3FKNA 4QTCA 5CEPA 5C27A 3Q9XA 4UMTA 4FGRA 3UO4A 3PA3A 3QA0A 4IWOA 4G5PA 2HY81 2EXCX 4JQ8A 4EBWA 3W18A 5HE0A 5IISA 3P23A 1JQHA 3AD4A 2JIIA 2DWBA 3CGOA 3R21A 2G9XA 2ZMCA 3GCPA 3MV5A 1B38A 2B9IA 3QKLA 2FB8A 5CLPA 5T68A 2ZYBA 2JD5A 3LXKA 1OIUA 4F6SA 2J2IB 3FZPA 2YISA 2CJMA 5HX8A 2NRYA 3FC1X 3WZUA 2PVLA 3NGAA 3N4TA 3FV8A 4FV9A 2VTHA 1WBSA 4TN6A 1T46A 5KMMA 2ZDTA 4TNBA 5BMSA 2VO0A 4IB3A 2XNBA 2YWVA 5C26A 4RIOA 1REKA 5ACBC 3UGCA 1X8BA 4ZSGA 3AC5A 4RWLA 4R77A 2BCJA 3FLZA 1JOWB 4H3PA 4WT6A 5AR8A 3TJDA 3RZBA 4ZAUA 3QZGA 1XR1A 4DT9A 2XK6A 4PQNA 3UOJA 3WZEA 3NUSA 5IH5A 1KOBA 3GEQA 3UPZA 3IKAA 4BCQA 4HVHA 4WSQA 3LQ8A 2P2IA 5HKMA 5ANKA 1JSVA 4D4VA 5ICPA 1ZWSA 3PA5A 2VWBA 4O7ZA 3BLQA 2GFCA 2UZEA 4PP7A 4IDVA 1Q8TA 2IW6A 3ZC5A 4AUAA 3OS3A 3MFTA 4RGJA 3WOWA 1GZKA 4LRJA 4MQ2A 4UZDA 3R04A 1YHSA 1ZOEA 5D10A 4FIGA 4FV3A 3EQPA 5IDPA 1M2PA 4DITA 4M69A 4BI1A 3V5LA 5CF8A 4GUBA 3KVXA 5C03A 4CT2A 3SXFA 5LQFA 2VWIA 4ACMA 5CEKA 4O0WA 3R7EA 2VTSA 1QCFA 3D5WA 3FLNC 4CD0A 4HYSA 4Q9SA 3E93A 2VTMA 3EYHA 1YXXA 1L3RE 4FZAB 2YM8A 4M84A 2WMBA 3II5A 2WFYA 3AT2A 4MXYA 1PKGA 5EK7A 1OUKA 2WPAA 3FUPA 2JDVA 4PPCA 4D28A 4FEVA 5M08A 4DH3A 4LL0A 4E6QA 3ZFXA 5IA5A 1OMWA 2FSLX 4N6YA 3U4WA 5M56A 2YM7A 3KY2A 4GK4A 5LWMA 2UW0A 3R9OA 4F08A 2R3NA 2QOQA 5EW9A 2P4IA 3VS3A 5M07A 3GNIB 3BU6A 3EN5A 2DQ7X 4AAAA 2PE2A 2ETKA 4O0VA 2WKMA 3VBTA 1GZNA 4X6RA 2XZSA 3MPAA 4R1VA 4W4YA 4N0SA 1F0QA 5E8ZA 3TL8A 3RWQA 3AT3A 2W17A 4K11A 4XBUA 1LR4A 4NIFB 4KS7A 4RRVA 3GCQA 4EZ3A 4XG9A 3C4FA 3IW4A 1HCLA 2QR8A 3QLFA 4LG4A 3M11A 3SAYA 3TJCA 2VD5A 5A14A 3DKGA 4HW7A 1YOLA 4ZY4A 3I60A 3LCKA 2LGCA 3HV5A 4FL2A 3U54A 2Y4PA 4BTKA 5JGDA 1XBAA 3O51A 3Q4ZA 4EORA 4GFGA 2XM8A 2G1TA 3EJ1A 3JPVA 4BDBA 3GBZA 2J90A 1OKZA 4IVCA 4EK3A 3NR9A 3CLYA 4FNXA 4P90A 2C6KA 5CEQA 3RP9A 1RE8A 3QKMA 3ZRLA 2HXLA 3RAWA 3S00A 4QQJA 2OLCA 5CAOA 1YI6A 4BCGA 5HLPA 4AGDA 1XBBA 3OZ6A 3P7AA 2X7FA 4L6QA 4FE2A 3LFQA 4EHEA 4TYHB 4EQCA 5L2TA 5GIOE 4D2TA 1I09A 4O86A 3MBLA 2W4KA 4QMLA 4KSQA 3HMPA 3SGCA 4IAYA 3JYAA 5JFXA 2QKWB 4U97A 3GVUA 4O38A 3RWPA 5ETIA 3BEAA 4D2VA 3R6XA 5BPYA 3FYJX 4FI1A 1Z57A 3L8VA 4AX8A 2XKCA 3ENMA 3PTGA 1H26A 3FLQA 3C0GA 3NAXA 4WUAA 3H9RA 4BHNA 4BIDA 5CSHA 4EOLA 3HA8A 3E63A 4FTAA 4FA2A 5JSMA 1WBTA 3CXWA 4AGWA 4C4JA 1JKSA 1Q8WA 2R0UA 4D1XA 3DY7A 3ZM9A 2PPQA 2X39A 3ET7A 4DGOA 3WF7A 4BN1A 4XX9A 2VV9A 5K0KA 4E5BA 2R9SA 3NAYA 4YJOA 4E5WA 5M51A 2B52A 2QOFA 2X9FA 4YC8A 1OL1A 5LOHA 4YC6A 4YO4A 3HA6A 5LCKA 2C47A 4IX4A 4BIEA 1UNHA 3LMHA 3PSCA 3UG1A 4CV8A 4XBRA 3DKCA 3BV3A 5IQFA 3AC1A 4I4EA 2OBJA 4XLIA 3BQRA 3Q5IA 2QG5A 4CKRA 4BCHA 3DCVA 4IZYA 3FXXA 3QTRA 4I6BA 2YCFA 4O0TA 3UDBA 2CGVA 4CSVA 5KUPA 1DAWA 2XEZA 4KSPA 1RJBA 2UW3A 5DIAA 1TQPA 3JY9A 4IAFA 3VULA 2JDOA 2VGOA 5EW3A 2JLDA 4BDDA 1YHVA 4CZTA 3ORXA 3R02A 3RNYA 5B2LA 1OUYA 3EQHA 3QRJA 4FKSA 3NPCA 5HBJA 5IMXA 3FKOA 4Z7HA 3GOKA 5CS6A 4NKSA 2P3GX 4BBFA 2Y6OA 3QCSA 2PY3A 4FVPA 3DBEA 4RJ7A 1SZMA 2ACXA 3BELA 4L44A 3RBWA 4LGHA 3TIZA 4ANMA 4BC6A 4RVLA 4KWPA 5IMEA 3H9OA 3MPMA 4OTFA 2PE1A 4ZK5A 3RM7A 3ZO4A 5E8SA 1S9JA 4RLKA 1UVRA 3HYHA 4KINA 5J87A 3R8MA 3MN3A 3VS0A 4RX8A 1A9UA 5K4JA 2UZBA 1JKLA 2GNJA 4FTIA 4ZTHA 4ANQA 3QRTA 2GNFA 5M57A 3BLRA 3KMUA 4D0WA 3R9HA 4G16A 5E92A 5CU6A 4DCAA 1Q8UA 4RWKA 4YZMA 4JDJA 1PF8A 3I7CA 3GT8A 4FIIA 3OY3A 4CG9A 3UZTA 4RA4A 3A8WA 3DGKA 5M55A 2YACA 5HVJA 3KMWA 1IASA 3S1HA 5AUYA 1O6LA 4KIKB 5CT7A 4CFWA 3ACJA 4BDCA 5FEDA 4YU2A 3DLSA 2QLUA 4KRCA 1BL7A 3GOPA 3MGYA 3WF6A 5C4KA 4KRDA 4OBQA 2VTJA 1PW2A 5A54A 2ZDUA 3AG9A 3QC4A 5C1QB 4RPVA 2XVDA 2E9UA 5CQUA 3AGLA 5EM8A 5KKRC 2NNWB 5GNKA 5LVLA 3HDNA 3SQQA 1H1SA 1PYXA 5EYCA 2ZV7A 3E3BX 3ZXZA 4BYJA 4X7QA 4ZOGA 5CY3A 3CR0A 4C4HA 2RKUA 4O82A 2VNWA 3K5VA 3IQ7A 4G17A 4O0UA 4P7EA 3ID6C 5IQIA 5HVKA 4U41A 4AA4A 2CGWA 4FIJA 3AC3A 2ITUA 1LPUA 4FV4A 4JRNA 3EZVA 3DJ6A 4D2SA 2G2FA 4O2PA 3PJ2A 2HWPA 4F0GA 5A46A 4GU6A 2R3LA 4OT6A 4RA5A 3BE2A 4IM3A 1H07A 5FLFA 2FA2A 5AM7A 4EONA 4RQVA 4TWCA 2CKQA 3C4XA 4KKEA 2Z7LA 5CENA 3HP5A 5AR7A 3PZHA 4AU8A 3HV3A 4V04A 4RIWB 2PULA 4XEYA 3DOGA 3EH9A 3AQVA 4MBLA 5LVMA 2GS7A 3FZRA 4RC2A 3HUCA 5LMKA 4A4XA 3FPMA 2JEDA 3DJ7A 5B7VA 4RFZA 4A06A 3G51A 4LUEA 5TR6A 3CIKA 4IVAA 4OLIA 5JGAA 3RNIA 2WELA 3QTQA 1YDRE 3L8SA 4RIXA 5CVGA 5EW8A 2IW9A 3VJNA 4QMNA 3ATSA 3KREA 2WMSA 4JL9A 4C3RA 4X2KA 5BQ0A 2BRNA 2C1AA 2Q0BA 4YZ9A 1ZARA 1SMHA 2XNGA 3TIYA 2UZTA 2WIPA 1BKXA 2R2PA 4NM5A 5J1WA 4BIBA 3VVHA 3I1AA 4A07A 3E64A 4L53A 3O17A 5AUXA 1F5QA 4MD7E 3VRZA 2BZIB 3JS2A 1BI8A 2HOGA 3GQLA 3OCSA 4MXOA 4BWKA 4QO9A 4YJPA 4C3PA 4C7TA 4YZCA 5G6VA 4EZ7A 3IGOA 3FE3A 1IR3A 3QBNA 1NXKA 4USDA 3UBDA 3BV2A 3Q5ZA 4BDGA 4D4RA 1Q5KA 3SDJA 1OPLA 4KA3A 4XP2A 1RQQA 3IPHA 4HPTE 2R3HA 4FTCA 5JRSA 3WZDA 5LMBA 4S31A 4MXXA 2H34A 4AFEA 3CTJA 5T3QA 5JFWA 4J95A 4FZ7A 4DFUA 3R1QA 2ITQA 4V01A 5DE2A 4Q5EA 3DBFA 4DF3A 3D7TB 4NM7A 3JVRA 3H30A 3QQGA 4E4MA 2W9ZB 2CMWA 2XBAA 3Q6UA 4GYGA 5CVHA 3F5UA 2EXEA 4GVAA 2GQGA 2VTQA 5TE0A 5GZAA 2C1BA 3CJGA 3OP5A 3W10A 4YZNA 5TF9A 5FUTA 4IVDA 3FY0A 5CEMA 1P4FA 4FTUA 3EL8A 3C50A 3LHJA 5HO6A 1K9AA 2J0LA 4ZZMA 3NEWA 3P9JA 2WQBA 4U6RA 5M44A 4FV7A 2CKEA 3D15A 4DEEA 3EWHA 1YI4A 3QTSA 3W2RA 4GKIA 1HCKA 3PFQA 3PDTA 5ANOA 2WTKC 3UP7A 3QHRA 5M53A 3D83A 1OI9A 4WNMA 3FY2A 4QPMA 4PPBA 3FLYA 5EQEA 4FNZA 1H1QA 4HVIA 3AMAA 3S2PA 3A60A 3PPJA 2BFYA 4X3JA 2C69A 2W1CA 3NIZA 1M7QA 4G31A 3S0OA 4O7VA 4G3DA 3UC3A 4J96A 2IVUA 3LFFA 2HZ0A 1Q24A 4L8MA 2VTAA 2B9JA 5DG5A 1O6KA 4BBMA 4YUQA 2IPXA 4HPUE 3ORNA 2WMTA 2WMQA 5CI6A 5FDXA 3W1FA 4DE4A 1FGIA 4ITIA 3BRBA 4M67A 2OK1A 4YJSA 2P33A 5BMMA 4Y85A 4KNBA 1M52A 3CP9A 4RC3A 4Y8DA 3JY0A 2OJ9A 4HGEA 5EI2A 2UW7A 4MNEB 5CU3A 1OIYA 2O0UA 3QTZA 1GIHA 3ZYAA 4WUNA 4DT8A 3U6HA 2CPKE 1UU9A 3TNQB 4FOCA 1J1BA 3TI1A 3G9LX 3NMUF 3VHKA 4MVFA 2YHVA 4CRLA 4IC7A 3FSFA 2JBOA 3Q4TA 1GNGA 3AC2A 4JBQA 4YC3A 4AGUA 4F65A 3H10A 3FMLA 4OTWA 1WZYA 3D2IA 4BDAA 4XHKB 5L2QA 4Y83A 3IW6A 4M3QA 4QQ5A 2X0GA 5IH4A 1YI3A 3BGPA 3EHAA 3THBA 4M0YA 1BX6A 2C6MA 1XBCA 3F7ZA 5IDNA 3ZH8A 4ASDA 1UKIA 2X8EA 2ONLC 4ASXA 1WCCA 4FTKA 5CNNA 2BKKA 2WQMA 2GHMA 4XMOA 1O6YA 3PXZA 2W1GA 4WBBB 4PDPA 3KC3A 4AW1A 1PMUA 3G15A 1RW8A 3W2PA 2PVFA 2QODA 3A7FA 4L43A 4O7SA 3DNDA 1YWNA 2XIKA 4QD6A 2VTIA 4KD1A 4E93A 3BHTA 4V0GB 4BRXA 3LMIA 4R78A 4NM3A 2PZRA 3NUUA 3OTVA 4FTQA 5IUGA 3A2CA 1UU3A 4HGSA 3F3VA 3U55A 2EWAA 4IXPA 1VZOA 3FI8A 5K5NA 5AX3A 4M0ZA 4EL9A 5AUTA 4M13A 4AA0A 3DKOA 2OJFE 3FWQA 4ACDA 2B0QA 3F7WA 4AZFA 3S95A 3BGZA 4F6UA 4LMUA 3LXPA 4JBVA 3CPCA 1UWJA 2YM5A 3G33A 1OIQA 2Y4IB 4RX9A 5IQBA 2QHMA 4USEA 4ANLA 1OL7A 2C4GA 3VNTA 3MY0A 4RJ6A 3FSKA 4FZ6A 2XK8A 1CM8A 2ZMDA 1P14A 4YSJA 1KE9A 4EH2A 4XRLA 2ITXA 1XJDA 4R5YA 5KZIA 5HQ0A 4AT4A 4YJTA 3R0TA 4P4CA 5L8LA 2R3PA 3I5ZA 4BTFA 2HW6A 5I9ZA 4GK2A 2IVVA 5CSWA 3W2QA 3LE6A 4YTHA 4ZSAA 3R7OA 5HE2A 2F7XE 1KE5A 5BVWA 2AUHA 5KMNA 2VWXA 2HWOA 3ITZA 3R00A 4K1BA 4TYEA 2R0IA 3CCNA 1J3HA 4Y72A 3TUDA 3FMNA 3W8LA 4O7RA 3KB7A 3AOXA 4GT3A 3OBGA 4JX3A 4MD8E 4X2NA 4IWQA 1BYGA 3OT8A 3VS7A 4FKQA 4QP8A 3EFKA 1OGUA 1KE8A 3WF8A 4E1ZA 2R3FA 3BYUA 4U42A 3GP0A 3UG2A 4UMRA 3MTLA 4LV8A 2R5TA 3UQGA 5IPJA 4D4SA 5J5TA 3GCSA 2G01A 4KIQA 3DK3A 3BWJA 3I5NA 3LXLA 4G3CA 1CMKE 4Z3VA 3E92A 4BCKA 4FSYA 3DBDA 2VO3A 3CKXA 2VTLA 4XG3A 4EOQA 3CSVA 3R1SA 2ETMA 3A61A 4QP7A 5HESA 4KBAA 3NVMB 4XLVA 3LLTA 5HOAA 5ANJA 4R3RA 5E9EA 3F88A 2OU7A 1B6CB 4HVDA 3FZOA 4H36A 3ULZA 3V8WA 3ZMMA 2QVSE 4WA9A 1NVQA 3NUNA 4X2GA 2R3QA 2VU3A 5AV1A 5AAGA 3OEFX 4L7SA 5DT0A 1UNLA 1M2QA 3GU5A 4Y46A 5AR3A 4AACA 4OTRA 1CDKA 5JK3A 3OWKA 3A4PA 3DDPA 3GB2A 2YERA 3AT4A 3QXPA 4KBCA 3VUGA 4IB1A 4C2VA 4Q5HA 4I21A 2RFNA 4FG8A 5BNJA 4O6LA 4X3FC 4AE6A 2I1MA 4CEGA 2ITTA 3PVGA 4EK5A 5IA2A 2OO8X 4FEXA 3U4UA 3SD0A 4BFMA 4BDFA 4RVKA 3ORLA 2BUJA 4RJ4A 4ACGA 1UU8A 3V04A 1TKIA 1WBWA 2BAJA 1JSUA 2O8YA 3OW4A 2B54A 4QRCA 3LPBA 3UP2A 1KUTA 3OOGA 4BI0A 1R0EA 2OZAA 3OF0A 5I9VA 5IEYA 3O8PA 1DAYA 2W06A 3FI2A 4EHZA 4PTGA 3A7HA 4EUTA 2QOIA 2ETRA 3QAME 4BTJA 1VEBA 4RX5A 3R73A 3UZRA 2HCKA 1H0VA 1LUFA 2OXXA 3LMGA 3O23A 4PPAA 5ACKA 4CFFA 4DFLA 4XH6A 5LJJA 4CG8A 3VWAA 4ERKA 2O3PA 2Y0AA 1JLUE 4FTNA 2CDZA 2VZ6A 4EOIA 4FT9A 3QC9A 4KB8A 3ZLWA 1XHAA 2H96A 2YZAA 3PSBA 5IA0A 5GZ8A 4JIKA 1GIJA 4M7IA 2PZPA 4GFMA 3MVHA 3DU8A 2PU8A 3MIYA 4WNPA 3DK6A 5AV4A 2XIZA 5JZJA 2ZV9A 3CTQA 3K54A 4WHZA 3ZLYA 2JKOA 1ERKA 4FEQA 3U8WA 1GY3A 4W4WA 3FHRA 3KRJA 2GU8A 2VNYA 1ZLTA 4FNYA 3BEGA 5BYLA 3RM6A 4CYJA 1W8CA 4CZUA 2V62A 3KN6A 5C8KA 3KXMA 3LXNA 4HZRA 4ANSA 5HU9A 4OT5A 3NUAA 3QD0A 4P5QA 4QPSA 5AUUA 5FWKK 3FMJA 4TYGA 5KMKA 3LJ1A 2QC6A 1ZMWA 1VR2A 3CY2A 4ZS4A 4FMQA 3U51A 2JFMA 4NTSA 3DA6A 4QYFA 2BTSA 4JXFA 3TNIA 1Q97A 4UBAA 1E1VA 5CYIA 2OIQA 5AP4A 1PKDA 3F2NA 1U54A 1UKHA 5ETFA 4OBOA 5CASA 3MW1A 2J0KA 4F9BA 3DFAA 4GT4A 4S33A 2XIRA 3Q9ZA 5LVNA 2QONA 5HBHA 4ZIMA 1O9UA 3W16A 3FQEA 3UOLA 4KBKA 4AW5A 2X8IA 4DBXA 3P7CA 3TG1A 2EU9A 5I3OA 3TNWA 4AA5A 4O2ZA 3LLAA 2XJ2A 4GMYA 4F63A 4YPDA 4DG0E 4U3YA 3TUCA 4U9AA 1YXVA 3F66A 3FMDA 2XNOA 3GC0A 4RWJA 2YIQA 2P2HA 2YIYA 4Y5HA 4Z7GA 3VUHA 4LOPA 4FV2A 5HLNA 5HU3A 2HXQA 3OBJA 5KNJA 1IAHA 3PJ1A 3ZO3A 4N70A 4BDIA 3E8DA 5IQEA 1W84A 1P4OA 4XV1A 4ZSJA 1Y6BA 3NDMA 3D9VA 4QNYA 4G3GA 4JDIA 4I6HA 2UVXA 5HVYA 4UMPA 4E8AA 2DYLA 4N57A 3VF9A 4IAIA 4UYNA 3IDPA 4QMOA 3R7VA 4Z16A 1SM2A 2C5VA 4PMMA 4BI2A 2HENA 4S30A 3KF4A 1FQ1B 5I0BA 3H4JA 5E1SA 2JAMA 5EG3A 3CEKA 3C0HA 3QUDA 4HNFA 3HL7A 3B2TA 4NM0A 4EYMA 3KFAA 3E7VA 4J97A 4MYGA 2B1PA 3UMXA 4LQMA 4HYHA 3ORTA 3GFWA 4M69B 4QTBA 4EOMA 1SVHA 3VHEA 4TL0A 4I41A 2PVRA 5F9EA 4GT5A 3GENA 3COMA 2NPQA 2OGVA 3WI6A 3ELJA 4I4FA 2VWZA 2R4BA 3NZ0A 5KE0A 3RZFA 3JXWA 2BROA 2VTPA 1YWVA 3E87A 2CN5A 4R3CA 4RFYA 4UZHA 4Y5QA 4EWQA 4YTFA 3ZFMA 4JAJA 3RHKA 3C1XA 3FXZA 4GJ3A 4LRKA 4NUSA 3ZONA 5I9YA 4D5KA 5L2IA 1OL5A 3Q53A 2BZHB 1K3AA 2WO6A 4M97A 3V5JA 3U6IA 4YBKA 2VTRA 3R28A 2BRHA 4FSUA 1PXKA 4FV0A 4Q2AA 4C38A 4U3ZA 3FMHA 5AWMA 3FKLA 1BL6A 1FINA 4BBEA 2QO9A 4ERWA 4WO5A 1YW2A 4DH7A 3G0FA 4UALA 3LQ3A 2GNLA 2P0CA 1TQIA 3POOA 4HCUA 4QTDA 4RT7A 4UXLA 3ZSGA 2F2CB 5DRBA 2GPHA 4WNKA 4EKLA 2ZOQA 1R1WA 3LJ0A 3EFLA 4EUUA 2ONLA 2W4JA 3EL7A 2UUEA 5DPVA 2VO6A 5EYMA 2GHLA 4XV2A 1R3CA 2C6EA 4E4LA 5C8NA 5CAPA 1VYZA 2JKMA 2E9PA 3KXGA 1A06A 5LVPA 2WMRA 3N9XA 3OY1A 4JLCA 2OIBA 3F5XA 4U0IA 4O91A 5AX9A 3V8SA 3SC1A 3TZMA 3R7UA 3V5WA 1G8SA 4IZAA 4GG7A 1R39A 3UJGA 3LCOA 3PIZA 3P4KA 3TZ9A 2X2LA 3SKCA 3FMEA 2ZB0A 1YXTA 4DINA 1Y6AA 4ZY5A 4JJRA 2J51A 3KXHA 4C02A 3UVPA 1FVRA 3A7JA 3EN9A 3NNVA 3BU3A 1QPJA 4IWDA 5HG5A 5HIBA 2VO7A 4GEOA 1OZ1A 3AD5A 5F95A 3FPQA 1OL2A 2VWVA 5F4NA 3W2SA 4CFVA 2R3KA 4CYIA 3OFMA 2GS2A 1JNKA 2BPMA 2XF0A 4AQCA 4BDEA 5DRDA 4EOKA 1A48A 2X9EA 2XEYA 3ZUVA 3LW0A 3GU4A 3MY1A 5CX9A 4B9DA 3UYTA 3MVJA 3QD4A 4O7TA 4L42A 5HORA 3SOCA 4U45A 4OTQA 3V8TA 3A8XA 3UC4A 3PIYA 4I5MA 1STCE 4ASZA 4EK8A 4EOOA 2RGPA 4J98A 3UTOA 1XH7A 4J52A 4W9WA 3OWJA 2G2IA 4XYFA 3VBQA 4I24A 3NS9A 3LCSA 1E9HA 3TCPA 2BDWA 3CY3A 3QCYA 4IAKA 4RLLA 4ITJA 4YHFA 4I6FA 4PX6A 3FI4A 2F49A 1VJYA 2W9FB 4NFNA 4CKJA 2QOLA 4IFCA 3ODYX 4I94A 3Q52A 4FUYA 5CF4A 5J79A 1ATPE 3PUPA 5GJFA 1JSTA 2XNMA 3KULA 4BYIA 3F9NA 4F1MA 5AP0A 3TDWA 1PXNA 3ZLXA 2VTOA 2E9OA 4B7TA 2WMXA 4WSYA 2X6DA 2WQNA 3DT1A 4HYIA 3ZDUA 4E6DA 1GOLA 2J9MA 3HEGA 4GL9A 4QYEA 4QMZA 2ZV2A 4RQKA 2BIKB 4NH1A 3HV6A 4F1OA 2XP2A 5E91A 3KVWA 1H1RA 5CNOA 2W5HA 3RCJA 1WVWA 4BICA 3VIDA 1SVGA 3HMOA 3FLSA 4EBVA 2W99B 2EXMA 4TYHA 2YWPA 5ANDA 2HZ4A 5AP6A 4G2FA 3RTPA 3R9NA 2PUUA 3TDVA 3M2WA 2YM3A 3G5DA 4FVRA 3COHA 3NUXA 3QWJA 2G2HA 4ALVA 4X3FA 4EKKA 2R3GA 3G9NA 4FK3A 2W4OA 5HBEA 4ACHA 4F7SA 3BWFA 4RIYB 4PV0A 2XNPA 4ENYA 1ZMUA 4Z55A 3BKBA 5GJGA 4BCJA 1WAKA 3B8RA 2PUPA 3DV3A 4A9YA 3IDBA 1M17A 3D7ZA 3KQ7A 4ZSLA 3LFEA 4AE9A 3NIEA 3LM5A 1ZYLA 4QYHA 2B7AA 2EB2A 3CD8A 4CFNA 1REJA 5CAVA 2WU6A 5J9YA 5DEYA 5BX0A 1W0XC 3CJFA 4CCBA 2OG8A 2Y8OA 4RVTA 3SRVA 4PNKA 1WVYA 4WD5A 2WAJA 1LEWA 2W1DA 4PF4A 4DCEA 5KMJA 5KCVA 2WXVA 3MESA 3U9CA 1XH9A 4J71A 3ZBXA 4D58A 3D14A 3BZ3A 3NCZA 5IF1A 4C57A 3CE3A 4MNFA 3TTIA 1NW1A 3NNUA 1Q62A 3PXFA 1ZOHA 5CXZA 5JEBA 3ZFYA 1YDTE 4B8LA 1H08A 3T3UA 3GU6A 3OOMA 3VBXA 4E26A 2ZM4A 4ZTRA 4C62A 3ATTA 3KRRA 5IEVA 4GU9A 3CKWA 2ITOA 3SG9A 4ZLOA 2XJ1A 2PTKA 1FGKA 2W5AA 3HGKA 3OD6X 4FT5A 3K3JA 5AV2A 3IGGA 1YDSE 3BHVA 3L8XA 4DEAA 2WMWA 4YLJA 3RAKA 3RK5A 4EH3A 1V0OA 1Y91A 5FTOA 4PRJA 4D4YA 1G5SA 1MRUA 1H1WA 3C4EA 3V3VA 4DFNA 2FVDA 2W1EA 2YABA 5AV0A 4UV0A 5HTCA 2QKRA 3QZHA 4XNEA 4AOJA 1OM1A 2SRCA 4FIHA 2VX0A 5J8IA 3U6JA 4C0TA 4O96A 1PYEA 2R3MA 4FICA 2ZAZA 2CGUA 3Q3BA 1DI8A 4D0XA 2XYUA 2HW7A 1ZY4A 5JH6A 3BX5A 2W05A 4BCIA 4TPTA 5D12A 3OCTA 1G3NA 3MFSA 2C5OA 2IVTA 2Y7JA 3PVWA 3KXXA 3GXLA 3QGYA 3EN4A 2XIXA 4TWNA 2JIUA 3HLLA 4RIXB 3TUBA 3DZQA 1QPCA 2ZB1A 4ITHA 4KKHA 4S34A 2R3RA 1OVEA 5CWZA 3VS6A 3NYVA 4YR8A 4U8ZA 5HD4A 4DLIA 3F5GA 3BBWA 3NUYA 4L46A 1H01A 4RBLA 2ITYA 4BZDA 4LV5A 4E3CA 4GKHA 2RIOA 1HOWA 5BVFA 3QU0A 3I6WA 3MB6A 2IO6A 1JVPP 1V1KA 2YLFA 5L6WL 4GVJA 2C6LA 3EN7A 5KBQA 2B53A 2OF4A 1WBOA 2CNUA 2Q83A 3AD6A 3HRCA 4L3LA 4NKAA 3SG8A 1M2RA 3CBLA 4X6QC 4MH7A 4K8AA 4DEBA 5L6PA 3EQIA 3QX4A 2YFXA 4I23A 3A99A 5D7AA 5CANA 4BR3A 3VW6A 3KCKA 3H0ZA 5HO7A 4EH5A 2OICA 4HOKA 1PMNA 2C6IA 3NWWA 4AG8A 5ANEA 3DAEA 3E88A 3PJ3A 3PXRA 4C4GA 4K6ZA 1KE6A 2QD9A 3GUBA 3NUPA 3P0MA 4MWIA 1YVJA 1JKTA 2IZSA 3HVCA 4TXCA 3RPRA 3TZ7A 1Q99A 3UNJA 5AR4A 4FK6A 2BRBA 1P2AA 3R8UA 5HTIA 3F82A 4E6CA 5JFSA 4AW0A 4AOTA 2J7TA 2B4SB 4II5A 4YTCA 4J8MA 3ZSIA 3I0QA 3D94A 3MJ1A 2PVKA 4O0SA 3JR1A 4FOBA 5H8BA 3VF8A 4CFMA 4EZ5A 1UWHA 3ACKA 3RGFA 1PXPA 1Y8GA 5DHJA 1W7HA 4TT7A 4QYGA 4BF2A 1EH4A 2R7IA 2BHEA 2CLXA 2XK7A 3ORPA 4M14A 3RJCA 3SXSA 5FTQA 3QQLA 2Z8CA 3ZDIA 4JQ7A 4DGGA 4BY9E 2XRWA 4W8DA 3R1NA 1OKYA 4ENXA 4HGLA 4Z9LA 5AA9A 3RCDA 2IN6A 5CXHA 3O2MA 2C3IB 5A4LA 5B2MA 3QXOA 3NSZA 1BMKA 3MWUA 4CZYB 5CALA 5AV3A 3C9WA 4O6EA 3LIJA 1KSWA 2EVAA 3QRUA 5J95A 5I9WA 1YOMA 3QX2A 1G8AA 1ZZLA 3UVQA 5A6OA 3SW7A 1PHKA 3H9FA 5F20A 3T9TA 2YEXA 4N4SA 2YDIA 3R2BA 4H1JA 2C3JA 4U43A 4WG4A 5HNGA 3KRLA 4AFJA 3FMMA 1FVTA 4DN5A 4ZLYA 5HICA 4L67A 4FF8A 4YZBA 3OUKA 4IANA 2J0MB 3MH1A 1QPEA 1Q4LA 2AC3A 4OTPA 4GK3A 5AIKA 2YITA 4GH2A 3E8CA 5C01A 1PRYA 2X4ZA 1WBPA 3CC6A 2PVMA 2QOOA 4QMWA 4QMXA 1S9IA 3WZJA 1NT2A 5FG8A 5M06A 3DTWA 3IO7A 3NYOA 2OIDA 3QRIA 4DH5A 4E6AA 4J99A 2OFVA 3FHIA 4BZOA 3Q6WA 4LUDA 4P2KA 3FZTA 4TY1A 3TV7A 3E8EA 2GNHA 4EJNA 4ZLZA 4QT1A 5DA3A 2V5QA 3NYNA 3EQDA 3HMMA 4MHAA 4IFGA 3KL8A 3VUDA 4DG3E 3MA6A 4OR5A 3DAJA 3R8LA 2ITVA 3GGFA 3Q96A 1P5EA 3DPKA 4IADA 4JDHA 4MTAA 3B2WA 2UZNA 2XA4A 5CQWA 1KV1A 2FGIA 4G6LA 5CF5A 2E9VA 3CS9A 1NY3A 4UYAA 2WIHA 3C4ZA 2I0YA 5KBRA 2F57A 2Q0NA 4BGQA 5A6NA 5IA3A 5J9ZA 5L2SA 4PDYA 3QD3A 4AXAA 3C5UA 1PJKA 2FSTX 2OI4X 4MNEA 1APME 2ITWA 5FXQA 2JITA 4F1TA 4TW9A 2CKOA 1W98A 2VTNA 4KABA 4EHGA 3F2AA 3H0YA 3VAPA 3NYXA 4O0RA 2WTIA 1U59A 3AMBA 1W83A 1ZYSA 5EDQA 3TM0A 3FYKX 3KRWA 4ZXTA 4IDTA 4RX7A 4QYYA 1DI9A 5E8YA 4RVMA 1MQ4A 3HX4A 5AFVA 1XQZA 1PXIA 1WBVA 4GIHA 4CCUA 2OXDA 4NEUA 3DAKA 4WBOA 4YLKA 5E8VA 2C6OA 4FKOA 4U79A 4E4NA 3NW5A 5JRQA 4NZWB 4MKCA 4YO6A 3FZSA 4G6OA 2I0HA 5DYJA 3F3TA 3PJCA 4NK9A 1GAGA 4K77A 4FV6A 4JVGA 2A27A 3OW3A 4RJ8A 4OTHA 2YJSA 5A4QA 4XG2A 4D2WA 3TACA 4DEGA 3ETAA 3TNHA 3OTUA 2PVHA 4S2ZA 4F70A 4DGNA 4MCVA 3SVVA 3VS4A 4BHZA 2WMAA 2BHHA 3F69A 4A9UA 4JRVA 4FIFA 5J9LA 3QWKA 2CCHA 4GSBA 2IWIA 4GCJA 3JUHA 4ASEA 5KO1A 2R3OA 1SYKA 4D2PA 3VUMA 4AT3A 4UN0C 1B39A 2BDJA 4D2RA 5EH0A 5I9XA 5LWNA 2UW9A 4R6VA 4XUFA 4CGAA 4IZ7A 4FV1A 2GDOA 4MF1A 4ZZNA 1MUOA 3EQRA 1Q3DA 4B0GA 1M14A 2QI8A 4ZS0A 4FC0A 5AP5A 3O71A 1WFCA 1SNUA 3BGQA 3R01A 1JKKA 3IW8A 4L3PA 4LYNA 2QURA 4TWOA 5FQDC 3TN8A 4B6LA 4M68A 1KOAA 3R30A 4L52A 5H8GA 2CKPA 1PXLA 4IJPA 4ZTLA 4EH6A 3WF9A 5EQYA 4BL1A 2OH4A 2O63A 2YAAA 2PE0A 3NNXA 3QD2B 2IG7A 4YJQA 4DTKA 2PUIA 3O8TA 5HCYA 4JI9A 2WB8A 4BCMA 3OWLA 4ONAA 5EDRA 4DHFA 3P7BA 4BWPA 4JBPA 5FEQA 3AMYA 1U5RA 3DB8A 4XRJA 3ERKA 4MBIA 4PP9A 4UMQA 4F9WA 5FBOA 2IZRA 2REIA 3AC4A 4FKTA 4AZSA 4O1PA 3ORZA 4FIEA 4EK6A 4QP9A 3EKNA 3N4UA 2J6MA 5FGKA 2XCKA 1AQ1A 1YKRA 3U87A 4FL1A 2PSQA 3GU8A 3HMNA 1J91A 3UE4A 2CNQA 5KKRB 5LVOA 4I0TA 2OWBA 4A4OA 4TRLA 3HRBA 4FSMA 3W33A 2F4JA 4R8QA 4WKQA 4YMJA 4CVAA 2BTRA 2OW3A 4QPAA 1IAJA 3P79A 3QHWA 2OZAB 3SX9A 4KS8A 3R63A 5AAFA 4M8TA 2C6TA 3QUEA 4DGMA 1PY5A 3BYMA 1IRKA 3EQBA 4IWPA 4PMSA 1H8FA 4G3FA 4IZ5A 4MF0A 3RHXA 3ZCLA 4QQTA 5IQHA 2HYYA 4YJUA 1R0PA 2HAKA 3BYOA 3DB6A 5BYZA 2I6LA 2PWLA 2VRXA 3QQUA 3L8PA 5CZHA 3UNKA 3FI3A 3RMFA 3GC8A 4GW8A 3F3WA 4FV5A 3IS5A 4I92A 4C36A 5GJDA 4EH8A 2BILB 4TYIA 3QCQA 4A4LA 3EB0A 5H8EA 1URCA 3GCVA 3EIDA 5IH6A 3KEXA 3HAMA 3Q60A 3OHTA 4MBJA 4FGBA 4JDKA 4FSZA 5D11A 4NTTA 2PYWA 5EM5A 2W0JA 2XRUA 4NW6A 2H9VA 4FL3A 3V6SA 3ZEPA 3DQXA 3IG7A 2B55A 1OBGA 5E8XA 4FTMA 5C9CA 5JN2A 4FEUA 4NSTA 3C7QA 5CF6A 2QOBA 2YM6A 3O50A 4FSQA 5KZ0A 2F7EE 3ULIA 3COKA 3HV4A 5BUEA 5IQAA 2QQ7A 5DGZA 4FSNA 2BRMA 5AUZA 2YIRA 4M15A 3UZPA 2GTMA 5AM6A 4CXAA 3WBLA 2ITPA 2FO0A 4E7WA 1UU7A 4FKLA 3ZBFA 3ZO2A 5CU2A 4D1SA 2I40A 2CCIA 3QALE 4FTLA 2JC6A 4ANNA 2GHGA 2BZJA 3EZRA 2PVNA 4YHJA 2X8DA 2XYNA 4QMPA 2JDTA 4EYJA 5AIRA 2PL0A 2OSCA 4PY1A 5B0XA 5TKDA 3WILA 4U80A 2WOTA 3Q9WA 4A9TA 5BVEA 4DA5A 4EOSA 4BCNA 5DI1A 2P55A 4O1OA 5FRIA 5BVKA 3ZTXA 1OPKA 2Z7RA 2VTTA 5HCZA 3RALA 4OW8A 1H27A 3AGMA 3IOPA 3L9PA 3PE1A 1OIRA 2WEIA 4YLLA 4IHPA 4MXZA 4QP2A 2VX3A 3A7IA 3D5XA 4DEHA 3L9LA 4CQGA 4CRSA 4FKRA 1QL6A 4H58A 3ROCA 1YRPA 1ZMVA 2QOKA 3VQUA 3BYSA 4DFZE 3ZM4A 3TEIA 2X6EA 2UZDA 4K9YA 1ZYDA 3ZZWA 3SLSA 2QNJA 3P5KA 2Z60A 2VWYA 2UV2A 3OXIA 2I0EA 3W8QA 4NFMA 1OKWA 4H1MA 2F9GA 4LMNA 4RFMA 4RJ5A 2YLEA 3IK3A 3BYVA 5EYDA 4PWNA 5D1JA 5L3AA 4UX9A 4NW5A 4YNEA 1CSNA 3C13A 4CFXA 2ESMA 2W5BA 4E73A 3F5PA 1J1CA 4RWIA 1XH6A 5TO8A 4C34A 4U81A 4FKGA 5M4CA 2A1AB 2WTCA 4FVQA 3TT0A 4O7LA 1XH8A 4FBXA 5BVDA 4JG8A 5KX8A 2WU7A 5HG7A 3E3PA 5ITAA 3O0GA 3T3VA 1XKKA 2EUFB 2QO7A 1OITA 3LJ2A 4FG7A 4R7HA 4EHVA 3MSSA 3QLGA 4NU1A 4DBNA 2BAQA 3HRFA 4AGCA 4H05A 3HNGA 4I20A 2FH9A 1RDQE 2B9FA 4ZJIA 5CEIA 3E5AA 2IZUA 5J7BA 5DWRA 2V22A 2OJJA 1H24A 5DR9A 3OT3A 1U4DA 2C6DA 4L01A 4E5AX 5C4LA 2RFSA 3SV0A 2X1NA 4IJ9A 2B9HA 3R8VA 3UOHA 3ZRKA 3D4QA 3Q9YA 1FBNA 2FSMX 3LZBA 4QTEA 3FQHA 5IG1A 2J5EA 3HV7A 3BIZA 1ZZ2A 2BKZA 3LQ5A 2ZM3A 1PXMA 1V0PA 4TTHB 4Y73A 4BDJA 4FTTA 3DBCA 2ERKA 3ODZX 2BMCA 3IDCA 2IVSA 4PNIA 4H3QA 4EQMA 2GS6A 4V05A 1YWRA 4F09A 4IACA 3ZU7A 2A2AA 4JQEA 4F9AA 3BU5A 1NA7A 3D2KA 3FL4A 1BLXA 3O7LB 4D9UA 4OUCA 5H2UA 2RSVA 3MS9A 5BVNA 4R7IA 5E4HA 3R7YA 4U40A 3BHHA 5BUJA 1J7IA 1ND4A 3PG3A 5F1ZA 1FPUA 4F99A 3CQEA 1PXOA 2XKEA 3A62A 3GI3A 3DK7A 3TKIA 4B8MA 2BR1A 4XS2A 2QU6A 2WZJA 4XCUA 2UZVA 3BQCA 4G34A 4XOYA 4C4EA 4I5HA 4UXQA 5H9BA 4YTIA 5FTGA 3ZZEA 3BBTB 4K18A 4JT3A 4YPSA 2GQRA 4EQUA 3O7LD 5EKOA 4X21A 2FSOX 3WZKA 2V0DA 4ZY6A 3BLHA 2R7BA 3LCTA 5JGBA 3KU2A 3TZ8A 4BGHA 4HVSA 5EKNA 4IBMA 3UO6A 3ZRMA 3FJQE 4AOIA 5HCXA 4OTIA 5ANIA 2UVZA 4C3FA 4ZP5A 4RG0A 4D9TA 2RG6A 4JBOA 4DFXE 3PVUA 5LCJA 3G6GA 2H6DA 2O2UA 3W2OA 3VUKA 4PDOA 1R78A 3RVGA 1GIIA 2YCSA 4O0YA 3COIA 4HNIA 3I79A 5L2WA 1UV5A 2O65A 4OAVB 2JIVA 2PVYA 2WD1A 5E1EA 3WIKA 2DUVA 5DR6A 4ZJJA 2I0VA 5IUIA 4EC9A 3EN6A 5FD2A 3MVLA 4EOJA 3TWJA 5K9IA 5DH3A 4U7ZA 1Y8YA 4I0RA 3VJOA 3WF5A 3ZOSA 4HZSA 4ACCA 4C35A 5IA4A 4TNDA 5M4FA 3VS2A 4O83A 3D0EA 3R8PA 3RAIA 2BRGA 2QCSA 4CFUA 4LRMA 1U5QA 4QNAA 1T45A 3BHYA 5I9UA 2NRUA 1LEZA 3HZTA 4FODA 5DT4A 2ZVAA 2UW5A 1UA2A 5EM6A 4YHTA 3OXTA 3PP1A 3UIUA 4CMTA 3DXNA 4L68A 3KK8A 3F2RA 3QYWA 4WG3A 5J1VA 3IW7A 4HGTA 2PMIA 3R83A 4DFYA 2OJIA 4HCVA 4UWCA 4BCFA 4XJ0A 2F2UA 2GSFA 2VGPA 5F94A 5FEEA 5HI2A 4ANBA 5BYYA 2OF2A 5JFVA 1ZOGA 2PVJA 2XCHA 3PZEA 4JOAA 4QP3A 4I6QA 3SOAA 2BVAA 4CT1A 3V51A 3V6RA 2R3IA 4IW0A 5ETCA 1PMVA 1U46A 4F9CA 4HJOA 5FXRA 1JPAA 3EFWA 4GFOA 4LM5A 5A3XA 5HNIX 5KHWA 3KULB 2C5NA 3VUTA 4FX3A 2VWWA 5AP3A 2UZUE 4O81A 4BDHA 1KE7A 4HVGA 5BUIA 2PZIA 3IONA 4NIFA 4P5ZA 3I81A 3LFAA 3OROA 3QCXA 3DXQA 1YQJA 2XNNA 2XUUA 3PPKA 3RK9A 5L6OA 4C61A 3VBYA 4PUZA 4MK0A 3DXPA 2C3LA 3RI1A 4ARKA 4YSMA 1MP8A 1YXUA 4EK4A 1DM2A 2J0IA 5HG9A 3UOKA 2HK5A 3KMMA 2GMXA 4QTAA 2GTNA 1UNGA 2UW8A 2RFDA 3QQFA 3FLWA 2ERZE 5LMAA 3PXKA 4FKUA 4CMOA 4USFA 1XWSA 5L4QA 3ZO1A 4DTAA 4LOOA 4YGAA 5HNBA 2E9NA 3EQFA 3ZEWA 4X3FB 2HELA 4DH8A 1H0WA 3O96A 3UMWA 1AGWA 3HAVA 4CV9A 2WNTA 2Y6MA 3RINA 2RL5A 5LXMA 3FC2A 4TKSA 2Z02A 4NYEA 3SW4A 4J7BA 4FTOA 1H25A 2GNGA 4D1ZA 4AWIA 5DN3A 3NRMA 3F6XA 4CTCA 5HX6A 4J8NA 1QPDA 3ALOA 2CLQA 3LFDA 3SRVB 2RFEA 5HLWA 2V55A 4U5JA 4GJ2A 2CNVA 5HIEA 4DAWA 1J7UA 1KV2A 2J50A 2Y4IC 4FKIA 4IE9A 4X2FA 5CSPA 5KMOA 1F3MC 3LKMA 3SXRA 4A9RA 4MEDA 3NVKI 3Q4UA 4O7NA 4FKVA 5AJQA 2YM4A 2YN8A 3P78A 4E20A 4O21A 2PMNX 4FYOA 2C0OA 3MFRA 2CHLA 4ID7A 4RZWA 4WNOA 4IMYA 3N4VA 3K2LA 3PA4A 1IEPA 3D5UA 4JR7A 5EFQA 4NCTC 4G9RA 3HDMA 4PDSA 5CU4A 2JDRA 5A4TA 5KMIA 3DLZA 3W2CA 1MRYA 1L8TA 3QTUA 4BWXA 4I1ZA 4FTJA 1OL6A 3DDQA 3PSDA 3G6HA 3TXOA 4DLJA 3PWDA 4BKJA 4I0SA 4YP8A 5J7HA 5HO8A 2QU5A 3I0OA 2IZTA 3ROYA 3QZIA 3C4CA 2UW6A 3WARA 2OFUA 1BUHA 4WRGA 1H28A 2X81A 3BE9A 3MH2A 4A7CA 4CMUA 4ZJVA 5JQ5A 2W1FA 3CD3A 1OECA 4S32A 3M1SA 4XV3A 4RIYA 1V0BA 3OMVA 2WTVA 2BALA 2XKDA 4L45A 4D5HA 1AD5A 3HKOA 5CSXA 3ANQA 4CTBA 4DEDA 5IZFA 5AP1A 4F7LA 2XB7A 5AA8A 5TT7A 4RSSA 3VS5A 3C0IA 4C33A 5M09A 4Q9ZA 4FUXA 4EEVA 4J1RA 1OB3A 2GFSA 3PRFA 4IX5A 4EJ7A 4QMQA 2HY0A 2XJ0A 5DFPA 3FZ1A 4MQ1A 4I5PA 3A4OX 2XK9A 2PMLX 3QQKA 3MTFA 1I44A 2G15A 4XG8A 4XP0A 2V7AA 1Y57A 3FL5A 2WGJA 3PP0A 5CSVA 2PHKA 2Z7SA 5FP6A 5GIPE 3Q4CA 3R1YA 4CLJA 4IX3A 3ZUUA 4ZTQA 4O22A 3IOKA 3VRYA 2XM9A 2X7GA 2QO2A 3FMKA 5AUVA 5K4IA 3VBWA 3C51A 2I7QA 3CPBA 5EI8A 5DEWA 4KIKA 4IH8A 4QMTA 3BI6A 3QFVA 1YHWA 2WMUA 4W4XA 4ORKA 3MIAA 3VN9A 4R7BA 2Z2WA 3E7OA 3FQSA 3MB7A 2JFLA 4EH9A 3UODA 3C4WA 3MA3A 4OTDA 1H00A 4FSTA 2V7OA 3P08A 4YJVA 3W32A 1W82A 1Z5MA 3DQWA 4IQ6A 4ZSEA 4EWHA 4QMUA 3GC7A 2JGZA 2RF9A 3K5UA 2QOHA 4JG6A 4MX9A 3FAAA 5HEZA 1ZYJA 4APCA 5AR2A 4WOVA 4JR3A 5EOLA 3LFBA 3GC9A 5CTPA 4JAIA 5ANGA 5HE1A 4I22A 3UVRA 1XO2B 2WTWA 1M7NA 1WMKA 2W7XA 4MXCA 2YJRA 5D9HA 5IUHA 2HZIA 4GIIA 5DVRA 5EM7A 2WHBA 4ZTSA 3UYSA 2X2KA 3VBVA 3RAHA 3BPRA 3UQCA 4UWBA 3U9NA 5E8WA 2XBJA 2C5XA 3B8QA 3QL8A 1IA8A 4Y95A 2VAGA 1JWHA 2YIWA 4RIWA 5CT0A 5GZ9A 2PK9A 4UWYA 4I5CA 2VX1A 4LL5A 5TOZA 2VWUA 2JKKA 4APPA 3QTXA 3GU7A 4EOPA 1GZOA 2QR7A 5D7VA 1K2PA 4FKWA 4EI4A 2OXYA 5DBXA 5HG8A 1PMEA 3QRKA 2XH5A 4BZNA 5CAQA 5KHXA 2WTDA 1MQBA 5HZNA 4AT5A 3PY1A 4FT0A 4C8BA 3PRIA 4F4PA 5L8JA 2XKFA 2OH0E 4UB7A 4O84A 5BVOA 3UO5A 3KGAA 3PLAE 4PTEA 4IB5A 3MY5A 3NW7A 4IIRA 2YDJA 3EOCA 4F0IA 3HP2A 3QF9A 4EH4A 4ZMFA 2HIWA 3R71A 4F7NA 3FBVA 3CTHA 4AN9A 4PMPA 3TNPC 4B99A 5DR2A 5K0XA 4JIAA 4YJRA 3ZSHA 4PL3A 3DTCA 5EHLA 3ZS5A 2WTJA 5FDPA 4UMUA 2HZNA 4IAAA 2CSNA 4KUJA 5EOBA 1MRVA 2XK3A 3TV6A 2WMVA 4FT7A 2XNEA 4I3ZA 2X4FA 3A7GA 5HHWA 3RPOA 4QQCA 5GHVA 4O27B 2O5KA 4K33A 5M4UA 4FSRA 3F3ZA 3PY0A 5I5ZA 3P1AA 3KF7A 3UPXA 3D7TA 3OC1A 4ZTMA 2E2BA 2PUNA 4PL4A 4CLIA
chains in the Genus database with same CATH superfamily
3Q32A 2FUMA 4MWHA 5EHOA 5EHYA 3NNWA 3V5PA 2A4LA 2JBPA 3EYGA 4X0MA 4O7YA 3LCDA 3PXYA 3OCGA 1WVXA 3ZXTA 5JMSA 4NJ3A 4F78A 3SHEA 3NW6A 3PYYA 5L8KA 1ZRZA 2W1IA 5JKGA 2QHNA 2BZKB 4IC8A 3GFEA 4QMVA 4XOZA 4DH1A 3UNZA 3T8OA 4I93A 3DJ5A 3PJ8A 3MDYA 2BAKA 5C8MA 3V5QA 3PPZA 2GCDA 2R64A 4DYMA 3KRXA 5AMNA 5HE3A 4F0FA 4IM2A 4RMZA 2ITNA 2RG5A 4CKIA 5DLSA 3MVMA 2W1HA 5DOSA 1CKIA 3WYXA 4R5SA 5EYKA 1OKVA 4HYUA 4OTGA 1KWPA 3ORKA 5AP2A 3VUIA 4AF3A 4FKPA 1FVVA 4BTMA 3FXWA 5AP7A 4B4LA 2H8HA 2AC5A 2NP8A 4F9YA 4DTBA 1JAMA 2UVYA 4O7WA 4BCOA 4QP6A 4ANOA 4GRBA 5G1XA 1URWA 4AZVA 3QA8A 4H39A 4AN3A 4FYNA 5CU0A 4ZZOA 5IU2A 3H3CA 3BCEA 1YXSA 4J53A 4LFIA 4FR4A 3PIXA 2ZJWA 2KTYA 2QLQA 1LP4A 2X2MA 3DBQA 4TYJA 3EKKA 4FTRA 5HTBA 4K2RA 3L9MA 4W4VA 5D41A 4FG9A 1TVOA 4XP3A 3ZC6A 2R3JA 2C30A 4FV8A 4XG4A 2QG7A 2J5FA 4MD9E 2UZOA 5K5XA 2YZLA 4GV1A 4C58A 2C0IA 2VN9A 4DC2A 2ITZA 3MI9A 3CQWA 3QGWA 3PXQA 1GZ8A 2WOUA 4KKGA 4YZDA 3OVVA 2C5YA 4C37A 3F3UA 5J5SA 1SNXA 2XK4A 4BKZA 4F6WA 3R8ZA 3D5VA 3IECA 3POZA 3R9RA 3FEGA 4NL0A 4U44A 2GNIA 4M12A 5KMLA 3BHUA 4YURA 3CQUA 3PE2A 3KK9A 4GS6A 2AEGA 2CN8A 4L00A 4K0YA 2NO3A 3Q04A 4IVBA 3REPA 4RJ3A 1DS5A 1YOJA 5AADA 3E8NA 4QP4A 2BIYA 4JNWA 3HUBA 2C3KA 4ALWA 3UIBA 2EB3A 3K3IA 3PY3A 1TQMA 2C0TA 4QMSA 2VUWA 1WBNA 3I4BA 4BVUA 2X0PA 4M66A 3MPTA 3QZFA 5CI7A 5EDPA 4CNHA 3ORMA 1Z9XA 4KAOA 5AAEA 3KKVA 5M4IA 2YIXA 1BI7A 4V0GA 4W8EA 2WQEA 1Q3WA 4F7JA 2YDKA 3EFJA 1CKJA 4IEBA 5IQCA 2YCQA 3HECA 3WE4A 3GCUA 4HCTA 1OBDA 4GYIA 5K3YA 3LOKA 4N6ZA 3QTIA 5FM2A 4NT4A 1IG1A 5DMZA 3PUFC 1NVSA 3CGFA 4MXAA 4YNOA 3JVSA 1ZXEA 4AZEA 2OZOA 2WEVA 3PVBA 4WIHA 4OAUC 2IJMA 3QQJA 3KXNA 2GQSA 4FSWA 3MH0A 3PLSA 5FXSA 3WYYA 4ZEGA 4H3BA 1PXJA 3WE8A 4BKYA 4X2JA 4C59A 3G0EA 2OKRA 2JDSA 4C4IA 1CKPA 4ZTNA 2QOCA 4QOXA 3RKBA 5GINE 1NVRA 5FBNC 3RK7A 3TV4A 4R3PA 4IB0A 3MJ2A 3O8UA 3QUPA 4G1WA 5IA1A 3ANRA 4NJDA 3W55A 4IAZA 4CQEA 3KN5A 2UZWE 4FT3A 4NCTA 3QYZA 4XG7A 4G5JA 3UDSA 5B2KA 2AYPA 2J4ZA 2IW8A 3LVPA 4C4FA 3TKHA 4G3EA 4YJNA 3ZHPC 2PMOX 3EQCA 4A9SA 1H1PA 3M42A 5CEOA 3R2YA 3VQHA 3TTJA 4JS8A 3AXWA 3MYGA 5H3QA 3RPVA 1FOTA 5JQ8A 1IA9A 3C5IA 3KA0A 5JZNA 4O0XA 3EMGA 4AZWA 2UZLA 3I6UA 1FMOE 4FEWA 5IEXA 4ALUA 4FZFB 3VW8A 4GUEA 4LGDA 3LFCA 3QTWA 5CZIA 1ZAOA 4AN2A 4G9CA 1Q41A 4DFBA 3OWPA 3OUNB 2XMYA 4PTCA 2O64A 2YCRA 4R1YA 4AZTA 1H4LA 3PG1A 1ZY5A 2ZV8A 2W1ZA 2YA9A 3LFSA 4W9XA 3RPYA 4YBJA 5HD7A 3P86A 5CVFA 2X7OA 4E4XA 3VO3A 2CGXA 2KULA 4QMYA 3TKUA 5I3RA 4KIOA 3ZLSA 5AUWA 3KXZA 4L9IA 4LI5A 3OCBA 2DS1A 5EI6A 3ENHA 3E62A 1QMZA 4JX7A 4OGRA 2OJGA 4PL5A 1E1XA 4RZVA 5HIDA 3R9DA 3V01A 2W96B 3DFCB 4IX6A 5DNRA 2FYSA 3OXZA 5IQGA 3ALNA 3GQIA 5A4CA 1OPJA 4FKJA 3F61A 3LM0A 1Q8YA 5AR5A 1Q61A 2Y9QA 3R7GA 4QP1A 2BDFA 3S3IA 3VS1A 1J7LA 4DGLC 4KIPA 5HGIA 3RPSA 4D55A 4DG2E 3PWYA 4BCPA 3NLBA 5IKWA 5FP5A 3R7IA 3ZUTA 4AW2A 3V5TA 3DZOA 4XV9A 3Q2JA 3UIXA 4TWPA 1ZYCA 3N51A 4EC8A 5A9UA 3Q2MA 3WIGA 4GG5A 2JKQA 5AEPA 4L7FA 5E8UA 4LOQA 4TZRA 3EQGA 3IW5A 1U54B 3MFUA 5CAUA 2Z7QA 2J0JA 3DNEA 3R22A 1XH5A 3NX8A 1FMKA 3ORIA 5E8TA 4OBPA 2XIYA 5FM3A 4ZMEA 5I4NA 1SVEA 2XS0A 3KCFA 5LARA 5JT2A 2ZM1A 4RC4A 3L1SA 1JBPE 4WG5A 1VYWA 3DS6A 5ETAA 3UQFA 3OG7A 5DT3A 2JAVA 2UW4A 2PZ5A 3G90X 5A4EA 3NCGA 4IM0A 2F7ZE 4JG7A 2PZYA 4AP7A 3MH3A 4NWMA 4PMTA 3T9IA 1CTPE 2C68A 4UEUA 4LGGA 5E7RA 4BDKA 4MAOA 3QQHA 3UIMA 3DKFA 4G6NA 2A0CX 4C2WA 4WRSA 4XG6A 2A19B 3VC4A 5EQPA 2WTKB 2X0QA 4BB4A 3AC8A 4F64A 1GJOA 3I7BA 3SA0A 4QMMA 1XH4A 3HMIA 2WQOA 5IQDA 3S4QA 2LAVA 3FDNA 3L9NA 4UY9A 3LFNA 3QKKA 4FNWA 5E90A 5T6KA 4AS0A 4DEIA 2BFXA 5LMKC 4BGGA 4L3JA 3G2FA 3OEZA 3LAUA 2YAKA 4FZDB 4EH7A 1Q8ZA 3FKNA 4QTCA 5CEPA 5C27A 3Q9XA 4UMTA 4FGRA 3UO4A 3PA3A 3QA0A 4IWOA 4G5PA 2HY81 2EXCX 4JQ8A 4EBWA 3W18A 5HE0A 5IISA 3P23A 1JQHA 3AD4A 2JIIA 2DWBA 3CGOA 3R21A 2G9XA 2ZMCA 3GCPA 3MV5A 1B38A 2B9IA 3QKLA 2FB8A 5CLPA 5T68A 2ZYBA 2JD5A 3LXKA 1OIUA 4F6SA 2J2IB 3FZPA 2YISA 2CJMA 5HX8A 2NRYA 3FC1X 3WZUA 2PVLA 3NGAA 3N4TA 3FV8A 4FV9A 2VTHA 1WBSA 4TN6A 1T46A 5KMMA 2ZDTA 4TNBA 5BMSA 2VO0A 4IB3A 2XNBA 2YWVA 5C26A 4RIOA 1REKA 5ACBC 3UGCA 1X8BA 4ZSGA 3AC5A 4RWLA 4R77A 2BCJA 3FLZA 1JOWB 4H3PA 4WT6A 5AR8A 3TJDA 3RZBA 4ZAUA 3QZGA 1XR1A 4DT9A 2XK6A 4PQNA 3UOJA 3WZEA 3NUSA 5IH5A 1KOBA 3GEQA 3UPZA 3IKAA 4BCQA 4HVHA 4WSQA 3LQ8A 2P2IA 5HKMA 5ANKA 1JSVA 4D4VA 5ICPA 1ZWSA 3PA5A 2VWBA 4O7ZA 3BLQA 2GFCA 2UZEA 4PP7A 4IDVA 1Q8TA 2IW6A 3ZC5A 4AUAA 3OS3A 3MFTA 4RGJA 3WOWA 1GZKA 4LRJA 4MQ2A 4UZDA 3R04A 1YHSA 1ZOEA 5D10A 4FIGA 4FV3A 3EQPA 5IDPA 1M2PA 4DITA 4M69A 4BI1A 3V5LA 5CF8A 4GUBA 3KVXA 5C03A 4CT2A 3SXFA 5LQFA 2VWIA 4ACMA 5CEKA 4O0WA 3R7EA 2VTSA 1QCFA 3D5WA 3FLNC 4CD0A 4HYSA 5BV3A 4Q9SA 3E93A 2VTMA 3EYHA 1YXXA 1L3RE 4FZAB 2YM8A 4M84A 2X0OA 2WMBA 3II5A 2WFYA 3AT2A 4MXYA 1PKGA 5EK7A 1OUKA 2WPAA 3FUPA 2JDVA 4PPCA 4D28A 4FEVA 5M08A 4DH3A 4LL0A 4E6QA 3ZFXA 5IA5A 1OMWA 2FSLX 4N6YA 3U4WA 5M56A 2YM7A 3KY2A 4GK4A 5LWMA 2UW0A 3R9OA 4F08A 2R3NA 2QOQA 5EW9A 2P4IA 3VS3A 5M07A 3GNIB 3BU6A 3EN5A 2DQ7X 4AAAA 2PE2A 2ETKA 4O0VA 2WKMA 3VBTA 1GZNA 4X6RA 2XZSA 3MPAA 4R1VA 4W4YA 4N0SA 1F0QA 5E8ZA 3TL8A 3RWQA 3AT3A 2W17A 4K11A 4XBUA 2XAMA 1LR4A 4NIFB 4KS7A 4RRVA 3GCQA 4EZ3A 4XG9A 3C4FA 3W0PA 3IW4A 1HCLA 2QR8A 3QLFA 4LG4A 3M11A 3SAYA 3TJCA 2VD5A 5A14A 3DKGA 4HW7A 1YOLA 4ZY4A 3I60A 3LCKA 2LGCA 3HV5A 4FL2A 3U54A 2Y4PA 4BTKA 5JGDA 1XBAA 3O51A 3Q4ZA 4EORA 4GFGA 2XM8A 2G1TA 3EJ1A 3JPVA 4BDBA 3GBZA 2J90A 1OKZA 4IVCA 4EK3A 3NR9A 3CLYA 4FNXA 4P90A 2C6KA 5CEQA 3RP9A 1RE8A 3QKMA 3ZRLA 2HXLA 3RAWA 3S00A 4QQJA 2OLCA 5CAOA 1YI6A 4BCGA 5HLPA 4AGDA 1XBBA 3NFFB 3OZ6A 3P7AA 2X7FA 4L6QA 4FE2A 3LFQA 4EHEA 4TYHB 4EQCA 5L2TA 3TYKA 5GIOE 4D2TA 1I09A 4O86A 3MBLA 2W4KA 4QMLA 4KSQA 3HMPA 3SGCA 4IAYA 3JYAA 5JFXA 2QKWB 4U97A 3GVUA 4O38A 3RWPA 5ETIA 3BEAA 4D2VA 3R6XA 5BPYA 3FYJX 4FI1A 1Z57A 3L8VA 4AX8A 2XKCA 3ENMA 3PTGA 1H26A 3FLQA 3C0GA 3NAXA 4WUAA 4BJJA 3H9RA 4BHNA 4BIDA 5CSHA 4EOLA 3HA8A 3E63A 4FTAA 4FA2A 5JSMA 1WBTA 3CXWA 4AGWA 4C4JA 1JKSA 1Q8WA 2R0UA 4D1XA 3DY7A 3ZM9A 2PPQA 2X39A 3ET7A 4DGOA 3WF7A 4BN1A 4XX9A 2VV9A 5K0KA 4E5BA 2R9SA 3NAYA 4YJOA 4E5WA 5M51A 2B52A 2QOFA 2X9FA 4YC8A 1OL1A 5LOHA 4YC6A 4YO4A 3HA6A 5LCKA 2C47A 4IX4A 4BIEA 1UNHA 3LMHA 3PSCA 3UG1A 4CV8A 4XBRA 3DKCA 3BV3A 3W0SA 3AC1A 4I4EA 2OBJA 5IQFA 4XLIA 3BQRA 3Q5IA 2QG5A 4CKRA 4BCHA 3DCVA 4IZYA 3FXXA 3QTRA 4I6BA 2YCFA 4O0TA 3UDBA 2CGVA 4CSVA 5KUPA 1DAWA 2XEZA 4KSPA 1RJBA 2UW3A 5DIAA 1TQPA 3JY9A 4IAFA 3VULA 2JDOA 2VGOA 5EW3A 2JLDA 4BDDA 1YHVA 4CZTA 3ORXA 3R02A 3RNYA 5B2LA 1OUYA 3EQHA 3QRJA 4FKSA 3NPCA 5HBJA 5IMXA 3FKOA 4Z7HA 3GOKA 5CS6A 4NKSA 2P3GX 4BBFA 2Y6OA 3QCSA 2PY3A 4FVPA 3DBEA 4RJ7A 1SZMA 2ACXA 3BELA 4L44A 3RBWA 4LGHA 3TIZA 4ANMA 4BC6A 4RVLA 4KWPA 5IMEA 3H9OA 3MPMA 4OTFA 2PE1A 4ZK5A 3RM7A 3ZO4A 5E8SA 1S9JA 4RLKA 1UVRA 3HYHA 4KINA 5J87A 3R8MA 3MN3A 3VS0A 4RX8A 1A9UA 5K4JA 2UZBA 1JKLA 2GNJA 4FTIA 4ZTHA 4ANQA 3QRTA 2GNFA 5M57A 3BLRA 3KMUA 4D0WA 3R9HA 4G16A 5E92A 5CU6A 4DCAA 1Q8UA 4RWKA 4YZMA 4JDJA 1PF8A 3I7CA 3GT8A 4FIIA 3OY3A 4CG9A 3UZTA 4RA4A 3A8WA 3DGKA 5M55A 2YACA 5HVJA 3KMWA 1IASA 3S1HA 5AUYA 1O6LA 4KIKB 5CT7A 4CFWA 3ACJA 4BDCA 5FEDA 4YU2A 3DLSA 2QLUA 4KRCA 1BL7A 3GOPA 3MGYA 3WF6A 5C4KA 4KRDA 4OBQA 2VTJA 1PW2A 5A54A 2ZDUA 3AG9A 3QC4A 5C1QB 4RPVA 2XVDA 2E9UA 5CQUA 3AGLA 5EM8A 5KKRC 2NNWB 5GNKA 5LVLA 3HDNA 3SQQA 1H1SA 1PYXA 5EYCA 2ZV7A 3E3BX 3ZXZA 4BYJA 4X7QA 4ZOGA 5CY3A 3CR0A 4C4HA 2RKUA 4O82A 2VNWA 3K5VA 3IQ7A 4G17A 4O0UA 4P7EA 3ID6C 5IQIA 5HVKA 4U41A 4AA4A 4DDGA 2CGWA 4FIJA 3AC3A 2ITUA 1LPUA 4FV4A 4JRNA 3EZVA 3DJ6A 4D2SA 2G2FA 4O2PA 3PJ2A 2HWPA 4F0GA 5A46A 4GU6A 2R3LA 4OT6A 4RA5A 3BE2A 4IM3A 1H07A 5FLFA 2FA2A 5AM7A 4EONA 4RQVA 4TWCA 2CKQA 3C4XA 4KKEA 2Z7LA 5CENA 3HP5A 5AR7A 3PZHA 4AU8A 3HV3A 4V04A 4RIWB 2PULA 4XEYA 3DOGA 3EH9A 3AQVA 4MBLA 5LVMA 2GS7A 3FZRA 4RC2A 3HUCA 5LMKA 4A4XA 3FPMA 2JEDA 3DJ7A 5B7VA 4RFZA 4A06A 3G51A 4LUEA 5TR6A 3CIKA 4IVAA 4OLIA 5JGAA 3RNIA 2WELA 3QTQA 1YDRE 3L8SA 4RIXA 5CVGA 5EW8A 2IW9A 3VJNA 4QMNA 3ATSA 3KREA 2WMSA 4JL9A 4C3RA 4X2KA 5BQ0A 2BRNA 2C1AA 2Q0BA 4YZ9A 1ZARA 1SMHA 2XNGA 3TIYA 2UZTA 2WIPA 1BKXA 2R2PA 4NM5A 5J1WA 4BIBA 3VVHA 3I1AA 4A07A 3E64A 4L53A 3O17A 5AUXA 1F5QA 4MD7E 3VRZA 2BZIB 3JS2A 1BI8A 2HOGA 3GQLA 3OCSA 4MXOA 4BWKA 4QO9A 4YJPA 4C3PA 4C7TA 4YZCA 5G6VA 4EZ7A 3IGOA 3FE3A 1IR3A 3QBNA 1NXKA 4USDA 3UBDA 3BV2A 3Q5ZA 4BDGA 4D4RA 1Q5KA 3SDJA 1OPLA 4KA3A 4XP2A 1RQQA 3IPHA 4HPTE 2R3HA 4FTCA 5JRSA 3WZDA 5LMBA 4S31A 4MXXA 2H34A 4AFEA 3CTJA 5T3QA 5JFWA 4J95A 4FZ7A 4DFUA 3R1QA 2ITQA 4V01A 5DE2A 4Q5EA 3DBFA 4DF3A 3D7TB 4NM7A 3JVRA 3H30A 3QQGA 4E4MA 2W9ZB 2CMWA 2XBAA 3Q6UA 4GYGA 5CVHA 3F5UA 2AQXA 2EXEA 4GVAA 2GQGA 2VTQA 5TE0A 5GZAA 2C1BA 3CJGA 3OP5A 3W10A 4YZNA 5TF9A 5FUTA 4IVDA 3FY0A 5CEMA 1P4FA 4FTUA 3EL8A 3C50A 3LHJA 5HO6A 1K9AA 2J0LA 4ZZMA 3NEWA 3P9JA 2WQBA 4U6RA 5M44A 4FV7A 2CKEA 3D15A 4DEEA 3EWHA 1YI4A 3QTSA 3W2RA 4GKIA 1HCKA 3PFQA 3PDTA 5ANOA 2WTKC 3UP7A 3QHRA 5M53A 3D83A 1OI9A 4WNMA 3FY2A 4QPMA 4PPBA 3FLYA 5EQEA 4FNZA 1H1QA 4HVIA 3AMAA 3S2PA 3A60A 3PPJA 2BFYA 4X3JA 2C69A 2W1CA 3NIZA 1M7QA 4G31A 3S0OA 4O7VA 4G3DA 3UC3A 4J96A 2IVUA 3LFFA 2HZ0A 1Q24A 4L8MA 2VTAA 2B9JA 5DG5A 1O6KA 4BBMA 4YUQA 2IPXA 4HPUE 3ORNA 2WMTA 2WMQA 5CI6A 5FDXA 3W1FA 4DE4A 1FGIA 4ITIA 3BRBA 4M67A 2OK1A 4YJSA 2P33A 5BMMA 4Y85A 4KNBA 1M52A 3CP9A 4RC3A 4Y8DA 3JY0A 2OJ9A 4HGEA 5EI2A 4O4EA 2UW7A 4MNEB 5CU3A 1OIYA 2O0UA 3QTZA 1GIHA 3ZYAA 4WUNA 4DT8A 3U6HA 2CPKE 1UU9A 3TNQB 4FOCA 1J1BA 3TI1A 3G9LX 3NMUF 3VHKA 4MVFA 2YHVA 4CRLA 4IC7A 3FSFA 2JBOA 3Q4TA 1GNGA 3AC2A 4JBQA 4YC3A 4AGUA 4F65A 4JMQA 3H10A 3FMLA 4OTWA 1WZYA 3D2IA 4BDAA 4XHKB 5L2QA 4Y83A 3IW6A 4M3QA 4QQ5A 2X0GA 5IH4A 1YI3A 3BGPA 3EHAA 3THBA 3BL9A 1OGYA 4M0YA 1BX6A 3P5JC 2C6MA 1XBCA 3F7ZA 5IDNA 3ZH8A 4ASDA 1UKIA 2X8EA 2ONLC 4ASXA 2IF8A 1WCCA 4FTKA 5CNNA 2BKKA 2WQMA 2GHMA 4XMOA 1O6YA 3PXZA 2W1GA 4WBBB 4PDPA 3KC3A 4AW1A 1PMUA 3G15A 1RW8A 3W2PA 2PVFA 2QODA 3A7FA 4L43A 4O7SA 3DNDA 1YWNA 2XIKA 4QD6A 2VTIA 4KD1A 4E93A 3BHTA 4V0GB 4BRXA 3LMIA 4R78A 4NM3A 2PZRA 3NUUA 3OTVA 4FTQA 5IUGA 3A2CA 1UU3A 4HGSA 3F3VA 3U55A 2EWAA 4IXPA 1VZOA 3FI8A 5K5NA 5AX3A 4M0ZA 4EL9A 5AUTA 4M13A 4AA0A 3DKOA 2OJFE 3FWQA 4ACDA 2B0QA 3F7WA 4AZFA 3W0MA 3S95A 3BGZA 4F6UA 4LMUA 3LXPA 4JBVA 3CPCA 1UWJA 2YM5A 3G33A 1OIQA 2Y4IB 4RX9A 5IQBA 2QHMA 4USEA 4ANLA 1OL7A 2C4GA 3VNTA 3MY0A 4RJ6A 3FSKA 4FZ6A 2XK8A 1CM8A 2XAOA 2ZMDA 1P14A 4YSJA 1KE9A 4EH2A 4XRLA 2ITXA 1XJDA 4R5YA 5KZIA 5HQ0A 4AT4A 4YJTA 3R0TA 4P4CA 5L8LA 2R3PA 3I5ZA 4BTFA 2HW6A 5I9ZA 4GK2A 2IVVA 4QDEA 5CSWA 3W2QA 3LE6A 4YTHA 4ZSAA 3R7OA 5HE2A 2F7XE 1KE5A 5BVWA 2AUHA 5KMNA 2VWXA 2HWOA 3ITZA 3R00A 4K1BA 4TYEA 2R0IA 3CCNA 1J3HA 4Y72A 3TUDA 3FMNA 3W8LA 4O7RA 3KB7A 3AOXA 4GT3A 3OBGA 4JX3A 4MD8E 4X2NA 4IWQA 1BYGA 3OT8A 3VS7A 4FKQA 4QP8A 3EFKA 1OGUA 1KE8A 3WF8A 4E1ZA 2R3FA 3BYUA 4U42A 3GP0A 3UG2A 4UMRA 3MTLA 4LV8A 2R5TA 3UQGA 5IPJA 4D4SA 5J5TA 3GCSA 2G01A 4KIQA 3DK3A 3BWJA 3I5NA 3LXLA 4G3CA 1CMKE 4Z3VA 3E92A 4BCKA 4FSYA 3DBDA 1VLRA 2VO3A 3CKXA 2VTLA 4XG3A 4EOQA 3CSVA 3R1SA 2ETMA 3A61A 4QP7A 5HESA 4KBAA 3NVMB 4XLVA 3LLTA 2XANA 5HOAA 5ANJA 4R3RA 5E9EA 3F88A 2OU7A 1B6CB 5AAGA 4HVDA 3FZOA 4H36A 3ULZA 3V8WA 3ZMMA 2QVSE 4WA9A 1NVQA 3NUNA 4X2GA 2R3QA 2VU3A 4O4FA 5AV1A 3OEFX 4L7SA 5DT0A 1UNLA 1M2QA 3GU5A 4Y46A 5AR3A 4AACA 4OTRA 1CDKA 5JK3A 3OWKA 3A4PA 3DDPA 3GB2A 2YERA 3AT4A 3QXPA 4KBCA 3VUGA 4IB1A 4C2VA 4Q5HA 4I21A 2RFNA 4FG8A 5BNJA 4O6LA 4X3FC 4AE6A 2I1MA 4CEGA 2ITTA 3PVGA 4EK5A 5IA2A 2OO8X 4FEXA 3U4UA 3SD0A 4BFMA 4BDFA 4RVKA 3ORLA 2BUJA 4RJ4A 4ACGA 1UU8A 3V04A 1TKIA 1WBWA 2BAJA 1JSUA 2O8YA 3OW4A 2B54A 4QRCA 3LPBA 3UP2A 1KUTA 3OOGA 4BI0A 1R0EA 2OZAA 3OF0A 5I9VA 5IEYA 3O8PA 1DAYA 2W06A 3FI2A 4EHZA 4PTGA 3A7HA 4EUTA 2QOIA 1G8JA 2ETRA 3QAME 4BTJA 1VEBA 4RX5A 3R73A 3UZRA 2HCKA 1H0VA 1LUFA 2OXXA 3LMGA 3O23A 4PPAA 5ACKA 4CFFA 4DFLA 4XH6A 5LJJA 4CG8A 3VWAA 4ERKA 2O3PA 2Y0AA 1JLUE 4FTNA 2CDZA 2VZ6A 4EOIA 4FT9A 3QC9A 4KB8A 3ZLWA 1XHAA 2H96A 2YZAA 3PSBA 5IA0A 5GZ8A 4JIKA 1GIJA 4M7IA 2PZPA 4GFMA 3MVHA 3DU8A 2PU8A 3MIYA 4WNPA 3DK6A 5AV4A 2XIZA 5JZJA 2ZV9A 3CTQA 3K54A 4WHZA 3ZLYA 2JKOA 1ERKA 4FEQA 3U8WA 3UDZA 1GY3A 4W4WA 3FHRA 3KRJA 2GU8A 2VNYA 1ZLTA 4FNYA 3BEGA 5BYLA 3RM6A 4CYJA 1W8CA 4CZUA 2V62A 3KN6A 5C8KA 3KXMA 3LXNA 4HZRA 4ANSA 5HU9A 4OT5A 3NUAA 3QD0A 4P5QA 4QPSA 5AUUA 5FWKK 3FMJA 2XARA 4TYGA 4AXDA 5KMKA 3LJ1A 2QC6A 1ZMWA 1VR2A 3CY2A 4ZS4A 4FMQA 3U51A 2JFMA 4NTSA 3DA6A 4QYFA 2BTSA 4JXFA 3TNIA 4QDVA 1Q97A 4UBAA 1E1VA 5CYIA 2OIQA 5AP4A 1PKDA 3F2NA 1U54A 1UKHA 4AAYA 5ETFA 4OBOA 5CASA 3MW1A 2J0KA 4F9BA 3DFAA 4GT4A 4S33A 2XIRA 3Q9ZA 5LVNA 2QONA 5HBHA 4ZIMA 1O9UA 3W16A 3FQEA 3UOLA 4KBKA 4AW5A 2X8IA 4DBXA 3P7CA 3TG1A 2EU9A 5I3OA 3TNWA 4AA5A 4O2ZA 3LLAA 2XJ2A 4GMYA 4F63A 4YPDA 4DG0E 4U3YA 3TUCA 4LDTA 4U9AA 1YXVA 3F66A 3FMDA 2XNOA 3GC0A 4RWJA 2YIQA 2P2HA 2YIYA 4Y5HA 4Z7GA 3VUHA 4LOPA 4FV2A 5HLNA 5HU3A 2HXQA 3OBJA 5KNJA 1IAHA 1ST4A 3PJ1A 3ZO3A 4N70A 4BDIA 3E8DA 5IQEA 1W84A 1P4OA 4XV1A 4ZSJA 1Y6BA 3NDMA 3D9VA 4QNYA 4G3GA 4JDIA 4I6HA 2UVXA 5HVYA 4UMPA 4E8AA 2DYLA 4N57A 3VF9A 4IAIA 4UYNA 3IDPA 4QMOA 3R7VA 4Z16A 1SM2A 2C5VA 4PMMA 4BI2A 2HENA 4S30A 3KF4A 1FQ1B 5I0BA 3H4JA 5E1SA 2JAMA 5EG3A 3CEKA 3C0HA 3QUDA 4HNFA 3HL7A 3B2TA 4NM0A 4EYMA 3KFAA 3E7VA 4J97A 4MYGA 3VONA 2B1PA 3UMXA 4LQMA 4HYHA 3ORTA 3GFWA 4M69B 4QTBA 4EOMA 1SVHA 3VHEA 4TL0A 4I41A 2PVRA 5F9EA 4GT5A 3GENA 3NFGB 3COMA 2NPQA 2OGVA 3WI6A 3ELJA 4I4FA 2VWZA 2R4BA 3NZ0A 5KE0A 3RZFA 3JXWA 2BROA 2VTPA 1YWVA 3E87A 2CN5A 4R3CA 4RFYA 4UZHA 4Y5QA 4EWQA 4YTFA 3ZFMA 2A98A 4JAJA 3RHKA 3C1XA 3FXZA 4GJ3A 4LRKA 4NUSA 3ZONA 5I9YA 4D5KA 5L2IA 1OL5A 3Q53A 2BZHB 1K3AA 2WO6A 4M97A 3V5JA 3U6IA 4YBKA 2VTRA 3R28A 2BRHA 4FSUA 1PXKA 4FV0A 4Q2AA 4C38A 4U3ZA 3FMHA 5AWMA 3FKLA 1BL6A 1FINA 4BBEA