3ZU7A

Crystal structure of a designed selected ankyrin repeat protein in complex with the map kinase erk2
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
344
structure length
344
Chain Sequence
EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/de novo protein
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 1
publication title Structural and Functional Analysis of Phosphorylation-Specific Binders of the Kinase Erk from Designed Ankyrin Repeat Protein Libraries.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 102
structure length 344
sequence length 344
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zu7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zu7A01
3C1XA 1UU9A 4ZIMA 5EK7A 3L8XA 5E8ZA 2ITNA 4EK8A 3UZRA 2QO9A 3AGMA 2OLCA 3JS2A 3S00A 4FSWA 4XUFA 4GVAA 3DU8A 4RVMA 4NWMA 4MXOA 4O0VA 3FC1X 4RVTA 1J7LA 3PA5A 3DAJA 3TZ7A 3AC3A 1H0WA 3QD0A 1KE9A 3F88A 4U79A 4EH4A 3P79A 4NKSA 4RWIA 4KB8A 4FNXA 4EOQA 4I0SA 3UNKA 1UNGA 1V1KA 3PTGA 4ID7A 3RNYA 3D15A 3FZRA 5K3YA 1G5SA 4BWXA 1G3NA 2J5FA 4FVRA 2Z7LA 4Z55A 4ZY4A 5JFWA 2R3GA 3HV5A 4IX5A 2Y9QA 2B54A 4U41A 2BIYA 4HYIA 3F5UA 4X0MA 2PVFA 5E92A 2UW4A 4DEHA 4O6LA 2JDSA 3V51A 4XG8A 2WZJA 4V01A 4IDVA 5I3OA 3E92A 2LGCA 4F7NA 5JGAA 5M56A 4MF1A 2P2IA 4ZSAA 4G16A 4UMQA 4RWLA 4ZSJA 3L9LA 1FVVA 3PRIA 2UZDA 4ZTLA 5ITAA 2HWOA 3ZLSA 4R6VA 1JVPP 3LCSA 5IQEA 2XIXA 3AC8A 4ZTMA 3VBQA 2ITPA 3OXIA 3AT3A 2CLQA 1XKKA 5L8JA 4CTCA 4Q5HA 4BGGA 2PUIA 3DAEA 1YWNA 2VWBA 4UWCA 4ACDA 4Q5EA 3R8UA 4FKPA 4A07A 2OG8A 5LMKC 2W1EA 3MS9A 4FNZA 5CT0A 3DDQA 5F9EA 1TVOA 2R3KA 4W9WA 4FOBA 4ENXA 5CAPA 4BB4A 2QVSE 2GFCA 4QMMA 2H8HA 1K9AA 2WTWA 1R0PA 1J91A 4Z7HA 4FVPA 2DUVA 1R3CA 4FTMA 4ZY6A 5CEPA 5CSWA 1PJKA 5TF9A 3RGFA 3UTOA 5IQIA 2W9FB 2WMXA 5DPVA 3TTJA 4JDHA 4C62A 2XF0A 3R63A 3RAIA 4J95A 4LOOA 4QP4A 3OC1A 4TWOA 2P4IA 2BDJA 3QQLA 2KTYA 2PVRA 4U8ZA 3U9NA 1UKIA 2VWXA 3MYGA 5JFXA 2JDOA 2P0CA 3DB6A 5J79A 3VC4A 2A4LA 2FSMX 3P08A 5KCVA 3DZQA 2ZV2A 4J98A 3IOKA 1QL6A 3RAHA 4PF4A 3EFKA 4QMXA 5I9WA 3ZO3A 4FEVA 5HHWA 3GCVA 4U3ZA 2XM8A 5AUYA 2O8YA 5HORA 4G3GA 5BPYA 4A4XA 5AEPA 2F7ZE 5T6KA 4WG3A 3LZBA 4FV6A 2O64A 2OKRA 3HV6A 4E5AX 4FIJA 4AE6A 2QOCA 3QKMA 5L3AA 3QAME 4FV9A 5HKMA 3CPCA 3QQFA 4WUNA 1SMHA 1VR2A 4J97A 4JIKA 3MVJA 5ACBC 2IW8A 2JFLA 4AW1A 4AA0A 4CQGA 2OZAA 5AA8A 4HGLA 5LOHA 3Q96A 4F9BA 3LPBA 3R04A 4FTTA 4BCNA 4E4MA 3MVHA 4AW0A 3BELA 3C0IA 3ORPA 4L46A 3POOA 3EQGA 3AD4A 4WG5A 4YJQA 5M09A 4E6DA 2A19B 5HX6A 5DYJA 3WIKA 2GQGA 4BDIA 4S33A 3OUNB 4FSTA 4AGWA 2G2FA 1H00A 4E1ZA 1A9UA 1NXKA 3ZCLA 3HMMA 4ALWA 5ANJA 3FL5A 4H58A 5AP3A 4AE9A 4EOIA 3SLSA 2NRYA 3G9NA 5AUXA 3QA0A 4DE4A 3PY1A 2JIUA 3TI1A 4IDTA 2J0JA 3V5TA 5EI2A 3QYZA 4ITJA 4MXYA 1LPUA 2W7XA 1BLXA 3I0QA 4LL0A 4C37A 4V0GA 4S30A 4UBAA 1W98A 4U9AA 5IG1A 4JBVA 4D2VA 4BCJA 5IDPA 2JAVA 3ANRA 4U44A 4DT8A 2PK9A 1OIUA 3FMKA 3JVRA 2PWLA 1XH7A 4F7LA 2WQNA 1PHKA 3E8EA 5AX3A 1U5QA 2VD5A 3TXOA 2VO7A 4NYEA 4APPA 1WAKA 4YZDA 4EKLA 5M4FA 4IACA 5BVKA 5CENA 2JC6A 3KA0A 3CQEA 3AC5A 3C4CA 4NFMA 4LGHA 4O0XA 3FAAA 2EU9A 2PZ5A 4B4LA 4MCVA 5AR7A 4E5BA 3C5UA 2YZLA 4BTMA 3W8LA 4CZYB 2GDOA 2JBPA 1YOMA 4I6FA 4PV0A 3UMWA 1GIJA 2W1IA 4G34A 5DNRA 3TWJA 2XA4A 4RJ6A 3R7IA 3C4FA 1LP4A 3BQCA 3QUPA 4NL0A 3HAVA 3CJFA 3FXWA 5IMEA 3EN5A 3GOPA 1KV1A 5EOBA 2WMRA 4O1PA 4FSZA 4XRJA 3ZEWA 5IQHA 4WRGA 4C59A 5AP6A 1Y6BA 2YDIA 1KE6A 4DEAA 3NUAA 5CAUA 1H01A 2FSLX 3OUKA 4PP7A 5CAVA 2BRHA 4ONAA 3GU7A 2YM3A 4FTJA 3R7YA 5AADA 5FDXA 4KA3A 3G90X 3IDCA 2BAKA 4FE2A 5LCJA 4S34A 4DEIA 4OGRA 1ZYLA 4PNKA 2GHGA 5CZHA 5HG7A 3OWLA 3PVUA 1WBWA 4EYMA 5HIDA 3A8XA 3GC9A 3NRMA 5CS6A 4FNYA 2HWPA 2Q0NA 4OTPA 4YJVA 5HVJA 4XP0A 4XG9A 2IVVA 4C58A 3AGLA 3CJGA 5AP5A 4ERKA 4UN0C 1Q8TA 4O6EA 1P2AA 4IH8A 3EHAA 5DGZA 5DOSA 3UG2A 3Q60A 2CGXA 2HK5A 3OWKA 3Q4TA 4QPMA 4KAOA 4AGDA 4ALVA 2CGUA 4YJOA 5F95A 3IW6A 3VBWA 2FYSA 3MH2A 2YACA 3TJCA 3N4VA 2BROA 4C2WA 3R7UA 4I24A 4QMYA 1VZOA 3WF6A 4I5CA 2DYLA 5HD4A 2HZ0A 4QNAA 3FXZA 4BFMA 4DTBA 3EQBA 4F6WA 3QYWA 3DZOA 4BCPA 4WNMA 5GIOE 5GIPE 5I5ZA 3MI9A 3OROA 3ZUTA 2XK9A 5IA4A 4HZSA 2BFYA 1FBNA 4D1ZA 3QFVA 2EUFB 2OICA 1J3HA 3NYNA 4ZTQA 2O0UA 4MX9A 3VUGA 4A9TA 5AV2A 4CYJA 3DLZA 3FLQA 3R7OA 2X8DA 2QU6A 4XLVA 5J8IA 3K5VA 2UZOA 3NCGA 2C6LA 3PPJA 2CJMA 4U81A 5FD2A 4OTQA 2X4ZA 2OZAB 4S31A 2RF9A 1P14A 2BTRA 2BILB 4FG8A 4Z7GA 3DBDA 2VRXA 1QMZA 3PJCA 4CTBA 2HZNA 3Q9ZA 3W2PA 5CAQA 2QONA 4I3ZA 1QPJA 2UZUE 3FI4A 3FQSA 5A4EA 2ZM3A 4L3LA 3Q4CA 4JG7A 4X6RA 3CC6A 4DGNA 2OJ9A 3E88A 4KD1A 3UC3A 4ZJVA 3Q32A 5CY3A 3VULA 2OXYA 3MA6A 2G2IA 3R6XA 4W8EA 4UV0A 4RVLA 1MUOA 3TKHA 4U42A 3NIEA 4E4XA 2ITYA 3FLSA 4QRCA 3RZBA 2VTIA 3D7TA 5BVNA 3P0MA 3IGOA 4O0RA 4L42A 1M7QA 4M13A 5CI7A 3C51A 2R3HA 2W1FA 3WZUA 3M11A 2XUUA 4N6ZA 5IF1A 4GFMA 5H8GA 1I09A 2W1DA 4IWQA 3R0TA 2W17A 3O0GA 2UZLA 4X3FA 4DGMA 2O63A 1V0PA 2WQBA 4QPSA 4IHPA 3VF9A 5AFVA 4YPDA 3ZH8A 3OY1A 5FWKK 5CVFA 4CG9A 1BMKA 2EXMA 4CEGA 3DBCA 4KKGA 2Z8CA 1IA9A 2B1PA 3RTPA 4C57A 5KNJA 3P23A 3I6WA 4H36A 3IG7A 2ERZE 3UJGA 4C4GA 1ZYCA 4UX9A 4O21A 4W4VA 4WSYA 3GQIA 3MFRA 3UIMA 4CFVA 2C6OA 4I5PA 2UZBA 4NU1A 3ORZA 4F0FA 2VX3A 2CN8A 5LQFA 1NVSA 3KRXA 3ZZWA 1Z57A 4R5YA 3E3PA 5DLSA 4E4LA 3V8WA 2YN8A 2OXDA 2VO3A 5K4JA 3MTFA 2OJJA 5J5TA 4RIWA 1MRYA 3HA6A 5IUGA 5LJJA 5AR4A 3JPVA 2OGVA 2XIRA 5ANIA 3RALA 3I6UA 2GNLA 4ANLA 4FIEA 3D14A 4ZLYA 3AMYA 4GK3A 4I23A 1MQBA 2EB2A 4E6CA 3V3VA 4RJ3A 3NDMA 5ETFA 2X0GA 3EN6A 5DRBA 3TKIA 4L52A 4TWCA 3R73A 2PZRA 2BRMA 4EH5A 4NJ3A 2WO6A 3DB8A 1PXOA 4RC4A 5IEXA 1CSNA 3P1AA 3SV0A 3LW0A 4L8MA 3NYOA 2FSOX 2GU8A 2IVUA 3BU5A 4CQEA 3NUUA 4DBXA 4MTAA 1XBCA 1YOJA 3O7LD 2O65A 2UW3A 5EI8A 4IB0A 5HG5A 1APME 1W0XC 2JFMA 3BEGA 5FXQA 4AAAA 3W2QA 4F99A 2WOUA 3HEGA 4B99A 1ZZLA 4KIPA 2UV2A 4C02A 3Q2JA 3B2TA 5E1SA 4ZS4A 3VJNA 1H07A 5CSXA 5CEQA 3GU5A 5DG5A 4W4YA 4PPAA 4J1RA 4OTHA 2BZJA 4QMWA 5H2UA 3Q5ZA 5DR6A 4JS8A 5EI6A 4QMZA 4O86A 4I1ZA 2J9MA 4TL0A 1YKRA 3ACKA 1VYWA 1Q41A 4O0TA 3WYXA 4QNYA 3AMBA 3MN3A 5B7VA 1JWHA 2OF4A 1FGIA 2YISA 4ZOGA 3MY1A 5FTQA 1RJBA 5HESA 4M14A 3N51A 3FLNC 4NZWB 3ZC6A 3BI6A 5E9EA 4QP3A 1YI6A 2BMCA 2ERKA 5CXHA 4IZYA 4F9CA 3CXWA 1ZOHA 4FSQA 4AACA 2QO7A 4UEUA 4F7SA 4IB5A 4F6SA 2VGOA 4DFBA 3PWDA 3IW7A 4G17A 2WU6A 4EK3A 4C34A 3E64A 3DQXA 2PL0A 5I9UA 4YZCA 2XCKA 2GFSA 5CEKA 3U6IA 4RFMA 3C13A 3I79A 4J96A 4RRVA 5I9VA 3CP9A 1OL6A 4LL5A 2R4BA 3F5XA 3R9RA 3EQDA 3ZC5A 4JQ8A 2YWVA 4I6QA 4BF2A 3QTUA 5GZ9A 4D1XA 4RWJA 5J1WA 2OI4X 3D7TB 4EWHA 3KCKA 3ZONA 4MXAA 2VTMA 4CV9A 1BYGA 4XV1A 4QYHA 5EYMA 1YDTE 3OHTA 5TE0A 1G8AA 2WMUA 4X2FA 3PXZA 3ZSGA 3BU6A 5C8MA 5HTCA 4PRJA 1H26A 4QQ5A 5C8NA 2C47A 1YXSA 3R00A 4RMZA 3DQWA 1NVQA 3O71A 3VW8A 4YPSA 3QA8A 4WUAA 5CF4A 4M69A 1PXNA 1I44A 2HELA 4FT7A 4CT2A 3R9NA 1SVEA 5DT0A 2P2HA 4USDA 3E8DA 4R7IA 3VS2A 3IECA 2W4KA 2C0OA 2VO6A 2WD1A 5DEYA 5M4UA 3G15A 4RBLA 4H3BA 3HLLA 3PDTA 2BKZA 4AA5A 3GCQA 5HZNA 4FV7A 2GCDA 3I5ZA 2AC3A 3JR1A 1BKXA 4YTFA 3UQFA 3KRWA 4DGLC 3Q3BA 3QCXA 3W2OA 2HYYA 2ZVAA 3FE3A 3PVWA 1U59A 3ROCA 2NNWB 4F6UA 4FTAA 1YXUA 3QHRA 2YLEA 4ZTRA 4YP8A 3SXFA 2JIVA 4CRLA 5CU3A 4RIWB 2PPQA 2JKKA 5HIBA 1OZ1A 4XP3A 4EH6A 5L8KA 4BICA 4FKUA 1UU8A 3QTWA 2WEVA 4H3QA 5FQDC 4D5KA 2ITUA 3D0EA 2W99B 1XHAA 3QKKA 5HVYA 5LVMA 3ATTA 3D9VA 4M15A 1PY5A 3VS7A 3W2SA 3L8VA 5GNKA 2GS7A 3BBWA 4F64A 3DXQA 4G3CA 2UW9A 2NRUA 4GU9A 4EC9A 2ZMDA 4EH8A 5BVFA 2X4FA 4GKIA 2XKDA 4AOJA 4G6LA 3FSFA 2R5TA 2XJ2A 1DM2A 5DT3A 3AC2A 5HX8A 4DH5A 4Y95A 4OTDA 1OI9A 2UZVA 5A4QA 2PMNX 4GCJA 2YFXA 1E1XA 5T68A 1BL7A 4IM2A 4AFJA 2XBAA 4RIYA 4AU8A 2PMIA 3NAXA 4BDJA 3NUNA 3H0ZA 2R0IA 3HZTA 5FDPA 3CTJA 4XHKB 5JRQA 3S0OA 3NUYA 4DFNA 4ANMA 5C8KA 3GCSA 3B2WA 2JAMA 2XEYA 3TIZA 3MV5A 4QT1A 5DE2A 4CSVA 2ZV9A 1KSWA 4G5JA 3ZUUA 4ERWA 3GB2A 5FEDA 1M2PA 3Q4UA 4IBMA 4MD7E 2F49A 3CTHA 4BKZA 3VS6A 4BBEA 5C27A 2WMSA 3P9JA 4R1VA 3R1YA 3GGFA 5AP2A 4F9WA 2IO6A 3NW5A 1WVYA 4NKAA 4K9YA 4V04A 4HGSA 4AZWA 1KUTA 3KRLA 5GHVA 2G1TA 4CFXA 1NVRA 5C03A 2WIHA 3CCNA 4AFEA 4YC6A 3D2KA 2ITVA 2IZRA 4WNKA 4L6QA 3SKCA 4O7NA 3U9CA 3ZTXA 4W4WA 4MXXA 3SW4A 1Q8ZA 4WNPA 3IW5A 2X2LA 1Q5KA 3ZO4A 3PIZA 2W5BA 3FJQE 2ZM4A 2BRBA 4IFGA 2YM5A 4DTAA 1X8BA 3HV4A 1YHVA 5EM7A 5EHLA 1FVRA 2WQEA 3HRCA 1OPJA 4J71A 3OCGA 5FP6A 4BCKA 1KWPA 3QF9A 1ZRZA 4FT9A 1W82A 2OFUA 2XNGA 2ZMCA 3POZA 4FR4A 3SXSA 3V5WA 3ZBFA 3VS4A 3CSVA 2GNIA 4C36A 4EOMA 2PUNA 2W1CA 3ATSA 2E9PA 3I7BA 2NP8A 5CVGA 2WTCA 4YU2A 1OMWA 2X81A 3RHKA 5A6OA 2CKQA 2PVHA 3T8OA 2CDZA 2HW6A 1E1VA 3EH9A 2YDKA 5BQ0A 3GU4A 1YWRA 4W4XA 2YAAA 5CF6A 4BDCA 2XNBA 1PMEA 4TN6A 1QCFA 3IGGA 3AD6A 5AJQA 5LVLA 3LXPA 4WNOA 1OIYA 3TNQB 3ORTA 2XB7A 2CMWA 2VAGA 2Y0AA 3IW4A 4QYGA 4U3YA 4W9XA 4YTCA 4FKVA 4GJ2A 2F7EE 1WVXA 3FMLA 4M7IA 4H1JA 4M97A 5FXSA 4IAZA 4CMOA 3G0FA 2W5HA 4TT7A 3VUTA 3UDBA 5AUZA 3ODZX 1XH5A 4BHNA 3Q4ZA 3CY2A 1Q3WA 3FY0A 4BL1A 2YAKA 4JR3A 1PXKA 2OIDA 2PE2A 4FV8A 4EH9A 4YZNA 3COHA 2B7AA 3R7GA 1Q3DA 4FF8A 2OSCA 3C7QA 4M0ZA 3DOGA 2YZAA 3QRJA 4FYNA 4J8MA 4RJ8A 3IDPA 4PMPA 2WFYA 2XS0A 3BPRA 3OT8A 4OBPA 3CIKA 4OT6A 4C4HA 5J9ZA 3TDWA 2FGIA 5EW8A 4FSYA 5FXRA 1URWA 4E7WA 1L8TA 4MNEA 1Q97A 2VTRA 3AC1A 4JDKA 3NZ0A 4UYNA 2QQ7A 3DGKA 3UC4A 5FLFA 3EN9A 2CGWA 5HNIX 1GIIA 4FIIA 4BWKA 3EQIA 4AGUA 5E8XA 3N4TA 5M4IA 2XNMA 1SM2A 4PNIA 4RX9A 3PYYA 5EW9A 2QKRA 3DA6A 3KF4A 4X2NA 1LR4A 2O5KA 3ORMA 3WF8A 5IQCA 4ACMA 4CKIA 2C3JA 4PUZA 3T9IA 4NFNA 5BVDA 3KXGA 4MNFA 5JMSA 5LWMA 3I81A 4KNBA 4WT6A 4AA4A 1M14A 1H4LA 1Q24A 3VJOA 3FMJA 4FBXA 2F2UA 4JG8A 2PVJA 4BRXA 3UZTA 1B38A 2PZPA 4JOAA 4PMMA 4R7BA 5CALA 3MWUA 3PY3A 4YZMA 3LFAA 4IVAA 5TR6A 1H08A 3FYJX 4EHVA 2ZV8A 2R0UA 3OT3A 3M2WA 2EWAA 4O27B 1H1QA 3EN4A 3ERKA 5D11A 1J1CA 3KXHA 5BYYA 1IRKA 1WBVA 4NM5A 2J50A 4WBOA 2Z7QA 3WE4A 5HCXA 3ROYA 5CQWA 1KE8A 5KMLA 2WXVA 4EEVA 4UB7A 1WVWA 4C4IA 3DPKA 3D5VA 3RK5A 4XEYA 3QUEA 3FLZA 2EVAA 3C50A 3G51A 5JZNA 4FNWA 4IXPA 4EK6A 4EQUA 2Z02A 1Q8YA 4FT5A 5JGBA 3K3JA 4FV3A 4H05A 3LFFA 3QALE 5FGKA 3ZRKA 2C5VA 5CTPA 3VW6A 4MF0A 3TTIA 5KZ0A 3BKBA 3NAYA 4K11A 3IDBA 3BYVA 5DFPA 3MJ2A 4BZDA 5A14A 2YM4A 1J7IA 5T3QA 5E4HA 3RAKA 2VTTA 3DBEA 3KKVA 5GZAA 3O96A 4FL2A 2IW6A 2WTVA 1UVRA 5J95A 2SRCA 2R7IA 3QZHA 2R3LA 1W83A 3MFUA 4HZRA 4USEA 4YZ9A 5K5NA 3NR9A 2YIRA 4HOKA 1BL6A 1OBGA 4GG5A 4Y5HA 3QZIA 3H3CA 4DN5A 3MJ1A 4EOPA 1H25A 1CDKA 1ND4A 4UXQA 2PU8A 2WMWA 5IUHA 4FVQA 4RWKA 3RKBA 3ZBXA 4F1OA 3OG7A 4GH2A 4MQ1A 3OY3A 5IA5A 2YERA 5AR8A 4EOSA 4O7RA 1DI9A 4PL3A 3MPMA 3VAPA 4O82A 5J87A 3TN8A 1JOWB 3CQWA 3LFSA 3M1SA 2QODA 5JQ5A 4I94A 1BUHA 3PXYA 3Q6WA 3W8QA 3DJ7A 3DLSA 5IU2A 4XBUA 5BX0A 4G2FA 3DTCA 4BIEA 4HCUA 3PA3A 3S95A 2UZTA 1ZY5A 2H96A 3PXKA 5IQFA 2JIIA 3W10A 2Z7SA 4NIFA 2I0YA 4CMTA 2OBJA 5KMOA 2YIWA 2J6MA 3QQJA 4K0YA 4FTIA 3C5IA 2BPMA 4BBMA 1BX6A 3LHJA 2IVTA 4LM5A 4R7HA 1IASA 3W55A 4QQJA 2UVYA 3GEQA 4RPVA 5BNJA 5L6OA 1M52A 1NW1A 1PXIA 1UU3A 3U4UA 4GFGA 2QU5A 1YWVA 2ZB0A 1H24A 3OZ6A 5CU6A 2VX0A 4G3DA 5EYDA 4P5ZA 4CFNA 3ZSIA 2XJ0A 4EHZA 4EUUA 4DH3A 3O50A 4TKSA 4ZSLA 2C5XA 5E8VA 5L2IA 3DV3A 4L43A 3QTSA 5HCZA 4ASEA 2CPKE 5EM5A 5IA2A 3FL4A 3SXRA 4Q9ZA 3HMPA 1XBAA 2R3OA 4MNEB 3RNIA 3SRVA 3FHIA 3O51A 4KRDA 3RM6A 3KN5A 1DS5A 4OLIA 2E9UA 2C3KA 3KU2A 3UIXA 3PSDA 1OKZA 4F0GA 1SZMA 4KWPA 4QP1A 1YVJA 3TACA 2VTSA 5B2MA 2C6DA 4YJRA 4QP6A 3HV3A 3WZJA 3UYTA 3NWWA 2GHLA 5A9UA 3ZRLA 1XQZA 3UO6A 2B9JA 3CGOA 4NUSA 3GENA 4U97A 4DG3E 2IVSA 4XBRA 2V55A 4UMTA 4OAVB 2R3FA 3AG9A 3RPRA 4AZFA 3U54A 4BDAA 2R3NA 3D4QA 3ZFYA 4FL1A 4HVSA 3P86A 5J1VA 3T3VA 3BYUA 2F4JA 4EOLA 1PW2A 3ORXA 4RA5A 1WFCA 5ICPA 4J53A 4LMNA 4CKRA 1OIRA 4FUYA 2YIQA 4DBNA 5CEOA 2OK1A 4C8BA 1YI3A 3LKMA 1V0OA 3D7ZA 3ZLWA 1ZMUA 2J0LA 2WTIA 4RT7A 4N4SA 5EG3A 3EN7A 3A2CA 3VUKA 4RX5A 2BUJA 4CFMA 4H1MA 1KOAA 4FTRA 3ZDUA 4IWPA 3GCUA 2QOFA 3DJ5A 5EFQA 3UGCA 4E20A 2EXCX 3DJ6A 3R8LA 2KULA 2I40A 4GT5A 2W0JA 4UXLA 5F4NA 2X7GA 1B39A 4O38A 1YW2A 3MPTA 3O2MA 4OR5A 4OTRA 3MFSA 3UQGA 5CXZA 2WTDA 2UVXA 3WI6A 3A60A 4ITHA 3S4QA 3ITZA 4ZS0A 3UIUA 2WAJA 1ZOEA 4MBJA 4D5HA 5A54A 1H28A 4FV2A 3DKFA 4WKQA 5FUTA 3HECA 1ZY4A 4BDEA 1KE7A 4K18A 2GQSA 5CT7A 3H30A 3CD3A 5HE2A 4ACGA 4I6BA 4F1TA 4F09A 5CAOA 3F2RA 5LVPA 4Y83A 2GMXA 4JXFA 4QTCA 4IZ7A 1BI8A 2YLFA 3BIZA 5CSVA 5AR3A 2I0HA 4B0GA 1XH9A 3PVBA 3PXQA 3QLGA 5JQ8A 4BGQA 4YMJA 5DMZA 4DF3A 4DA5A 1IR3A 2YA9A 4Q9SA 1GAGA 4D2TA 2G9XA 4II5A 3BZ3A 4KBKA 4EBVA 3FKLA 4MVFA 3G6HA 4AOIA 4D4YA 5JKGA 4OTWA 5AUVA 4ITIA 4LGGA 5EYKA 5KMIA 4IVDA 1R1WA 1XWSA 3HP2A 4PDSA 2PUPA 2ZB1A 3A4PA 2DWBA 3R1SA 4L3PA 2UW5A 3NYXA 3HAMA 4BIDA 4AX8A 2RGPA 4L68A 4V05A 2WOTA 1IAJA 5A4CA 4LFIA 3A4OX 2RSVA 2V22A 3LLAA 3LCOA 3PIYA 2UZEA 3ORLA 3QC4A 2EXEA 4AN3A 5CYIA 4FZDB 2J90A 4KKHA 5JZJA 4JVGA 2CN5A 3LLTA 4C61A 3BQRA 4NIFB 1WBSA 3F3VA 4U5JA 3I4BA 5AAGA 3UPXA 2CKPA 4RQKA 1XH6A 2PYWA 1PXJA 4R5SA 2C6EA 4MHAA 4RX8A 3FYKX 4XCUA 5G1XA 3UOLA 1OIQA 3K5UA 1O9UA 4KBAA 4ZJIA 4EH7A 4UZDA 5IDNA 2ESMA 2GNHA 2PY3A 3GXLA 4FKGA 3UMXA 4APCA 3UOJA 4BI0A 4ARKA 2W1HA 2XNPA 2CLXA 3ZO1A 3R71A 2R3RA 3F6XA 4TNBA 4DFLA 5JT2A 1KV2A 4WSQA 5IQGA 3I7CA 4MK0A 1H1WA 2BHHA 4DLIA 3ULZA 4X2JA 5IZFA 2ETKA 2W4OA 5CF5A 4XLIA 3A7JA 4R1YA 2JKQA 2OH4A 1UWHA 3SRVB 3MH3A 4EUTA 4YURA 3DNDA 4UALA 3TNHA 3KMUA 3A62A 3UIBA 1OL1A 3PPZA 5BVOA 4A7CA 3SVVA 2GHMA 3KFAA 4R3PA 5HO6A 2YITA 1YQJA 4JG6A 3LJ1A 3V6SA 5CU2A 4IX3A 3P7BA 4AGCA 4L44A 3QHWA 3CKXA 4BDGA 3UP7A 4K1BA 3MY5A 3HDNA 1NT2A 5HE0A 5DR2A 3LOKA 3LIJA 3ZLXA 4CGAA 3KRJA 2NO3A 2QG5A 4NT4A 3MIAA 4JIAA 3LMIA 3W33A 4FIGA 5L8LA 4AWIA 3DBFA 4CD0A 2WMAA 3H9RA 4FV0A 3QUDA 4I5HA 4J7BA 3M42A 2CSNA 2OH0E 3G2FA 4PY1A 4BCIA 4FKIA 3CD8A 4DTKA 5M44A 1F5QA 2BZHB 3MBLA 4OBQA 2QURA 4ZAUA 3KC3A 4BVUA 4I0RA 4JT3A 4D9UA 4MBLA 3ZDIA 3AXWA 4C33A 3BEAA 5L6PA 4GKHA 3FDNA 3DK6A 5B2KA 5HNBA 3WE8A 3OOMA 5ANEA 4BY9E 1Z5MA 3FMEA 4AG8A 3IO7A 4FUXA 2W05A 2WGJA 2FH9A 2XKEA 5E90A 4YC8A 3SGCA 3NUSA 4XYFA 5EOLA 3QL8A 5HICA 2DQ7X 1YXVA 3V5LA 5KX8A 4DLJA 2RFDA 5FBOA 1FMKA 1TQMA 5F1ZA 3F3UA 4BCGA 2G15A 4L45A 1OL2A 3A8WA 3R9OA 5E8TA 1G8SA 2I6LA 3TV6A 3O17A 4PL4A 2WHBA 3VUDA 2PVMA 4TZRA 4TWPA 3R21A 2YIYA 3LFBA 4LQMA 1OVEA 1FINA 1P5EA 3DBQA 4QTEA 2YM7A 5M07A 2WMBA 3RZFA 2C69A 2ZV7A 2XNEA 3NEWA 4GG7A 5CZIA 4DEEA 3KB7A 2YCFA 3F61A 2X8EA 3CY3A 3IK3A 2ETRA 4PX6A 5HEZA 3T9TA 5DEWA 2P33A 5CLPA 4L7SA 3I5NA 4FYOA 3WZEA 4ZZMA 4R3RA 3CLYA 4PMSA 3V04A 3VNTA 4F1MA 4TNDA 5D1JA 3FWQA 4CXAA 2RFNA 2VNYA 3RPOA 4U43A 1UV5A 3MVLA 4CFWA 3G5DA 1Q61A 3HRFA 3EIDA 3LFCA 3F82A 4FKQA 1UU7A 2C6TA 3KCFA 5HLPA 4FG7A 1M17A 3CS9A 3R8PA 2C6IA 2V7AA 4RIOA 3BYOA 4AZSA 1TQPA 3JUHA 4LRJA 2B55A 5CASA 3TDVA 2C1AA 2VTAA 3NNXA 3QQGA 3KVXA 2IPXA 5DRDA 4YJUA 5AV3A 3LCTA 5TO8A 3RWQA 2FSTX 3KGAA 3NNVA 3QRUA 3VUIA 4BI1A 2Z60A 5DIAA 3DFCB 4RC3A 4XRLA 1YHWA 3EKNA 4O91A 3VN9A 4IAAA 4RSSA 2BRNA 1SVHA 2VN9A 5M4CA 3R1QA 2YEXA 4PPBA 2XCHA 3OTVA 4G3EA 3VBVA 1PXMA 5J7BA 1OUYA 5AV4A 3A7HA 1UNLA 2ONLA 3BGZA 4M67A 4ANSA 5IQAA 1PYXA 4TRLA 3R30A 1JBPE 1CTPE 5KHWA 4R78A 4ZZNA 3HUBA 2JLDA 2RFSA 3MY0A 3UE4A 3C0HA 2YJSA 4FT3A 5HIEA 1DI8A 4CZUA 3GBZA 2XZSA 4AP7A 4FK6A 4EK5A 4YSJA 4GV1A 4ZK5A 2H6DA 3P5KA 3O8UA 4BN1A 2XJ1A 4WA9A 3NS9A 4O7TA 5LCKA 4KBCA 3IS5A 4FOCA 2F57A 2PVKA 2Y8OA 3EB0A 5AIKA 5FEEA 5TKDA 2B9FA 5E8SA 4C3RA 3EQRA 3PJ3A 4XNEA 4DINA 2FVDA 2JDVA 3SAYA 3H4JA 2XIYA 4FC0A 1ZOGA 4TW9A 3PPKA 3NW6A 3W18A 4JDIA 3KEXA 1RE8A 2P55A 2R2PA 4NTSA 4MYGA 4GVJA 1RDQE 4UMRA 2I7QA 3GT8A 3WZKA 4AQCA 2RL5A 4YHFA 2WELA 2C5NA 3PP1A 4QMSA 1GIHA 2C5YA 2WMVA 3JYAA 4KSPA 4QTBA 5LWNA 1MRVA 4B8MA 2NPQA 2XK8A 4KUJA 3AT4A 1PMUA 3PLSA 4IAIA 4WIHA 5GINE 2OZOA 1YXTA 4F9YA 4FV4A 3B8QA 3NW7A 5L2QA 2YCSA 3BBTB 3GU6A 4E6AA 2BRGA 4MAOA 4D2PA 4WO5A 3FV8A 3O8PA 3NGAA 4AUAA 4QMNA 2BAJA 4K77A 4MH7A 4CLJA 5HE3A 2HZIA 4O96A 1PXPA 3GP0A 3GU8A 4YO4A 3SG8A 2QKWB 2WQMA 5AWMA 3VHKA 5JGDA 2R7BA 2VTOA 5IA0A 2GPHA 3QX4A 3VRYA 4RA4A 4EI4A 1JQHA 4AZVA 3VS3A 1M2QA 4PP9A 4U0IA 3G6GA 3PUPA 4HNFA 5AP0A 3VS1A 4FV5A 4JLCA 4P90A 4C35A 1FGKA 2XBJA 3MDYA 3HMIA 3SQQA 4HPTE 3ZU7A 4O22A 5HO8A 3JY9A 4D0XA 4DG2E 2ITXA 5KMKA 4AN9A 4JQEA 3OD6X 1YOLA 2ONLC 2VNWA 2VWIA 4JAIA 5BVWA 3VWAA 3A61A 4DG0E 3TUBA 2WQOA 3KXXA 4M84A 3Q9WA 4TPTA 4D9TA 3WF9A 3AQVA 3DK7A 5IKWA 1YDRE 1FOTA 4I4FA 3R8VA 4IAFA 4YJNA 4GIHA 3R8ZA 4YLLA 3ZFMA 1DAYA 4AS0A 3FLWA 5HVKA 5CQUA 4MQ2A 3MH1A 5DI1A 3UVQA 4CCUA 2BALA 3BCEA 3F9NA 3H9OA 4IAKA 1OL5A 1P4FA 3ZM4A 4GJ3A 1AD5A 4TY1A 4U7ZA 3ODYX 3CEKA 1Q99A 5D12A 4G5PA 4PDOA 1YHSA 4OAUC 2VTPA 3ZFXA 3PXFA 4BI2A 3SHEA 4RGJA 2X9FA 3OF0A 3ORNA 1H0VA 1REJA 3QTRA 2H34A 2VWZA 3W1FA 1GY3A 2QI8A 1UKHA 3FMMA 4P4CA 5HU3A 1PF8A 3OXTA 3ORKA 5AM6A 1IG1A 1T45A 3EL8A 2YWPA 3LCDA 4IVBA 4JRVA 2VU3A 3DDPA 4WD5A 1OITA 4CZTA 4LRKA 5M51A 3E93A 1YDSE 5CU4A 3JY0A 4L01A 4L53A 3THBA 1H8FA 4C2VA 4NEUA 2C0TA 4EZ5A 2E9VA 4B9DA 4CG8A 5GZ8A 5E8WA 2IZTA 2QD9A 4GUBA 1FQ1B 4HPUE 5CF8A 1OECA 4Y8DA 4IJ9A 5CNOA 4DEBA 5C4LA 2QOLA 3IW8A 4AOTA 4NM7A 1K2PA 1TKIA 2V7OA 3KMWA 1S9IA 2RIOA 5E7RA 4TYIA 3WBLA 5AUTA 3U8WA 4IB3A 3TUCA 3KY2A 4ACCA 2ZYBA 4YBJA 4QQCA 1ZYJA 4F63A 2HXLA 2VUWA 2WIPA 1GNGA 2Y6OA 3PRFA 1OPKA 4F65A 3HKOA 4GIIA 3EZVA 2QOHA 3PIXA 5GJDA 3R7VA 2WPAA 3ULIA 3RWPA 1OKWA 3BE2A 3TV4A 4XOYA 4AW2A 2OIQA 4KINA 3AD5A 2JD5A 3TCPA 3TL8A 1GZOA 1P4OA 5EM8A 4NSTA 1ERKA 2VTHA 3QD3A 4L9IA 3TNIA 1XH8A 4BCFA 5CSHA 4CNHA 3W32A 3QTZA 4O1OA 2JBOA 3QXPA 5HD7A 3F5PA 3ZRMA 3BHTA 1STCE 4FZFB 4BIBA 5IEYA 4ALUA 5A3XA 3MFTA 3F3TA 3OFMA 3MPAA 4D55A 2YIXA 4I21A 2WB8A 4A9SA 5EYCA 3PJ2A 2J51A 5M08A 5C4KA 4IE9A 5IA3A 1Y6AA 4CVAA 4D58A 4ZMEA 3BYSA 4XV9A 3DXNA 3ZXZA 3I1AA 2UW6A 1E9HA 2XKFA 5J9YA 4YJSA 5DR9A 1Q8UA 2R3QA 2Z2WA 3MA3A 4G31A 3Q2MA 4BHZA 4D4SA 3ENMA 5HGIA 4KSQA 5FRIA 4PTEA 3NMUF 3NCZA 3PZEA 3LM0A 1GZNA 4MD9E 5L4QA 2ITOA 4KS7A 4YTHA 4QP2A 2XIKA 3QZFA 4M8TA 1AGWA 3HNGA 5D9HA 4YTIA 1JSUA 3MVMA 1H27A 1NY3A 3V6RA 3ZO2A 3HMOA 1Y8YA 3K2LA 3EQCA 2OJIA 5AP7A 2HENA 4XJ0A 4YJPA 4EOOA 3KK8A 5CANA 1YRPA 3K54A 3KREA 2OW3A 2QG7A 3IQ7A 3Q5IA 4QMOA 4FX3A 4XS2A 5C26A 4FKJA 4FKTA 2OXXA 3HGKA 3K3IA 2OF2A 4I22A 5L6WL 4RJ7A 2UZNA 2C1BA 1JKLA 5L2WA 4A9YA 4N0SA 4DCAA 4FTNA 1WBTA 1O6LA 2G2HA 3ID6C 4IVCA 1XO2B 2WTJA 4C3PA 1UWJA 3FI8A 4RG0A 3FKNA 2WNTA 4QYFA 4YHTA 3L9PA 4ZLZA 4M12A 3NLBA 5EDRA 2A27A 4QMVA 4U45A 4BDFA 3QWKA 5AP1A 3RI1A 4FIHA 1WBNA 4JAJA 3MSSA 3EKKA 3EJ1A 2C5OA 4KABA 5I9ZA 2PULA 3MB6A 4EWQA 4FSNA 4FSMA 3HYHA 4GYIA 2XNOA 3BX5A 3BU3A 4I41A 4O7WA 5H3QA 4F70A 5E8YA 3GFEA 3F69A 4DGOA 5BVEA 3LQ5A 1IAHA 1U46A 4IANA 4LOPA 5JH6A 3O7LB 4R3CA 3DKGA 4GK2A 2IWIA 3TJDA 1URCA 5DBXA 4DH8A 4DYMA 2I0EA 3CKWA 5KZIA 3R9DA 2GSFA 2BFXA 1QPEA 4OBOA 2W9ZB 4IZAA 5C1QB 3TM0A 2ITQA 4EH3A 3CTQA 3RK9A 1JAMA 1CKIA 4D4VA 1ZMVA 3OCTA 2W96B 4Y73A 3KQ7A 2Y4PA 3FQEA 3Q6UA 4FL3A 4HJOA 4AT5A 3UO4A 4BCQA 4DEGA 4G9RA 3COKA 3W2RA 2AC5A 3E8CA 4FIFA 3QRKA 5LVOA 4B8LA 2V0DA 4M0YA 2CNVA 3EQPA 1PMVA 2UVZA 1Q4LA 5K4IA 3EL7A 5H8EA 2WEIA 2ZAZA 4NW6A 4TYHB 2X39A 4FTKA 4E8AA 4MWHA 2BDWA 3ALNA 3PJ1A 2VWWA 3LXKA 4LG4A 1WZYA 2QCSA 2H9VA 3ZSHA 3GVUA 4EBWA 3CQUA 4KS8A 4QO9A 5BUIA 3EYHA 3C4WA 3CE3A 5AV0A 3MESA 1Z9XA 3UO5A 4EL9A 4J99A 4DH1A 2OFVA 2Y4IC 2CCHA 2J0MB 4KKEA 3L9NA 2I1MA 3R2YA 3DTWA 2QC6A 4JL9A 3BHHA 4OTIA 3HUCA 2PTKA 2QOBA 3CBLA 3BLHA 5HO7A 4BC6A 3TV7A 3ZYAA 3PE2A 4HYHA 2W5AA 2G01A 3U51A 3UVRA 4CYIA 4O81A 3NNWA 4MXZA 2IZSA 4WBBB 5G6VA 1VYZA 3Q9YA 5BMMA 4UMUA 3LQ3A 1U54B 2XP2A 3PZHA 3ZS5A 4LUDA 1YXXA 3EWHA 3F3ZA 4YNOA 4JRNA 3PG1A 2ZDTA 5J9LA 2YJRA 4XP2A 4Y46A 4D28A 1PXLA 5LMBA 3G9LX 4GS6A 5AR5A 3EFWA 5AV1A 1RQQA 4ANNA 2DS1A 3FZ1A 5JK3A 2XH5A 1ZYSA 4L3JA 3R83A 5J7HA 3BGPA 3UODA 3OEZA 4OTGA 5D41A 1ZXEA 1F0QA 1F3MC 1XBBA 5JFVA 3OWPA 3FLYA 1HCLA 3KULB 4CKJA 3UOHA 4BZOA 3QZGA 2GTNA 4O7VA 4BDKA 4ZY5A 3C4XA 5HNGA 3VHEA 4KIKB 2JITA 3QD2B 5DVRA 3OMVA 3QQUA 3EZRA 3QLFA 4BZNA 3GCPA 4DT9A 3PSBA 5I9XA 2ACXA 3C4ZA 4I0TA 4H39A 2E2BA 3QTXA 2XK6A 5DHJA 2BR1A 2PMLX 4GEOA 4BWPA 2PUUA 4FKWA 2Y4IB 4Y5QA 5E8UA 1LUFA 5D7VA 5ETIA 2O3PA 2VZ6A 4NK9A 4B7TA 3V5JA 1GJOA 4IMYA 4C38A 4ANBA 3QXOA 4E26A 3VVHA 4EZ3A 4DFZE 3UOKA 4K33A 3PXRA 2C68A 3QWJA 1H1RA 4U40A 1PKGA 3HRBA 3AT2A 5B0XA 3ANQA 4TYEA 4EJ7A 3VRZA 1PYEA 2B9IA 1O6YA 4PPCA 3PP0A 4HYSA 3SOCA 3QQKA 4PDPA 4NM3A 4BTFA 1R39A 3R8MA 3OCBA 1WBPA 3F7WA 4ZEGA 2PVYA 2QLQA 3DT1A 1MRUA 3L9MA 4FT0A 4YZBA 4OUCA 2UW8A 2XYNA 4FMQA 2YHVA 5KO1A 4BKJA 3A99A 4CCBA 1OGUA 2R3PA 2QHMA 1GZKA 4LYNA 3KN6A 5I9YA 3QCYA 4DH7A 4A4OA 5H8BA 4PL5A 4EYJA 2HY81 3SD0A 4NM0A 4AT4A 3FMHA 1U5RA 2PZIA 4F08A 5K9IA 4UYAA 3V5QA 4FTUA 3ZXTA 2X2KA 4YJTA 4P5QA 3S2PA 4YNEA 4GT4A 4O7ZA 5AR2A 4A9RA 4EKKA 5TT7A 4M68A 2PZYA 4E4NA 2HIWA 4X6QC 3G33A 1RW8A 4BDDA 1IA8A 4Y85A 4QYYA 1T46A 4UZHA 4HGTA 4RIXA 5EM6A 2CKOA 1EH4A 4RFYA 2XKCA 3LFDA 3GC7A 3PA4A 3UBDA 3LJ0A 2QOQA 5KMMA 2J5EA 1JNKA 4IJPA 2PE0A 5EQEA 2QO2A 3RMFA 2AYPA 4QD6A 3DY7A 4FKSA 3WF7A 1WCCA 5FM3A 3DK3A 3FSKA 3RBWA 3T3UA 2W1GA 2PHKA 2X1NA 3FZOA 3O23A 4NH1A 2R9SA 3KF7A 2OJFE 3QGWA 4NJDA 4X7QA 4BTKA 4D2SA 2UW7A 2ZOQA 4ASXA 1OUKA 4I6HA 3UG1A 5A4LA 5AAEA 2PVNA 3KXMA 2ZM1A 4IC8A 2GS6A 2WMTA 3ELJA 5ANGA 4EK4A 4FZAB 3DXPA 3GI3A 5FTOA 1SYKA 2ITTA 2JEDA 4IAYA 3LMGA 4KIQA 3VS0A 4USFA 4YHJA 2QR8A 1VEBA 4P7EA 4FZ6A 4P2KA 3GUBA 5HE1A 3RM7A 4RJ4A 4UWBA 2VWUA 4R77A 4EJNA 1J7UA 5EHYA 4E93A 4IQ6A 4RC2A 5IQBA 3E3BX 1BI7A 4FEXA 1JLUE 4EHGA 4PWNA 4X3JA 3DAKA 4QP7A 4QYEA 3IOPA 4HVHA 3N4UA 4PMTA 3FI3A 2C6MA 2PE1A 3FBVA 2REIA 3RINA 3PWYA 5HBJA 4XX9A 1Q62A 4UWYA 5DH3A 1YI4A 3RVGA 3W2CA 2I0VA 2HCKA 3EOCA 4G6NA 5FEQA 3NUPA 3TZ9A 2CHLA 3NNUA 3LFNA 4L00A 5HLWA 3F5GA 3PSCA 2E9NA 4JDJA 2Y6MA 2F9GA 4WHZA 4O0UA 4HVDA 3L8SA 2J7TA 4EORA 3FQHA 5I4NA 4RLLA 3VBTA 1W84A 3AC4A 3LXLA 3OW3A 4X2KA 3TZMA 3OBJA 1L3RE 5EH0A 5IMXA 2ZDUA 4U80A 2IZUA 3LQ8A 3P7CA 2X8IA 3I60A 2LAVA 3FEGA 4Z16A 3GOKA 3SA0A 5D10A 2OO8X 4FTOA 4IX6A 4E3CA 4ENYA 5A46A 3U6JA 3UPZA 4TWNA 4AN2A 3NVKI 4MEDA 4QMTA 3COMA 3EFLA 2EB3A 4YR8A 1JSVA 3WILA 3S3IA 3BLRA 4F4PA 2F2CB 4RX7A 5D7AA 2Z7RA 1ZYDA 4FKOA 4C3FA 5BYLA 1KE5A 5AMNA 2XM9A 1MP8A 4IWDA 2WTKC 5M57A 2QR7A 4HNIA 3SC1A 5M06A 5AX9A 4E6QA 1R78A 3DS6A 3TZ8A 4WG4A 1PRYA 2VTLA 4XG3A 5HCYA 4AZEA 3QQHA 4CMUA 4IC7A 3A7FA 4HCTA 1CKPA 3R01A 4GT3A 4X2GA 5IUIA 4G3FA 3UYSA 3WF5A 3LFQA 3NX8A 4CRSA 2FO0A 3ZEPA 2IG7A 3RP9A 3P7AA 2RKUA 1FMOE 4ZSEA 4AZTA 4BDHA 4MWIA 3KMMA 3E7VA 3Q53A 4GK4A 2BVAA 2YM6A 2P3GX 2YABA 3G0EA 3VQHA 1K3AA 5IH4A 3ZOSA 4CLIA 4V0GB 3R22A 1OM1A 3RAWA 1PMNA 4UY9A 4O84A 3U6HA 3FXXA 2JDRA 3D94A 3FC2A 4QMQA 4JBQA 2QHNA 2WU7A 3OXZA 4D1SA 1AQ1A 5EDQA 1QPCA 5M53A 3A7IA 1S9JA 4DFXE 2X9EA 3C4EA 5BMSA 3JXWA 4RIXB 3F7ZA 5BYZA 2HY0A 3LE6A 5FTGA 5FG8A 2A2AA 2X6DA 3VBXA 4YO6A 4DC2A 4NTTA 4E5WA 2BIKB 3GNIB 3WOWA 3DFAA 4F0IA 2B9HA 5H9BA 1OL7A 2B4SB 4FGRA 1LEZA 2F7XE 3DKCA 4LRMA 4QP9A 3R2BA 3OP5A 3BHUA 3QTQA 3EQFA 1ZARA 4O0YA 1IEPA 5BUJA 2WTKB 4FEQA 3F66A 3ENHA 4N70A 2B52A 3BE9A 3OTUA 4J8NA 4BBFA 4ASDA 5B2LA 4DGGA 3ACJA 3ZHPC 1XJDA 1W8CA 3E62A 2FUMA 3FY2A 4RVKA 3VF8A 5EHOA 2J0IA 5CSPA 1ZWSA 2A0CX 3VS5A 4RZWA 4FTCA 5DA3A 4BYJA 5A6NA 2BCJA 4HGEA 2BHEA 2VGPA 5IH5A 3CR0A 4Y72A 4LV8A 5CU0A 3ZM9A 2XK7A 3AOXA 2GNGA 4RZVA 2J4ZA 4TYJA 4Z3VA 3LFEA 4FI1A 1LEWA 4ANQA 3D5WA 4EQCA 1QPDA 4QTAA 3WARA 3PLAE 2HAKA 2GNFA 2X6EA 3GC8A 4JX3A 4Q2AA 4YGAA 3FZSA 4PTGA 5AM7A 3V01A 3QX2A 4GYGA 3QU0A 3HVCA 2QOOA 3VBYA 1WMKA 4EQMA 5CWZA 4YC3A 4LMUA 2E9OA 3C0GA 3E5AA 3GC0A 3QTIA 4O0WA 3SOAA 5AUUA 3D83A 3ET7A 3R02A 5HU9A 2Q0BA 4YBKA 3EFJA 4FTLA 1JKSA 3OEFX 5ETAA 2W1ZA 3R28A 2X2MA 4I5MA 4DAWA 1OPLA 3Q9XA 2PVLA 4RJ5A 3HV7A 3L1SA 3BYMA 3BHYA 4S2ZA 4YLKA 4QMUA 4D0WA 4EHEA 4N57A 2OWBA 3QRIA 3MH0A 3ZMMA 4M66A 3KXZA 2O2UA 4O0SA 3ALOA 5FBNC 3QGYA 3CGFA 3COIA 4BCOA 1SVGA 1FVTA 4JNWA 5FP5A 4D4RA 5AA9A 3D5UA 4X3FC 4D2RA 2PMOX 3WYYA 1W7HA 5IQDA 2R64A 3KVWA 4GRBA 4FK3A 4IADA 4HCVA 3RPVA 3TNWA 4F7JA 2HOGA 4XG6A 1ZAOA 4CV8A 2QOKA 5HTIA 3SW7A 4ZMFA 4K2RA 2ETMA 5IISA 4ZXTA 1OKYA 1CM8A 3MW1A 3PJ8A 5I0BA 4FV1A 3SG9A 2WMQA 4JBPA 5DWRA 4ZTSA 3UQCA 4BCHA 2XVDA 4EZ7A 4KRCA 4GU6A 2UZWE 5EKOA 4O2PA 5KBQA 4HVIA 4AF3A 4LUEA 4XG7A 5JSMA 4EONA 3BLQA 1WBOA 4UMPA 3VO3A 3FUPA 4ZTNA 5HLNA 4WOVA 4PQNA 1OB3A 3FKOA 4IWOA 2B53A 4AW5A 4GW8A 5FM2A 4HVGA 2QOIA 3BRBA 4IFCA 4DCEA 3OOGA 4NW5A 4XH6A 4BR3A 3F3WA 1FPUA 2ZJWA 3MTLA 4ZZOA 4Z9LA 2A1AB 2C0IA 2GNJA 3EYGA 5CEMA 5HBHA 5M55A 1M7NA 5JN2A 3BV3A 2CCIA 3BV2A 5KMJA 1ZLTA 2CGVA 2AUHA 2C4GA 2YCRA 2Y7JA 1UNHA 3AMAA 2FB8A 1SNXA 3PG3A 4I93A 4K8AA 1DAWA 4QQTA 5JFSA 1Q8WA 3LMHA 3Q52A 4F9AA 4MD8E 4FG9A 4QPAA 2HXQA 5ANKA 4DFYA 4QOXA 3U87A 4TYGA 4X3FB 3PE1A 1H1PA 5IH6A 5KUPA 3GQLA 3LAUA 4DITA 4GFOA 4ACHA 3LVPA 4OW8A 5AUWA 3ZUVA 2HW7A 5E1EA 3VUMA 3EMGA 5EW3A 3FHRA 4FEUA 2YCQA 2J2IB 5GJFA 5BUEA 1TQIA 1UA2A 2RG6A 3OWJA 4JX7A 4QMPA 4FA2A 5KKRC 3Q04A 4GSBA 4E73A 3TG1A 2BTSA 2X7OA 4XG4A 1JKKA 2OJGA 3TUDA 2JKMA 3W16A 4FZ7A 3U55A 1A06A 2WKMA 3NUXA 4YUQA 3E63A 3R7EA 4LOQA 4MXCA 3HL7A 3IONA 2XIZA 2C30A 4X21A 3PY0A 2VTNA 2QNJA 1NA7A 2GS2A 4LI5A 5C01A 4C0TA 3DNEA 3S1HA 3FMDA 3GFWA 4RQVA 4TXCA 3SDJA 3F2AA 2BDFA 3VUHA 5LXMA 4L7FA 5AIRA 2BZKB 2QLUA 4U6RA 3RCJA 5HTBA 3REPA 4TTHB 4IEBA 4BKYA 2XYUA 4O2ZA 3PFQA 3RCDA 1H1SA 4PTCA 5K5XA 3V8TA 1M2RA 3ETAA 4L67A 4HW7A 4JBOA 2YM8A 2X7FA 3UVPA 3HA8A 4BGHA 2CNUA 2R3IA 3IPHA 5EQPA 2RFEA 3RJCA 5IA1A 1GOLA 4FKLA 4GUEA 3QCQA 2C6KA 5HBEA 1CKJA 2IN6A 3NSZA 3NYVA 2ITWA 4KIOA 5DN3A 3TNPC 2XEZA 4CFUA 2XRUA 4ZSGA 1Y8GA 4MBIA 4BYIA 2B0QA 3RHXA 4O7SA 4I4EA 3FPQA 4G6OA 4D2WA 5A4TA 4G1WA 5KHXA 2BAQA 3LCKA 5LVNA 4ZTHA 1A48A 1V0BA 4R8QA 3C9WA 4JR7A 3A7GA 1XH4A 3MIYA 3P4KA 3I0OA 3QC9A 5HQ0A 5KKRB 2C3LA 4WRSA 3RPSA 3VQUA 2CNQA 4C4FA 3H0YA 5TOZA 5EQYA 3PVGA 1ATPE 3FPMA 3EQHA 5DT4A 4EH2A 4FGBA 5AP4A 3BHVA 1ZMWA 3KXNA 4LV5A 5ANOA 3L8PA 4H3PA 3NVMB 5J5SA 2R3JA 4TYHA 5CI6A 4XV2A 4EOJA 4I92A 5AAFA 1U4DA 2VX1A 4OTFA 4QP8A 5CNNA 3QKLA 4BCMA 5L2SA 4G9CA 4I20A 3UNJA 3NPCA 3TEIA 3KL8A 4PDYA 3B8RA 3QCSA 4ZP5A 3TKUA 1OKVA 5HG8A 1JPAA 1REKA 2R3MA 1B6CB 2XRWA 4K6ZA 3KK9A 2YDJA 4MKCA 3LXNA 3SX9A 5E91A 3DKOA 3IKAA 4A06A 3P78A 4ZJJA 2VV9A 3DCVA 3R9HA 4C4JA 5CX9A 3N9XA 5IPJA 4ORKA 4DFUA 3F2NA 4DEDA 3LM5A 2OIBA 4NCTA 5GJGA 3E87A 3VIDA 4AXAA 3MGYA 4XV3A 4ASZA 3FZPA 1U54A 2Q83A 4YSMA 2IW9A 2XK3A 3E8NA 3HDMA 2JGZA 3II5A 3BWFA 5LARA 4C7TA 3ORIA 1HOWA 1Y57A 2JDTA 3HMNA 5HG9A 4QMLA 1GZ8A 4XMOA 2VWVA 5L2TA 3QRTA 3HX4A 3OVVA 3QBNA 4FKRA 4RFZA 4BDBA 3FZTA 1O6KA 4O83A 2OU7A 4GL9A 4A4LA 4OT5A 1SNUA 4FSRA 4FODA 3KULA 2V5QA 2XK4A 5ANDA 3OS3A 4CFFA 3BGQA 4M69B 3H9FA 2UUEA 4GMYA 3WIGA 4DHFA 4EOKA 1OBDA 5HI2A 4KIKA 4A9UA 4IB1A 4IM0A 4JI9A 5K0XA 3OBGA 4CT1A 4M3QA 1CMKE 4IW0A 3V8SA 3RK7A 2VO0A 2PSQA 2V62A 4BTJA 3LJ2A 5JRSA 1J1BA 1ZZ2A 3QD4A 3FMNA 3WZDA 3NIZA 3TIYA 5I3RA 4FSUA 2UW0A 5F20A 4HYUA 2VWYA 3KRRA 4AT3A 4S32A 2RG5A 1R0EA 2VTQA 4W8DA 3O8TA 1PKDA 3V5PA 4ZLOA 2GQRA 5F94A 2HZ4A 5C9CA 2BZIB 5CVHA 2W4JA 1Y91A 2C3IB 2FA2A 5JEBA 2JKOA 1HCKA 4XG2A 3H10A 5KE0A 2GTMA 3MB7A 1XR1A 5CEIA 3TT0A 5K0KA 2W06A 4IM3A 4XOZA 3UP2A 2IJMA 3ZLYA 3FI2A 3U4WA 3D5XA 5LMKA 2XNNA 3BWJA 2VTJA 4IIRA 3OCSA 1JSTA 5EDPA 4FTQA 4IX4A 1VJYA 3UZPA 4C4EA 5KBRA 4FEWA 2XMYA 3HP5A 2BKKA 4JJRA 4YLJA 2J0KA 4IZ5A 5LMAA 5HOAA 3UNZA 4QTDA 5ETCA 1MQ4A 3CPBA 3D2IA 1KOBA 4FICA 4B6LA 5EKNA 2CKEA 5ACKA 3RPYA 3R1NA 3E7OA 4RLKA 4ANOA 5KMNA 5IEVA 2ITZA 3ZZEA 4O7YA 4O7LA 3JVSA 4JQ7A 4LGDA 4EC8A 4NCTC 4J52A 4RIYB 3OW4A 4N6YA 1JKTA
chains in the Genus database with same CATH superfamily
3C1XA 1UU9A 4ZIMA 5EK7A 3L8XA 5E8ZA 2ITNA 4EK8A 3UZRA 2QO9A 3AGMA 2OLCA 4LDTA 3JS2A 3S00A 4FSWA 4XUFA 4GVAA 3DU8A 4RVMA 4NWMA 4MXOA 4O0VA 3FC1X 4RVTA 1J7LA 3PA5A 3DAJA 3TZ7A 3AC3A 1H0WA 3QD0A 1KE9A 3F88A 4U79A 4EH4A 3P79A 4NKSA 4RWIA 4KB8A 4FNXA 4EOQA 4I0SA 3UNKA 1UNGA 1V1KA 3PTGA 4ID7A 3RNYA 3D15A 3FZRA 5K3YA 1G5SA 4BWXA 1G3NA 2J5FA 4FVRA 2Z7LA 4Z55A 4ZY4A 5JFWA 2R3GA 3HV5A 4IX5A 2Y9QA 2B54A 4U41A 2BIYA 4HYIA 3F5UA 4X0MA 2PVFA 5E92A 2UW4A 4DEHA 4O6LA 2JDSA 3V51A 4XG8A 2WZJA 4V01A 4IDVA 5I3OA 3E92A 2LGCA 4F7NA 5JGAA 5M56A 4MF1A 2P2IA 4ZSAA 4G16A 4UMQA 4RWLA 4ZSJA 3L9LA 1FVVA 3PRIA 2UZDA 4ZTLA 5ITAA 2HWOA 3ZLSA 4R6VA 1JVPP 3LCSA 5IQEA 2XIXA 3AC8A 4ZTMA 3VBQA 2ITPA 3OXIA 3AT3A 2CLQA 1XKKA 5L8JA 4CTCA 4Q5HA 4BGGA 2PUIA 3DAEA 1YWNA 2VWBA 4UWCA 4ACDA 4Q5EA 3R8UA 4FKPA 4A07A 2OG8A 5LMKC 2W1EA 3MS9A 4FNZA 5CT0A 3DDQA 5F9EA 1TVOA 2R3KA 4W9WA 4FOBA 4ENXA 5CAPA 4BB4A 2QVSE 2GFCA 4QMMA 2H8HA 1K9AA 2WTWA 1R0PA 1J91A 4Z7HA 4FVPA 2DUVA 1R3CA 4FTMA 4ZY6A 5CEPA 5CSWA 1PJKA 5TF9A 3RGFA 3UTOA 5IQIA 2W9FB 2WMXA 5DPVA 3TTJA 4JDHA 4C62A 2XF0A 3R63A 3RAIA 4J95A 4LOOA 4QP4A 3OC1A 4TWOA 2P4IA 2BDJA 3QQLA 2KTYA 2PVRA 4U8ZA 3U9NA 1UKIA 3W0NA 2VWXA 3MYGA 5JFXA 2JDOA 2P0CA 3DB6A 5J79A 3VC4A 2A4LA 2FSMX 3P08A 5KCVA 3DZQA 2ZV2A 4J98A 3IOKA 3VONA 1QL6A 3RAHA 4PF4A 3EFKA 4QMXA 5I9WA 3ZO3A 4FEVA 5HHWA 3GCVA 4U3ZA 2XM8A 5AUYA 2O8YA 5HORA 4G3GA 5BPYA 4A4XA 5AEPA 2F7ZE 5T6KA 4WG3A 3LZBA 4FV6A 2O64A 2OKRA 3HV6A 4E5AX 4FIJA 4AE6A 2QOCA 3QKMA 5L3AA 3QAME 4FV9A 5HKMA 4QDEA 3CPCA 3QQFA 4WUNA 1SMHA 1VR2A 4J97A 4JIKA 3MVJA 5ACBC 2IW8A 2JFLA 4AW1A 4AA0A 4CQGA 2OZAA 5AA8A 4HGLA 5LOHA 3Q96A 4F9BA 3LPBA 3R04A 4FTTA 4BCNA 4E4MA 3MVHA 4AW0A 3BELA 3C0IA 3ORPA 4L46A 3POOA 3EQGA 3AKKA 3AD4A 4WG5A 4YJQA 5M09A 4E6DA 2A19B 5HX6A 5DYJA 3WIKA 2GQGA 4BDIA 4S33A 3OUNB 4FSTA 4AGWA 2G2FA 1H00A 4E1ZA 1A9UA 1NXKA 3ZCLA 3HMMA 4ALWA 5ANJA 3FL5A 4H58A 5AP3A 4AE9A 4EOIA 3SLSA 2NRYA 3G9NA 5AUXA 3QA0A 4DE4A 3PY1A 2JIUA 3TI1A 4IDTA 2J0JA 3V5TA 5EI2A 3QYZA 4ITJA 4MXYA 1LPUA 2W7XA 1BLXA 3I0QA 4LL0A 4C37A 4V0GA 4S30A 4UBAA 1W98A 4U9AA 5IG1A 4JBVA 4D2VA 4BCJA 5IDPA 2JAVA 3ANRA 4U44A 4DT8A 2PK9A 1OIUA 3FMKA 3JVRA 2PWLA 1XH7A 4F7LA 2WQNA 1PHKA 3E8EA 5AX3A 1U5QA 2VD5A 3TXOA 2VO7A 4NYEA 4APPA 1WAKA 4YZDA 4EKLA 5M4FA 4IACA 5BVKA 5CENA 2JC6A 3KA0A 3CQEA 3AC5A 3C4CA 4NFMA 4LGHA 4O0XA 3FAAA 2EU9A 2PZ5A 4B4LA 4MCVA 5AR7A 4E5BA 3C5UA 2NYAA 2YZLA 4BTMA 3W8LA 4CZYB 2GDOA 2JBPA 1YOMA 4I6FA 4PV0A 3UMWA 1GIJA 2W1IA 4G34A 5DNRA 3TWJA 2XA4A 4RJ6A 3R7IA 3C4FA 1LP4A 3BQCA 3QUPA 4NL0A 3HAVA 3CJFA 3FXWA 5IMEA 3EN5A 3GOPA 1KV1A 5EOBA 2WMRA 4O1PA 4FSZA 4XRJA 3ZEWA 5IQHA 4WRGA 4C59A 5AP6A 1Y6BA 2YDIA 1KE6A 4DEAA 3NUAA 5CAUA 4F78A 1H01A 2FSLX 3OUKA 4AQKA 4PP7A 5CAVA 2BRHA 4ONAA 3GU7A 2YM3A 4FTJA 3R7YA 5AADA 5FDXA 4KA3A 3G90X 3IDCA 2BAKA 4FE2A 5LCJA 4S34A 4DEIA 4OGRA 1ZYLA 4PNKA 2GHGA 5CZHA 5HG7A 3OWLA 3PVUA 1WBWA 4EYMA 5HIDA 3A8XA 3GC9A 3NRMA 5CS6A 4FNYA 2HWPA 2Q0NA 4OTPA 4YJVA 5HVJA 4XP0A 4XG9A 2IVVA 4C58A 3AGLA 3CJGA 5AP5A 4ERKA 4UN0C 1Q8TA 4O6EA 1P2AA 4IH8A 3EHAA 5DGZA 5DOSA 3UG2A 3Q60A 2CGXA 2HK5A 3OWKA 3Q4TA 4QPMA 4KAOA 4AGDA 4ALVA 2CGUA 4YJOA 5F95A 3IW6A 3VBWA 2FYSA 3MH2A 2YACA 3TJCA 3N4VA 2BROA 4C2WA 3R7UA 4I24A 4QMYA 1VZOA 3WF6A 4I5CA 2DYLA 5HD4A 2HZ0A 4O4BB 4QNAA 3FXZA 4BFMA 3EQBA 4DTBA 4F6WA 3QYWA 3DZOA 4BCPA 4WNMA 5GIOE 5GIPE 5I5ZA 3TMOA 3MI9A 3OROA 3ZUTA 2XK9A 5IA4A 4HZSA 2BFYA 1FBNA 4D1ZA 3QFVA 2EUFB 2OICA 1J3HA 3NYNA 4ZTQA 2O0UA 4MX9A 3VUGA 4A9TA 5AV2A 4CYJA 3P5JC 3DLZA 3FLQA 3R7OA 2X8DA 2QU6A 4XLVA 5J8IA 3K5VA 2UZOA 3NCGA 2C6LA 3PPJA 2CJMA 4U81A 5FD2A 4OTQA 2X4ZA 2OZAB 4S31A 2RF9A 1P14A 2BTRA 2BILB 4FG8A 4Z7GA 3DBDA 2VRXA 1QMZA 3PJCA 4CTBA 2HZNA 3Q9ZA 3W2PA 5CAQA 2QONA 4I3ZA 1QPJA 2UZUE 3FI4A 3FQSA 5A4EA 2ZM3A 4L3LA 3Q4CA 4JG7A 4X6RA 3CC6A 4DGNA 2OJ9A 3E88A 4KD1A 3UC3A 4ZJVA 3Q32A 5CY3A 3VULA 2OXYA 3MA6A 2G2IA 3R6XA 4W8EA 4UV0A 4RVLA 1MUOA 3W0OA 3TKHA 4U42A 3NIEA 4E4XA 2ITYA 3FLSA 4QRCA 3RZBA 2VTIA 3D7TA 5BVNA 3P0MA 3IGOA 4O0RA 4L42A 1M7QA 4M13A 5CI7A 3C51A 2R3HA 2W1FA 3WZUA 3M11A 2XUUA 4N6ZA 5IF1A 4GFMA 5H8GA 1I09A 2W1DA 4IWQA 3R0TA 2W17A 3O0GA 2UZLA 4X3FA 4DGMA 2O63A 1V0PA 2WQBA 4QPSA 4IHPA 3VF9A 5AFVA 4YPDA 3ZH8A 3OY1A 5FWKK 5CVFA 4CG9A 1BMKA 2EXMA 4CEGA 3DBCA 3KIOC 4KKGA 2Z8CA 1IA9A 2B1PA 3RTPA 4C57A 5KNJA 3P23A 3W0QA 3I6WA 4H36A 3IG7A 2ERZE 3UJGA 4C4GA 1ZYCA 4UX9A 4O21A 4W4VA 4WSYA 3GQIA 3MFRA 3UIMA 4CFVA 2C6OA 4I5PA 2UZBA 4NU1A 3ORZA 4F0FA 2VX3A 2CN8A 5LQFA 1NVSA 3KRXA 3ZZWA 1Z57A 4R5YA 3E3PA 5DLSA 4E4LA 3V8WA 2YN8A 2OXDA 2VO3A 5K4JA 3MTFA 2OJJA 5J5TA 4RIWA 1MRYA 3HA6A 5IUGA 5LJJA 5AR4A 3JPVA 2OGVA 2XIRA 5ANIA 3RALA 3I6UA 2GNLA 4ANLA 4FIEA 3D14A 4ZLYA 3AMYA 4GK3A 4I23A 1MQBA 2EB2A 4E6CA 3V3VA 4RJ3A 3NDMA 5ETFA 2X0GA 3EN6A 5DRBA 3TKIA 4L52A 4TWCA 3R73A 2PZRA 2BRMA 4EH5A 4NJ3A 2WO6A 3DB8A 1PXOA 4RC4A 5IEXA 4O4FA 1CSNA 3P1AA 3SV0A 3LW0A 4L8MA 3NYOA 2FSOX 2GU8A 2IVUA 3BU5A 4CQEA 3NUUA 4DBXA 4MTAA 1XBCA 1YOJA 3O7LD 2O65A 2UW3A 5EI8A 4IB0A 5HG5A 1APME 1W0XC 2JFMA 3BEGA 5FXQA 4AAAA 3W2QA 4F99A 2WOUA 3HEGA 4B99A 1ZZLA 4KIPA 2UV2A 4C02A 3Q2JA 3B2TA 5E1SA 4ZS4A 3VJNA 1H07A 5CSXA 5CEQA 3GU5A 5DG5A 4W4YA 4PPAA 4J1RA 4OTHA 2BZJA 4QMWA 5H2UA 3Q5ZA 5DR6A 4JS8A 5EI6A 4QMZA 4O86A 4I1ZA 2J9MA 4TL0A 1YKRA 3ACKA 1VYWA 1Q41A 4O0TA 3WYXA 4QNYA 3AMBA 3MN3A 5B7VA 1JWHA 2OF4A 1FGIA 2YISA 4ZOGA 3MY1A 5FTQA 1RJBA 5HESA 4M14A 3N51A 3FLNC 4NZWB 3ZC6A 3BI6A 5E9EA 4QP3A 1YI6A 4BJJA 2BMCA 2ERKA 5CXHA 4IZYA 4F9CA 3CXWA 1ZOHA 4FSQA 4AACA 2QO7A 4UEUA 4F7SA 3UDTA 4IB5A 4F6SA 2VGOA 4DFBA 3PWDA 3IW7A 4G17A 2WU6A 4EK3A 4C34A 3E64A 3DQXA 2PL0A 5I9UA 4YZCA 2XCKA 2GFSA 5CEKA 3U6IA 4RFMA 3C13A 3I79A 4J96A 4RRVA 5I9VA 3CP9A 1OL6A 4LL5A 2R4BA 3F5XA 3R9RA 3EQDA 3ZC5A 4JQ8A 2YWVA 4I6QA 4BF2A 3QTUA 5GZ9A 4D1XA 4RWJA 5J1WA 4DDIA 2OI4X 3D7TB 4EWHA 3KCKA 3ZONA 4MXAA 2VTMA 4CV9A 1BYGA 4XV1A 4QYHA 5EYMA 4JMQA 1YDTE 3OHTA 5TE0A 1G8AA 2WMUA 4X2FA 3PXZA 3ZSGA 3BU6A 5C8MA 5HTCA 4PRJA 1H26A 4QQ5A 5C8NA 2C47A 1YXSA 3R00A 4RMZA 3DQWA 1NVQA 3O71A 3VW8A 4YPSA 3QA8A 4WUAA 5CF4A 4M69A 1PXNA 1I44A 2HELA 4FT7A 4CT2A 3R9NA 1SVEA 5DT0A 2P2HA 4USDA 4DDGA 3E8DA 4R7IA 3VS2A 3IECA 2W4KA 2C0OA 2VO6A 2WD1A 5DEYA 5M4UA 3G15A 4RBLA 4H3BA 3HLLA 3PDTA 2BKZA 4AA5A 3GCQA 5HZNA 4FV7A 2GCDA 3I5ZA 2AC3A 3JR1A 1BKXA 4YTFA 3UQFA 3KRWA 4DGLC 3Q3BA 3QCXA 3W2OA 2HYYA 2ZVAA 3FE3A 3PVWA 1U59A 3AKLA 3ROCA 2NNWB 4F6UA 4FTAA 1YXUA 3QHRA 2YLEA 4ZTRA 4YP8A 3SXFA 2JIVA 4CRLA 5CU3A 4RIWB 2PPQA 2JKKA 5HIBA 1OZ1A 4XP3A 4EH6A 5L8KA 4BICA 4FKUA 1UU8A 3QTWA 2WEVA 4H3QA 5FQDC 4D5KA 2ITUA 3D0EA 2W99B 1XHAA 3QKKA 5HVYA 5LVMA 3ATTA 3D9VA 4M15A 1PY5A 3VS7A 3W2SA 3L8VA 5GNKA 2GS7A 3BBWA 4F64A 3DXQA 4G3CA 2UW9A 2NRUA 4GU9A 4EC9A 2ZMDA 4EH8A 5BVFA 2X4FA 4GKIA 2XKDA 4AOJA 4G6LA 3FSFA 2R5TA 2XJ2A 1DM2A 5DT3A 3AC2A 5HX8A 4DH5A 4Y95A 4OTDA 1OI9A 2UZVA 5A4QA 2PMNX 4GCJA 2YFXA 1E1XA 5T68A 1BL7A 4IM2A 4AFJA 2XBAA 4RIYA 4AU8A 2PMIA 3NAXA 4BDJA 3NUNA 3H0ZA 2R0IA 3HZTA 5FDPA 3CTJA 4XHKB 5JRQA 3S0OA 3NUYA 4DFNA 4ANMA 5C8KA 3GCSA 3B2WA 2JAMA 2XEYA 3TIZA 3MV5A 4QT1A 5DE2A 4CSVA 2ZV9A 1KSWA 4G5JA 3ZUUA 4ERWA 3GB2A 5FEDA 1M2PA 3Q4UA 4IBMA 4MD7E 2F49A 3CTHA 4BKZA 3VS6A 4BBEA 5C27A 2WMSA 3P9JA 4R1VA 3R1YA 3GGFA 3UDSA 5AP2A 4F9WA 2IO6A 3NW5A 1WVYA 4NKAA 4K9YA 4V04A 4HGSA 4AZWA 1KUTA 3KRLA 5GHVA 2G1TA 4CFXA 1NVRA 5C03A 2WIHA 3CCNA 4AFEA 4YC6A 3D2KA 2ITVA 2IZRA 4WNKA 4L6QA 3SKCA 4O7NA 3U9CA 3ZTXA 4W4WA 4MXXA 3SW4A 1Q8ZA 4WNPA 3IW5A 2X2LA 1Q5KA 3ZO4A 3PIZA 2W5BA 3FJQE 2ZM4A 2BRBA 4IFGA 2YM5A 4DTAA 1X8BA 3HV4A 1YHVA 5EM7A 5EHLA 1FVRA 2WQEA 3HRCA 1OPJA 4J71A 3OCGA 5FP6A 4BCKA 1KWPA 3QF9A 1ZRZA 4FT9A 1W82A 2OFUA 2XNGA 2ZMCA 3POZA 4FR4A 3SXSA 3V5WA 3ZBFA 3VS4A 3CSVA 2GNIA 4C36A 4EOMA 2PUNA 2W1CA 3ATSA 2E9PA 3I7BA 2NP8A 5CVGA 2WTCA 4YU2A 1OMWA 2X81A 3RHKA 5A6OA 2CKQA 2PVHA 3T8OA 2CDZA 2HW6A 1E1VA 3EH9A 2YDKA 5BQ0A 3GU4A 1YWRA 4W4XA 2YAAA 5CF6A 4BDCA 2X0QA 4DHZA 2XNBA 1PMEA 4TN6A 1QCFA 3IGGA 3AD6A 5AJQA 5LVLA 3LXPA 4WNOA 1OIYA 3TNQB 3ORTA 2XB7A 2CMWA 2VAGA 2Y0AA 3IW4A 4QYGA 4U3YA 4W9XA 2XARA 4YTCA 4FKVA 4GJ2A 2F7EE 1WVXA 3FMLA 4M7IA 4H1JA 4M97A 5FXSA 4IAZA 4CMOA 3G0FA 2W5HA 4TT7A 3VUTA 3UDBA 5AUZA 3ODZX 1XH5A 4BHNA 1W2DA 3CY2A 3Q4ZA 1Q3WA 3FY0A 4BL1A 2YAKA 4JR3A 1PXKA 2OIDA 2PE2A 4FV8A 4EH9A 4YZNA 3COHA 2B7AA 3R7GA 1Q3DA 4FF8A 2OSCA 3C7QA 4M0ZA 3DOGA 2YZAA 3QRJA 4FYNA 4J8MA 4RJ8A 3IDPA 4PMPA 2WFYA 2XS0A 3BPRA 3OT8A 4OBPA 3CIKA 4OT6A 4C4HA 5J9ZA 3TDWA 2FGIA 5EW8A 4FSYA 5FXRA 1URWA 4E7WA 1L8TA 4MNEA 1Q97A 2VTRA 3AC1A 4JDKA 3NZ0A 4UYNA 2QQ7A 3DGKA 3UC4A 1ST0A 5FLFA 3EN9A 2CGWA 5HNIX 1GIIA 4FIIA 5BV3A 4BWKA 3EQIA 4AGUA 5E8XA 3N4TA 5M4IA 2XNMA 1SM2A 4PNIA 4RX9A 3PYYA 5EW9A 2QKRA 3DA6A 3KF4A 4X2NA 1LR4A 2O5KA 3ORMA 3WF8A 5IQCA 4ACMA 4CKIA 2C3JA 4PUZA 3T9IA 4NFNA 5BVDA 3KXGA 4MNFA 5JMSA 5LWMA 3I81A 4KNBA 4WT6A 4AA4A 1M14A 1H4LA 1Q24A 3VJOA 3FMJA 4FBXA 2F2UA 4JG8A 2PVJA 4BRXA 3UZTA 1B38A 2PZPA 4JOAA 4PMMA 4R7BA 5CALA 3MWUA 3PY3A 4YZMA 3LFAA 4IVAA 5TR6A 1H08A 3FYJX 4EHVA 2ZV8A 2R0UA 3OT3A 3M2WA 2EWAA 4O27B 1H1QA 3EN4A 3ERKA 4FRFA 1J1CA 3KXHA 5D11A 5BYYA 1IRKA 1WBVA 4NM5A 2J50A 4WBOA 2Z7QA 3WE4A 5HCXA 3ROYA 5CQWA 1KE8A 5KMLA 2WXVA 4EEVA 4UB7A 1WVWA 4C4IA 3DPKA 3D5VA 3RK5A 4XEYA 3QUEA 3FLZA 2EVAA 3C50A 3G51A 5JZNA 4FNWA 4IXPA 4EK6A 1W2FA 4EQUA 2Z02A 1Q8YA 4FT5A 5JGBA 3K3JA 4FV3A 4H05A 3LFFA 3QALE 5FGKA 3ZRKA 2C5VA 5CTPA 3VW6A 4MF0A 4AAYA 3TTIA 5KZ0A 3BKBA 3NAYA 4K11A 3IDBA 3BYVA 5DFPA 3MJ2A 4BZDA 5A14A 2YM4A 1J7IA 5T3QA 5E4HA 3RAKA 2VTTA 3DBEA 3KKVA 5GZAA 3O96A 4FL2A 2IW6A 2WTVA 1UVRA 5J95A 2SRCA 2R7IA 3QZHA 2R3LA 1W83A 3MFUA 4HZRA 4USEA 4YZ9A 5K5NA 3NR9A 2YIRA 4HOKA 1BL6A 1OBGA 4GG5A 4Y5HA 3QZIA 3H3CA 4DN5A 3MJ1A 4EOPA 1H25A 1CDKA 1ND4A 4UXQA 2PU8A 2WMWA 5IUHA 4FVQA 4RWKA 3RKBA 3ZBXA 4F1OA 3OG7A 4GH2A 4MQ1A 3OY3A 5IA5A 2YERA 5AR8A 4EOSA 4O7RA 1DI9A 4PL3A 3MPMA 3VAPA 4O82A 5J87A 3TN8A 1JOWB 3CQWA 3LFSA 3M1SA 2QODA 5JQ5A 4I94A 1BUHA 3PXYA 3Q6WA 3W8QA 3DJ7A 3DLSA 5IU2A 4XBUA 5BX0A 4G2FA 4AXCA 4O4DA 3DTCA 4BIEA 4HCUA 3PA3A 3S95A 2UZTA 1ZY5A 2H96A 3PXKA 5IQFA 2JIIA 3W10A 2Z7SA 4NIFA 2I0YA 4CMTA 2OBJA 5KMOA 2YIWA 2J6MA 3QQJA 4K0YA 4FTIA 3C5IA 2BPMA 4BBMA 1BX6A 3LHJA 2IVTA 4LM5A 4R7HA 1IASA 3W55A 4QQJA 2UVYA 3GEQA 4RPVA 5BNJA 5L6OA 1M52A 1NW1A 1PXIA 1UU3A 3U4UA 4GFGA 2QU5A 1YWVA 2ZB0A 1H24A 3OZ6A 5CU6A 2VX0A 4G3DA 5EYDA 4P5ZA 4CFNA 3ZSIA 2XJ0A 4EHZA 4EUUA 4DH3A 3O50A 4TKSA 4ZSLA 2C5XA 5E8VA 5L2IA 3DV3A 4L43A 3QTSA 5HCZA 4ASEA 2CPKE 5EM5A 5IA2A 3FL4A 3SXRA 4Q9ZA 3HMPA 1XBAA 2R3OA 4MNEB 3RNIA 3SRVA 3FHIA 3O51A 4KRDA 3RM6A 3KN5A 1DS5A 4OLIA 2E9UA 2C3KA 3KU2A 3UIXA 3PSDA 1OKZA 4F0GA 1SZMA 4KWPA 4QP1A 1YVJA 3TACA 2VTSA 5B2MA 2C6DA 4YJRA 4QP6A 3HV3A 3WZJA 3UYTA 3NWWA 2GHLA 5A9UA 3ZRLA 1XQZA 3UO6A 2B9JA 3CGOA 4NUSA 3GENA 4U97A 4DG3E 2IVSA 4XBRA 2V55A 4UMTA 4OAVB 2R3FA 3AG9A 3RPRA 4AZFA 3U54A 4BDAA 2R3NA 3D4QA 3ZFYA 4FL1A 4HVSA 3P86A 5J1VA 3T3VA 3BYUA 2F4JA 4EOLA 1PW2A 3ORXA 4RA5A 1WFCA 5ICPA 4J53A 4LMNA 4CKRA 1OIRA 4FUYA 2YIQA 4DBNA 5CEOA 2OK1A 4C8BA 1YI3A 3LKMA 1V0OA 3D7ZA 3ZLWA 1ZMUA 2J0LA 2WTIA 4RT7A 4N4SA 5EG3A 3EN7A 3A2CA 3VUKA 4RX5A 2BUJA 4AXEA 4CFMA 4H1MA 1KOAA 4FTRA 3ZDUA 4IWPA 3GCUA 2QOFA 3DJ5A 5EFQA 3UGCA 4E20A 2EXCX 3DJ6A 3R8LA 2KULA 2I40A 4GT5A 2W0JA 4UXLA 5F4NA 2X7GA 1B39A 4O38A 1YW2A 3MPTA 3O2MA 4OR5A 4OTRA 3MFSA 3UQGA 5CXZA 2WTDA 2UVXA 3WI6A 3A60A 4ITHA 3S4QA 3ITZA 4ZS0A 3UIUA 2WAJA 1ZOEA 4MBJA 4D5HA 5A54A 1H28A 4FV2A 3DKFA 4WKQA 5FUTA 3HECA 1ZY4A 4BDEA 1KE7A 4K18A 2GQSA 5CT7A 3H30A 3CD3A 5HE2A 4ACGA 4I6BA 4F1TA 4F09A 5CAOA 3F2RA 5LVPA 4Y83A 2GMXA 4JXFA 4QTCA 4IZ7A 1BI8A 2YLFA 3BIZA 4O4EA 5CSVA 5AR3A 2I0HA 4B0GA 1XH9A 3PVBA 3PXQA 3QLGA 5JQ8A 4BGQA 4YMJA 5DMZA 3O5AA 4DF3A 1IR3A 2YA9A 4Q9SA 1GAGA 4D2TA 2G9XA 4II5A 3BZ3A 4KBKA 4EBVA 3FKLA 4MVFA 3G6HA 4AOIA 4D4YA 5JKGA 4OTWA 5AUVA 4ITIA 2A98A 4LGGA 5EYKA 5KMIA 4IVDA 1R1WA 1XWSA 3HP2A 4PDSA 2PUPA 2ZB1A 3A4PA 2DWBA 3R1SA 4L3PA 2UW5A 3NYXA 3HAMA 4BIDA 4AX8A 2RGPA 4L68A 4V05A 2WOTA 1IAJA 5A4CA 4LFIA 3A4OX 2RSVA 2V22A 3LLAA 3LCOA 3PIYA 2UZEA 3ORLA 3QC4A 2EXEA 4AN3A 5CYIA 4FZDB 2J90A 4KKHA 5JZJA 4JVGA 2CN5A 3LLTA 4C61A 3BQRA 4NIFB 1WBSA 3F3VA 4U5JA 3I4BA 5AAGA 3UPXA 2CKPA 4RQKA 1XH6A 2PYWA 1PXJA 4R5SA 2C6EA 4MHAA 4RX8A 3FYKX 4XCUA 5G1XA 3UOLA 1OIQA 3K5UA 1O9UA 4KBAA 4ZJIA 4EH7A 4UZDA 5IDNA 2ESMA 2GNHA 2PY3A 3GXLA 4FKGA 3UMXA 4APCA 3UOJA 4BI0A 4ARKA 2W1HA 2XNPA 2CLXA 3ZO1A 3R71A 2R3RA 3F6XA 4TNBA 4DFLA 5JT2A 1KV2A 4WSQA 5IQGA 3I7CA 4MK0A 1H1WA 2BHHA 4DLIA 3ULZA 4X2JA 5IZFA 2ETKA 2W4OA 5CF5A 4XLIA 3A7JA 4R1YA 2JKQA 2OH4A 1UWHA 3SRVB 3MH3A 4EUTA 4YURA 3DNDA 3W0MA 4UALA 3TNHA 3KMUA 3A62A 3UIBA 1OL1A 3PPZA 5BVOA 4A7CA 3SVVA 2GHMA 3KFAA 4R3PA 5HO6A 2YITA 1YQJA 4JG6A 3LJ1A 3V6SA 5CU2A 4IX3A 3P7BA 4AGCA 4L44A 3QHWA 3CKXA 4BDGA 3UP7A 4K1BA 3MY5A 3HDNA 1NT2A 5HE0A 5DR2A 3LOKA 4MUQA 3LIJA 3ZLXA 4CGAA 3KRJA 2NO3A 2QG5A 4NT4A 3MIAA 4JIAA 3LMIA 3W33A 4FIGA 5L8LA 4AWIA 3DBFA 4CD0A 2WMAA 3H9RA 4FV0A 3QUDA 4I5HA 4J7BA 3M42A 2CSNA 2OH0E 3G2FA 4PY1A 4BCIA 4FKIA 3CD8A 4DTKA 5M44A 1F5QA 2BZHB 3MBLA 4OBQA 2QURA 4ZAUA 3KC3A 4BVUA 4I0RA 4JT3A 4D9UA 4MBLA 3ZDIA 3AXWA 4C33A 3BEAA 5L6PA 4GKHA 3FDNA 3DK6A 5B2KA 5HNBA 3WE8A 3OOMA 5ANEA 4BY9E 1Z5MA 3FMEA 4AG8A 3IO7A 4FUXA 2W05A 2WGJA 2FH9A 2XKEA 5E90A 4YC8A 3SGCA 3NUSA 4XYFA 5EOLA 3QL8A 5HICA 2DQ7X 1YXVA 3V5LA 5KX8A 4DLJA 2RFDA 5FBOA 1FMKA 1TQMA 5F1ZA 3F3UA 4BCGA 2G15A 4L45A 1OL2A 3UDZA 3A8WA 3R9OA 5E8TA 1G8SA 2I6LA 3TV6A 3O17A 4PL4A 2WHBA 3VUDA 3TYKA 2PVMA 4TZRA 4TWPA 3R21A 2YIYA 3LFBA 4LQMA 1OVEA 1FINA 1P5EA 3DBQA 4QTEA 2YM7A 5M07A 2WMBA 3RZFA 2C69A 2ZV7A 2XNEA 3NEWA 4GG7A 5CZIA 4DEEA 3KB7A 2YCFA 3F61A 2X8EA 3CY3A 3IK3A 2ETRA 4PX6A 5HEZA 3T9TA 5DEWA 2P33A 5CLPA