3ZEWA

Crystal structure of ephb4 in complex with staurosporine
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
280
structure length
269
Chain Sequence
EIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLSSDPTTSSKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords EPHRIN TYPE-B RECEPTOR 4
publication title Completing the Structural Family Portrait of the Human Ephb Tyrosine Kinase Domains
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 269
sequence length 280
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zewA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zewA01
2B9FA 3DZOA 1M2PA 2R3IA 4I4FA 5AX3A 1R0EA 2YDKA 3C4WA 3OOGA 4HOKA 2Z7RA 3ZDIA 4D4VA 4KS7A 4D2VA 3PSCA 3OROA 4WBOA 2IVTA 5HD4A 3G2FA 5HIEA 4ANBA 5D11A 1Y8YA 3VQUA 2Q0NA 4PDPA 3W55A 3QGYA 4QTDA 2BZHB 3F3TA 4IM2A 2QO2A 2HENA 5HG5A 2E2BA 3L1SA 3R9OA 4AFEA 3IOPA 3U4UA 2YHVA 4GIHA 5AP5A 1NY3A 3HV4A 3P7AA 3GC7A 3EFWA 3OW4A 1YWVA 1ZOGA 2CMWA 3HLLA 3Q3BA 3EQGA 5IMEA 5HE2A 2B1PA 2W4KA 4YMJA 4JRVA 4DFBA 5FM2A 4FTLA 4OBPA 1GJOA 3N51A 3W2CA 3LFQA 4AZSA 4FV5A 4X2GA 1PF8A 1VYZA 3COHA 5D7AA 1H1QA 2GTMA 3QA8A 4FTUA 3DZQA 3BGQA 4CFWA 3LFAA 3SG9A 4BZNA 2UVZA 4E4NA 1ND4A 4J96A 4DT9A 4LV5A 4EKLA 4GL9A 5AA8A 3S0OA 3A4OX 3HUBA 2CGUA 4PQNA 4AZEA 1PXLA 3QHWA 3ZEPA 5K5XA 5C03A 4FR4A 2UZTA 3GQLA 3THBA 3EN5A 4GCJA 1R0PA 3F3UA 1BMKA 2X39A 4WNPA 4QMOA 3R0TA 4ALVA 5EK7A 5FDPA 4F99A 4L45A 1KE8A 2XK8A 2Y6MA 3FQHA 4I6BA 4JS8A 4LYNA 4FKIA 2VWYA 4U8ZA 5FLFA 3E92A 1ATPE 5H8EA 2P2HA 4E26A 4AWIA 1OKZA 3UNZA 4U80A 4GRBA 2CGWA 4V04A 1VEBA 2W99B 4FV7A 3QCXA 4C35A 4EHEA 3S00A 3EL7A 3QQHA 5AP3A 4N4SA 4AW1A 5AP7A 3OY1A 5ETIA 5KUPA 4YBKA 5L6OA 1OL5A 2R2PA 4WT6A 3UO6A 2YA9A 2E9UA 4TYGA 3QD4A 5LOHA 2Q83A 4PMPA 3CQEA 4O0SA 4OBOA 3VS0A 2VWXA 5M44A 3Q2MA 1H1PA 4BBFA 1TQPA 3MY5A 1H27A 3R9NA 3SLSA 4G3FA 3KN5A 3QUEA 3A60A 4K1BA 1SVEA 3DGKA 3R8LA 2R3LA 4N70A 2EXMA 4F6UA 3O8UA 1LPUA 3E5AA 5DGZA 1CKIA 5HHWA 2J9MA 3KY2A 4LGDA 4O0TA 2WMXA 1YDRE 3R01A 2NP8A 4JI9A 3VBWA 4DHFA 4FIFA 4Z7HA 5CI6A 3SC1A 2PVFA 4EH5A 5IISA 2G2FA 2HK5A 2YACA 3MGYA 5HTBA 3VW8A 4O7LA 2VWWA 3FPMA 4FBXA 4AX8A 3O50A 2EXCX 5JK3A 2YERA 4OUCA 4BDJA 3DLZA 4CYIA 2R9SA 3I5ZA 4JG7A 1YQJA 4HYSA 5LCJA 4Z55A 4LOQA 2ACXA 3QD3A 3QWJA 4BWPA 2W1EA 5F4NA 3ORMA 3AD6A 5BMMA 5M07A 2F7EE 4G9RA 2G2HA 4IB0A 4NW5A 2YJRA 4XRLA 5CU6A 2WTKB 4LUEA 2VWVA 2IZTA 3FMMA 4GG7A 4CT1A 5LWMA 1UWHA 3PVUA 4FG7A 2X8DA 4PUZA 4DLJA 4XHKB 3FDNA 3ORNA 5AJQA 3H9FA 4NM0A 2P3GX 3KGAA 2I1MA 3D5UA 3DK7A 3LE6A 4H1JA 5BQ0A 2SRCA 5HORA 4MNFA 4KD1A 4V05A 3TXOA 4Y8DA 4JG6A 3BYSA 3GC0A 3HECA 2QKWB 4TPTA 2CGXA 4IZ7A 2JBPA 3RINA 2IJMA 4LOOA 3R30A 3CXWA 2ITWA 3BHHA 3GENA 4B6LA 5FEQA 3NVMB 1PHKA 4I6FA 4IX5A 2WFYA 3QAME 4IB1A 3AD5A 2WMRA 4LI5A 3MDYA 4O0YA 2ZVAA 3UGCA 2PVHA 5EQEA 3BI6A 3NUNA 2ITTA 3HMNA 1KE6A 1SYKA 3OCTA 5CNNA 3OZ6A 3GCSA 1BX6A 3PA3A 4MEDA 3A7HA 3O7LB 3U9NA 3VO3A 3CSVA 3RCDA 2QVSE 4C0TA 4FNXA 5AP6A 3TZMA 3ZCLA 2B4SB 4YC8A 3FYKX 3L8XA 4H3QA 4IJPA 2BRBA 3NIEA 4UMQA 4YTCA 4RMZA 3C51A 4RZWA 4S34A 4DE4A 2O65A 4I24A 3FC1X 1JQHA 3FUPA 4FOBA 1DM2A 4CFVA 4J97A 4YJSA 3Q60A 3HP2A 4FKLA 4YSMA 1PXKA 5DNRA 5H2UA 2F9GA 4XG6A 4D0WA 4QQCA 5KNJA 1TKIA 5CSXA 3UQFA 5E8ZA 4D2RA 1PYXA 3MV5A 3R7VA 2O2UA 4BIDA 3WZUA 5EKNA 2PUPA 5CY3A 3MYGA 4TRLA 3IW8A 3NUYA 4XG4A 5G6VA 3LMHA 4YHTA 5CEQA 3EQIA 4CFXA 2VTNA 3RHKA 1E1XA 3BU5A 1UA2A 4DTKA 1H26A 1OKVA 3EH9A 4E20A 4RLLA 4JBVA 4ZLOA 5DN3A 2ZYBA 4QTCA 2WTVA 2DUVA 3VF8A 3U6JA 5GINE 3HVCA 4L3LA 4Y5QA 5EHYA 3KCKA 3EZRA 3MY0A 3AMBA 4BWXA 2WTJA 3L8VA 3TIZA 4BICA 3UIUA 2ITPA 2FSMX 2QOFA 1H0VA 1V0BA 2RL5A 4R6VA 1H8FA 1OM1A 2BCJA 4RPVA 5FTOA 2W5BA 4AU8A 2CCIA 4TNBA 4KIOA 1VR2A 4M13A 3MS9A 2IPXA 2C5XA 1FVTA 4ZSEA 5JQ5A 5M56A 3DTCA 4QD6A 3HRFA 5AR7A 3EQRA 4S31A 2R3JA 3DAEA 2R7BA 3PA5A 2QOHA 4O0UA 5FBNC 4M66A 4TWNA 3CE3A 4OR5A 4U3YA 1TQMA 2OBJA 5HOAA 4CEGA 1ZLTA 3VUIA 4MD7E 5JEBA 4AE6A 4APCA 3EQBA 2UZVA 3ORKA 2GFCA 4CNHA 2CKQA 2ETRA 3TZ9A 3HMOA 1GAGA 1NA7A 3H30A 3FPQA 2IW9A 4C3FA 3UOKA 3RWPA 1XQZA 1Q3DA 2I7QA 4QMSA 5ITAA 3G0EA 3LLAA 5AP2A 3GP0A 4BI0A 4EH8A 4EH3A 2YFXA 3A61A 1DAYA 3VUKA 3L9LA 2OICA 4O7YA 2IVVA 1XH8A 3FY0A 3ULZA 3O2MA 5KCVA 4BZOA 4FZ6A 3NPCA 4E4MA 3F7WA 3UIXA 3I5NA 4ZSLA 3NNVA 5KZ0A 3RZBA 3ZRMA 2GTNA 1ZYLA 3E62A 3OS3A 3C0IA 3PXQA 5KKRB 4KSPA 3CKXA 3IW4A 1IG1A 2JDSA 3QQLA 2R64A 4QMXA 5LCKA 2DQ7X 1ZOEA 2PWLA 2VX3A 3KL8A 2JBOA 2YM3A 3B2WA 3QA0A 5DE2A 4CTCA 5CEOA 2YITA 5IG1A 3TIYA 3IONA 3HMMA 1GIJA 4IAZA 4ITHA 5HTIA 4D9TA 3CD3A 3QD0A 4FTKA 3RPYA 4BDIA 4Z9LA 4AZWA 2CKPA 5AR2A 4KBCA 3OBGA 4QOXA 5E1EA 2PUNA 5B0XA 5H8GA 1SMHA 4QMZA 5CT7A 5KHXA 3POZA 3W10A 3ZO3A 3QX4A 4E4XA 5CEIA 3PG3A 3ROYA 1F3MC 3A99A 2RG5A 1YOLA 3MVMA 5TR6A 2YM8A 4QTAA 4LV8A 4MD9E 3SXSA 4M12A 1R3CA 3UO5A 5A4CA 2UZOA 2YLEA 5DG5A 2WTDA 4PRJA 2R3OA 4II5A 5KMIA 4FTCA 3GUBA 3F3WA 5IH4A 5TKDA 5IA0A 4MH7A 4C4JA 4C61A 1XJDA 2XKCA 1H25A 1MRYA 3JVRA 5DPVA 3Q5IA 2YZLA 2OZOA 3UDBA 2QOBA 4KRDA 3JUHA 2CJMA 4UXQA 2B0QA 4DH1A 4IB3A 4BCIA 2C69A 4U5JA 4YC3A 3FMHA 3ZFYA 3MIYA 2QLQA 4D5KA 3AT3A 4BIEA 2QOKA 4L42A 4I92A 2PVYA 2XF0A 2ZV9A 3DB8A 3PTGA 4UB7A 1JKKA 5DBXA 2F2UA 4QT1A 2OJ9A 3F6XA 4Q5EA 1OBGA 4ACCA 3OF0A 3DTWA 1YHWA 4LMUA 4R3RA 2W9FB 3LCDA 2O5KA 4O7VA 2BZIB 3QZFA 3C13A 5L8JA 3DAJA 3KMUA 3VS1A 4HYHA 3JS2A 3MFSA 4RVTA 5IUHA 2J5EA 5F20A 3UZTA 3NMUF 3R1QA 5CU4A 2ZV8A 4USEA 3EQPA 3V6SA 4ANSA 3MY1A 5CF6A 2WMUA 3KMMA 2W1GA 2YAKA 2JAVA 1SM2A 2VWIA 2C5YA 3PPKA 3VBXA 3KK8A 5CAPA 4YNEA 4UN0C 3U9CA 3P79A 5AV0A 3KN6A 4OTWA 4TYHB 4BHZA 1S9IA 2XM8A 1ZOHA 2H6DA 4Z3VA 4FX3A 1Q8TA 1ZMUA 5CU2A 3V8SA 4EH9A 2GS6A 1ZWSA 2Y0AA 3R9DA 3GOPA 3PZEA 3W2SA 1IEPA 3HDMA 4C2VA 4TKSA 4E6CA 4ZLYA 4X3JA 3BLHA 3WE8A 1XH9A 3MIAA 4TZRA 4HGLA 5KE0A 4RX7A 4ZJIA 4IAKA 4ONAA 2B55A 2EVAA 4DT8A 4AZFA 5CSVA 2Y9QA 2WQBA 4LRKA 4XG3A 4JOAA 2PUUA 4QP9A 3T9IA 3ZUTA 3ZFMA 4AN9A 5HBEA 4XX9A 3QTZA 3ZHPC 4ZZOA 1YW2A 4QMMA 4BGHA 3NYVA 5KBRA 4DG2E 1A48A 3JYAA 5LMAA 3E7OA 4FGBA 5M08A 1KOBA 1GNGA 1WBVA 4X6RA 2ETKA 1KE9A 2XNNA 3RPRA 5EOLA 3JY9A 4PNIA 3VRYA 2O3PA 3KKVA 3MB6A 5LVLA 2YDIA 3IW7A 4O7TA 4A07A 4YURA 4I22A 3SW4A 4O86A 3ETAA 4W8EA 4KA3A 4K33A 5I9UA 2R3QA 5J9ZA 4LUDA 4CRLA 1I44A 2BRGA 4AW0A 5CU0A 4RIYB 3PRFA 3AC5A 1PXMA 3EMGA 2BDWA 5L3AA 3RK7A 4GT5A 3KMWA 3DNEA 2VWBA 3WZEA 3SV0A 2ITVA 4R1VA 5IA4A 4ASDA 4ZS4A 3BV3A 4G3EA 4WHZA 4X7QA 4G31A 2Z7LA 2QLUA 2FSTX 2HY81 4FG9A 1UKIA 1WZYA 3Q5ZA 4FV8A 4PL4A 4KIPA 2FGIA 1JKTA 3VS6A 4FGRA 3O8TA 4ASZA 3UOLA 3R00A 1YOMA 4Q2AA 2QU5A 4BCPA 1GOLA 3FKLA 4QO9A 5CSPA 4CFUA 2R3FA 3RWQA 4QNYA 1YRPA 4UY9A 4FSUA 4DBNA 5JN2A 4GU6A 4L43A 4L52A 3QUDA 2CHLA 3CY2A 2RIOA 1XHAA 3A8WA 4BGQA 3MH0A 3Q53A 1HCKA 5EW8A 4XBUA 3E87A 5AAFA 2BHHA 4FK6A 3QRJA 3LJ1A 5CAOA 4G2FA 3QLGA 1KV2A 4AT5A 2JKOA 4MXOA 4DFYA 2XNOA 3EL8A 4U3ZA 2X0GA 4RIWA 5BVDA 4J53A 3Q52A 2GHLA 4ZLZA 3ZUUA 4IM3A 1L8TA 2GNGA 2VUWA 4FTNA 3GU8A 2ZDUA 3KCFA 4IE9A 3NS9A 4QYHA 4AA0A 1H28A 4UWBA 1OZ1A 3F5PA 3NYXA 4FKUA 3UQGA 1LR4A 1DI9A 5ETAA 4NEUA 3PSBA 4BYIA 5I3OA 3TKUA 2OXYA 5IQIA 2C6EA 3SX9A 3ALNA 1ZARA 1WBWA 1H4LA 4LG4A 2BFYA 2XIKA 3ZZEA 4AUAA 4ZXTA 2IZUA 3GEQA 3LFBA 4DF3A 2HIWA 2YDJA 5TF9A 1NXKA 1QCFA 3TUBA 3R8PA 5CI7A 4EQUA 3UP2A 3O0GA 1FBNA 4F64A 3HDNA 2CKOA 4TYJA 2CDZA 4EZ3A 4NTSA 3C5IA 3CIKA 3VS4A 3IQ7A 3E63A 3HYHA 4NIFB 1UKHA 4O6LA 3QC4A 4N0SA 2C3LA 2JIIA 3KRWA 4YO4A 3TM0A 3R7EA 4IB5A 3F61A 4PV0A 5F94A 1H1SA 2WMWA 2ZM1A 3F88A 4HVIA 5E8TA 2A19B 3JVSA 2BHEA 3ZUVA 5M4UA 3GU4A 1IR3A 4L3PA 4ORKA 5I4NA 4LL5A 4F0GA 4DH8A 4U81A 3PJ8A 3MI9A 4CMUA 2A4LA 5HX6A 3EQHA 3VQHA 4F1TA 3U51A 4YSJA 4O7RA 1Q8ZA 3ZC6A 5LVOA 3OUKA 3ORLA 3I0QA 3FI4A 5L8KA 4BCKA 3EJ1A 4QNAA 3W2OA 3Q4ZA 3PVGA 5IH5A 1YDSE 5FXRA 4FNYA 4LQMA 3UMXA 1FPUA 3TUCA 3BPRA 3LM0A 2JDRA 2J6MA 3FL5A 3ZBXA 4D4SA 2WB8A 3UVRA 2F4JA 3AMAA 4NJ3A 1BI8A 4WNOA 4AOTA 3AXWA 5CXZA 4C33A 2OF4A 5FG8A 4Y83A 3LFNA 4FNZA 4FZDB 3LXKA 4G34A 4FT3A 4YJQA 3DKFA 5AR5A 3UP7A 5IF1A 5TOZA 3FMNA 5JZJA 2J4ZA 2VO3A 1RQQA 3LFDA 3AQVA 3KF7A 1KE5A 4X3FA 5ANIA 2CPKE 4D28A 2OLCA 4BDCA 3LQ8A 3G90X 5AAGA 3MN3A 4BDFA 3IW5A 2CNQA 2XEZA 5DT4A 2QHNA 3R8UA 4IDVA 3OBJA 2QCSA 5FP5A 3TL8A 1OIQA 2XKFA 3UVPA 3DV3A 1OL1A 3ERKA 2ZB1A 4ENYA 2WTWA 5F9EA 3FLWA 4O7NA 5T6KA 3KA0A 1V0PA 3C4FA 4JDJA 4RFZA 2X9FA 4WSQA 3PE1A 3MESA 3PDTA 3K3JA 3UIMA 3GCUA 4U7ZA 3IGOA 1KSWA 5A3XA 4QYYA 4YGAA 4BR3A 3W1FA 5ANGA 3AC1A 4MVFA 4WUAA 4A9RA 4AOIA 5IQCA 2QOQA 5HLNA 2HZNA 4IVAA 4RWJA 3VAPA 1U54B 1U4DA 1UU8A 2F2CB 3DU8A 3PPZA 4H3PA 1ZYSA 4IFGA 3E64A 5FXSA 2XMYA 3UNKA 5BVOA 4KRCA 1YXVA 2HZIA 4EKKA 4YU2A 2RG6A 3DBQA 1YHVA 3PA4A 5DEYA 3EQCA 1WCCA 3LCTA 3PRIA 4Q5HA 3WBLA 2WO6A 3PY1A 5EYCA 5JKGA 4IX6A 4GW8A 4M67A 2WD1A 2XIYA 3KXZA 3RPSA 2W05A 4O7ZA 5LMKA 3RZFA 3DJ6A 5GJDA 2FUMA 5AUVA 4QMQA 5CAQA 4B9DA 4MF0A 3WYYA 4R7BA 4IJ9A 2B7AA 2EWAA 5FUTA 2YWPA 2OZAA 5DIAA 4A9UA 5CNOA 4XLIA 3ULIA 5DLSA 3QTSA 2NNWB 4NCTA 4U0IA 2QONA 3F5GA 2PMNX 4IMYA 4TW9A 3FLNC 2FSOX 2LAVA 3HAMA 4GV1A 4QP6A 4D58A 3PFQA 4FKSA 4IBMA 2HELA 3SKCA 1O6LA 4APPA 2X2LA 2RGPA 1PYEA 2WQMA 3ZMMA 4B0GA 2V55A 3MJ1A 1PXJA 2O8YA 1WAKA 3MWUA 3QF9A 4UWCA 3V5LA 4IACA 3SDJA 2QKRA 2R0IA 3DBFA 4ANNA 2I0HA 3UC3A 4ZSAA 2Z60A 5DR6A 1PXOA 2W96B 2BTRA 3O23A 4EEVA 4EYMA 1YWRA 3D7TA 1ZY5A 5C27A 5HCYA 5GZ9A 3AT2A 3RALA 4YTHA 1FVRA 3Q6UA 2Y6OA 5AP0A 3CJFA 3MSSA 3QWKA 1YXXA 1ZRZA 4IZAA 3W8QA 5LWNA 4G6NA 4FIGA 1BL7A 4I94A 3D0EA 5HESA 3VWAA 3U6HA 2C1BA 4IH8A 3C4ZA 5HD7A 2CSNA 4M0ZA 5AR4A 3PIXA 4DN5A 3GBZA 1Q24A 3IK3A 3HL7A 2OIQA 3COIA 3G6HA 3S4QA 4QQJA 5EYDA 1J7UA 2F7ZE 3ANRA 4G16A 4CD0A 3DXQA 5IKWA 2WNTA 4OTIA 4W4YA 4DGNA 4O91A 1RE8A 3R04A 5FTGA 4DCAA 4FTTA 3HV3A 1W98A 4FSQA 5AIRA 5DRBA 3BBTB 4CMTA 2BDFA 2J2IB 5L6WL 5HLPA 4J7BA 4KS8A 4TT7A 4XV9A 4E5BA 1A06A 3QKLA 3CLYA 4EOSA 1F0QA 2XNEA 3DBEA 3KVXA 4JDKA 5FDXA 4F63A 3LFSA 4Q9SA 2YM7A 3D9VA 3HZTA 3PY3A 2O64A 3BEAA 4ZY5A 4JNWA 4E5AX 3PVWA 5FWKK 4D0XA 5K4JA 2I0EA 2VV9A 4CFMA 1J7LA 3NUAA 3LHJA 1XWSA 2BIYA 3K5UA 3R73A 2YM5A 4RJ6A 4RIXA 2IG7A 3IPHA 2OJGA 5D7VA 1FMOE 3QL8A 1CM8A 4W9WA 2QC6A 4OTFA 5FEDA 4EUTA 4TYIA 2B54A 3MPAA 3EKNA 4FOCA 4GT3A 4XRJA 4ZJJA 3VHEA 4ANMA 4CRSA 3DQXA 4F70A 3BLRA 4RFMA 3A7IA 3EIDA 5IEXA 3P78A 1ZY4A 4D4YA 3LCOA 3NYNA 3UNJA 5CF5A 2B52A 4FKRA 2QOLA 4FUXA 3BGPA 4XP2A 5KBQA 4DTBA 4I41A 4V0GA 1RDQE 2UW5A 4HVSA 5BNJA 1PXNA 5GNKA 3P5KA 4A9YA 5K9IA 4FEXA 1VJYA 2PL0A 4FICA 4GSBA 3WARA 3BX5A 4BTJA 1KWPA 3NAXA 2RKUA 4F9WA 5IQBA 4DA5A 3LJ2A 5HICA 3ID6C 4F7JA 4J71A 3KXXA 4IANA 4F9CA 2UZEA 3FSFA 3I7CA 2ZV2A 4L3JA 4C02A 3TKHA 1S9JA 3EKKA 2C5OA 2J90A 2W1IA 4G3CA 4FSZA 3MVHA 4PTGA 4ZSGA 1H1RA 3QD2B 1FGKA 1BYGA 5JFWA 3BHTA 4F0IA 4RQVA 3ORZA 4K6ZA 3DXPA 1RJBA 3HRBA 3U6IA 4OTHA 2VTOA 1U5QA 4JIAA 4BBEA 2VTTA 2X6EA 5FXQA 2RFNA 5HEZA 1TQIA 3LW0A 5M09A 4FKTA 3V01A 3HV7A 4IX4A 4PDYA 3FLYA 4K2RA 2H96A 2OFVA 4RJ8A 4F09A 3T9TA 3ZSHA 4BDKA 3HMIA 4YJNA 3RMFA 3TNPC 2IO6A 4B99A 2BRMA 2RSVA 2XH5A 4YZMA 3UPXA 3VS3A 3VS2A 3E3PA 4M7IA 3FZPA 1M17A 4NJDA 2YABA 3SRVA 3UG1A 3NYOA 3KRRA 1J1BA 5E8VA 5E8XA 3R83A 1ZXEA 2R5TA 2CLXA 5HCXA 4LMNA 2WU6A 4L53A 4ZZMA 4ANQA 1REKA 4EQMA 4YHFA 2WTIA 3CY3A 1GZNA 1H24A 1UU3A 3B8RA 3F2NA 3FMJA 3R71A 4FZ7A 4IQ6A 4QP1A 5HO8A 4PDOA 3ORIA 4E6QA 3BHYA 5KKRC 2PVRA 2R7IA 4G1WA 4TYEA 4W4WA 1B39A 3QKMA 2G9XA 2HYYA 3MH1A 3EFLA 3NUUA 2OH4A 1XH5A 4ANOA 1W82A 1LEZA 2C3JA 2EB2A 2ZAZA 4D4RA 4DC2A 3ITZA 4FEUA 5I9ZA 4BCGA 1NVSA 3HV5A 3RK9A 4FI1A 3RGFA 4EOJA 1CKPA 2XIZA 4LRJA 2F49A 3NUSA 5ANDA 3QTWA 3FWQA 2VX0A 4F9AA 5HIBA 2ITOA 2J0LA 4EHGA 5BUEA 2C6TA 2PE2A 5LVNA 5JH6A 3LPBA 3EWHA 1FQ1B 1E1VA 2GMXA 4FNWA 4ZTSA 2W9ZB 5ACBC 3TG1A 3QU0A 3FI2A 4MWHA 4A7CA 4ALWA 1J1CA 4EI4A 5AUTA 5BX0A 5JMSA 5DMZA 4H05A 3NUPA 4ACHA 5HKMA 1MUOA 4RA4A 4EOLA 5H3QA 1B38A 1BUHA 1JKLA 3O8PA 4YO6A 4F6SA 5CEKA 3VIDA 5ICPA 5BPYA 5I9VA 1LEWA 2XYUA 2IZRA 3G9LX 3LXPA 4U43A 4D2WA 3NW5A 4EK8A 1I09A 3DB6A 3OWLA 5LARA 3R7YA 3KXMA 4OTGA 3V51A 5AWMA 3R1NA 3GU7A 3VS5A 4BIBA 2W1ZA 4ZTHA 5L8LA 2JKQA 2W06A 2JFLA 4DEDA 4QMWA 3VF9A 1XBBA 3ZBFA 5LVPA 3QXPA 1FGIA 3FV8A 3QRTA 4X2NA 4GYIA 4BZDA 2XCHA 3T3UA 3QUPA 4FV1A 4OBQA 1REJA 2J7TA 3NW7A 5B2MA 5CENA 5BMSA 4J99A 3ACKA 3GFWA 4YJOA 3VBTA 3JXWA 4YJTA 4PPAA 3GU5A 2JFMA 3UJGA 1OUYA 1SNXA 1Q8UA 2GNIA 3DAKA 3DS6A 2PZIA 2CCHA 4MX9A 1CTPE 4PTCA 4IFCA 1KE7A 1Q41A 1DAWA 4HZSA 1M14A 5FBOA 4BY9E 2XJ1A 4EOOA 4BYJA 4XOZA 3A7JA 2R4BA 2HZ4A 4WG4A 5K3YA 2UZBA 4F7LA 3T3VA 3PLAE 5CSHA 3NLBA 4C7TA 3MA3A 4XOYA 3QX2A 2HOGA 4GFMA 1BKXA 3QTUA 3I60A 1YHSA 3IO7A 4XV2A 5CF8A 5EM6A 1CKJA 4XCUA 2VTPA 1OPJA 3GXLA 3OEZA 2G01A 3FLSA 4CMOA 3Q96A 4BKZA 4WRSA 3D5WA 3I81A 3QGWA 4GH2A 1O9UA 3RVGA 2UW9A 3UIBA 4UZDA 1CDKA 2J5FA 4JRNA 2JKKA 4QP4A 4AG8A 4E3CA 1Z9XA 3CBLA 1U46A 2BPMA 3R1SA 3C7QA 2UZLA 5AUWA 3I79A 5EDQA 4QMNA 4QMYA 2JKMA 2W7XA 3ZLSA 4NSTA 5FRIA 5A54A 3F3ZA 3JPVA 4WA9A 2BKKA 3QBNA 2GDOA 5JZNA 3UE4A 4IWPA 4IX3A 4UALA 3U4WA 4EK3A 5CYIA 1MQBA 5IDPA 4CCUA 5IEVA 2QI8A 3PP1A 1PMVA 3QALE 3V5QA 3BLQA 3FZ1A 1KUTA 2E9NA 1IASA 3BE2A 4IVCA 5JGDA 3BWJA 4NL0A 2QOOA 4K9YA 4BDHA 2PVLA 3L9MA 3NDMA 1GZ8A 3FI8A 1KOAA 5EDRA 4TWOA 3PXZA 3BWFA 3EN6A 3VN9A 4HYUA 4CKIA 1RW8A 4FYOA 2HWOA 2WMVA 4I0RA 4E6DA 5H8BA 4DEAA 4E73A 3HGKA 5HQ0A 4EZ5A 5L2IA 2XK4A 1OI9A 4BCJA 2YIWA 4GJ3A 1UNHA 4IAYA 4BCOA 5JRQA 4IW0A 2QQ7A 3KXNA 5A6NA 5KO1A 3BYUA 3UOJA 4RJ7A 2VN9A 2WQOA 4FL1A 4PP9A 3P1AA 3P08A 5M53A 3KU2A 4C4GA 4IAFA 4YUQA 3B2TA 2O63A 4ZTMA 1NW1A 4BRXA 3OXZA 4AW5A 2W1DA 5K0KA 3OY3A 4BC6A 4L46A 4YJUA 3ZLXA 1A9UA 1M7NA 4TN6A 4W4XA 4WO5A 5HVYA 4XEYA 5JGBA 4IDTA 3BBWA 4KBAA 4ZJVA 5K0XA 4ZTLA 4I0SA 2ZJWA 5E90A 1W8CA 1WVYA 2P33A 2DS1A 2UZWE 2QG5A 2CN8A 4TL0A 4D2PA 5C9CA 2GCDA 2EXEA 3DKCA 3H3CA 5BYYA 3OHTA 4ACGA 1Y6AA 3KVWA 3QRUA 3NCZA 4EL9A 2J0MB 3CPCA 2PPQA 2W17A 4XG8A 4BFMA 2VTIA 2YCQA 4C36A 3LFEA 3WF5A 5C26A 5IA3A 5HVJA 3BV2A 4ARKA 3F82A 5C8MA 3BQRA 2GQSA 4OTPA 2RF9A 3F9NA 1NVQA 2JDVA 1P14A 2UZNA 2DWBA 2QHMA 2X7OA 3QKKA 4MBLA 5CWZA 3HUCA 4KKGA 2NRYA 1PMUA 3IS5A 5EI2A 1Q5KA 3MBLA 3WZKA 4EZ7A 4EUUA 4RFYA 5EQYA 3QQUA 1P4FA 3HP5A 1H07A 3PWYA 3D14A 2OXXA 2YIRA 3F66A 4NM3A 5J95A 4W8DA 3SXFA 3ACJA 2EUFB 2IVSA 2XRUA 2C3KA 4FKPA 4I23A 4I3ZA 4AT3A 5IA2A 2NPQA 5AADA 5IDNA 2QURA 4O96A 4DBXA 4FSTA 5KMNA 2OI4X 3QLFA 5AMNA 4EH2A 4N6YA 3ORPA 4QMVA 5JFXA 4YLKA 5M51A 2WKMA 3D15A 2G1TA 3CC6A 3O71A 4XP0A 5AM6A 1YOJA 4HVGA 4YTFA 5IH6A 4C3RA 2ITUA 3A4PA 3F7ZA 4QP7A 5CVGA 2GNLA 4FSYA 4BHNA 5HG9A 2OWBA 4DEEA 2VTJA 3AOXA 3PVBA 1T45A 3CTQA 3CS9A 4DGLC 2HXLA 4CLIA 3ELJA 3RPOA 4L44A 4UEUA 3DXNA 4CG8A 4RRVA 2HXQA 5EOBA 3RCJA 4O7SA 3H10A 5G1XA 1OKWA 3CCNA 4ITJA 5GJGA 3VBYA 5DVRA 2PTKA 4FZFB 4I4EA 2IVUA 4RWIA 5FP6A 2WMBA 2W5HA 4RJ3A 2XJ0A 4YZBA 3ZRKA 4A9SA 1VYWA 3LQ3A 3KXHA 4YZCA 2JITA 1BL6A 4IXPA 2IZSA 3GT8A 1U5RA 4J8MA 4EOKA 3NNUA 3G5DA 4JDHA 4RA5A 3SA0A 4XUFA 5GJFA 4G5PA 4S33A 2X6DA 1WVXA 3ZM4A 2PMIA 3LIJA 4BDEA 1SNUA 1R39A 2GQRA 4BCNA 2GHGA 4PP7A 3UOHA 3I4BA 3ZO1A 4BCQA 3D4QA 3PSDA 2YZAA 3FHRA 1V1KA 4FT9A 3UZRA 4FIIA 2UV2A 2EB3A 3G9NA 3CP9A 4JDIA 5ETFA 5EW9A 4NTTA 3ZDUA 4HVHA 3OT8A 1OL2A 4ZTQA 2VO6A 4DAWA 1OBDA 3IECA 5J9LA 3WI6A 4ALUA 4EH6A 2YLFA 3HAVA 4NM7A 2B9HA 3QHRA 3W2RA 4QRCA 4EQCA 5KMMA 3Q2JA 2WOUA 2QD9A 2PU8A 3AC4A 4J52A 4QP8A 3QCQA 3GCQA 3FQSA 3DDPA 2BMCA 4EOMA 4D2SA 4NFMA 4U42A 2JGZA 3GB2A 4KUJA 2YCSA 4MD8E 5A6OA 4FA2A 2YIYA 3SQQA 2WTCA 2FYSA 3MW1A 5GHVA 3IDBA 2C6MA 2IW8A 1APME 5ANKA 3ZSIA 5IQEA 2PK9A 3TZ7A 2XM9A 4BGGA 4UMTA 5CXHA 4A9TA 5KHWA 3Q4UA 5HU9A 2I0YA 1H0WA 3CGOA 2UW0A 2C4GA 3D83A 3FQEA 3QTRA 1YVJA 2NRUA 1G3NA 4CKRA 3AGMA 3FKNA 2XK7A 2XRWA 3PWDA 5DFPA 3R02A 4FSNA 3V3VA 4FEVA 4FK3A 2QU6A 3I6WA 5LMBA 5J7BA 3LXNA 2X9EA 2ZM3A 4G17A 5A9UA 2BUJA 4EH4A 2C6DA 1OVEA 3ZRLA 3U54A 4JQEA 3UBDA 3ZXZA 1WBPA 3M42A 1DS5A 3MVLA 4PMSA 1PXIA 4AGUA 3B8QA 3RBWA 4EC8A 4X3FC 5TE0A 3MFUA 2FSLX 1UV5A 3MH3A 5D9HA 3TDVA 3FMKA 4CGAA 3RAWA 4AAAA 1K3AA 3FZTA 2OG8A 3HX4A 4FG8A 4CYJA 3WF8A 4F7NA 5HX8A 2X8IA 5IQGA 1KV1A 1YKRA 4IADA 3QTIA 2I0VA 5FTQA 3N4VA 3DLSA 4MNEA 2OH0E 3GFEA 1Q8YA 1UVRA 2Y4IC 1ERKA 3DCVA 5AR8A 3PP0A 4F0FA 4KWPA 2C47A 3H9OA 3Q9XA 4J95A 2B53A 5I9XA 3PIZA 5EM7A 3C5UA 1NT2A 4B8LA 2BIKB 2WMTA 3SOAA 2ZOQA 2O0UA 1E9HA 4QYGA 4M69A 3VNTA 2PULA 2WIPA 3RM7A 4FTJA 3MPMA 3TV4A 4PL5A 1GZKA 4EHZA 4M84A 4BI2A 5EFQA 4PMMA 5JRSA 4UZHA 4L9IA 2P0CA 3GI3A 1GY3A 4TXCA 4N57A 1H01A 2BVAA 4KINA 2VRXA 4NZWB 3BCEA 3NWWA 1PMEA 5K5NA 4BI1A 4HNFA 4DG0E 2X2MA 2UW4A 3D2KA 4JAIA 4GK2A 2VAGA 5C8KA 3T8OA 2ITXA 4GT4A 4I20A 4WG5A 1AQ1A 3H0YA 2QO7A 1YXSA 3IDCA 4UBAA 5LMKC 3NIZA 4ANLA 5CALA 3I1AA 4H39A 3UO4A 1YXUA 3SGCA 4FKGA 4YTIA 4XLVA 4XNEA 3ZYAA 4BCFA 4Y46A 5AM7A 3LQ5A 4ZSJA 4F65A 4FODA 5HGIA 2X1NA 3P23A 4F6WA 4JBOA 4WOVA 2QOCA 2VTSA 5AV3A 1IAHA 3M2WA 2W0JA 1JNKA 4RIWB 4AN2A 4KABA 3CPBA 4CT2A 2VTLA 3R8ZA 4CKJA 3SG8A 2YISA 2WZJA 2OKRA 1IA9A 3OCGA 4RLKA 5CVHA 4MTAA 3CTJA 4C62A 2GNHA 3VBQA 3UODA 1O6KA 4U79A 5TT7A 2ESMA 4EK6A 4O81A 4MXZA 4IEBA 2VO0A 4LGGA 2V7OA 2YN8A 2IWIA 3FYJX 3MTLA 5FQDC 2YAAA 4I5PA 4AGWA 5DT0A 4L6QA 4BDGA 1SVHA 4I21A 1M2RA 5L2TA 1MQ4A 2OO8X 3TNHA 4H3BA 4ZY4A 3P7BA 1H1WA 4C57A 3ANQA 4WSYA 3LZBA 4CLJA 4LOPA 3ZS5A 4K77A 4FIHA 4KIQA 4O2ZA 4XJ0A 4DFLA 3DDQA 3Q4TA 5M4IA 3H4JA 4WIHA 3I7BA 4EC9A 4NU1A 1WBNA 5FEEA 3UMWA 2PZYA 5HTCA 4GFGA 5IA1A 4LFIA 3RM6A 5BYLA 3QQGA 2HZ0A 5AX9A 4OAVB 3VBVA 5E92A 3R9HA 5CSWA 5LQFA 2Y4PA 1Q62A 1BI7A 5E8YA 3NGAA 2Z2WA 1JSUA 3PXFA 4DG3E 2GU8A 2QR8A 3QQKA 4GG5A 4QP3A 3W2PA 5CLPA 3CTHA 5DHJA 5DWRA 1ZZLA 4AN3A 4B4LA 4MKCA 2UW7A 2BALA 4E6AA 4RVMA 3ENMA 4S30A 3E8EA 3Q04A 5AA9A 4AP7A 3QRIA 2BZKB 4ZS0A 3TCPA 4G9CA 2XNPA 4MXXA 5BVFA 3NVKI 4XG9A 4GVAA 3ZONA 3PPJA 5CQWA 4KIKA 2XJ2A 4Y95A 2C30A 2C6OA 5FM3A 3G33A 4YZ9A 1W7HA 3C4CA 3DBCA 3TKIA 2WXVA 1JSVA 4C38A 1MP8A 4Y72A 3VRZA 3DKGA 4O22A 4UMRA 3BELA 1WMKA 2RFDA 4F08A 4IWDA 2PVJA 4O0WA 3ZZWA 3C0HA 2JC6A 4DEGA 3OMVA 4X3FB 4X2JA 2YIQA 3LMIA 4PX6A 2OU7A 4RX9A 3R8VA 4XG7A 4PL3A 4O1PA 2R3RA 3S95A 2Y7JA 2ZV7A 3ATSA 4FTQA 3S3IA 4R7HA 3P7CA 5C8NA 2I6LA 3TV7A 3DFCB 5CZHA 2PY3A 3EYHA 3WOWA 4FE2A 1K9AA 3TZ8A 2QOIA 3OTUA 3MFTA 4A4XA 4MBIA 2UVYA 1J3HA 4OT5A 3R21A 2Y4IB 4CQEA 5IMXA 3OCSA 4GUEA 2C68A 5HNIX 5DR9A 2R3PA 4FV2A 4EORA 1M52A 5EHLA 1FOTA 3UVQA 3FXZA 4AOJA 4J98A 5C1QB 5AP1A 5AV1A 5HO6A 3FI3A 4FKVA 4DH7A 3P0MA 2GNJA 4ACMA 2VTQA 2UW3A 4YP8A 2FH9A 4IZYA 3R6XA 4OTRA 3W33A 4OGRA 4OAUC 2C5NA 4ZTRA 5FGKA 4NKSA 4KIKB 3GC8A 5IUGA 5EYMA 3R22A 1AD5A 3R7UA 1OECA 5A46A 4GEOA 2RFSA 2BAKA 1GIHA 2HWPA 4GMYA 4L7SA 4RG0A 4NT4A 4U97A 3V6RA 5C4LA 3DQWA 5BUJA 4USFA 4CTBA 1FMKA 1M2QA 2PMLX 2XYNA 5EG3A 3ZM9A 2Z8CA 4AF3A 4I5HA 5M4CA 3I6UA 2XB7A 4JVGA 5EI8A 4ERWA 2HCKA 4CZTA 5E1SA 4TY1A 4JX3A 2EU9A 4ZY6A 4M8TA 5HG7A 2AYPA 2GFSA 4JG8A 5EDPA 3ZO4A 4WKQA 4GUBA 2AC3A 2OZAB 3DNDA 4X2FA 5AUZA 5ACKA 4RX5A 4FT0A 2H34A 3DPKA 4X2KA 5CEPA 4PPCA 3U87A 5B2LA 3AC8A 5B7VA 4YNOA 4XS2A 3AC2A 4UX9A 4XV1A 3EHAA 4HCVA 5B2KA 4PY1A 4CXAA 4D1SA 3CR0A 1JKSA 4FTAA 3OXTA 2C6KA 4FT7A 5BVEA 5M55A 1PXPA 4FMQA 5HCZA 3VUTA 5K4IA 4GK3A 3GOKA 3EQDA 3LAUA 3PE2A 4MWIA 3D7TB 5EH0A 2BDJA 3IDPA 4F7SA 5J7HA 3FL4A 4XP3A 3FZSA 4ACDA 1OMWA 4GS6A 3VW6A 1GIIA 4FYNA 2JIVA 3VUMA 5IPJA 3KQ7A 4G3GA 4FL2A 4KB8A 2Q0BA 3LCKA 4QYEA 3HKOA 4RJ5A 3PJCA 1WBSA 3TT0A 4R8QA 4CZUA 1CMKE 1Q4LA 3QCYA 2PVMA 5AV4A 4DEIA 1JOWB 3V5TA 3O96A 2OXDA 3UG2A 3PLSA 1PKDA 4ASXA 4D2TA 2C0OA 3D94A 4HGSA 3GU6A 2W5AA 4E93A 2H8HA 2OSCA 4ERKA 4C58A 3K5VA 4FC0A 3KF4A 2HW7A 5EM8A 4W4VA 4BKYA 4I5CA 4WNMA 3RHXA 2V7AA 2ONLA 4AA5A 5M06A 3GCVA 4J1RA 4QPMA 3DFAA 1CSNA 3PY0A 3QYZA 4O21A 1AGWA 4OT6A 2J50A 4WUNA 3RK5A 3L8SA 4BL1A 1OGUA 1Q3WA 1Q99A 5TO8A 2C1AA 4GKIA 3MFRA 2C5VA 3SHEA 3TWJA 3ZOSA 2BILB 2IN6A 4IC8A 3EFKA 4C4IA 5IQHA 4QQ5A 2R3NA 3KREA 4EBVA 3UZPA 3MVJA 4BVUA 2BRNA 3QTXA 4RIXB 3O51A 4DH3A 4MCVA 2BFXA 2PYWA 3PJ2A 3OUNB 3EOCA 4FZAB 3N4TA 1K2PA 4F1MA 3OC1A 3AC3A 4Y73A 5AIKA 4D1XA 3QC9A 3TNQB 3EYGA 4V0GB 4DGMA 4RWKA 1WBOA 3U55A 3GGFA 3OD6X 4FTOA 4O0RA 4P4CA 4B8MA 2C3IB 3ROCA 4V01A 3GC9A 1P5EA 2QR7A 4U9AA 5KMJA 1ZMVA 2H9VA 3FMDA 5IQDA 3MB7A 3DOGA 4BCMA 4AE9A 4UWYA 4WRGA 5EQPA 4UYAA 2X4ZA 1Q61A 4DLIA 4UMPA 2ZMCA 3C1XA 3FSKA 2AUHA 2OF2A 2XBAA 4JQ8A 4CZYB 1M7QA 5AUUA 4IM0A 2HW6A 2VU3A 4L01A 4AQCA 5LXMA 3TNIA 4LM5A 4FV4A 2PMOX 2P2IA 3KRLA 4BTMA 2VTRA 4HNIA 4I6QA 4O0XA 3FXWA 4XV3A 2R3KA 2QG7A 4UXLA 1X8BA 1OIRA 2X81A 4GFOA 4U40A 4L7FA 5CQUA 2W1HA 2WHBA 3DBDA 3PXKA 2XIXA 5CF4A 4E4LA 4FIEA 3VS7A 4P5QA 4YZDA 3LFCA 3VUDA 4G3DA 3SRVB 4CQGA 3VJOA 4ZMEA 2JDTA 5E7RA 3BU3A 5J1VA 5DH3A 2A1AB 5HU3A 4DGGA 3AD4A 4GKHA 1OUKA 1XO2B 3EN9A 5JFSA 3GNIB 5M4FA 4P90A 2ITZA 3QXOA 1F5QA 4M97A 3D5XA 4W9XA 5DI1A 5FD2A 4D55A 1UWJA 3H9RA 4R3PA 4UV0A 4IVBA 4ZOGA 3SAYA 4G6LA 3TTIA 5A4EA 3R1YA 2WOTA 4C8BA 2Z7SA 3NNWA 3GCPA 3VUGA 3ZXTA 4E5WA 3S2PA 1G5SA 3C50A 1ZAOA 4OLIA 5CVFA 3TJDA 4BF2A 5CAVA 2R3GA 3P86A 1HCLA 3BYOA 5T3QA 4X21A 4Y5HA 4CVAA 1T46A 4QTEA 2A0CX 4C4HA 2OJFE 3DK6A 4HW7A 4ZIMA 4M68A 1LP4A 2W1CA 1IA8A 5DT3A 2V62A 3WIKA 4Y85A 5CX9A 4FSMA 4YZNA 4O84A 1YI4A 3OEFX 3VVHA 1PY5A 4NFNA 4NUSA 2PHKA 3GQIA 4WNKA 4DEBA 4DFUA 3RNYA 1MRVA 5L2WA 2REIA 4CSVA 2I40A 2ITNA 1HOWA 2F57A 4MQ2A 2E9OA 1STCE 1WVWA 4LL0A 4EH7A 5D41A 2QO9A 4Z16A 5CZIA 1JAMA 3TTJA 5AUYA 5KMOA 3VUHA 3KXGA 4IIRA 5JFVA 5IQAA 2VD5A 2ITQA 3QCSA 4CFFA 3KB7A 5A4TA 3CJGA 3AG9A 4BDAA 3LFFA 4FUYA 3TDWA 4RWLA 2BZJA 4XMOA 3Q9YA 4TTHB 3F69A 4O82A 3PYYA 1IAJA 5CT0A 3II5A 5I5ZA 4E7WA 3WZJA 2XIRA 3CD8A 2FB8A 4QTBA 4EOQA 3MPTA 1U59A 2J0KA 3N9XA 5EM5A 1SZMA 2HY0A 3R28A 1OIUA 2GQGA 3OFMA 4MQ1A 5AP4A 2UZUE 2XP2A 3TNWA 2GS2A 2VNYA 4YC6A 3SD0A 4XYFA 5EI6A 4JAJA 2YWVA 2X7GA 2JIUA 4R1YA 4JQ7A 5DOSA 1JSTA 1GZOA 3LCSA 2BROA 3R9RA 5GIPE 4KNBA 4C34A 2GNFA 3WE4A 1PKGA 3W32A 3ET7A 1WBTA 3L9PA 4FTIA 1YI3A 4PTEA 3EZVA 4C37A 4WBBB 4R5YA 1XBAA 3Q4CA 5BVNA 2VWZA 3DJ7A 3OXIA 4M14A 2V22A 2BAJA 3K3IA 5AUXA 4F4PA 1R1WA 3TJCA 5GZ8A 2V0DA 2P4IA 1IRKA 5HG8A 1Y91A 3R8MA 3CQUA 1J91A 2GS7A 4DFXE 5E91A 5I9YA 4D1ZA 2JDOA 4FL3A 4EJNA 3RNIA 1PRYA 4ZZNA 1Y8GA 2UW8A 2YJSA 4DEHA 5HNGA 2Y8OA 2YEXA 3COKA 4RQKA 3QQJA 3UYTA 3NZ0A 3SOCA 4K18A 4PF4A 4RBLA 5HE3A 5HIDA 3A7FA 1JPAA 2WEVA 2Z7QA 3E88A 4ASEA 2ITYA 5HNBA 4AT4A 2Z02A 1OPKA 4BDBA 4U6RA 3FLZA 2PZ5A 1ZMWA 4IHPA 3PG1A 3Q32A 3WIGA 3R7GA 3V5PA 3N4UA 2CKEA 5D10A 3NRMA 3OCBA 5JGAA 3CKWA 5J5SA 5A14A 3H0ZA 4QPSA 3OTVA 4I1ZA 4RIOA 3WF9A 2B9IA 3RKBA 2GPHA 3OP5A 3A7GA 3G0FA 4OTQA 5DYJA 3SW7A 2PUIA 2BRHA 3F3VA 4R7IA 3EQFA 1W84A 2UVXA 4JXFA 4JX7A 1UU7A 1OPLA 3SVVA 4DTAA 1Q97A 4YBJA 4O83A 2X4FA 4N6ZA 2QODA 4QMLA 1YDTE 4FVQA 3Q6WA 2C6LA 3KK9A 2XK6A 4R78A 4KKEA 3BGZA 5C01A 5I9WA 2X7FA 4KAOA 4GYGA 4EOIA 2OGVA 1QL6A 3IGGA 2FA2A 3E3BX 1VZOA 3POOA 2UUEA 2W4JA 3KC3A 3LOKA 3QFVA 1B6CB 2BKZA 2XEYA 4RJ4A 4QMTA 3WZDA 4EJ7A 4FV9A 5CANA 3F2AA 4JT3A 4OW8A 4ID7A 3KFAA 2IW6A 3BKBA 4MXAA 4EONA 5E4HA 4DFNA 2A2AA 4MXYA 4A4LA 4HGTA 3TACA 4TYHA 4I5MA 2CNVA 3BIZA 1FINA 4FKOA 4XG2A 4JL9A 1G8SA 2GSFA 3ZH8A 2A27A 5HE0A 4M0YA 5M57A 3IW6A 3FJQE 3HEGA 3V8WA 1O6YA 3CQWA 4ITIA 4L67A 5JQ8A 4NM5A 4KBKA 4PPBA 4NW6A 2WMAA 1Y6BA 2VWUA 4AACA 3FEGA 3U8WA 3CGFA 4MF1A 5L2QA 2W4OA 2XA4A 4HCTA 4YPDA 3DK3A 4EYJA 3EN4A 4GU9A 5EKOA 2X2KA 3BU6A 3EFJA 4ZAUA 2JAMA 3HMPA 3V04A 4RSSA 1URWA 3BEGA 4IZ5A 4LRMA 2VX1A 3P9JA 4JR3A 3HRCA 5AFVA 3O17A 2XS0A 1DI8A 2YCFA 3M11A 4USDA 2PZPA 3ALOA 3I0OA 3NCGA 4KSQA 5CEMA 4NK9A 4RT7A 3W2QA 3TEIA 5CU3A 1ZYDA 3PXRA 4K0YA 4JIKA 5HI2A 3BE9A 4AGDA 5ETCA 4AA4A 4BWKA 4PMTA 2R0UA 4EWQA 4TWPA 3MJ2A 4QQTA 3BRBA 2WELA 3IG7A 3K54A 4PDSA 2OJJA 5KMKA 1W83A 3VC4A 2PVKA 4A4OA 3EB0A 3LJ0A 2JD5A 3KEXA 5EW3A 3ENHA 3FAAA 4U41A 4QP2A 4AW2A 4EHVA 1Z5MA 2F7XE 3A8XA 3QYWA 4M3QA 4XBRA 5HZNA 4WD5A 4RIYA 4FF8A 5A4QA 2ETMA 3DKOA 3OT3A 4K8AA 4MYGA 5F1ZA 5BYZA 4UMUA 5KMLA 3OWPA 4EOPA 2R3MA 1Z57A 2XVDA 4YR8A 5AEPA 2B9JA 3MA6A 2ZM4A 4RX8A 3UC4A 4P2KA 4BKJA 2HAKA 3K2LA 2KULA 1SVGA 3QZIA 4RZVA 1QPCA 2ZDTA 3RAIA 3S1HA 4JLCA 5DEWA 3E8DA 4IAIA 2R3HA 4FSWA 4L68A 3AT4A 4BTFA 3V8TA 5HE1A 2VTHA 5ANJA 4I6HA 4JBPA 4E8AA 4NH1A 3E93A 5J5TA 1UU9A 4BTKA 1QPJA 4DGOA 3D7ZA 2GHMA 3C9WA 3PZHA 4O2PA 4YJRA 3ZLYA 4BN1A 1R78A 3JY0A 5I0BA 5L6PA 5D12A 2ZMDA 2YCRA 3NX8A 3LXLA 4YPSA 3QQFA 1UNLA 4IWOA 4AZVA 3AMYA 3BQCA 1LUFA 4ZMFA 3M1SA 4HZRA 3G15A 3UYSA 3NAYA 4B7TA 4FVPA 4E1ZA 4MHAA 2XZSA 4J8NA 4AGCA 4YHJA 3BHUA 3HNGA 2LGCA 4G6OA 4QMUA 3ZFXA 2VTAA 5CS6A 5BVKA 4BDDA 4F1OA 2JEDA 2XBJA 2XUUA 2YM6A 2J51A 3RAKA 4GIIA 3ZC5A 1NVRA 3PJ1A 3Q9WA 4IWQA 3NR9A 1PW2A 4FVRA 4FKQA 1UNGA 5HBHA 5J8IA 4EK5A 2C0IA 2VGPA 3KULA 5BVWA 3HA8A 3OG7A 3IOKA 3RP9A 3ZEWA 5H9BA 2WAJA 4PNKA 5HVKA 1ZZ2A 4H1MA 5I3RA 4M15A 2CGVA 4O0VA 4H36A 3AGLA 3NSZA 4ZTNA 3C0GA 3OW3A 3KRJA 2XNMA 1OKYA 3V5JA 2BR1A 4ZK5A 2C6IA 2J0JA 3EN7A 3FHIA 5AAEA 1J7IA 3LLTA 4BCHA 4Z7GA 3RTPA 1OB3A 4AFJA 1L3RE 2FO0A 5IU2A 3GVUA 1XBCA 4C2WA 4O7WA 3MH2A 4NIFA 4HVDA 1P4OA 1QMZA 4TWCA 5JSMA 2ERZE 3UQCA 2VGOA 1Y57A 4Q9ZA 4O1OA 5CAUA 4UYNA 4QMPA 5IQFA 2G15A 1TVOA 1BLXA 2AC5A 2WIHA 4RC3A 1PJKA 3FZOA 1ZYCA 3R2BA 5IEYA 4KKHA 4ZEGA 3W16A 4RC4A 3E8CA 2OW3A 3QTQA 4IVDA 4WG3A 3BHVA 2PVNA 2WMSA 4X6QC 3FMLA 1XH6A 4BB4A 1YI6A 4H58A 3TV6A 5IZFA 4HPTE 5J1WA 3QRKA 4G5JA 3DT1A 5T68A 3COMA 2XKDA 3KULB 4HYIA 4C59A 4HCUA 1G8AA 5L4QA 5GIOE 2VZ6A 3OOMA 4FV3A 4O38A 4AS0A 3WILA 5DR2A 2OJIA 4TNDA 1XR1A 4NCTC 3VJNA 3TN8A 4DITA 4NYEA 3LMGA 3ZU7A 1JBPE 4IC7A 4C4EA 4U45A 4MNEB 5D1JA 2ERKA 3R63A 1OIYA 3HA6A 3NEWA 5EHOA 1YWNA 4EK4A 2E9VA 3E8NA 5E8UA 3OWKA 2NO3A 1H00A 4R77A 4DYMA 4FEWA 5IA5A 4F9BA 3KRXA 4M69B 4YJPA 4CFNA 4O27B 3VULA 1H08A 3W8LA 3LKMA 2WQEA 3FE3A 4X0MA 3A2CA 3ORTA 4MAOA 3JR1A 5E9EA 3NNXA 4FSRA 4BBMA 1V0OA 5ANEA 5KZIA 3REPA 3RAHA 5GZAA 5HLWA 3FKOA 2PSQA 2DYLA 3QZGA 4GJ2A 2VO7A 2BTSA 4DFZE 5L2SA 1PMNA 2WU7A 5A4LA 2XK3A 4R3CA 2PZRA 4HJOA 5HO7A 3G6GA 1YXTA 2C0TA 2WMQA 2YIXA 3C4EA 2XNBA 3L9NA 3O7LD 3ZTXA 3IKAA 3ORXA 5C4KA 5EYKA 5J87A 3RJCA 4EWHA 3BYVA 3PXYA 1U54A 3FC2A 3UTOA 4DH5A 2G2IA 3P4KA 3FZRA 2X8EA 4MK0A 4A06A 1JLUE 4P5ZA 4PWNA 3WF7A 4RVKA 5LVMA 3ATTA 2CN5A 2E9PA 2P55A 2W1FA 2UW6A 3NW6A 1QPEA 4NWMA 4FEQA 5ANOA 4FTMA 3QZHA 5J79A 3PUPA 2JLDA 3D5VA 5AV2A 2ZB0A 2PE0A 5KX8A 3NUXA 3BZ3A 4GVJA 4DCEA 3W18A 1JWHA 3V5WA 2CNUA 4C4FA 3R7IA 2UZDA 2WQNA 1WFCA 1XH4A 4MXCA 3R2YA 3ZLWA 5HBJA 3UPZA 4OTDA 4FTRA 5JT2A 3PJ3A 4NKAA 1URCA 4I0TA 4LGHA 3TI1A 3F5UA 5E8SA 2BAQA 1FVVA 4CV8A 5F95A 4ENXA 4GK4A 3R7OA 1W0XC 2WGJA 3PIYA 2KTYA 1JVPP 2CLQA 4YLJA 3TUDA 3FY2A 2WEIA 4MBJA 3ZSGA 5DRDA 2VTMA 4R5SA 4RGJA 1XKKA 2FVDA 3DJ5A 2XK9A 1ZYJA 3G51A 3VHKA 3MTFA 4YJVA 2RFEA 4XH6A 3WYXA 2OK1A 4FKWA 3FXXA 4S2ZA 3ODZX 4U44A 2ONLC 3RI1A 4F9YA 1P2AA 4QYFA 4CCBA 3FBVA 5CTPA 4ZP5A 4EBWA 4P7EA 2OIBA 3F5XA 3ZO2A 4IAAA 4O6EA 4YLLA 2WPAA 3HV6A 4AXAA 1OL6A 3LM5A 3L8PA 3FMEA 3OVVA 3F2RA 1MRUA 3A62A 3DY7A 4FKJA 4L8MA 2V5QA 4L00A 4QPAA 4HGEA 5AR3A 4S32A 4JR7A 3DA6A 1EH4A 3E7VA 4CG9A 5IUIA 1OITA 4FIJA 5J9YA 4FV6A 4D5HA 4C3PA 4JJRA 2J0IA 2YM4A 3LVPA 5LJJA 4AZTA 5BUIA 4D9UA 2OFUA 3CEKA 4JBQA 4FT5A 2WTKC 2XKEA 2OIDA 3D2IA 4CV9A 3Q9ZA 2VNWA 2XCKA 3RPVA 4RC2A 4K11A 2XNGA 3BYMA 3OWJA 5CASA 1Q8WA 1QPDA 4I93A 4HPUE 3ODYX 2PE1A 4RVLA 1XH7A 3FLQA 5E8WA 2QNJA 4DINA 3WF6A 1OL7A 4FV0A 3C4XA 5DA3A 3SXRA
chains in the Genus database with same CATH superfamily
2B9FA 3DZOA 1M2PA 2R3IA 4I4FA 5AX3A 1R0EA 2YDKA 3C4WA 3OOGA 4HOKA 2Z7RA 3ZDIA 4D4VA 4KS7A 4D2VA 3PSCA 3OROA 4WBOA 2IVTA 5HD4A 3G2FA 5HIEA 4ANBA 5D11A 1Y8YA 3VQUA 2Q0NA 4AQKA 4PDPA 3W55A 3QGYA 4QTDA 2BZHB 3F3TA 4IM2A 2QO2A 2HENA 5HG5A 2E2BA 3L1SA 3R9OA 4AFEA 3IOPA 3U4UA 2YHVA 4GIHA 5AP5A 1NY3A 3HV4A 3P7AA 3GC7A 3EFWA 3OW4A 1YWVA 1ZOGA 2CMWA 3HLLA 3Q3BA 3EQGA 5IMEA 5HE2A 2B1PA 2W4KA 4YMJA 4LV7A 4JRVA 4DFBA 5FM2A 4FTLA 4OBPA 1GJOA 3N51A 3W2CA 3LFQA 4AZSA 4FV5A 4X2GA 1PF8A 1VYZA 3COHA 5D7AA 1H1QA 2GTMA 3QA8A 4FTUA 3DZQA 3BGQA 4CFWA 3LFAA 3SG9A 4BZNA 2UVZA 4E4NA 1ND4A 4J96A 4DT9A 4LV5A 4EKLA 4GL9A 5AA8A 3S0OA 3A4OX 3HUBA 2CGUA 4PQNA 4AZEA 1PXLA 3QHWA 3ZEPA 5K5XA 5C03A 4FR4A 2UZTA 3GQLA 3THBA 3EN5A 4GCJA 1R0PA 3F3UA 1BMKA 2X39A 4WNPA 4QMOA 3R0TA 4ALVA 5EK7A 5FDPA 4F99A 4L45A 1KE8A 2XK8A 2Y6MA 3FQHA 4I6BA 4JS8A 4LYNA 4FKIA 2VWYA 4U8ZA 5FLFA 3E92A 1ATPE 5H8EA 2P2HA 4E26A 4AWIA 1OKZA 3UNZA 4U80A 4GRBA 2CGWA 4V04A 1VEBA 2W99B 4FV7A 3QCXA 4C35A 4EHEA 3S00A 3EL7A 3QQHA 5AP3A 4N4SA 4AW1A 5AP7A 3OY1A 5ETIA 5KUPA 3AKKA 4YBKA 5L6OA 1OL5A 2R2PA 4WT6A 3UO6A 2YA9A 4DHZA 2E9UA 4TYGA 3QD4A 5LOHA 2Q83A 4PMPA 3CQEA 4O0SA 4OBOA 3VS0A 2VWXA 5M44A 3Q2MA 1H1PA 4BBFA 1TQPA 3MY5A 1H27A 3R9NA 3SLSA 4G3FA 3KN5A 3QUEA 3A60A 4K1BA 1SVEA 3DGKA 3R8LA 2R3LA 4AXEA 4N70A 2EXMA 4F6UA 3O8UA 1LPUA 3E5AA 5DGZA 1CKIA 5HHWA 2J9MA 3KY2A 4LGDA 4O0TA 2WMXA 1YDRE 3R01A 2NP8A 4JI9A 3VBWA 4DHFA 4FIFA 4Z7HA 2XARA 5CI6A 3SC1A 2PVFA 4EH5A 5IISA 2G2FA 2HK5A 2YACA 3MGYA 5HTBA 2XALA 3VW8A 4O7LA 2VWWA 3FPMA 4FBXA 4AX8A 3O50A 2EXCX 5JK3A 2YERA 4OUCA 4BDJA 3W0MA 3DLZA 4CYIA 2R9SA 3I5ZA 4JG7A 1YQJA 4HYSA 5LCJA 4Z55A 4LOQA 2ACXA 3QD3A 3QWJA 4BWPA 2W1EA 5F4NA 3ORMA 3AD6A 5BMMA 5M07A 2F7EE 4G9RA 2G2HA 4IB0A 4NW5A 2YJRA 4XRLA 5CU6A 2WTKB 4LUEA 2VWVA 2IZTA 3FMMA 4GG7A 4CT1A 5LWMA 1UWHA 3PVUA 4FG7A 2X8DA 4PUZA 4DLJA 4XHKB 3FDNA 3ORNA 5AJQA 3H9FA 4NM0A 2P3GX 3KGAA 2I1MA 3D5UA 3DK7A 3LE6A 4H1JA 5BQ0A 2SRCA 5HORA 4MNFA 4KD1A 4V05A 3TXOA 4Y8DA 4JG6A 3BYSA 3GC0A 3HECA 2QKWB 4TPTA 2CGXA 4IZ7A 2JBPA 3RINA 2IJMA 4LOOA 3R30A 3CXWA 2ITWA 3BHHA 3GENA 4B6LA 5FEQA 3NVMB 1PHKA 4I6FA 4IX5A 2WFYA 3QAME 4IB1A 3AD5A 2WMRA 4LI5A 3MDYA 4O0YA 2ZVAA 3UGCA 2PVHA 5EQEA 3BI6A 3NUNA 2ITTA 3HMNA 1KE6A 1SYKA 3OCTA 5CNNA 3OZ6A 3GCSA 1BX6A 3PA3A 4MEDA 3A7HA 3O7LB 3U9NA 3VO3A 3CSVA 3RCDA 2QVSE 4C0TA 4FNXA 5AP6A 3TZMA 3ZCLA 2B4SB 4DHJA 4YC8A 3FYKX 3L8XA 4H3QA 4IJPA 2BRBA 3NIEA 4UMQA 4YTCA 4RMZA 3C51A 4RZWA 4S34A 4DE4A 2O65A 4I24A 3FC1X 1JQHA 3FUPA 4FOBA 1DM2A 4CFVA 4J97A 4YJSA 3Q60A 3HP2A 4FKLA 4YSMA 1PXKA 5DNRA 5H2UA 2F9GA 4XG6A 4D0WA 4QEBA 4QQCA 5KNJA 1TKIA 5CSXA 3UQFA 5E8ZA 4D2RA 1PYXA 3MV5A 3R7VA 2O2UA 4BIDA 3WZUA 5EKNA 2PUPA 5CY3A 3MYGA 4TRLA 3IW8A 3NUYA 4XG4A 4AXDA 5G6VA 3LMHA 4YHTA 5CEQA 3EQIA 4CFXA 2VTNA 3RHKA 1E1XA 3KIOC 3BU5A 1UA2A 4DTKA 1H26A 1OKVA 3EH9A 4E20A 4RLLA 4JBVA 4ZLOA 5DN3A 2ZYBA 4QTCA 2WTVA 2DUVA 3VF8A 3U6JA 5GINE 3HVCA 4L3LA 4Y5QA 5EHYA 3W0SA 3KCKA 3EZRA 3MY0A 3AMBA 4BWXA 2WTJA 3L8VA 3TIZA 4BICA 3UIUA 2X0PA 2ITPA 2FSMX 2QOFA 1H0VA 1V0BA 2RL5A 4R6VA 1H8FA 1OM1A 2BCJA 4RPVA 5FTOA 2W5BA 4AU8A 2CCIA 4TNBA 4KIOA 1VR2A 4M13A 3MS9A 2IPXA 2C5XA 1FVTA 4ZSEA 5JQ5A 5M56A 3DTCA 4QD6A 3HRFA 5AR7A 3EQRA 4S31A 2R3JA 3DAEA 2R7BA 3PA5A 2QOHA 4O0UA 5FBNC 4M66A 4TWNA 3CE3A 4OR5A 4U3YA 1TQMA 2OBJA 5HOAA 4CEGA 1ZLTA 3VUIA 4MD7E 5JEBA 4AE6A 4APCA 3EQBA 2UZVA 3ORKA 2GFCA 4CNHA 2CKQA 2ETRA 3TZ9A 3HMOA 1GAGA 1NA7A 3H30A 4BJJB 3FPQA 2IW9A 4C3FA 3UOKA 3RWPA 1XQZA 1Q3DA 2I7QA 4QMSA 5ITAA 3G0EA 3LLAA 5AP2A 3GP0A 4BI0A 4EH8A 4EH3A 2YFXA 3A61A 1DAYA 3VUKA 3L9LA 2OICA 4O7YA 2IVVA 1XH8A 3FY0A 3ULZA 3O2MA 5KCVA 4BZOA 4FZ6A 3NPCA 4E4MA 3F7WA 3UIXA 3I5NA 4ZSLA 3NNVA 5KZ0A 3RZBA 3ZRMA 2GTNA 1ZYLA 3E62A 3OS3A 3C0IA 3PXQA 5KKRB 4KSPA 3CKXA 3IW4A 1IG1A 2JDSA 3QQLA 2R64A 4QMXA 5LCKA 2DQ7X 1ZOEA 2PWLA 2VX3A 3KL8A 2JBOA 2YM3A 3B2WA 3QA0A 5DE2A 4CTCA 5CEOA 2YITA 5IG1A 3TIYA 3IONA 3HMMA 1GIJA 4IAZA 4ITHA 5HTIA 4D9TA 3CD3A 3QD0A 4FTKA 3RPYA 4BDIA 4Z9LA 4AZWA 2CKPA 5AR2A 4KBCA 3OBGA 4QOXA 5E1EA 2PUNA 5B0XA 5H8GA 1SMHA 4QMZA 5CT7A 5KHXA 3POZA 3W10A 3ZO3A 3QX4A 4E4XA 5CEIA 3PG3A 3ROYA 1F3MC 3A99A 2RG5A 1YOLA 3MVMA 5TR6A 2YM8A 4QTAA 4LV8A 4MD9E 3SXSA 4M12A 1R3CA 3UO5A 5A4CA 2UZOA 2YLEA 5DG5A 2WTDA 4PRJA 2R3OA 4II5A 5KMIA 4FTCA 3GUBA 3F3WA 5IH4A 4QDEA 5TKDA 5IA0A 4MH7A 4C4JA 4C61A 1XJDA 2XKCA 1H25A 1MRYA 3JVRA 5DPVA 3Q5IA 2YZLA 2OZOA 3UDBA 2QOBA 4KRDA 3JUHA 2CJMA 4UXQA 2B0QA 4DH1A 4IB3A 4BCIA 2C69A 4U5JA 4YC3A 3FMHA 3ZFYA 3MIYA 2QLQA 4D5KA 3AT3A 4BIEA 2QOKA 4L42A 4I92A 2PVYA 2XF0A 2ZV9A 3DB8A 3PTGA 4UB7A 1JKKA 5DBXA 2F2UA 4QT1A 2OJ9A 3F6XA 4Q5EA 1OBGA 4ACCA 3OF0A 3DTWA 1YHWA 4LMUA 4R3RA 2W9FB 3LCDA 2O5KA 4O7VA 2BZIB 3QZFA 3C13A 5L8JA 3DAJA 3KMUA 3VS1A 4HYHA 3JS2A 3MFSA 4RVTA 5IUHA 2J5EA 5F20A 3UZTA 3NMUF 3R1QA 5CU4A 2ZV8A 4USEA 3EQPA 3V6SA 4ANSA 3MY1A 5CF6A 2WMUA 3KMMA 2W1GA 2YAKA 2JAVA 1SM2A 2VWIA 2C5YA 3PPKA 3VBXA 3KK8A 5CAPA 4YNEA 2XANA 4UN0C 3U9CA 3P79A 5AV0A 3KN6A 4OTWA 4TYHB 4BHZA 1S9IA 2XM8A 1ZOHA 2H6DA 4Z3VA 4FX3A 1Q8TA 1ZMUA 5CU2A 3V8SA 4F78A 4EH9A 2GS6A 1ZWSA 2Y0AA 3R9DA 3GOPA 3PZEA 3W2SA 1IEPA 3HDMA 4C2VA 4TKSA 4E6CA 4ZLYA 4X3JA 3BLHA 3WE8A 1XH9A 3MIAA 4TZRA 4HGLA 5KE0A 4RX7A 4ZJIA 4IAKA 4ONAA 2B55A 2EVAA 4DT8A 4AZFA 5CSVA 2Y9QA 2WQBA 4LRKA 4XG3A 4JOAA 2PUUA 4QP9A 3T9IA 3ZUTA 3ZFMA 4AN9A 5HBEA 4XX9A 3QTZA 3ZHPC 4ZZOA 1YW2A 4QMMA 4BGHA 3NYVA 5KBRA 4DG2E 1A48A 3JYAA 5LMAA 3E7OA 4FGBA 5M08A 1KOBA 1GNGA 1WBVA 4X6RA 2ETKA 2IEWA 1KE9A 2XNNA 3RPRA 5EOLA 3JY9A 4PNIA 3VRYA 2O3PA 3KKVA 3MB6A 5LVLA 2YDIA 3IW7A 4O7TA 4A07A 4YURA 4I22A 3SW4A 4O86A 3ETAA 4W8EA 4KA3A 4K33A 5I9UA 2R3QA 5J9ZA 4LUDA 4CRLA 1I44A 2BRGA 4AW0A 5CU0A 4RIYB 3PRFA 3AC5A 1PXMA 3EMGA 2BDWA 5L3AA 3RK7A 4GT5A 3KMWA 3DNEA 2VWBA 3WZEA 3SV0A 2ITVA 4R1VA 5IA4A 4ASDA 4ZS4A 3BV3A 4G3EA 4WHZA 4X7QA 4G31A 2Z7LA 2QLUA 2FSTX 2HY81 4FG9A 1UKIA 1WZYA 3Q5ZA 4FV8A 4PL4A 4KIPA 2FGIA 1JKTA 3VS6A 4FGRA 3O8TA 4ASZA 3UOLA 3R00A 1YOMA 4Q2AA 2QU5A 4BCPA 1GOLA 3FKLA 4QO9A 5CSPA 4CFUA 2R3FA 3RWQA 4QNYA 1YRPA 4UY9A 4FSUA 4DBNA 5JN2A 4GU6A 4L43A 4L52A 3QUDA 2CHLA 3CY2A 2RIOA 1XHAA 3A8WA 4BGQA 3MH0A 3Q53A 1HCKA 5EW8A 4XBUA 3E87A 5AAFA 2BHHA 4FK6A 3QRJA 3LJ1A 5CAOA 4G2FA 3QLGA 1KV2A 4AT5A 2JKOA 4MXOA 4DFYA 2XNOA 3EL8A 4U3ZA 2X0GA 4RIWA 5BVDA 4J53A 3Q52A 2GHLA 4ZLZA 3ZUUA 4IM3A 1L8TA 2GNGA 2VUWA 4FTNA 3GU8A 2ZDUA 3KCFA 4IE9A 3NS9A 4QYHA 4AA0A 1H28A 4UWBA 1OZ1A 3F5PA 3NYXA 4FKUA 3UQGA 1LR4A 1DI9A 5ETAA 4NEUA 3PSBA 4BYIA 1VLRA 5I3OA 3TKUA 2OXYA 5IQIA 2C6EA 3SX9A 3ALNA 1ZARA 1WBWA 1H4LA 4LG4A 2BFYA 2XIKA 3ZZEA 4AUAA 4ZXTA 2IZUA 3GEQA 3LFBA 4DF3A 2HIWA 2YDJA 5TF9A 1NXKA 1QCFA 4O4FA 3TUBA 3R8PA 5CI7A 4EQUA 3UP2A 3O0GA 1FBNA 3ML1A 4F64A 3HDNA 2CKOA 4TYJA 2CDZA 4EZ3A 4NTSA 3C5IA 3CIKA 3VS4A 3IQ7A 3E63A 3HYHA 4NIFB 1UKHA 4O6LA 3QC4A 4N0SA 2C3LA 2JIIA 3KRWA 4YO4A 3TM0A 3R7EA 4IB5A 3F61A 4PV0A 5F94A 1H1SA 2WMWA 2ZM1A 3F88A 4HVIA 5E8TA 2A19B 3JVSA 2BHEA 3ZUVA 5M4UA 3GU4A 1IR3A 4L3PA 4ORKA 5I4NA 4LL5A 4F0GA 4DH8A 4U81A 3PJ8A 3MI9A 4CMUA 2A4LA 5HX6A 3EQHA 3VQHA 4F1TA 3U51A 4YSJA 4O7RA 1Q8ZA 3ZC6A 5LVOA 3OUKA 3ORLA 3I0QA 3FI4A 5L8KA 4BCKA 3EJ1A 4QNAA 3W2OA 3Q4ZA 3PVGA 5IH5A 1YDSE 5FXRA 4FNYA 4LQMA 3UMXA 1FPUA 3TUCA 3BPRA 3LM0A 2JDRA 2J6MA 3FL5A 3ZBXA 4D4SA 2WB8A 3UVRA 2F4JA 3AMAA 4NJ3A 3TMOA 1BI8A 4WNOA 4AOTA 3AXWA 5CXZA 4C33A 2OF4A 5FG8A 4Y83A 3LFNA 4FNZA 4FZDB 3LXKA 4G34A 4FT3A 4YJQA 3DKFA 5AR5A 3UP7A 5IF1A 5TOZA 3FMNA 5JZJA 2J4ZA 2VO3A 1RQQA 3LFDA 3AQVA 3KF7A 1KE5A 4X3FA 5ANIA 3VONA 2CPKE 4D28A 2OLCA 4BDCA 3LQ8A 3G90X 5AAGA 3MN3A 4BDFA 3IW5A 2CNQA 2XEZA 5DT4A 2QHNA 3R8UA 4IDVA 3OBJA 2QCSA 5FP5A 3TL8A 1OIQA 2XKFA 3UVPA 3DV3A 1OL1A 3ERKA 2ZB1A 4ENYA 2WTWA 5F9EA 3FLWA 4O7NA 5T6KA 3KA0A 1V0PA 3C4FA 4JDJA 4RFZA 2X9FA 4WSQA 3PE1A 3MESA 3PDTA 3K3JA 3UIMA 3GCUA 4U7ZA 3IGOA 1KSWA 5A3XA 4QYYA 4YGAA 1XMLA 3BL9A 3W1FA 5ANGA 3AC1A 4MVFA 4WUAA 4A9RA 4AOIA 5IQCA 2QOQA 5HLNA 2HZNA 4IVAA 4RWJA 3VAPA 1U54B 1U4DA 1UU8A 2F2CB 3DU8A 3PPZA 4H3PA 1ZYSA 4IFGA 3E64A 5FXSA 2XMYA 3UNKA 5BVOA 4KRCA 1YXVA 2HZIA 4EKKA 4YU2A 2RG6A 3DBQA 1YHVA 3PA4A 5DEYA 3EQCA 1WCCA 3LCTA 3PRIA 4Q5HA 3WBLA 2WO6A 3PY1A 5EYCA 5JKGA 4IX6A 4GW8A 4M67A 2WD1A 2XIYA 3KXZA 3RPSA 2W05A 4O7ZA 5LMKA 3RZFA 3DJ6A 5GJDA 2FUMA 5AUVA 4QMQA 5CAQA 4B9DA 4MF0A 3WYYA 4LDTA 4IJ9A 4R7BA 2B7AA 2EWAA 5FUTA 2YWPA 2OZAA 5DIAA 4A9UA 5CNOA 4XLIA 3ULIA 5DLSA 3QTSA 2NNWB 4NCTA 4U0IA 2QONA 3F5GA 2PMNX 4IMYA 4TW9A 3FLNC 2FSOX 2LAVA 3HAMA 4GV1A 4QP6A 4D58A 3PFQA 4FKSA 4IBMA 2HELA 3SKCA 1O6LA 4APPA 2X2LA 2RGPA 1PYEA 2WQMA 3ZMMA 4B0GA 2V55A 3MJ1A 1PXJA 2O8YA 1WAKA 3MWUA 3QF9A 4UWCA 3V5LA 4IACA 3SDJA 2QKRA 2R0IA 3DBFA 4ANNA 2I0HA 3UC3A 4ZSAA 2Z60A 5DR6A 1PXOA 2W96B 2BTRA 3O23A 4EEVA 4EYMA 1YWRA 3D7TA 2A98A 1ZY5A 5C27A 5HCYA 5GZ9A 3AT2A 3RALA 4YTHA 1FVRA 3Q6UA 2Y6OA 2XAMA 5AP0A 3CJFA 3MSSA 3QWKA 1YXXA 1ZRZA 4IZAA 3W8QA 5LWNA 4G6NA 4FIGA 1BL7A 4I94A 3D0EA 5HESA 3VWAA 3U6HA 2C1BA 4IH8A 3C4ZA 5HD7A 2CSNA 4M0ZA 5AR4A 3PIXA 4DN5A 3GBZA 1Q24A 3IK3A 3HL7A 2OIQA 3COIA 3G6HA 3S4QA 4QQJA 5EYDA 1J7UA 4JMQA 2F7ZE 3ANRA 4G16A 4CD0A 3DXQA 5IKWA 2WNTA 4OTIA 4W4YA 4DGNA 4O91A 1RE8A 3R04A 5FTGA 4DCAA 4FTTA 3HV3A 1W98A 4FSQA 5AIRA 5DRBA 3BBTB 4CMTA 2BDFA 2J2IB 5L6WL 5HLPA 4J7BA 4KS8A 4TT7A 4XV9A 4E5BA 1A06A 3QKLA 3CLYA 4EOSA 1F0QA 2XNEA 3DBEA 3KVXA 4JDKA 5FDXA 4F63A 3LFSA 4Q9SA 2YM7A 3D9VA 3HZTA 3PY3A 2O64A 3BEAA 4ZY5A 4JNWA 4E5AX 3PVWA 5FWKK 4D0XA 5K4JA 2I0EA 2VV9A 4CFMA 1J7LA 3NUAA 3LHJA 1XWSA 2BIYA 3K5UA 3R73A 2YM5A 4RJ6A 4RIXA 2IG7A 3IPHA 2OJGA 5D7VA 1FMOE 3QL8A 1CM8A 4W9WA 2QC6A 4OTFA 5FEDA 4EUTA 4TYIA 2B54A 3MPAA 3EKNA 4FOCA 4GT3A 4XRJA 4ZJJA 3VHEA 4ANMA 4CRSA 3DQXA 4F70A 3BLRA 4RFMA 3A7IA 3EIDA 5IEXA 3P78A 1ZY4A 4D4YA 3LCOA 3NYNA 3UNJA 5CF5A 2B52A 4FKRA 2QOLA 4FUXA 3BGPA 4XP2A 5KBQA 4DTBA 4I41A 4V0GA 1RDQE 2UW5A 4HVSA 5BNJA 1PXNA 5GNKA 3P5KA 4FRFA 4A9YA 5K9IA 1VJYA 2PL0A 4FICA 4GSBA 3WARA 3BX5A 4BTJA 1KWPA 3NAXA 2RKUA 4F9WA 3PUFC 5IQBA 4DA5A 3LJ2A 5HICA 3ID6C 4F7JA 4J71A 3KXXA 4IANA 4F9CA 4O4DA 2UZEA 3FSFA 3I7CA 2ZV2A 4L3JA 4C02A 3TKHA 1S9JA 3EKKA 2C5OA 2J90A 2W1IA 4G3CA 4FSZA 3MVHA 4PTGA 4ZSGA 1H1RA 3QD2B 1FGKA 1BYGA 5JFWA 3BHTA 2X0OA 4F0IA 4RQVA 3ORZA 1ST0A 4K6ZA 3DXPA 1RJBA 3HRBA 3U6IA 4OTHA 2VTOA 1U5QA 4JIAA 4BBEA 2VTTA 2X6EA 5FXQA 2RFNA 5HEZA 1TQIA 3LW0A 5M09A 4FKTA 3V01A 3HV7A 4IX4A 4PDYA 3FLYA 4K2RA 2H96A 2OFVA 4RJ8A 4F09A 3NFGB 3T9TA 3ZSHA 4BDKA 3HMIA 4YJNA 3RMFA 3TNPC 2IO6A 4B99A 2BRMA 2RSVA 2XH5A 4YZMA 3UPXA 3VS3A 3VS2A 3E3PA 4M7IA 3FZPA 1M17A 4NJDA 2YABA 3SRVA 3UG1A 3NYOA 3KRRA 3BLAA 1J1BA 5E8VA 5E8XA 3R83A 1ZXEA 2R5TA 2CLXA 5HCXA 4LMNA 2WU6A 4L53A 4ZZMA 4ANQA 1REKA 4EQMA 4YHFA 2WTIA 3CY3A 1GZNA 1H24A 1UU3A 3B8RA 3F2NA 3FMJA 3R71A 4FZ7A 4IQ6A 4QP1A 5HO8A 3BL7A 4AXFA 4PDOA 3ORIA 4E6QA 3BHYA 5KKRC 2PVRA 2R7IA 4G1WA 4TYEA 4W4WA 1B39A 3QKMA 2G9XA 2HYYA 3MH1A 3EFLA 3NUUA 2OH4A 1XH5A 4ANOA 1W82A 1LEZA 2C3JA 2EB2A 2ZAZA 4D4RA 4DC2A 3ITZA 4FEUA 5I9ZA 4BCGA 1NVSA 3HV5A 3RK9A 4FI1A 3RGFA 4EOJA 1CKPA 2XIZA 4LRJA 2F49A 3NUSA 1TZDA 3QTWA 3FWQA 5ANDA 2VX0A 4F9AA 5HIBA 2ITOA 2J0LA 4EHGA 5BUEA 2C6TA 2PE2A 5LVNA 5JH6A 3LPBA 3UDSA 3EWHA 1FQ1B 1E1VA 2GMXA 4FNWA 4ZTSA 2W9ZB 5ACBC 3TG1A 3QU0A 3FI2A 4MWHA 4A7CA 4ALWA 1J1CA 4EI4A 5AUTA 5BX0A 5JMSA 5DMZA 4H05A 3NUPA 4ACHA 5HKMA 1MUOA 4RA4A 4EOLA 5H3QA 1B38A 1BUHA 1JKLA 3O8PA 4YO6A 4F6SA 5CEKA 3VIDA 5ICPA 5BPYA 5I9VA 1LEWA 2XYUA 2IZRA 3G9LX 3LXPA 4U43A 4D2WA 3NW5A 4EK8A 1I09A 3DB6A 3OWLA 5LARA 3R7YA 3KXMA 4OTGA 3V51A 4DDIA 5AWMA 3R1NA 3GU7A 3VS5A 4BIBA 2W1ZA 4ZTHA 5L8LA 4DDGA 2JKQA 2W06A 2JFLA 4DEDA 4QMWA 3VF9A 1XBBA 3ZBFA 5LVPA 3QXPA 1FGIA 3FV8A 3QRTA 4X2NA 4GYIA 4BZDA 2XCHA 3T3UA 3QUPA 4FV1A 4OBQA 1REJA 2J7TA 3NW7A 5B2MA 5CENA 5BMSA 4J99A 3ACKA 3GFWA 4YJOA 3VBTA 3JXWA 4YJTA 4PPAA 3GU5A 3AKLA 2JFMA 3UJGA 1OUYA 1SNXA 1Q8UA 2GNIA 3DAKA 3DS6A 2PZIA 2CCHA 4MX9A 1CTPE 4PTCA 4IFCA 1KE7A 1Q41A 1DAWA 4HZSA 1M14A 5FBOA 4BY9E 2XJ1A 4EOOA 4BYJA 4XOZA 3A7JA 2R4BA 2HZ4A 4WG4A 5K3YA 2UZBA 4F7LA 3T3VA 3PLAE 5CSHA 3NLBA 4C7TA 3MA3A 4XOYA 3QX2A 2HOGA 4GFMA 1BKXA 3QTUA 3I60A 1YHSA 3IO7A 4XV2A 5CF8A 5EM6A 1CKJA 4XCUA 2VTPA 1OPJA 3GXLA 3OEZA 2G01A 3FLSA 4CMOA 3Q96A 4BKZA 4WRSA 3D5WA 3I81A 3QGWA 4GH2A 1O9UA 3RVGA 2UW9A 3UIBA 4UZDA 1XMMA 1CDKA 2J5FA 4JRNA 2JKKA 4QP4A 4AG8A 4E3CA 1Z9XA 3CBLA 1U46A 2BPMA 3R1SA 3C7QA 2UZLA 5AUWA 3I79A 5EDQA 4QMNA 4QMYA 2JKMA 2W7XA 3ZLSA 4NSTA 5FRIA 5A54A 3F3ZA 3JPVA 4WA9A 2BKKA 3QBNA 2GDOA 5JZNA 3UE4A 4IWPA 4IX3A 4UALA 3U4WA 4EK3A 5CYIA 1MQBA 5IDPA 4CCUA 5IEVA 2QI8A 3PP1A 1PMVA 3QALE 3V5QA 3BLQA 3FZ1A 1KUTA 2E9NA 1IASA 3BE2A 4IVCA 5JGDA 3W0NA 3BWJA 4NL0A 2QOOA 4K9YA 4BDHA 2PVLA 3L9MA 3NDMA 3UDTA 1GZ8A 3FI8A 1KOAA 5EDRA 4TWOA 3PXZA 3BWFA 3EN6A 3VN9A 4HYUA 4CKIA 1RW8A 4FYOA 2HWOA 2WMVA 4I0RA 4E6DA 5H8BA 4DEAA 4E73A 3HGKA 5HQ0A 4EZ5A 5L2IA 2XK4A 1OI9A 4BCJA 4BR3A 2YIWA 4GJ3A 1UNHA 4IAYA 4BCOA 5JRQA 4IW0A 2QQ7A 3KXNA 5A6NA 5KO1A 3BYUA 3UOJA 4RJ7A 2VN9A 2WQOA 4FL1A 4PP9A 3P1AA 3P08A 5M53A 3KU2A 4C4GA 4IAFA 4YUQA 3B2TA 4I6LA 2O63A 4ZTMA 1NW1A 4BRXA 3OXZA 4AW5A 2W1DA 5K0KA 3OY3A 4BC6A 4L46A 4YJUA 3ZLXA 1A9UA 1M7NA 4TN6A 4W4XA 4WO5A 5HVYA 3W0QA 4XEYA 5JGBA 4IDTA 3BBWA 4KBAA 4ZJVA 5K0XA 4ZTLA 4I0SA 2ZJWA 5E90A 1W8CA 1WVYA 2P33A 2DS1A 2UZWE 2QG5A 2CN8A 4TL0A 4D2PA 5C9CA 2GCDA 2EXEA 3DKCA 3H3CA 5BYYA 3OHTA 4ACGA 1Y6AA 3KVWA 3QRUA 3NCZA 4EL9A 2J0MB 3CPCA 2PPQA 2W17A 4XG8A 4BFMA 2VTIA 2YCQA 4C36A 3LFEA 3WF5A 5C26A 5IA3A 5HVJA 3BV2A 4ARKA 3F82A 5C8MA 3BQRA 2GQSA 4OTPA 2RF9A 3F9NA 1NVQA 2JDVA 1P14A 2UZNA 2DWBA 2QHMA 2X7OA 3QKKA 4MBLA 5CWZA 3HUCA 4KKGA 2NRYA 1PMUA 3IS5A 5EI2A 1Q5KA 3MBLA 3WZKA 4EZ7A 4EUUA 4RFYA 5EQYA 3QQUA 1P4FA 3HP5A 1H07A 3PWYA 3D14A 2OXXA 2YIRA 3F66A 4NM3A 5J95A 4W8DA 3SXFA 3ACJA 2EUFB 2IVSA 2XRUA 2C3KA 4FKPA