3ZU7A

Crystal structure of a designed selected ankyrin repeat protein in complex with the map kinase erk2
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
344
structure length
344
Chain Sequence
EMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MITOGEN-ACTIVATED PROTEIN KINASE 1
publication title Structural and Functional Analysis of Phosphorylation-Specific Binders of the Kinase Erk from Designed Ankyrin Repeat Protein Libraries.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/de novo protein
total genus 102
structure length 344
sequence length 344
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2011-07-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zu7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zu7A01
1J7UA 5IQFA 2PE2A 3QTZA 3KEXA 4RX9A 2G1TA 3P78A 3TCPA 4QTAA 1ZWSA 4D4RA 3C51A 4E20A 5KHWA 2P55A 2C1AA 5GIOE 2XMYA 4O0WA 4CLJA 4U3ZA 5E90A 2HENA 3VS1A 3Q9WA 1R1WA 4BHNA 1A06A 3WE8A 3R8PA 4MF1A 2BHEA 5KBRA 3OCBA 3FQHA 3HRFA 2I6LA 4GK4A 3IW5A 3CPBA 5AV3A 4JX7A 3DBDA 4MXXA 1M14A 5BVKA 3RBWA 4K6ZA 3G90X 3ZZEA 1IAHA 4FC0A 3QYWA 4OT5A 2BIYA 3P1AA 3LFBA 3ORTA 4OBPA 5C8MA 4UMPA 3QZFA 3GUBA 4RG0A 2W06A 4FSRA 4GL9A 3MB7A 4M68A 3CJGA 4M7IA 4CT2A 5K9IA 3U6JA 2CKPA 4BR3A 3ORZA 3QLGA 4JIKA 3H0YA 5DVRA 4EBVA 3ZEWA 3CY2A 5KUPA 4BGHA 4F09A 3FKNA 4FZAB 3NYOA 4F7SA 3ZHPC 5M4UA 5D41A 2WMWA 3S00A 3MV5A 2QD9A 4U45A 3R8LA 4YZCA 4MXYA 3V5WA 1KE6A 3SOCA 1P14A 3DKFA 3WF6A 3WZUA 3JY0A 3LFCA 4IFCA 4IAFA 4G34A 5KBQA 1STCE 3C4XA 4JQ8A 2VU3A 3BBTB 5EHOA 4PY1A 5HLPA 3TZMA 5AP2A 3UNJA 4AG8A 4LM5A 2VWVA 3L8VA 4RJ5A 1NVRA 2PVFA 4FKGA 4FV6A 5IA2A 4FIFA 4KIKA 2J50A 3MFSA 4O27B 3CQWA 3EN6A 4X6QC 5ETCA 5AR2A 4PTEA 2EWAA 4BGGA 3LCKA 2PE1A 3OXTA 4O0XA 3E8CA 5LVLA 3EN4A 4RJ3A 3QTUA 4C57A 4LRKA 4FIGA 3LKMA 5I9XA 1GIHA 3QD0A 3T8OA 4BWKA 4QP4A 4YURA 5HE3A 3AG9A 3A61A 4GFGA 5FBNC 2XRUA 4BIBA 3GXLA 2HY81 2XIRA 5IA1A 4V0GA 4D2RA 3R9DA 3KULA 4FEWA 5BVOA 4FVRA 4YC6A 3KA0A 1Q24A 2NRUA 5EK7A 4C61A 3ULIA 3UVQA 4CMTA 4ZY5A 2VTQA 4K2RA 5CAPA 5HVYA 4FICA 3LCDA 5ETAA 4WNKA 3LMIA 3ENHA 5GZAA 1Q97A 4ANMA 3GCQA 3GI3A 3KXMA 1G5SA 1MRYA 2BZHB 2VO7A 3V01A 1Z57A 5JSMA 4IQ6A 3QCQA 3RINA 3E8EA 3OXIA 4UV0A 1OGUA 3OS3A 3HA8A 3DFCB 3G9LX 3AOXA 4ZSLA 3U8WA 4ACHA 4F9WA 3KFAA 4QTCA 4TT7A 4FZ7A 2IVVA 4GU6A 2QOQA 4XBUA 3V5TA 4RVTA 2E2BA 5CXHA 3U9CA 3KCFA 3Q4UA 2WIPA 3LFFA 4GJ2A 3HZTA 3VS2A 4DC2A 3QRJA 5HHWA 4C35A 4NTTA 4YHJA 3KRXA 5KNJA 3LQ5A 4G6LA 1YHWA 2B1PA 4K33A 2Y6OA 4HPTE 1Q3WA 3GCSA 5EM8A 3AC1A 4OTDA 5I9UA 3BBWA 5D7AA 1SNXA 5HCXA 2GDOA 3ORXA 4C4IA 4NFNA 4ZY6A 2WO6A 4C36A 4RX8A 1QPCA 2R7BA 4FV0A 3CSVA 4DCEA 5EDPA 4C2WA 1JSUA 2X6EA 2QG7A 5DT4A 4AZTA 4BCGA 4AT3A 1Y6BA 2XEZA 2YLEA 2QO2A 4BF2A 4YJNA 3RZBA 3BU6A 5FXQA 3EQPA 4X3FB 3B8RA 4ANQA 4U6RA 1F0QA 4I5PA 2VD5A 5HESA 3HMIA 4MD8E 4J8NA 1P2AA 1H1RA 1SYKA 3BE9A 3ZO4A 2HXQA 5EKNA 3RALA 3FQEA 3HX4A 2B53A 3PDTA 2H9VA 1CM8A 1AQ1A 3QHWA 4BDEA 4EOJA 4FG8A 1W8CA 4JS8A 4IM3A 3WILA 3R7EA 4FT5A 4GRBA 2OIDA 4DITA 4FYNA 1BL6A 2PMIA 4M67A 1UU7A 3LCOA 5T6KA 4BL1A 4NM0A 3NVKI 4ZJVA 3GBZA 4V04A 2RG5A 2R3IA 4QMUA 3HVCA 1W98A 4GVJA 4RC3A 2IN6A 4GIHA 1Q62A 4HCTA 5C03A 4L67A 3QYZA 4QYGA 3NUNA 3DU8A 1BX6A 5AP3A 2P2HA 4RIWB 3NCGA 5F1ZA 5DBXA 2PVYA 1KOBA 1PXOA 2E9VA 2Q83A 3BU5A 4C62A 4CSVA 5CF6A 2CGUA 3D9VA 5CZIA 4G6NA 2R5TA 4GS6A 3UNZA 4GKHA 3TEIA 1PF8A 3QQHA 2YABA 3PXFA 4FKLA 3IW7A 3Q32A 1CKPA 1PXLA 2WIHA 3U87A 3QD3A 3V5QA 4JQ7A 2O8YA 4EWQA 5FM2A 1W83A 4K1BA 3PPJA 4K18A 4AA5A 1OITA 4IVDA 4UXLA 4XG8A 4MWHA 4QMZA 1OKWA 3EQIA 3RGFA 3CD8A 1Q5KA 1J3HA 1XBCA 3GCUA 3BGPA 4EHEA 3GU5A 2W5AA 4IDVA 4IX4A 4BDDA 3C4CA 4NSTA 3BKBA 4G9CA 2XK3A 4TNBA 3R04A 5JFXA 3G0FA 3DT1A 2CNQA 2B9JA 4CG9A 4ZXTA 3ORIA 2UW6A 2JKOA 5CQWA 3ID6C 3EOCA 3A8XA 3QCYA 1DM2A 4ZIMA 2I0VA 4I6QA 1ND4A 5EQYA 4JNWA 4S2ZA 3FC1X 2XNGA 2JIUA 1YXXA 3BYUA 4BDCA 5BPYA 5BVNA 2J9MA 2YCSA 3D0EA 1ZYJA 2P4IA 5ICPA 4YC3A 5IEYA 3DDPA 4IWDA 4C4FA 5KE0A 3Q2JA 3IO7A 4JL9A 4DF3A 5LJJA 3RTPA 3P5KA 4N0SA 5AUZA 3K3JA 3W16A 3VUIA 3KK9A 4I3ZA 5AX3A 3UMWA 1XH6A 2C5XA 4G5JA 3BLHA 4Z55A 5IA4A 2WEIA 3H30A 4J99A 4GCJA 4ZZNA 4CZUA 4QYYA 5J79A 3R22A 3UQGA 5LOHA 4LV8A 2G9XA 3PLAE 1XJDA 4TWNA 2XKEA 4RC4A 2XJ2A 3VS0A 2G15A 4X2KA 3E8DA 3BHVA 4D58A 5LVMA 2CJMA 3RPRA 3S4QA 2F2CB 4WIHA 4A9SA 2PMOX 3PTGA 3A7FA 3ROCA 3RPOA 3LM5A 5L2QA 4OBQA 3ZRMA 3TV7A 4DEHA 3FAAA 5EQEA 4GG7A 3UC4A 2C3JA 5A9UA 1YWVA 4UBAA 4IWOA 4WNMA 4PNIA 1H1SA 2YITA 3CBLA 3O17A 3PYYA 2H6DA 2HZIA 2ZM4A 3CEKA 1PXPA 3OF0A 4NM5A 3QA8A 5M55A 2BILB 4Z16A 3SVVA 2W5BA 4FL2A 3ZFYA 4FTRA 5AR7A 5A4LA 2UZLA 2QO7A 4USDA 2FYSA 2O5KA 2WTCA 4RX7A 3RCDA 3QCXA 5FTGA 4F7NA 3OUKA 4XRLA 3S2PA 4QYEA 4WHZA 2NPQA 4PQNA 3SG8A 4ZP5A 4DG0E 1QPEA 2CNUA 4PV0A 5HG8A 2OH4A 4BDHA 4IVBA 3L8XA 5EM7A 2FA2A 5JQ5A 2IG7A 3NZ0A 3GU7A 3O96A 4D55A 5E1SA 4YNOA 3FXWA 5D10A 2XA4A 1DI8A 5LVPA 4FTIA 4ARKA 3PY3A 2ITZA 4R5SA 1ZZLA 4PPAA 1WBWA 3PXYA 4QMWA 3FMLA 2CPKE 1GZ8A 1OPKA 3OEFX 4FKOA 4I6FA 2B55A 2ZJWA 4XHKB 5CT7A 4EOLA 4M69A 3ALOA 3MIAA 5AIKA 5F95A 3EQRA 3ZFXA 2GS7A 4E5WA 4UEUA 2W1HA 4QPAA 1XH4A 2R3LA 3KGAA 5L6PA 1ZZ2A 3SA0A 5DYJA 4AQCA 2C3KA 1O6YA 3HYHA 5KMJA 5DT0A 2QU5A 4Y8DA 5AM6A 5TF9A 4F0IA 4IZAA 2WMTA 5AMNA 3LJ0A 4CT1A 3BX5A 4AE6A 1CKJA 2QOFA 4OR5A 1H1WA 4GEOA 3R00A 2XBJA 4Y85A 3FSFA 5AUWA 5I4NA 3A4OX 3KF7A 5FRIA 3DA6A 3R7IA 1YHSA 2ITPA 4RA5A 3EFJA 4PPCA 4CFNA 4O91A 2XK9A 4X2NA 3SAYA 4EC9A 3BGZA 4YHTA 3TDWA 2X2MA 3ZLXA 3UO6A 2IVTA 2QKRA 4EOMA 5FDPA 2QOKA 2V22A 4TZRA 1YW2A 5K0KA 3MH1A 3QD4A 5KCVA 5IH4A 3QRTA 5AV2A 4W4VA 3FLNC 3LPBA 1NY3A 3FY0A 2IWIA 2C6LA 4U40A 3C1XA 4YZMA 4XJ0A 4CXAA 4L43A 3Q4CA 3SXSA 5AFVA 3Q3BA 5E8WA 3U4UA 2GFCA 2J0MB 4FTCA 3A7HA 1NVSA 2C30A 2VZ6A 4QMTA 1OUKA 2ZB0A 3H3CA 4HVDA 3AT4A 3TKIA 1W0XC 4YJSA 5BUIA 2UW4A 1O6LA 1ZYDA 2RFNA 2WEVA 4FV4A 4G5PA 2Y4IB 4OTQA 2VWBA 4ASEA 4RVLA 4CFMA 2P3GX 2Z7RA 2WMUA 3PVGA 5CI6A 5CLPA 3D14A 4MBLA 3ZU7A 3MGYA 4MQ1A 1U5RA 2PVHA 4ZSEA 4KNBA 4IH8A 1CMKE 4FVQA 4YO6A 5K0XA 5BYLA 4FOCA 3N4UA 5FEEA 3MA3A 3HMPA 2X81A 3JVRA 4E4LA 3G5DA 3RK9A 2QONA 4YZDA 3II5A 3Q2MA 3F5XA 5FM3A 3LMHA 4F6UA 4AOJA 3F7WA 4K11A 4C02A 5BVDA 5IA3A 4QMLA 2QOOA 4CEGA 2OXDA 3KQ7A 4M15A 4P90A 5LMAA 4XG6A 1URWA 2ZMDA 4QQ5A 2IW9A 4BDIA 4NIFB 4RIXB 3F5GA 3ERKA 4WNOA 4QPMA 2VNYA 5EHYA 4O7YA 5F9EA 1M7NA 4V01A 4W4WA 3ZXZA 2JAMA 3I60A 4II5A 5FP6A 2X4FA 3HDMA 1VEBA 2UZDA 4HNIA 4KS8A 5ETFA 4U8ZA 4O7RA 2R3HA 4E4XA 4WO5A 4AWIA 3UO5A 4QMMA 3TKUA 4IANA 5DWRA 4IVAA 2PHKA 3LJ1A 4IFGA 2BTRA 4M12A 3LFSA 4TKSA 2RG6A 3EFWA 4JBQA 4WG4A 4H1JA 4AUAA 1K9AA 3BLRA 1WVYA 4YTIA 4FK3A 2PWLA 4OTRA 2WTIA 1UV5A 3ET7A 4QMOA 4UYAA 2OU7A 2C47A 5CU2A 5GZ8A 3UIBA 5A4QA 4ASDA 1GZOA 4KINA 4DFBA 4U3YA 4JR3A 2YM7A 3C0HA 5CT0A 3WI6A 3G51A 2R3KA 4B0GA 4LUEA 1XH8A 5E4HA 5CALA 3ZUVA 4C34A 1QMZA 2EUFB 4NTSA 5TKDA 2H34A 3BIZA 2ITXA 4A06A 2YA9A 3W8LA 4E1ZA 3VW6A 1H0WA 3D15A 4ASZA 2PUNA 5KZIA 4QYFA 1Y6AA 4C3FA 3D5VA 3DFAA 5M56A 4GV1A 4F9CA 2XEYA 4RZWA 2PULA 3R7OA 3KXGA 1NW1A 2GQGA 1UU8A 5DR6A 3FLSA 3JPVA 4RIYB 3N9XA 2Z7SA 1RW8A 2OO8X 3L9LA 4U81A 3RWQA 2G2FA 1H27A 2XIXA 4CFXA 4I0SA 3QRKA 2PSQA 2VTSA 4GU9A 4FSQA 3AT3A 3O8PA 4FX3A 4MNEB 4D28A 2OIQA 3UYSA 3ZC6A 1O9UA 3ZSIA 4CV9A 3KRRA 2ETKA 1FMOE 2KULA 4BICA 3DDQA 1UNHA 3C50A 1V0PA 5JMSA 3C4FA 4KBKA 4U7ZA 5HIDA 3ZUTA 3PA5A 4QNAA 5IEVA 3HV3A 3P86A 2IVSA 5D1JA 1FMKA 3MYGA 1GZKA 1G8AA 2PZPA 4WG3A 5HTCA 4K0YA 4EC8A 5AR3A 4Q5HA 1JAMA 4KBCA 4EZ3A 4HYHA 4KAOA 5DRDA 2JFMA 5H9BA 3CKWA 4ZTNA 3I79A 3BEAA 2JBPA 3MTLA 4D2SA 3FQSA 3A7JA 3TIZA 3F2AA 3N4VA 3MESA 1SM2A 2UZNA 2YCRA 3DJ5A 4IZ5A 3QTWA 5E8ZA 1P5EA 3TV4A 3TV6A 5HTBA 1REJA 4B9DA 3WOWA 4PPBA 3ZLSA 3I6UA 5HVKA 1WCCA 4NL0A 1OI9A 4H05A 5HCZA 1FQ1B 1AD5A 1T46A 4YBKA 5E8XA 5A46A 3GCVA 5BNJA 5IQEA 4CRSA 2W4KA 4BCFA 4FEXA 3DAJA 1PMNA 5EI8A 4IDTA 3ZBXA 3W2OA 3G15A 4EOKA 4MHAA 1FOTA 1OIYA 4FV1A 4RFZA 2VTJA 5EI2A 2GHGA 5KMLA 3IS5A 3OEZA 4CZTA 4YTCA 5A54A 4X6RA 2Y8OA 3QFVA 4X21A 4FTQA 1H00A 3BCEA 5CSPA 3DKOA 3LXLA 3KKVA 3F5PA 4RBLA 3WYXA 5K4IA 3FMEA 2QQ7A 3V8SA 2YIXA 4DEDA 3LQ3A 1P4FA 4QP8A 3GQIA 4CYIA 3D5UA 3LW0A 4JG6A 5HBJA 2XJ0A 4DT8A 2ESMA 2YIWA 1PJKA 3QAME 4FTUA 3V8TA 4USFA 4JBOA 4AN2A 4FG9A 5AX9A 4ACDA 4AW1A 3BEGA 5LVOA 2ITNA 5JK3A 3GC8A 3PA4A 4FL3A 4QYHA 3SRVB 5H2UA 4R1VA 1BKXA 3LAUA 5KKRB 2OSCA 2JKKA 3TL8A 2I0YA 3PJ3A 1XHAA 2GU8A 4JQEA 1IA9A 5JFSA 3W33A 3EN9A 4MXCA 2WQNA 3ZEPA 5EQPA 3ZRKA 5B2KA 1OL6A 5DEYA 3OTUA 5AP0A 2BFYA 4JLCA 3A62A 5JGDA 4UX9A 4EUTA 3FZPA 3QKMA 2HWPA 5L4QA 5LVNA 2VWUA 2Z8CA 1YQJA 3QUEA 1VR2A 5L8JA 2JDOA 4QPSA 2VTHA 1OBDA 3ENMA 4E6CA 4YZBA 3NEWA 3I7BA 2UW3A 2JKQA 4TRLA 3OWJA 3TZ8A 3KXNA 3OWKA 4LMNA 1DAYA 2BAQA 4TTHB 2X7OA 2WQBA 5CS6A 4DHFA 3EQFA 1K2PA 4ZTLA 2UVXA 4LOQA 2CGWA 3D7TB 4G3EA 4JXFA 3DK6A 4NU1A 5FEQA 2OIBA 3E63A 3HP5A 3QA0A 3ZO3A 4LQMA 1L8TA 3LZBA 3KRLA 1QPDA 4G6OA 3PJ2A 3QWJA 4YZNA 3BHYA 4A9UA 4GK2A 4UY9A 1QL6A 3UZPA 3LCTA 4RJ8A 3TJCA 3VRZA 3ATSA 3FBVA 3O71A 5M4CA 3NAYA 4I4EA 4I24A 4Y73A 1W7HA 2WTKB 4AS0A 4HGSA 3LVPA 3PP1A 1ZY4A 4KIPA 3QWKA 1WBNA 3RZFA 4CMOA 4HNFA 3DBCA 3MSSA 4I93A 4FSWA 3RAIA 2BRGA 1J1CA 3IECA 4L7SA 3Q4TA 4FTNA 4G9RA 5HBHA 4WG5A 4TWCA 2R3OA 3SXFA 4BC6A 4QMQA 1M2QA 4TYGA 2FB8A 4O81A 1OL1A 3A7IA 4XBRA 4YUQA 5AUUA 3MN3A 4YJVA 2OKRA 3ZM4A 2GHLA 1ZOHA 4BIEA 2BHHA 3U54A 2R7IA 4PF4A 4YLKA 3OTVA 3CXWA 3ZRLA 1ZMWA 2AC3A 4CVAA 4E6QA 5E8VA 4BVUA 1OKYA 3NPCA 3R2BA 4O0TA 2C0OA 4L3PA 3A2CA 4YP8A 5I3RA 5HG9A 1FVRA 1ZRZA 1B39A 2JGZA 4G2FA 5AR8A 2OICA 3G9NA 4CNHA 1YI3A 3NUXA 2C3LA 3RI1A 3VRYA 4F70A 3ETAA 3HNGA 3NNVA 3UQCA 5AV1A 2WPAA 5JEBA 4OGRA 2W4OA 3H10A 1ZYCA 3QZHA 3MVHA 4YJRA 4DFXE 4D4YA 5J9LA 1BMKA 3UQFA 4M13A 1YOLA 4J53A 3EN5A 4Y5QA 2CNVA 5IQBA 3WE4A 2PL0A 3SC1A 1ZXEA 3ANQA 3THBA 3ORLA 3F3ZA 3OT8A 2ITTA 4G16A 3E62A 4WUNA 4JDKA 1PMVA 2XNEA 4DGGA 5AEPA 2JLDA 2CN8A 3A7GA 4PDYA 1U46A 2J0IA 3ZDUA 3NS9A 5FTQA 3ZSHA 3R1NA 2W1EA 2DQ7X 2IZTA 4D2VA 2P33A 3QGWA 5T68A 2W99B 4AA0A 2QR8A 4DE4A 5AP5A 3VS6A 4BCQA 5IH6A 3OCSA 2OJJA 1H26A 3CQEA 1SNUA 2DUVA 4JDHA 3CKXA 2IO6A 3E87A 5FTOA 2R3RA 4AE9A 3MH2A 4YJTA 2AYPA 2RFSA 3C4ZA 5IPJA 1BI7A 3AC2A 4U80A 4A4OA 3KRJA 4MYGA 2BZIB 3BWJA 4JJRA 3NW7A 3JXWA 4GT3A 3V51A 3MA6A 1OB3A 3FI2A 5M51A 3O50A 4XP3A 2I0EA 3V04A 4HGEA 5JRSA 2IW6A 3IW6A 3P7CA 3EKKA 2E9NA 4JBPA 3KULB 4FV2A 3L9NA 4Z9LA 2F7ZE 4AFJA 4BCJA 2QODA 5BUEA 1A9UA 3D4QA 5HBEA 5HD7A 4X7QA 4OAVB 4HYUA 3LE6A 4FF8A 4L45A 3R8VA 2XNNA 2VTMA 3EL8A 4E8AA 4QP3A 2WQEA 2XB7A 4M66A 4TWPA 4JIAA 2DS1A 2IJMA 1OMWA 4JI9A 4NM7A 4D9TA 4XP2A 3O8UA 3VIDA 2CLXA 3O7LD 5D7VA 4HZRA 4FSYA 4F65A 2FUMA 2NRYA 2J4ZA 2XNBA 5B2MA 2WTJA 5HU9A 3QKKA 4KKHA 3C9WA 4EHVA 3OD6X 4FKPA 3E7VA 2BCJA 2WHBA 3AC8A 4NUSA 2W0JA 3IG7A 2EB2A 3QC4A 5ANDA 3U6IA 2C0IA 2GFSA 2UZWE 3LIJA 4CTBA 1IG1A 4O1PA 4B8LA 3CPCA 3C0GA 5CXZA 4S31A 3COIA 2ZVAA 3MFUA 2UVYA 4IZ7A 4MK0A 4KKEA 2JDVA 1L3RE 4U0IA 2JC6A 2YAAA 5H8GA 2R0IA 1J7IA 2YAKA 3K3IA 5L2TA 2B9FA 2GPHA 2RGPA 4MTAA 5DLSA 4D5HA 4F1MA 2G2IA 1Y91A 1H28A 3WZDA 4ZTMA 1Q8YA 2ZAZA 3MY1A 3PSDA 4HVGA 2YCFA 3R30A 4O0VA 5KMOA 4PMMA 5J8IA 4AF3A 2YZLA 4O0RA 4YLLA 3OC1A 4FKUA 4CTCA 1GNGA 5EH0A 4DYMA 4EH4A 3GC0A 3IKAA 4WUAA 3VS7A 2YISA 3R8UA 2XIYA 2BAJA 1KWPA 3DLSA 3GT8A 4LYNA 3BYMA 4FODA 5BUJA 1YXUA 2QU6A 3Q9ZA 4EOSA 5LWNA 3U9NA 4DFZE 3MH0A 4ZMFA 5E8YA 3FY2A 4ZTRA 4TYHA 4DCAA 3QU0A 5CAVA 2JIIA 1TQPA 4BDBA 4Y5HA 3C5UA 2ERZE 2YHVA 3AC5A 4J1RA 4IAAA 1BLXA 4S34A 4ALVA 2XK6A 4DBNA 4F9YA 5EDQA 4FOBA 5DEWA 1UA2A 4EK8A 3B2WA 4G3CA 4XV3A 3IOPA 3PZHA 4IAYA 4O21A 3MVJA 3FHRA 4ANSA 4CV8A 3K5UA 4L9IA 4MXZA 3VBYA 1YVJA 2AC5A 4EH9A 3UJGA 2X8IA 3PWDA 3D5WA 3DAKA 3I0QA 3I5ZA 3MVLA 5ETIA 4R1YA 5AADA 3KREA 4CGAA 5FXRA 4ZMEA 3MJ1A 4TXCA 4RLKA 3H9RA 4AW2A 4B6LA 5IMEA 4KUJA 2QLQA 3KN6A 3EH9A 4IWPA 2R3MA 3FWQA 1ZLTA 4FT7A 4JAJA 4LV5A 4DEEA 5I0BA 2XIZA 4RJ6A 3C0IA 4FT0A 4AOTA 4NZWB 1KE8A 2HY0A 3LLTA 5H3QA 4UB7A 4GK3A 3FI4A 3PFQA 4DH7A 2Z02A 3IK3A 1OBGA 4LI5A 5GZ9A 1ZOGA 4KA3A 3FLYA 3PZEA 4BWXA 1OECA 3R7YA 2OLCA 4E5AX 3I0OA 4YSMA 1OIRA 3OCGA 1H24A 4P4CA 3AXWA 3FPQA 2A19B 4OT6A 4TWOA 4ACCA 4JG8A 4HYSA 4WOVA 3SV0A 3FHIA 3ZDIA 2XKFA 3PJ1A 2OFUA 3QZIA 4M97A 2JAVA 1E1VA 2C6IA 3QUPA 3VAPA 4DGOA 4NEUA 2C5NA 4ALWA 1IRKA 4FVPA 2BFXA 3GFEA 2WU7A 3GNIB 4AT4A 4YJOA 3D5XA 3BGQA 3F5UA 4MD7E 4ACMA 5L6OA 1H1QA 2ZMCA 4UZDA 4BI0A 2VWWA 2VWZA 3MH3A 4D9UA 1S9JA 1U5QA 2YZAA 4ERKA 3R1QA 1YI6A 3CR0A 3IW4A 1KV1A 4NFMA 4DFYA 2Y0AA 4LG4A 3PG1A 3UIUA 4NH1A 2WU6A 1KSWA 5T3QA 3P9JA 4W8DA 4XV9A 3TNIA 3PP0A 1BL7A 1CTPE 3HKOA 3NMUF 3UPXA 4ACGA 2OBJA 2IZRA 2XYNA 3GFWA 3QQGA 1H4LA 3Q96A 2WOUA 4OTPA 4G3FA 5M44A 1S9IA 1OZ1A 3NUSA 2HK5A 5AUYA 5CASA 3TIYA 3FEGA 3ZOSA 5AP1A 4DT9A 4KWPA 3DTCA 5BVFA 3DQXA 5B0XA 2Z7LA 4BKJA 2I7QA 2NNWB 2CLQA 4IB3A 4TW9A 4ORKA 3FYKX 3PY0A 2OXXA 3VBTA 2PMLX 3BV3A 3A4PA 3IDBA 4BGQA 4GUEA 3R1YA 3T9IA 3TI1A 2C6TA 3WZEA 2I40A 4OTWA 5IUGA 4JR7A 4FV7A 4RZVA 2B52A 5F20A 3W1FA 4MVFA 1OUYA 3E5AA 3OCTA 4IM0A 3W32A 5IKWA 3WARA 3I7CA 1R0PA 3EJ1A 1FBNA 1J1BA 5HD4A 1Y57A 3T3VA 3V5LA 2GNLA 4NKAA 5DR2A 4YJPA 1PHKA 1WVXA 5I9ZA 3C7QA 3R73A 3PPKA 4IXPA 4EZ5A 4YJUA 3CP9A 2A4LA 3I81A 4ZSGA 3UTOA 5DIAA 4BB4A 5AR5A 5CAOA 5HICA 4EH5A 4O7LA 3WBLA 1WMKA 2YM3A 2GTNA 3HP2A 1XO2B 2Y7JA 5JFVA 5LWMA 4FKVA 1Y8YA 2Z2WA 4JRNA 4N6YA 4QD6A 3TTJA 3OW4A 1OIUA 5AM7A 3Q9YA 1WBVA 3EN7A 3DBFA 3P7AA 4H3BA 5BVWA 3KXZA 4Y72A 4PP9A 4RFYA 2J0KA 3QKLA 3NRMA 4R8QA 4WSYA 5G1XA 2CKQA 2V5QA 1R0EA 4I6BA 3IW8A 4FTJA 4IC7A 4FT3A 3F6XA 3U55A 4EOPA 5CNOA 3VQHA 2YWVA 3Q6WA 4USEA 1SMHA 3UPZA 4S32A 1JKKA 3UNKA 4M69B 1XBAA 3W18A 3NYVA 3OVVA 4RGJA 4UWCA 4N4SA 4ZLOA 5CF8A 5M57A 3ATTA 3QBNA 1YXVA 2BKKA 4QP9A 3AMBA 3NVMB 3GOPA 3VBVA 5J95A 2WKMA 2NP8A 3QTSA 2OK1A 3FL4A 5HOAA 4EK3A 3OUNB 5M53A 5GINE 5CY3A 4DH1A 5JKGA 3QF9A 2H96A 1OL7A 3R28A 2W96B 3E92A 4FSMA 1FGIA 2ZYBA 3EYHA 1U4DA 2FSMX 3BELA 4BDJA 1XKKA 4C4JA 3I6WA 4MBJA 1JPAA 3NUPA 5C9CA 4OTFA 4EJNA 4QP2A 5EG3A 2GQRA 1PYXA 3FXXA 2F7XE 5IDNA 2OJ9A 3O23A 1TVOA 4ZS0A 2XKCA 1Q99A 3ANRA 3QCSA 4BTFA 2WELA 2O65A 5JN2A 3V3VA 3V5JA 2XUUA 3R63A 2UW5A 2YN8A 1ZYSA 5AP7A 2EB3A 1G8SA 2UVZA 4RMZA 4Y95A 3UE4A 2WMQA 3FMJA 3O2MA 4DH3A 2BVAA 2CGVA 2W1GA 3VQUA 5A3XA 3MFTA 3UOJA 3PVUA 4C33A 3CGOA 3PIZA 5H8BA 1UWHA 5J5TA 2XNOA 4KD1A 2BR1A 3FKOA 4RIOA 1JBPE 5AP6A 4ZSAA 2Q0NA 2R9SA 4DAWA 3VHEA 2BDWA 1XH9A 2YEXA 5DPVA 5HIBA 2QOHA 4J7BA 4NW5A 2BDFA 3UVPA 1WBOA 2W17A 5CEQA 3ULZA 3NAXA 4DG2E 5JZJA 2FSLX 2XJ1A 2O0UA 5IUIA 2R3QA 2WXVA 3QX4A 3AGLA 4CKIA 4FA2A 1GZNA 5ANIA 5DN3A 3NW6A 2PVMA 5CNNA 1JSTA 3FKLA 5BMMA 4LGDA 4OAUC 4BZDA 3KB7A 4GYIA 4EH6A 3ODZX 5FBOA 4FTMA 4C37A 5AV4A 3COHA 3HRBA 4FNZA 4CKJA 3HUCA 3PE1A 3EQHA 2WMBA 1GIIA 4PDPA 3ZMMA 4A9TA 2YFXA 2RF9A 4TNDA 1X8BA 2Y9QA 3BQCA 4MXAA 2YACA 1KE9A 3MVMA 3VF8A 4QMSA 5AA9A 3VNTA 3FUPA 2XIKA 2PZIA 4IWQA 2XF0A 2XP2A 3OROA 4KIOA 5M07A 1VYWA 2W1DA 5M09A 3SLSA 1KE5A 3CD3A 2HCKA 3RJCA 1I09A 5K5XA 2HOGA 2Q0BA 3JS2A 5DNRA 4IE9A 5C8KA 3UG1A 2QKWB 3FZTA 5J7HA 3CJFA 3SG9A 1TKIA 4ZTQA 3KRWA 4GVAA 3UP2A 4BRXA 5J5SA 3F7ZA 5CAUA 3GU6A 2WQMA 4RQKA 3O0GA 3R02A 3GC7A 3ZZWA 1ERKA 2BRNA 4U44A 1M7QA 5DR9A 3VS5A 5HZNA 3JUHA 2O2UA 2PTKA 4EHGA 5CAQA 1U59A 2V55A 3NWWA 2YDJA 3G0EA 3SDJA 4QP6A 2CMWA 3QTXA 4NIFA 3F69A 1LUFA 3MPAA 4NK9A 4Z3VA 4RWIA 2EXMA 4E4NA 2G2HA 3MI9A 2HWOA 5TT7A 4AX8A 2WGJA 3Q53A 3VO3A 4FNXA 3RHKA 2VWIA 4KSPA 4BBMA 4EK4A 3ZYAA 4XMOA 4DEIA 4FEUA 1UNGA 4IMYA 5KMKA 3U6HA 3PVWA 5HEZA 3P08A 4W4XA 1CKIA 2BTSA 4G1WA 2EXEA 1JVPP 1R39A 4H1MA 3IGOA 4I1ZA 5CSVA 3EHAA 3SGCA 4AZVA 5LQFA 4RWKA 5D11A 2YM8A 2OJIA 3QXOA 1UKHA 2E9PA 5I9WA 4JRVA 1B38A 2B9HA 5GJDA 4BDKA 4O2PA 5LXMA 1PMEA 4H58A 2WD1A 2YJSA 4ITIA 4R3RA 3TNHA 4CQGA 3TDVA 2YM5A 5B7VA 3R6XA 3K2LA 2PVRA 3HA6A 2GNGA 5KZ0A 4GFOA 5EOLA 3C5IA 3OBJA 1PXJA 3VW8A 3ORKA 4XG2A 2OI4X 2C5VA 1HCKA 4GG5A 4LOOA 2VX1A 5E92A 3LOKA 3MDYA 4FGBA 4FIJA 3WYYA 4RIYA 5GHVA 3S1HA 4XX9A 2WNTA 5ACKA 2OZAA 5AAEA 3E3BX 2BKZA 1CSNA 3PXRA 4L42A 5FDXA 5HO8A 4O82A 5EDRA 3ELJA 3I5NA 4LRJA 5J1WA 4BTJA 5L8KA 3GOKA 3HMMA 4MNEA 4C3PA 4MBIA 4J95A 3VUGA 5GJFA 4I20A 2X6DA 1V0BA 3KVWA 1UU3A 2WMSA 4ZTSA 1V1KA 1ZARA 3GU4A 1OKVA 2RFEA 2YM6A 2XM8A 4FTKA 2R64A 3U51A 4BCKA 4F1TA 3NUAA 5A4CA 4O7NA 4UALA 3C13A 1TQMA 4PP7A 2ZOQA 4XNEA 3V5PA 4IBMA 5GNKA 3DY7A 2ITOA 4ZK5A 1F3MC 2YM4A 4FKJA 3POOA 1NA7A 4J52A 3UO4A 3CQUA 3BQRA 1JSVA 1YOJA 5JT2A 2A2AA 3QC9A 2FSOX 3BPRA 3VUTA 2IZSA 1CDKA 4R3CA 5HG7A 4ZLYA 2C69A 3F61A 4BCNA 4EOIA 5HI2A 2XK7A 2QNJA 4EEVA 3DJ7A 3FMHA 4FNWA 1FVVA 2V7AA 2HIWA 3BI6A 3OW3A 3SKCA 4OLIA 4X2JA 4YNEA 4O86A 3M42A 2J51A 2C4GA 1Z9XA 1HCLA 3TG1A 4AP7A 2QO9A 1NXKA 3DXNA 3Q60A 3IONA 3MW1A 3UOHA 2SRCA 1JKSA 3F82A 4JOAA 3AD4A 3WIKA 3DZOA 4U97A 5IEXA 4JDIA 4B99A 4YO4A 4TYIA 2VTTA 3VUMA 4BCPA 3RMFA 3SW7A 2OH0E 1Y8GA 1ZMVA 4AGWA 5IQGA 1PW2A 3E64A 3MB6A 3GU8A 3NNWA 2ONLC 2WTKC 5CSXA 3F9NA 5LCJA 4XCUA 4ENYA 3R1SA 3R9OA 3UOKA 1APME 3T9TA 4F6WA 5AP4A 2BPMA 1U54A 3TNWA 4G31A 3RM7A 3OHTA 4RJ4A 1T45A 4YC8A 4QTBA 4ZZMA 3PSBA 4O22A 5EKOA 4C3RA 4DA5A 4QNYA 4IJ9A 2ERKA 4QO9A 4GT4A 1NVQA 3VJNA 4IIRA 4O6LA 4E6AA 1PXNA 3FC2A 4C2VA 4FL1A 2VWYA 4RVKA 3GC9A 5JFWA 5TR6A 4FZFB 2RIOA 4EBWA 4UWBA 2GS2A 5EW9A 2YIQA 4H36A 4DBXA 5KHXA 4M8TA 4EYMA 2HAKA 2WMAA 5D9HA 4CFVA 3COKA 4ZLZA 4YPDA 3ZM9A 1Q4LA 4R3PA 4L3JA 3F3WA 2QLUA 1OPLA 3LFNA 2J0LA 4GKIA 3RM6A 4E4MA 2E9UA 2YCQA 3AD5A 4I4FA 3PG3A 3P7BA 4G3GA 4EONA 4XS2A 3WIGA 4O0UA 3FLQA 4BN1A 3D2IA 5CU3A 5HX6A 4MAOA 3ROYA 3EMGA 2QOBA 4ANBA 3IDPA 1IAJA 3FLZA 4BI1A 2Z60A 4PNKA 5FLFA 3FMKA 4C8BA 2GMXA 1VJYA 5CQUA 3CS9A 3FL5A 4D0XA 3QL8A 1VZOA 5HE2A 4FEQA 3PWYA 5ITAA 1Q61A 4DTBA 3DOGA 4HJOA 4D5KA 2UZOA 5JGAA 3DNDA 4L46A 2QURA 3OBGA 4E6DA 4FTTA 3DLZA 3EQGA 4D4VA 3E3PA 4ZZOA 3FMMA 3EWHA 3PVBA 3SD0A 3PJ8A 4XEYA 2GQSA 4EK5A 4FUYA 4C4EA 4FV9A 5A6NA 1VYZA 3D7TA 4EK6A 5J87A 2VTAA 4U41A 4CKRA 1EH4A 4NYEA 4HVIA 2BUJA 4IB0A 4FSUA 5C8NA 3JYAA 2WMVA 4ZS4A 5DRBA 2ZV2A 1UNLA 4DFNA 4O7VA 4IADA 2UZEA 2F4JA 3VN9A 2BALA 2ONLA 4ANLA 3FI3A 4MKCA 4DH5A 3PJCA 3B2TA 2VTPA 4BY9E 2C1BA 2W1CA 5TO8A 3WZJA 5DE2A 1OM1A 3PXKA 5EYDA 2PVKA 4RJ7A 4C38A 4I21A 4RWLA 5BYYA 1YI4A 4DTKA 4DGLC 3ZUUA 3DK3A 5A4EA 5IA0A 3AMYA 3EQCA 4O7TA 3O51A 3LXPA 3NNUA 4JG7A 5E8UA 4EWHA 5FQDC 1TQIA 5LMKC 3M2WA 4UMRA 2YDIA 3SHEA 3EIDA 4XV1A 3H0ZA 2HELA 1PRYA 3DTWA 1MQ4A 4APPA 4GW8A 2ETRA 5IG1A 3ACKA 4EI4A 2VTNA 2X8EA 2YDKA 3P23A 5TOZA 3S3IA 3I4BA 4AGDA 4CFFA 5JGBA 1GAGA 2UW0A 3OY3A 4X2FA 4HGLA 2NO3A 2J0JA 3QLFA 2CDZA 2UZVA 3MJ2A 4FIEA 4PWNA 3IPHA 3N51A 3QQJA 3WZKA 2FVDA 3L9PA 2X8DA 3TM0A 3QUDA 5FP5A 3KU2A 5EM5A 2IW8A 4O83A 1BUHA 3SXRA 4FKWA 3SQQA 3QTIA 5AAGA 3TKHA 4TYJA 3DBEA 4KIKB 2VO6A 3QZGA 4EZ7A 1LP4A 2F49A 4FNYA 4BKYA 5CVGA 3DAEA 2VGOA 4ID7A 4MX9A 3BYSA 5TE0A 4UMTA 2CHLA 2HZNA 5AV0A 1OL5A 2XK4A 2HYYA 3AMAA 5K3YA 2LAVA 4A7CA 2VV9A 2OZOA 3FV8A 1H8FA 5HORA 1H01A 4XOYA 5ACBC 2PZRA 4WNPA 4L68A 5HNIX 4V0GB 1WZYA 3QTQA 3QXPA 2VTOA 4IVCA 3MY0A 5HNGA 3D2KA 4U9AA 4WSQA 3TUDA 3UOLA 4AGUA 2X7FA 2ZM1A 4FI1A 4ZOGA 3BHHA 1RDQE 2ETMA 3OFMA 2WTDA 4R7HA 5EM6A 4C58A 4D1ZA 4QRCA 1KE7A 1OVEA 5FWKK 3IGGA 4MD9E 3ZFMA 4X3FC 3OMVA 1GIJA 3O8TA 3BU3A 2P2IA 5C4LA 1HOWA 2W7XA 1B6CB 4BZNA 2I0HA 5IISA 4PX6A 4X0MA 4E73A 1JOWB 4EOQA 3P4KA 2VNWA 5BYZA 5I9VA 3LXNA 4GJ3A 5HG5A 2GNIA 2BZKB 3NYXA 2OXYA 2ITYA 2R4BA 3PLSA 4WKQA 3UZRA 3RWPA 5LMKA 5DI1A 3UIMA 1DI9A 3GGFA 4FKRA 5DHJA 3DJ6A 3TNQB 3KF4A 4J71A 1FGKA 4IB5A 4IB1A 2VO0A 2IVUA 4FV8A 4O38A 4EJ7A 2GNFA 5C01A 3F2NA 3ODYX 3ZLWA 2WOTA 4QQJA 4I23A 4ZAUA 4O1OA 4KRCA 1PXKA 3V6SA 4JVGA 5E8SA 4FKSA 3GCPA 4AZSA 3LHJA 1YDSE 2FSTX 3NYNA 3R7UA 3NCZA 2J5FA 3HL7A 4LL5A 2UW8A 3F66A 5JQ8A 5CANA 3E8NA 2VX3A 2UZUE 5L2IA 4RQVA 2W5HA 4MF0A 2Y4PA 4IX6A 2J5EA 5DOSA 3ZCLA 5IH5A 3RP9A 1QPJA 5HCYA 1LPUA 4HZSA 4K77A 3FMNA 2CCIA 2C6OA 2OF4A 4IC8A 4KABA 5G6VA 2XVDA 4DEBA 1M2PA 4J97A 2C6EA 3NX8A 2RSVA 2J7TA 3IOKA 4M3QA 4AAAA 3OWPA 1SVHA 1Q8UA 3ZTXA 2XH5A 4CCBA 4YTFA 4D2WA 4KIQA 5I5ZA 3LQ8A 5J9ZA 3GVUA 4JAIA 4E26A 1UKIA 3QRIA 1RJBA 4X3JA 5HQ0A 2VAGA 4GFMA 4TYHB 4DG3E 4NWMA 3ACJA 4F6SA 2WQOA 3HRCA 5K4JA 2Y6MA 5A6OA 2X7GA 5AUTA 3FJQE 1LEZA 4XP0A 4L44A 3FI8A 1OKZA 2ZDTA 2XNPA 3K5VA 5AA8A 4BHZA 2JITA 4AU8A 4AGCA 5IF1A 2WTWA 3QQFA 4FR4A 4QMXA 4JT3A 5CTPA 3F3TA 5CF5A 1ZYLA 5M08A 3UGCA 4P7EA 4C4HA 4O7ZA 5EYKA 1YXTA 2X2LA 3PSCA 5IZFA 3E88A 2RKUA 4OBOA 1WAKA 1OPJA 1LEWA 1J91A 4X3FA 4AA4A 4R78A 4BDGA 4DLIA 3BZ3A 4MCVA 3R9NA 3R2YA 4ERWA 4CFWA 4QMNA 4QMPA 3VBQA 4BTMA 3D7ZA 2W05A 4BI2A 1XQZA 4LRMA 5CU4A 4M0ZA 2I1MA 1W84A 4PL3A 4WRGA 2JD5A 2PYWA 1Q8TA 3WF8A 4ANOA 4EQUA 5A4TA 4FE2A 3H9OA 2ZV8A 1NT2A 1IASA 5KMNA 5C4KA 4GT5A 5IA5A 3PRIA 4U43A 3R8ZA 4RLLA 4TN6A 3CC6A 3UODA 1PY5A 4F0FA 3S0OA 4OTGA 5AJQA 4CRLA 1E9HA 5HE1A 3MBLA 1RE8A 3BE2A 3DB6A 2PMNX 2W1IA 5CU6A 2PPQA 4ONAA 2OFVA 5DFPA 2C68A 4D4SA 1K3AA 2B4SB 2B0QA 5DG5A 5H8EA 3O7LB 4LL0A 4XUFA 1ATPE 5BVEA 4AACA 2QG5A 4OTHA 2GSFA 1DAWA 4RIWA 4EQMA 5CI7A 2JIVA 4RT7A 4F63A 4YSJA 4M0YA 4WRSA 3HDNA 3MWUA 3OG7A 4HCUA 4WBOA 5E7RA 2PUUA 5KX8A 4O7SA 4QP1A 4L6QA 5IQCA 4FTLA 3KMWA 4BDAA 3BWFA 1UU9A 2X9FA 1FVTA 1UVRA 1ZY5A 2C5YA 3AD6A 5E9EA 5E1EA 4AN3A 3REPA 4FMQA 2OJGA 2GHMA 2B54A 4IW0A 3FDNA 2VN9A 4HVSA 1PXIA 2C5OA 1JKLA 3TNPC 5L8LA 3GENA 4K8AA 3TJDA 2QOLA 2XNMA 2ITVA 4L01A 4Z7HA 3KMUA 5L6WL 3PUPA 2YERA 4YBJA 1KUTA 1MRVA 3HV7A 3FLWA 2BRHA 4BYIA 5FGKA 2CN5A 2VTRA 3OY1A 3PXZA 4QT1A 3TWJA 3ZLYA 4CMUA 4N70A 4BZOA 1PXMA 4L00A 2WTVA 3LM0A 3COMA 4S33A 3H4JA 4FIIA 3OXZA 4W4YA 3ZO2A 4AW0A 2X39A 4FYOA 4WT6A 4U42A 1Q3DA 2PUIA 5HLNA 3R7VA 4QTDA 3LFAA 3HV6A 5D12A 1V0OA 2VGPA 3FZSA 4TYEA 3CE3A 4ZJIA 2WMRA 4F4PA 2R3FA 1M17A 4AT5A 2UV2A 2BRMA 2BDJA 4L8MA 5HGIA 1YKRA 2OG8A 1A48A 4AN9A 2J2IB 2Z7QA 4JDJA 5M4IA 3EQBA 3RAWA 5EHLA 2PVNA 4BKZA 5J7BA 4YHFA 3UVRA 3ORPA 5CEMA 4I22A 2YJRA 4FZ6A 2X0GA 4RWJA 3QQLA 3QX2A 4G3DA 4BFMA 4EOOA 4W9WA 2XK8A 3R8MA 5CF4A 3IQ7A 3TUCA 5AIRA 3ALNA 3CTJA 3UIXA 1AGWA 3HECA 2W9FB 3NDMA 2GNJA 4QQTA 4X2GA 5EI6A 3W2PA 4YR8A 4UZHA 2QR7A 3UZTA 1ZOEA 5IMXA 1H0VA 2E9OA 2CGXA 2X9EA 4IM2A 2R3NA 3B8QA 3DV3A 1YXSA 4Q2AA 5CZHA 3VVHA 3R7GA 4EH3A 4O7WA 1ZMUA 3VS4A 4EKLA 2IPXA 1PMUA 3OZ6A 3RPYA 1I44A 4MH7A 4WD5A 1YHVA 2VWXA 3VUHA 4MQ2A 3RHXA 2PZ5A 2A1AB 3KK8A 2ACXA 3QTRA 2WZJA 4JX3A 3DZQA 4MWIA 3AT2A 3PIXA 3FMDA 2LGCA 3T3UA 3GEQA 4AOIA 4PDSA 2ZV9A 3EKNA 3ORNA 2R3JA 4B7TA 4TL0A 3ZONA 2ITWA 5ANOA 4A07A 4R7BA 4FT9A 3EFKA 4Q9ZA 2HW6A 2VRXA 3ZO1A 3AC3A 4NT4A 4W8EA 2A27A 5ANEA 3JVSA 5E8TA 4F0GA 5J9YA 4PTGA 5IUHA 4HGTA 2W4JA 4O6EA 4IJPA 4YU2A 4FIHA 4XOZA 4L53A 2XRWA 4XG3A 5CX9A 3NNXA 4K9YA 3F2RA 1GOLA 3U4WA 2C6DA 5EYMA 4N57A 4LOPA 5HE0A 1KOAA 3TACA 3ZXTA 3TZ7A 5KO1A 2QHNA 3HLLA 3MIYA 5C1QB 5CWZA 4EH2A 2Y4IC 4AZWA 3FPMA 4ANNA 3DCVA 1JNKA 5CVFA 5HNBA 1WBTA 4ZSJA 4D1SA 1H1PA 4FG7A 3LMGA 2XS0A 4BWPA 1RQQA 5K5NA 1E1XA 2XCHA 3LJ2A 2UW7A 3D94A 5HU3A 2C0TA 4YJQA 5HO6A 3QHRA 4EYJA 2V7OA 3RNYA 1PKDA 4P5QA 4IACA 4R7IA 5I3OA 3A99A 5L3AA 4IAZA 2RL5A 3Q9XA 2WB8A 2X1NA 5IDPA 1F5QA 4XLVA 5B2LA 3FE3A 3Q4ZA 4F1OA 4Y83A 4M84A 5IU2A 4GSBA 4F64A 5LMBA 5CEKA 3KXHA 4H3QA 2OGVA 4C59A 3CTHA 4HW7A 4RPVA 2JEDA 2B7AA 5HKMA 4KBAA 4I5MA 2R0UA 4EHZA 5M06A 5BMSA 4HVHA 4CCUA 3M11A 3TUBA 4BYJA 2XYUA 4KSQA 2PVLA 4E7WA 2GS6A 4FKTA 4I5HA 3VWAA 5LARA 4B4LA 2YIYA 4CD0A 4XH6A 4ZJJA 2F57A 5ANGA 4A9YA 4F9AA 4I0TA 4A4LA 2O63A 3D83A 1YDTE 4FGRA 2F2UA 1BI8A 5HIEA 2QVSE 2CSNA 4Z7GA 4CZYB 4OUCA 4DLJA 3DKCA 2UZBA 5A14A 2O3PA 4DN5A 4YMJA 4FSNA 3BLQA 4L7FA 4RRVA 3M1SA 3KVXA 4PUZA 3R83A 4DEGA 4GH2A 4I6HA 4S30A 2ZB1A 4XV2A 4FZDB 3RPSA 1H08A 4DEAA 4YTHA 1IEPA 3ZH8A 3BYOA 4JBVA 3GB2A 5I9YA 4UXQA 1OIQA 3C4WA 3L1SA 4J98A 4V05A 3UMXA 3HAMA 2R3PA 3KL8A 2JKMA 3QRUA 3R21A 4MNFA 4QP7A 3CIKA 4NW6A 3PE2A 4ZY4A 4YZ9A 5KMIA 4UWYA 3RAKA 3R9RA 1XR1A 4IAKA 5AUVA 5L2SA 1WBPA 3NUUA 3P79A 2P0CA 2R2PA 2JDSA 4YLJA 5CENA 1SVGA 5GJGA 3ZC5A 1MRUA 4O0SA 3VBXA 1XH7A 3EYGA 4KRDA 5C26A 2VO3A 4CLIA 5EW3A 5IQIA 4C4GA 4A4XA 4HPUE 4W9XA 4XG9A 4ZTHA 5HVJA 3TZ9A 4UMQA 3VC4A 1W82A 3I1AA 1J7LA 5CSHA 3VUKA 2QI8A 3A60A 2BIKB 2ITUA 2J90A 2OWBA 2QC6A 3NW5A 1JKTA 4I5CA 3OOMA 5AAFA 2BAKA 3UDBA 3V8WA 4CQEA 2VX0A 4RSSA 2O64A 3EQDA 1M52A 4F7LA 3CY3A 3LLAA 3MS9A 4D2PA 3RPVA 3UP7A 2XM9A 4A9RA 3EZRA 1UWJA 1XH5A 2XKDA 2FGIA 3KCKA 2PU8A 4EH7A 1P4OA 3FYJX 1H07A 4FV5A 3E93A 3HUBA 2XBAA 3WF5A 4HYIA 4AXAA 3QQUA 4RIXA 4H3PA 3UBDA 2HZ0A 4FUXA 4XG4A 5FEDA 4FBXA 4D2TA 3HV5A 4L3LA 3NR9A 3FZRA 4LGGA 1H25A 2WAJA 4QMYA 2VTLA 1JLUE 3W8QA 3KC3A 4XLIA 4FKQA 4WBBB 2PZYA 4FSTA 5DGZA 1PYEA 4U5JA 3MFRA 5JH6A 4OTIA 4NCTC 3HV4A 4P2KA 5CEIA 3VBWA 1Q41A 3VULA 1Z5MA 2W9ZB 3AC4A 3ZSGA 4ALUA 4DINA 5FUTA 2JDTA 4OW8A 3VF9A 3VHKA 2GNHA 4AFEA 4D0WA 2W1ZA 1XBBA 4LGHA 4I92A 5EOBA 2UZTA 2PK9A 4RX5A 3FZ1A 3KN5A 1YWNA 5DA3A 5L2WA 3PPZA 4C7TA 1GY3A 5CU0A 2EXCX 4KS7A 2A0CX 3L8PA 2C3IB 3CCNA 2PE0A 4BCHA 2JDRA 3NGAA 3RNIA 4BDFA 2B9IA 3MTFA 4C0TA 4TY1A 5FG8A 2OJFE 2QOIA 4UYNA 4F9BA 4LUDA 4DGNA 3LFDA 3MPTA 5EYCA 4GMYA 4O0YA 3RKBA 5JRQA 3EFLA 5AR4A 3W2CA 4F7JA 3PRFA 3EB0A 1ZAOA 4PL4A 4I41A 2QOCA 2XCKA 2OZAB 2VTIA 2WMXA 3PIYA 4EUUA 3BYVA 4MXOA 4RC2A 3W55A 2V62A 1YRPA 2WFYA 4APCA 4UN0C 3CGFA 2PVJA 4O2ZA 3W2SA 4J96A 1MQBA 1MUOA 3NIZA 2FH9A 3NSZA 3BRBA 2EVAA 3LCSA 2XZSA 2KTYA 4L52A 3AGMA 4EORA 2RFDA 5KKRC 4IX3A 4IAIA 3ITZA 3L8SA 4KB8A 2QCSA 5DH3A 3R71A 3PXQA 5AWMA 3R9HA 3UC3A 5EFQA 4D1XA 2BROA 2X2KA 2HZ4A 3DPKA 1URCA 3OP5A 5C27A 4FV3A 3MY5A 4BCMA 3TT0A 2R3GA 2JFLA 3HAVA 3N4TA 4I0RA 4CYJA 4O96A 4PMSA 1PKGA 1REKA 2V0DA 3DS6A 3HMOA 3OWLA 3DNEA 4PL5A 1DS5A 3RVGA 3UG2A 2YWPA 1O6KA 5CSWA 4DFLA 3DB8A 3DXPA 3P0MA 2ZV7A 4J8MA 3H9FA 2IZUA 5E91A 3RCJA 3GQLA 4E93A 3SX9A 1SVEA 4U79A 2ZM3A 2G01A 4LFIA 4P5ZA 3HMNA 1R78A 3V6RA 1M2RA 3W2RA 2F9GA 3W10A 3TTIA 3PA3A 3VS3A 3LFQA 3JR1A 4QTEA 5GIPE 4YPSA 4NCTA 4BCOA 1XWSA 1YOMA 1LR4A 2UUEA 4PMTA 4PRJA 4XG7A 1WBSA 4E3CA 4R6VA 3AQVA 4BTKA 3POZA 3Q5ZA 3Q6UA 4E5BA 4HCVA 4RVMA 5FD2A 4XRJA 3PY1A 4AZEA 3FZOA 4FK6A 4CG8A 3QALE 3Q04A 4ITHA 5M4FA 3DXQA 2GTMA 1FINA 3ZS5A 3RK5A 3DK7A 2REIA 4TPTA 5DT3A 2DWBA 4WA9A 3NLBA 3WF9A 3F3UA 5F94A 4DFUA 4DGMA 3F88A 2EU9A 2X4ZA 2C6MA 4FTAA 2AUHA 1WFCA 3A8WA 3KMMA 4NKSA 1U54B 3E7OA 1JQHA 2BMCA 2QHMA 4AZFA 4F08A 4NM3A 4B8MA 3HEGA 3DBQA 3IDCA 4PDOA 3Q5IA 3LXKA 3W2QA 3BV2A 3EL7A 2YLFA 3EZVA 2OF2A 1IR3A 3GP0A 3NIEA 1MP8A 3R0TA 4LMUA 3VJOA 4DTAA 4EH8A 4R5YA 3FSKA 3S95A 3C4EA 2OW3A 2CCHA 3G6HA 2CKOA 5IQDA 5F4NA 2HXLA 4BBEA 3WF7A 2VUWA 4ASXA 2JBOA 3SRVA 5LCKA 1YWRA 4QMVA 1JWHA 4PTCA 5BX0A 1BYGA 4M14A 3JY9A 3RK7A 4FEVA 3F3VA 3KY2A 3R01A 2YIRA 4IZYA 5HLWA 3K54A 1Q8WA 4BBFA 3LFEA 4G17A 3G6GA 4H39A 5FXSA 2PY3A 3DKGA 4QOXA 5ANKA 3G33A 1WVWA 2DYLA 3KXXA 4ITJA 3ORMA 4Q9SA 3BHUA 5HO7A 3QQKA 1KV2A 4RA4A 3RAHA 4HOKA 4GUBA 4IEBA 2H8HA 4NJDA 3TN8A 5J1VA 2ITQA 4NJ3A 1G3NA 3NUYA 4CFUA 5HX8A 4YGAA 5ANJA 2PUPA 2HW7A 4IHPA 4RFMA 3HGKA 5BQ0A 3ZBFA 1Q8ZA 2C6KA 4EL9A 4IX5A 3Q52A 3DGKA 4N6ZA 5CYIA 4QQCA 3SW4A 3VUDA 4ENXA 1OL2A 4KKGA 4Q5EA 2BZJA 4MEDA 4UMUA 3BHTA 3OT3A 5EW8A 4GYGA 2W1FA 3L9MA 5HTIA 2GCDA 1GJOA 3QGYA 5CEOA 4I94A 3OOGA 3FXZA 1IA8A 3DQWA 4BIDA 4R77A 4ZEGA 5CEPA 5IQHA 3QD2B 4O84A 4AW5A 2J6MA 3UYTA 4BCIA 4DH8A 3CTQA 2CKEA 4PMPA 1SZMA 3G2FA 1QCFA 2BRBA 4XYFA 4Y46A 5AUXA 5DMZA 5IQAA 5JZNA 4FTOA 5CVHA 2ZDUA 4GIIA 1YDRE 2F7EE 5KMMA 1FPUA 4FKIA 1R3CA 4EQCA 4EKKA 3MPMA 3TXOA 4F99A 2FO0A 3CLYA 4FSZA 3SOAA 2UW9A
chains in the Genus database with same CATH superfamily
1J7UA 5IQFA 2PE2A 3QTZA 3KEXA 4RX9A 2G1TA 3P78A 3TCPA 4QTAA 1ZWSA 4D4RA 3C51A 4E20A 5KHWA 2P55A 2C1AA 3PFYA 5GIOE 2XMYA 4O0WA 4CLJA 4U3ZA 5E90A 2HENA 3VS1A 3Q9WA 1R1WA 4BHNA 1A06A 3WE8A 3R8PA 4MF1A 2BHEA 5KBRA 3OCBA 3FQHA 3HRFA 2I6LA 4GK4A 3IW5A 3CPBA 5AV3A 4JX7A 3DBDA 4MXXA 1M14A 5BVKA 3RBWA 4K6ZA 3G90X 3ZZEA 1IAHA 4FC0A 3QYWA 4OT5A 2BIYA 3UDSA 3P1AA 3LFBA 3ORTA 4OBPA 5C8MA 4UMPA 3QZFA 3GUBA 4RG0A 2W06A 4FSRA 4GL9A 3MB7A 4M68A 3CJGA 4M7IA 4CT2A 5K9IA 3U6JA 2CKPA 4BR3A 3ORZA 3QLGA 4JIKA 3H0YA 5DVRA 4EBVA 3ZEWA 3CY2A 5KUPA 4BGHA 4F09A 3FKNA 4FZAB 3NYOA 4F7SA 3ZHPC 5M4UA 5D41A 2WMWA 3S00A 3MV5A 2QD9A 4U45A 3R8LA 4YZCA 4MXYA 3V5WA 1KE6A 3SOCA 1P14A 3DKFA 3WF6A 3WZUA 3JY0A 3LFCA 4IFCA 4IAFA 4G34A 5KBQA 1STCE 3C4XA 4JQ8A 2VU3A 3BBTB 5EHOA 4PY1A 5HLPA 3TZMA 5AP2A 3UNJA 4AG8A 4LM5A 2VWVA 3L8VA 4RJ5A 1NVRA 2PVFA 4FKGA 4FV6A 5IA2A 4FIFA 4KIKA 2J50A 3MFSA 4O27B 3CQWA 3EN6A 4X6QC 5ETCA 5AR2A 4PTEA 2EWAA 2NYAA 4BGGA 3LCKA 2PE1A 3OXTA 4O0XA 3E8CA 5LVLA 3EN4A 4RJ3A 3QTUA 4C57A 4LRKA 4FIGA 2X0PA 3LKMA 5I9XA 1GIHA 3QD0A 3T8OA 4BWKA 4QP4A 4YURA 5HE3A 3AG9A 3A61A 4GFGA 5FBNC 2XRUA 4BIBA 3GXLA 2HY81 2XIRA 5IA1A 4V0GA 4D2RA 3R9DA 3KULA 4FEWA 5BVOA 4FVRA 4YC6A 3KA0A 1Q24A 2NRUA 5EK7A 4C61A 3ULIA 3UVQA 4CMTA 4ZY5A 2VTQA 4K2RA 5CAPA 5HVYA 4FICA 3LCDA 5ETAA 4WNKA 3LMIA 3ENHA 5GZAA 1Q97A 4ANMA 3GCQA 3GI3A 3KXMA 1G5SA 1MRYA 2BZHB 2VO7A 3V01A 1Z57A 5JSMA 4IQ6A 3QCQA 3RINA 3E8EA 3OXIA 4UV0A 1OGUA 3OS3A 3HA8A 3DFCB 3G9LX 3AOXA 4ZSLA 3U8WA 4ACHA 4F9WA 3KFAA 4QTCA 4TT7A 4FZ7A 2IVVA 4GU6A 2QOQA 4XBUA 3V5TA 4RVTA 2E2BA 5CXHA 3U9CA 3KCFA 3Q4UA 2WIPA 3LFFA 4GJ2A 3HZTA 3VS2A 4DC2A 3QRJA 5HHWA 4C35A 1G8KA 4NTTA 4YHJA 3KRXA 4AXEA 5KNJA 3LQ5A 4G6LA 1YHWA 2B1PA 4K33A 2Y6OA 4HPTE 1Q3WA 3GCSA 3UDZA 5EM8A 3AC1A 4OTDA 3BL9A 5I9UA 3BBWA 5D7AA 1SNXA 5HCXA 2GDOA 3ORXA 4C4IA 4NFNA 4ZY6A 2WO6A 3ML1A 4C36A 4RX8A 1QPCA 2R7BA 4FV0A 3CSVA 4DCEA 5EDPA 4C2WA 1JSUA 2X6EA 2QG7A 5DT4A 4AZTA 3P5JC 4BCGA 4AT3A 1Y6BA 2XEZA 2YLEA 2QO2A 4BF2A 4YJNA 3NFFB 3RZBA 3BU6A 5FXQA 3EQPA 4X3FB 3B8RA 4ANQA 4U6RA 1F0QA 4I5PA 2VD5A 5HESA 3HMIA 4MD8E 4J8NA 1P2AA 1H1RA 1SYKA 3BE9A 3ZO4A 2HXQA 5EKNA 3RALA 3FQEA 3HX4A 2B53A 3PDTA 2H9VA 1CM8A 1AQ1A 3QHWA 4BDEA 4EOJA 4FG8A 1W8CA 4JS8A 4IM3A 3WILA 3R7EA 4FT5A 4GRBA 2OIDA 4DITA 4FYNA 1BL6A 2PMIA 4M67A 1UU7A 3LCOA 5T6KA 4BL1A 4NM0A 3NVKI 4ZJVA 3GBZA 4V04A 2RG5A 2R3IA 4QMUA 3HVCA 1W98A 4GVJA 4RC3A 2IN6A 4GIHA 1Q62A 4HCTA 5C03A 4L67A 3PUFC 3QYZA 4QYGA 3NUNA 3DU8A 1BX6A 5AP3A 2P2HA 4RIWB 3NCGA 5F1ZA 5DBXA 2PVYA 1KOBA 1PXOA 2E9VA 2Q83A 3BU5A 4C62A 4CSVA 5CF6A 2CGUA 3D9VA 5CZIA 4G6NA 2R5TA 4GS6A 3UNZA 4GKHA 3TEIA 1PF8A 3QQHA 2YABA 3PXFA 4FKLA 3IW7A 3Q32A 1CKPA 1PXLA 2WIHA 3U87A 3QD3A 3V5QA 4JQ7A 2O8YA 4EWQA 5FM2A 3W0MA 1W83A 4K1BA 3PPJA 4K18A 4AA5A 1OITA 4IVDA 4UXLA 4XG8A 4MWHA 4QMZA 1TFFA 1OKWA 3EQIA 3RGFA 3CD8A 1Q5KA 1J3HA 1XBCA 3GCUA 3BGPA 4EHEA 3GU5A 2W5AA 4IDVA 4IX4A 4BDDA 3C4CA 4NSTA 3BKBA 4G9CA 2XK3A 4TNBA 3R04A 5JFXA 3G0FA 3DT1A 2CNQA 2B9JA 4CG9A 4ZXTA 3ORIA 2UW6A 2JKOA 5CQWA 3ID6C 3EOCA 3A8XA 3QCYA 1DM2A 4ZIMA 2I0VA 4I6QA 1ND4A 5EQYA 4JNWA 4S2ZA 3FC1X 2XNGA 2JIUA 1YXXA 3BYUA 4BDCA 5BPYA 5BVNA 2J9MA 2YCSA 3D0EA 1ZYJA 2P4IA 5ICPA 4YC3A 5IEYA 3DDPA 4IWDA 4C4FA 5KE0A 3Q2JA 3IO7A 4JL9A 4DF3A 5LJJA 3RTPA 3P5KA 4N0SA 5AUZA 3K3JA 3W16A 3VUIA 3KK9A 4I3ZA 5AX3A 3UMWA 1XH6A 2C5XA 4G5JA 3BLHA 4Z55A 5IA4A 2WEIA 3H30A 4J99A 4GCJA 4ZZNA 4CZUA 4QYYA 5J79A 3R22A 3UQGA 5LOHA 4LV8A 2G9XA 3PLAE 1XJDA 4TWNA 2XKEA 4RC4A 2XJ2A 3VS0A 2G15A 4X2KA 3E8DA 3BHVA 4D58A 5LVMA 2CJMA 3RPRA 3S4QA 2F2CB 4WIHA 4A9SA 2PMOX 3PTGA 3A7FA 3ROCA 3RPOA 3LM5A 5L2QA 4OBQA 3W0OA 4LDTA 3ZRMA 3TV7A 4DEHA 3FAAA 5EQEA 4GG7A 4LV7A 3UC4A 2C3JA 5A9UA 1YWVA 4UBAA 4IWOA 4WNMA 4PNIA 1H1SA 2YITA 3CBLA 3O17A 3PYYA 2H6DA 2HZIA 2ZM4A 3CEKA 1PXPA 3OF0A 4NM5A 3QA8A 5M55A 2BILB 4Z16A 3SVVA 2W5BA 4FL2A 3ZFYA 4FTRA 5AR7A 5A4LA 2UZLA 2QO7A 4USDA 2FYSA 2O5KA 2WTCA 4RX7A 3RCDA 3QCXA 5FTGA 4F7NA 3OUKA 4XRLA 3S2PA 4QYEA 4WHZA 2NPQA 4PQNA 3SG8A 4ZP5A 4DG0E 1QPEA 2CNUA 4PV0A 5HG8A 2OH4A 4BDHA 4IVBA 3L8XA 5EM7A 2FA2A 5JQ5A 2IG7A 3NZ0A 3GU7A 3O96A 4D55A 5E1SA 3W0RA 4YNOA 3FXWA 5D10A 2XA4A 1DI8A 5LVPA 4FTIA 4ARKA 3PY3A 2ITZA 4R5SA 1ZZLA 4PPAA 1WBWA 2IEWA 3PXYA 4QMWA 3FMLA 2CPKE 1GZ8A 1OPKA 3OEFX 4FKOA 4I6FA 2B55A 2ZJWA 4XHKB 5CT7A 4EOLA 4M69A 3ALOA 3MIAA 5AIKA 5F95A 3EQRA 3ZFXA 2GS7A 4E5WA 4UEUA 2W1HA 4QPAA 1XH4A 2R3LA 3KGAA 5L6PA 1ZZ2A 3SA0A 5DYJA 4AQCA 2C3KA 1O6YA 3HYHA 5KMJA 5DT0A 3W0NA 2QU5A 4Y8DA 5AM6A 5TF9A 4F0IA 4IZAA 2WMTA 5AMNA 3LJ0A 4CT1A 3BX5A 4AE6A 1CKJA 2QOFA 4OR5A 1H1WA 4GEOA 3R00A 2XBJA 4Y85A 3FSFA 5AUWA 5I4NA 3A4OX 3KF7A 5FRIA 3DA6A 4QDEA 3R7IA 1YHSA 2ITPA 4RA5A 3EFJA 4PPCA 4CFNA 4O91A 2XK9A 4X2NA 3SAYA 4EC9A 3BGZA 4YHTA 3TDWA 4BJJA 2X2MA 3ZLXA 3UO6A 2IVTA 2QKRA 4EOMA 5FDPA 2QOKA 2V22A 4TZRA 1YW2A 5K0KA 3MH1A 3QD4A 5KCVA 5IH4A 3QRTA 5AV2A 4W4VA 3FLNC 3LPBA 1NY3A 3FY0A 2IWIA 2C6LA 4U40A 3C1XA 4YZMA 4XJ0A 4CXAA 4L43A 3Q4CA 3SXSA 5AFVA 3Q3BA 5E8WA 3U4UA 2GFCA 2J0MB 4MUQA 4FTCA 3A7HA 1NVSA 2C30A 2VZ6A 4QMTA 1OUKA 2ZB0A 3H3CA 4HVDA 3AT4A 3TKIA 1W0XC 4YJSA 5BUIA 2UW4A 1O6LA 1ZYDA 2RFNA 2WEVA 4FV4A 4G5PA 2Y4IB 4OTQA 2VWBA 4ASEA 4RVLA 4CFMA 2P3GX 2Z7RA 2WMUA 3PVGA 5CI6A 5CLPA 3D14A 4MBLA 3ZU7A 3MGYA 4MQ1A 1U5RA 2PVHA 4ZSEA 4KNBA 4IH8A 1CMKE 4FVQA 4YO6A 5K0XA 5BYLA 4FOCA 3N4UA 5FEEA 3MA3A 3HMPA 2X81A 3JVRA 4E4LA 3G5DA 3RK9A 2QONA 4YZDA 3II5A 3Q2MA 3F5XA 5FM3A 3LMHA 4F6UA 4AOJA 3F7WA 4K11A 4C02A 5BVDA 5IA3A 4QMLA 2QOOA 4CEGA 2OXDA 3KQ7A 4M15A 4P90A 5LMAA 4XG6A 1URWA 2ZMDA 4QQ5A 2IW9A 4BDIA 4NIFB 4RIXB 3F5GA 3ERKA 4WNOA 4QPMA 4AXCA 2VNYA 5EHYA 4O7YA 5F9EA 1M7NA 4V01A 4W4WA 3ZXZA 2JAMA 3I60A 4II5A 5FP6A 2X4FA 3HDMA 1VEBA 2UZDA 4HNIA 4KS8A 5ETFA 4U8ZA 4O7RA 2R3HA 4E4XA 4WO5A 4AWIA 3UO5A 4QMMA 3TKUA 4IANA 5DWRA 4IVAA 2PHKA 3LJ1A 4IFGA 2BTRA 4M12A 3LFSA 4TKSA 2RG6A 3EFWA 4JBQA 4WG4A 4H1JA 4AUAA 1K9AA 3BLRA 1WVYA 4YTIA 4FK3A 2PWLA 4OTRA 2WTIA 1UV5A 3ET7A 4QMOA 4UYAA 2OU7A 2C47A 5CU2A 5GZ8A 3UIBA 5A4QA 4ASDA 1GZOA 4KINA 4DFBA 4U3YA 4JR3A 2YM7A 3C0HA 5CT0A 3WI6A 3G51A 2R3KA 4B0GA 4LUEA 1XH8A 5E4HA 5CALA 3ZUVA 4C34A 1QMZA 2EUFB 4NTSA 5TKDA 2H34A 3BIZA 2ITXA 4A06A 2YA9A 3W8LA 4E1ZA 3VW6A 1H0WA 3D15A 4ASZA 2PUNA 5KZIA 4DHIB 4QYFA 1Y6AA 4C3FA 3D5VA 3DFAA 5M56A 4GV1A 1XMMA 4F9CA 2XEYA 4RZWA 2PULA 3R7OA 3KXGA 1NW1A 2GQGA 1UU8A 5DR6A 3FLSA 3JPVA 4RIYB 3N9XA 2Z7SA 1RW8A 2OO8X 3L9LA 4U81A 3RWQA 2G2FA 1H27A 2XIXA 4CFXA 3KIOC 4I0SA 3QRKA 2PSQA 2VTSA 4GU9A 4FSQA 3AT3A 3O8PA 4FX3A 4MNEB 4D28A 2OIQA 3UYSA 3ZC6A 1O9UA 3ZSIA 4CV9A 3KRRA 2ETKA 1FMOE 2KULA 4BICA 3DDQA 1UNHA 3C50A 1V0PA 5JMSA 3C4FA 4KBKA 4U7ZA 5HIDA 3ZUTA 3PA5A 4QNAA 5IEVA 3HV3A 3P86A 2IVSA 5D1JA 1FMKA 3MYGA 1GZKA 1G8AA 2PZPA 4WG3A 5HTCA 4K0YA 4EC8A 5AR3A 4Q5HA 1JAMA 4KBCA 4EZ3A 4HYHA 4KAOA 5DRDA 2JFMA 5H9BA 3CKWA 4ZTNA 3I79A 3BEAA 2JBPA 3MTLA 4D2SA 3FQSA 3A7JA 3TIZA 3F2AA 3N4VA 3MESA 1SM2A 2UZNA 2YCRA 3DJ5A 4IZ5A 3QTWA 5E8ZA 1P5EA 3TV4A 3TV6A 5HTBA 1REJA 4B9DA 3WOWA 4PPBA 3ZLSA 3I6UA 5HVKA 1WCCA 4NL0A 1OI9A 4H05A 5HCZA 1FQ1B 1AD5A 1T46A 4YBKA 5E8XA 5A46A 3GCVA 5BNJA 5IQEA 4CRSA 2W4KA 4BCFA 4FEXA 3DAJA 1PMNA 5EI8A 4IDTA 3ZBXA 3W2OA 3G15A 4EOKA 4MHAA 1FOTA 1OIYA 4FV1A 4RFZA 2VTJA 5EI2A 2GHGA 5KMLA 3IS5A 3OEZA 4CZTA 4YTCA 5A54A 4X6RA 2Y8OA 3QFVA 4X21A 4FTQA 1H00A 3BCEA 5CSPA 3DKOA 3LXLA 3KKVA 3F5PA 4RBLA 3WYXA 5K4IA 3FMEA 2QQ7A 3V8SA 2YIXA 4DEDA 3LQ3A 1P4FA 4QP8A 3GQIA 4CYIA 3D5UA 3LW0A 4JG6A 5HBJA 2XJ0A 3TMOA 4DT8A 2ESMA 2YIWA 1PJKA 3QAME 4FTUA 3V8TA 4USFA 4JBOA 4AN2A 4FG9A 5AX9A 4ACDA 4AW1A 3BEGA 5LVOA 2ITNA 5JK3A 3GC8A 3PA4A 4FL3A 4QYHA 3SRVB 5H2UA 4R1VA 1BKXA 3LAUA 5KKRB 2OSCA 2JKKA 3TL8A 2I0YA 3PJ3A 1XHAA 2GU8A 4JQEA 1IA9A 5JFSA 3W33A 3EN9A 4MXCA 2WQNA 3ZEPA 5EQPA 3ZRKA 5B2KA 1OL6A 5DEYA 3OTUA 5AP0A 2BFYA 4JLCA 3A62A 5JGDA 4UX9A 4EUTA 3FZPA 3QKMA 2HWPA 5L4QA 5LVNA 2VWUA 2Z8CA 1YQJA 3QUEA 1VR2A 5L8JA 2JDOA 4QPSA 2VTHA 1OBDA 3ENMA 4E6CA 4YZBA 3NEWA 3I7BA 2UW3A 2JKQA 4TRLA 3OWJA 3TZ8A 3KXNA 3OWKA 4LMNA 1DAYA 2BAQA 4TTHB 2X7OA 2WQBA 5CS6A 4DHFA 3EQFA 1K2PA 2XAMA 4ZTLA 2UVXA 4LOQA 2CGWA 3D7TB 4G3EA 4JXFA 3DK6A 4NU1A 5FEQA 2OIBA 3E63A 3HP5A 3QA0A 3ZO3A 4LQMA 1L8TA 3LZBA 3KRLA 1QPDA 4G6OA 3PJ2A 3QWJA 4YZNA 3BHYA 4A9UA 4GK2A 4UY9A 1QL6A 3UZPA 3LCTA 4RJ8A 3TJCA 3VRZA 3ATSA 3FBVA 3O71A 5M4CA 3NAYA 4I4EA 4I24A 4Y73A 1W7HA 1W2CA 2WTKB 4AS0A 4HGSA 3LVPA 3PP1A 1ZY4A 4KIPA 3QWKA 1WBNA 3RZFA 4CMOA 4HNFA 3DBCA 3MSSA 4I93A 4FSWA 3RAIA 2BRGA 1J1CA 3IECA 4L7SA 3Q4TA 4FTNA 4G9RA 5HBHA 4WG5A 4TWCA 2R3OA 3SXFA 4BC6A 4QMQA 1M2QA 4TYGA 2FB8A 4O81A 1OL1A 2XALA 3A7IA 4XBRA 4YUQA 5AUUA 3MN3A 4YJVA 2OKRA 3ZM4A 2GHLA 1ZOHA 4BIEA 2BHHA 3U54A 2R7IA 4PF4A 4YLKA 3OTVA 3CXWA 3ZRLA 1ZMWA 2AC3A 4CVAA 4E6QA 5E8VA 4BVUA 1OKYA 3NPCA 3R2BA 4O0TA 2C0OA 4L3PA 3A2CA 4YP8A 5I3RA 5HG9A 1FVRA 1ZRZA 1B39A 2JGZA 4G2FA 5AR8A 2OICA 3G9NA 4CNHA 1YI3A 3NUXA 2C3LA 3RI1A 3VRYA 4F70A 3ETAA 3HNGA 3NNVA 3UQCA 5AV1A 2WPAA 5JEBA 4OGRA 2W4OA 3H10A 1ZYCA 3QZHA 3MVHA 4YJRA 4DFXE 4D4YA 5J9LA 1BMKA 3UQFA 4M13A 1YOLA 4J53A 3EN5A 4Y5QA 2CNVA 5IQBA 3WE4A 2PL0A 3SC1A 1ZXEA 3ANQA 3THBA 3ORLA 3F3ZA 3OT8A 2ITTA 4G16A 3E62A 4WUNA 4JDKA 1PMVA 2XNEA 4DGGA 5AEPA 2JLDA 2CN8A 3A7GA 4PDYA 1U46A 2J0IA 3ZDUA 3NS9A 5FTQA 3ZSHA 3R1NA 2W1EA 2DQ7X 2IZTA 4D2VA 2P33A 3QGWA 5T68A 2W99B 4AA0A 2QR8A 4DE4A 5AP5A 3VS6A 4BCQA 5IH6A 3OCSA 2OJJA 1H26A 3CQEA 1SNUA 2DUVA 4JDHA 3CKXA 2IO6A 3E87A 5FTOA 2R3RA 4AE9A 3MH2A 4YJTA 2AYPA 2RFSA 3C4ZA 5IPJA 1BI7A 3AC2A 4U80A 4A4OA 3KRJA 4MYGA 2BZIB 3BWJA 4JJRA 3NW7A 3JXWA 4FRFA 4GT3A 3V51A 3MA6A 1OB3A 3FI2A 5M51A 3O50A 4XP3A 2I0EA 3V04A 4HGEA 5JRSA 2IW6A 3IW6A 3P7CA 3EKKA 2E9NA 4JBPA 3KULB 4FV2A 3L9NA 4Z9LA 2F7ZE 4AFJA 4BCJA 2QODA 5BUEA 1A9UA 3D4QA 5HBEA 5HD7A 2AEGA 4X7QA 4OAVB 4HYUA 3LE6A 4FF8A 4L45A 3R8VA 2XNNA 2VTMA 3EL8A 4E8AA 4QP3A 2WQEA 2XB7A 4M66A 4TWPA 4JIAA 2DS1A 2IJMA 1OMWA 4JI9A 4NM7A 4D9TA 4XP2A 3O8UA 3VIDA 2CLXA 3O7LD 5D7VA 4HZRA 4O4FA 4FSYA 4F65A 2FUMA 2NRYA 2J4ZA 2XNBA 5B2MA 2WTJA 4F78A 5HU9A 3QKKA 4KKHA 3C9WA 4EHVA 3OD6X 4FKPA 3E7VA 2BCJA 2WHBA 3AC8A 4NUSA 2W0JA 3IG7A 2EB2A 3QC4A 5ANDA 3U6IA 2C0IA 2GFSA 2UZWE 3LIJA 4CTBA 1IG1A 4O1PA 4B8LA 3CPCA 3C0GA 5CXZA 4S31A 3COIA 2ZVAA 3MFUA 2UVYA 4IZ7A 4MK0A 4KKEA 2JDVA 1L3RE 4U0IA 2JC6A 2YAAA 5H8GA 2R0IA 1J7IA 2YAKA 3K3IA 5L2TA 2B9FA 2GPHA 2RGPA 4MTAA 5DLSA 4D5HA 4F1MA 2G2IA 1Y91A 1H28A 3WZDA 4ZTMA 1Q8YA 2ZAZA 3MY1A 3PSDA 4HVGA 2YCFA 3R30A 4O0VA 5KMOA 4PMMA 5J8IA 4AF3A 4QDVA 2YZLA 4O0RA 4YLLA 3OC1A 4FKUA 4CTCA 1GNGA 5EH0A 4DYMA 4EH4A 3GC0A 3IKAA 4WUAA 3VS7A 2YISA 3R8UA 2XIYA 2BAJA 1KWPA 3DLSA 3GT8A 4LYNA 3BYMA 4FODA 5BUJA 1YXUA 2QU6A 3Q9ZA 4EOSA 5LWNA 3U9NA 4DFZE 3MH0A 4ZMFA 5E8YA 3FY2A 4ZTRA 4TYHA 4DCAA 3QU0A 5CAVA 2JIIA 1TQPA 4BDBA 4Y5HA 3C5UA 2ERZE 2YHVA 3AC5A 4J1RA 4IAAA 1BLXA 4S34A 4ALVA 2XK6A 4DBNA 4F9YA 5EDQA 4FOBA 5DEWA 1UA2A 4EK8A 3B2WA 4G3CA 4XV3A 3IOPA 3PZHA 4IAYA 4O21A 3MVJA 3FHRA 4ANSA 4CV8A 3W0QA 3K5UA 4L9IA 4MXZA 3VBYA 1YVJA 2AC5A 4EH9A 3UJGA 2X8IA 3PWDA 3D5WA 3DAKA 3I0QA 3I5ZA 3MVLA 5ETIA 4R1YA 5AADA 3KREA 4CGAA 5FXRA 4ZMEA 4DDIA 3MJ1A 4TXCA 4RLKA 3H9RA 4AW2A 4B6LA 5IMEA 4KUJA 2QLQA 3KN6A 3EH9A 4IWPA 2R3MA 3FWQA 1ZLTA 4FT7A 4JAJA 4LV5A 4DEEA 5I0BA 2XIZA 4RJ6A 3C0IA 4FT0A 4AOTA 4NZWB 1KE8A 2HY0A 3LLTA 5H3QA 4UB7A 4GK3A 3FI4A 3PFQA 4DH7A 2Z02A 1OGYA 1W2FA 3IK3A 1OBGA 4LI5A 5GZ9A 4DHZA 1ZOGA 4KA3A 3FLYA 3PZEA 4BWXA 1OECA 3R7YA 2XAOA 2OLCA 4E5AX 3I0OA 4YSMA 1OIRA 3OCGA 1H24A 4P4CA 3AXWA 3FPQA 2A19B 4OT6A 4TWOA 4ACCA 4JG8A 4HYSA 4WOVA 3SV0A 3FHIA 4FJVA 3ZDIA 2XKFA 3PJ1A 2OFUA 3QZIA 4M97A 2JAVA 1E1VA 2C6IA 3QUPA 3VAPA 4DGOA 4NEUA 2C5NA 4ALWA 1IRKA 4FVPA 2BFXA 3GFEA 2WU7A 3GNIB 4AT4A 4YJOA 3D5XA 3BGQA 3F5UA 4MD7E 4ACMA 5L6OA 1H1QA 2ZMCA 4UZDA 4BI0A 2VWWA 2VWZA 3MH3A 4D9UA 1S9JA 1U5QA 2YZAA 4ERKA 3R1QA 1YI6A 3CR0A 3IW4A 1KV1A 4NFMA 4DFYA 2Y0AA 4LG4A 3PG1A 3UIUA 4NH1A 2WU6A 1KSWA 5T3QA 3P9JA 4W8DA 4XV9A 3TNIA 3PP0A 1BL7A 1CTPE 3HKOA 3NMUF 3UPXA 4ACGA 2OBJA 2IZRA 2XYNA 3GFWA 3QQGA 1H4LA 3Q96A 2WOUA 4OTPA 4G3FA 5M44A 1S9IA 1OZ1A 3NUSA 2HK5A 5AUYA 5CASA 3TIYA 3FEGA 3ZOSA 5AP1A 4DT9A 4KWPA 3DTCA 5BVFA 3DQXA 5B0XA 2Z7LA 4BKJA 2I7QA 2NNWB 2CLQA 4IB3A 4TW9A 4ORKA 3FYKX 3PY0A 2OXXA 3VBTA 2PMLX 3BV3A 3A4PA 3IDBA 4BGQA 4GUEA 3R1YA 3T9IA 3TI1A 2C6TA 3WZEA 2I40A 4OTWA 5IUGA 4JR7A 4FV7A 4O4CA 4RZVA 2B52A 5F20A 3W1FA 4MVFA 1OUYA 3E5AA 3OCTA 4IM0A 3W32A 5IKWA 3WARA 3I7CA 1R0PA 3EJ1A 1FBNA 1J1BA 5HD4A 1Y57A 3T3VA 3V5LA 1VLRA 2GNLA 4NKAA 5DR2A 4YJPA 1PHKA 1WVXA 5I9ZA 3C7QA 3R73A 3PPKA 4IXPA 4EZ5A 4YJUA 3CP9A 2A4LA 3I81A 4ZSGA 3UTOA 5DIAA 4BB4A 5AR5A 5CAOA 5HICA 4EH5A 4O7LA 3WBLA 1WMKA 2YM3A 2GTNA 3HP2A 1XO2B 2Y7JA 5JFVA 5LWMA 4FKVA 1Y8YA 2Z2WA 4JRNA 4N6YA 4QD6A 3TTJA 3OW4A 1OIUA 5AM7A 3Q9YA 1WBVA 3EN7A 3DBFA 3P7AA 4H3BA 5BVWA 3KXZA 4Y72A 4PP9A 4RFYA 2J0KA 3QKLA 3NRMA 4R8QA 4WSYA 5G1XA 2CKQA 2V5QA 1R0EA 4I6BA 3IW8A 4FTJA 4IC7A 4FT3A 3F6XA 3U55A 4EOPA 5CNOA 3VQHA 2YWVA 3Q6WA 4USEA 1SMHA 3UPZA 4S32A 1JKKA 3UNKA 4M69B 1XBAA 3W18A 3NYVA 3OVVA 4RGJA 4UWCA 4N4SA 4ZLOA 5CF8A 5M57A 3ATTA 3QBNA 1YXVA 2BKKA 4QP9A 3AMBA 3NVMB 3GOPA 3VBVA 5J95A 2WKMA 2NP8A 3QTSA 2OK1A 3FL4A 5HOAA 4EK3A 3OUNB 5M53A 5GINE 5CY3A 4DH1A 5JKGA 3QF9A 2H96A 1OL7A 3R28A 2W96B 3E92A 4FSMA 4JMQA 1FGIA 2ZYBA 3EYHA 1U4DA 2FSMX 3BELA 4BDJA 1XKKA 4C4JA 3I6WA 4MBJA 1JPAA 3NUPA 5C9CA 4OTFA 4EJNA 4QP2A 5EG3A 2GQRA 1PYXA 3FXXA 2F7XE 5IDNA 2OJ9A 3O23A 1TVOA 4ZS0A 2XKCA 1Q99A 3ANRA 3QCSA 4BTFA 2WELA 2O65A 5JN2A 3W0PA 3V3VA 3V5JA 2XUUA 3R63A 2UW5A 2YN8A 1ZYSA 5AP7A 2EB3A 1G8SA 2UVZA 4RMZA 4Y95A 3UE4A 2WMQA 3FMJA 3O2MA 4DH3A 2BVAA 2CGVA 2W1GA 3VQUA 5A3XA 3MFTA 3UOJA 3PVUA 4C33A 3CGOA 3PIZA 5H8BA 1UWHA 5J5TA 2XNOA 4KD1A