3ZEWA

Crystal structure of ephb4 in complex with staurosporine
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
280
structure length
269
Chain Sequence
EIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLSSDPTTSSKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPHRIN TYPE-B RECEPTOR 4
publication title Completing the Structural Family Portrait of the Human Ephb Tyrosine Kinase Domains
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 76
structure length 269
sequence length 280
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2012-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3zewA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3zewA01
5FBNC 4JDHA 3LPBA 4PMTA 2C3IB 4G3EA 3MPAA 3KXXA 1H24A 5HNGA 4A9YA 1T46A 2C69A 1H1QA 2R5TA 2V55A 2VWIA 2W0JA 4ANSA 5LVMA 3ZEWA 2ZAZA 3POOA 5CASA 5H8BA 3U6JA 3TUDA 2C5VA 3DXNA 2J9MA 3V51A 2BMCA 4U42A 2JKMA 2BZKB 1PY5A 5GNKA 2W05A 3OY1A 4MYGA 1YDRE 3CQUA 5DWRA 5IMEA 5DN3A 3RGFA 3QUPA 5K4IA 3KKVA 4QOXA 2J6MA 3CSVA 3V6RA 2FB8A 5EM7A 3F3VA 5DMZA 4QP7A 4ZMEA 3KL8A 4XJ0A 5KKRC 4PPAA 3UODA 1IA9A 1NXKA 1REJA 2YFXA 4UMTA 4YJOA 5BYZA 3ZO4A 2QOHA 3LZBA 2GTMA 4L01A 5KCVA 2GNJA 1U5RA 3W8QA 2Z60A 1V0OA 4HGTA 3KA0A 2I0EA 3FYJX 4YJRA 3FY2A 4FG7A 2IVVA 2VZ6A 3OMVA 4EZ3A 2PUUA 3GCQA 2E9OA 4BKYA 3IDBA 5BPYA 5K9IA 4FV4A 4A9RA 4AZFA 3RZBA 5JFXA 4DCAA 4YLKA 4GYIA 4JIAA 5HX6A 3ODZX 4CQGA 3V01A 3O51A 5IA1A 3PWDA 4DH1A 4ZLYA 2CKOA 2C6LA 1OL6A 3FHRA 3OBGA 4FYNA 4U3YA 1P2AA 5CAOA 2OFVA 5IQFA 3C4ZA 3WOWA 4RIXB 3T9TA 1L8TA 3TT0A 4C34A 2UZWE 1F5QA 3EQHA 1XR1A 3GT8A 3O96A 4O22A 3UIXA 3BCEA 3ZXTA 4C4HA 5HO7A 1UKHA 3PP1A 2PY3A 4ASXA 4C36A 4QRCA 2WIHA 3QL8A 4PDOA 4FKTA 4PTGA 5EW8A 3ZM9A 2W4JA 4BDIA 3QX4A 3RZFA 5M06A 5AV4A 1O6KA 1Y6BA 2PWLA 3D2IA 3KULB 3NCZA 4O7ZA 4F9YA 1H4LA 1Q4LA 3BLRA 4ANMA 4HGLA 4MXOA 3FXZA 3UE4A 5A9UA 3R22A 1URCA 4NJDA 4E5AX 3NNUA 4PNIA 4OW8A 3VS1A 3C5UA 4E4NA 3LCSA 1H8FA 3DAKA 5M07A 4UV0A 3V5TA 2UZVA 1XJDA 3H9OA 3ORZA 5CU2A 3RAIA 5H8GA 4BHZA 3ROCA 2B7AA 4NCTC 2PULA 3EN7A 2BRHA 4GSBA 4J52A 2IW8A 3RKBA 4AZWA 5GHVA 3O17A 3ITZA 4JG7A 3P78A 4X3JA 4BCNA 3ANQA 2BILB 4RQKA 1R1WA 5DYJA 3EQCA 4FKIA 4JDJA 3PE1A 4IADA 2HWOA 3LFCA 3SW4A 5K4JA 5LVOA 2XJ1A 4V0GB 2ZV9A 2WOTA 2I0VA 3FHIA 4I5PA 3O8TA 2JBPA 3CY3A 1WFCA 5A54A 4AS0A 4WNMA 2X8EA 2X7GA 5GJGA 2C1AA 4RX7A 4EH9A 1FPUA 5CAVA 1CKIA 3EN6A 3ZBFA 3ZO3A 3LLTA 2E2BA 3MB6A 4ZOGA 4NU1A 4ANNA 3U8WA 4EOLA 4YZMA 2B53A 3OW3A 2X7OA 2ETKA 2G2IA 4IVDA 4XOYA 2GFCA 2YDKA 3UG2A 4DN5A 4ORKA 4NEUA 3NW6A 2HZ4A 5AWMA 3RAWA 4MAOA 2GNLA 3KFAA 4OGRA 4WSQA 4WOVA 2ITPA 1YDTE 3DAJA 2BHEA 1OBDA 2VU3A 3BRBA 4FEWA 3A99A 2PVYA 4FTTA 4Y8DA 3S95A 4LYNA 2WU6A 3O8PA 5FG8A 2GHGA 3DK7A 5J7HA 2A1AB 2HK5A 3DAEA 5ANGA 3W33A 4ITIA 3F7ZA 1OZ1A 4BRXA 2XVDA 3GFEA 4EI4A 4WO5A 3LM5A 4JAIA 1OI9A 3K3JA 4LOOA 5HEZA 5DT3A 4WRGA 2QU5A 3KCFA 1G8AA 1OIQA 4QMNA 4FIHA 2OU7A 3W2QA 2CNVA 5H3QA 1TQMA 4DFYA 1Q99A 3VRYA 3KMUA 3KRWA 3DV3A 5CZIA 4O27B 4C0TA 1PKDA 3OXIA 2XK3A 4L6QA 4IH8A 5AIRA 5DG5A 3WZJA 1ZZ2A 3KREA 4HW7A 3PA3A 2WIPA 4TRLA 4D0XA 3OG7A 4BCOA 2B9FA 1VJYA 4WG5A 1GIJA 5AMNA 2CGWA 4QQ5A 4XOZA 1S9IA 3GFWA 5A14A 2WMWA 3FMEA 2DQ7X 5KMKA 3DTCA 4DINA 4OBOA 4WT6A 1Z5MA 2VX3A 1JKTA 3EQDA 2OZAA 4BTJA 3TUCA 4CTCA 5IG1A 4DITA 1Y91A 2ITTA 3OVVA 4ACCA 4LRJA 2AC3A 3N4VA 2EXMA 5D1JA 2AYPA 2XIZA 4I5CA 4YP8A 2UVXA 3RMFA 4FL2A 1OPLA 4GVAA 4AU8A 4V01A 1UA2A 4BTMA 4CLIA 4GJ2A 4EYMA 4QMQA 4I0RA 1QPJA 4RVLA 3UYTA 5DR2A 4GEOA 3MVJA 3D14A 4NL0A 5IU2A 4EUTA 2YM7A 1H00A 4FR4A 4FV1A 5LMBA 4ZJJA 3LMGA 3DY7A 2W17A 4K8AA 4EUUA 1OKZA 3OXTA 5IA0A 4QPSA 3TL8A 2JEDA 5JKGA 4DH3A 3DK6A 5HNBA 2QO7A 4IW0A 3NIEA 3E87A 3EQIA 5J87A 1WVXA 5JSMA 5A6OA 4RWKA 2W1GA 4BDHA 1VEBA 2QCSA 5LWNA 1OITA 3BPRA 3CTHA 4IBMA 2PK9A 3NUSA 4X3FB 4Y5QA 3ZZEA 3GUBA 4YZ9A 3ULZA 5LWMA 4U97A 4AZTA 4BDEA 2VWBA 1M14A 3R04A 2IG7A 1GZOA 2GDOA 3U51A 2QG5A 1JKLA 4XP0A 3LFEA 5HE0A 5CI6A 1T45A 1OUKA 2IVTA 3H30A 3O50A 3P4KA 1IA8A 2HZIA 2RF9A 3FLWA 4IC8A 4LRMA 3SXSA 2Y7JA 5CF4A 2JKQA 2PZ5A 3IW5A 3LVPA 5BYLA 3UPXA 3BYMA 5E9EA 3E92A 1O9UA 4USEA 4Y5HA 3VUHA 4GK2A 2W5AA 4UXQA 3TDWA 2YM8A 4M12A 4ASZA 1O6YA 3AGMA 3GCVA 4F9AA 2C0OA 3UZRA 3HV4A 4JG8A 4CVAA 3R8MA 4FSNA 4FSZA 3SG9A 3HNGA 3ANRA 4I6FA 3PXYA 4FOBA 3RJCA 4GK3A 3PVUA 4O84A 2R3OA 1TQPA 1Q41A 4ANLA 4UWYA 5EW3A 4DFLA 3DXPA 2Y8OA 3SGCA 3HA8A 3FZSA 4EQUA 2VWZA 2ACXA 2BROA 1U5QA 4TYEA 4YSMA 3MVHA 5LMKC 3A7IA 4FTIA 5M4IA 4EOMA 3CLYA 2YCSA 5M09A 2I0HA 3COHA 4LV5A 1YXTA 4JX7A 2VAGA 2BZJA 4AT4A 4FV9A 4AFJA 4BIBA 5KMIA 5C4LA 1WAKA 3C7QA 5ACKA 1UV5A 3UVQA 3VHKA 2WMSA 3EKNA 4G34A 2CPKE 2NPQA 4NTTA 4W9WA 4JQ8A 4BDCA 5IDNA 3QC4A 3BHTA 3NGAA 4K18A 4DHFA 2PUPA 4C4FA 2HCKA 2EVAA 1SM2A 3NW7A 3FE3A 3UMXA 4DF3A 3NLBA 4FOCA 3RWQA 3I7CA 2IZSA 5DRDA 5TO8A 5BQ0A 3TJDA 5HBHA 4DAWA 5CS6A 3KRXA 4L44A 3BV2A 2VD5A 4RVMA 5H2UA 3R9HA 3NW5A 2CCIA 3SRVA 1ZYSA 2XNBA 4BZNA 4RZWA 1W83A 3FJQE 3DBCA 3W16A 5CF6A 2WGJA 2WAJA 5HBJA 4IDTA 1OPJA 5HG5A 4ZTSA 4Z7GA 3JVSA 2OG8A 4II5A 5E1EA 2YHVA 5ANOA 4Z7HA 4LOPA 2ZVAA 4TXCA 4I20A 4GU9A 3CKWA 3FPMA 4R1VA 4TKSA 4QTDA 4W8DA 2C3KA 3OROA 3RTPA 5M56A 1JKSA 2UUEA 4D58A 3NS9A 3LM0A 3NRMA 3WE4A 5B2MA 5D7AA 3RVGA 3U6IA 4AAAA 2WHBA 2XYUA 3KXHA 4IAAA 4IVAA 5L6PA 2VO3A 5C4KA 1PW2A 4FL3A 2C0IA 5GIOE 5G6VA 2X2MA 3VWAA 5HZNA 3UIBA 2AC5A 2CHLA 4C38A 3A60A 5HTBA 4IX3A 3UO5A 3IOKA 4BC6A 5IQDA 4BCGA 3CQWA 3E93A 3LHJA 5LVLA 1H1RA 4OTQA 3BI6A 3CY2A 3CGOA 5JQ8A 1UU8A 3NIZA 4DFUA 3MJ2A 4TN6A 3U4UA 4M0ZA 2XNOA 4W8EA 1K2PA 3PDTA 3UPZA 3OW4A 4JG6A 1PXJA 2OF4A 4FODA 4EH5A 3CD3A 5FGKA 3PXKA 5CSWA 5C03A 3FQEA 4GG7A 5DEYA 2RFDA 4FMQA 3QQKA 1JSTA 2VNYA 4IX4A 5C26A 5ITAA 2GSFA 3TJCA 3Q5IA 2UZDA 5IQAA 4MF1A 3AOXA 3RPRA 4NKAA 2WMVA 1IRKA 3VC4A 4O7RA 1ZARA 4UMPA 3KMMA 1AQ1A 2HW6A 2ZV2A 4NFNA 2YDIA 4LGHA 5KBQA 4RC4A 4D2VA 3NSZA 2X81A 3QQUA 2C68A 4YZNA 1YRPA 5IQHA 4JBVA 2WMUA 5CSVA 3V5LA 2UZNA 2VX1A 3HA6A 3V3VA 4IB5A 2OIQA 2VWUA 3HYHA 4GK4A 4L7FA 1YOMA 2VTTA 2ERKA 4C35A 1J1CA 3ERKA 4O1PA 3SOAA 2Q0NA 5I0BA 5EM8A 3RM6A 3AC5A 3QTIA 3UOKA 3DKFA 4YR8A 4QMOA 3PG3A 4G5PA 4A7CA 3GU6A 2XP2A 2ZV7A 1IASA 3QTSA 2W9FB 3BHVA 4HYHA 1G5SA 4L68A 2W9ZB 3Q9XA 1XBBA 3LFBA 4O0VA 4XV9A 2G1TA 4OAVB 5ANEA 4NWMA 3OWKA 3FMLA 4KSQA 5HIBA 4QD6A 5LMAA 1F3MC 4CZTA 2IVUA 3DA6A 4OBQA 1YW2A 5FDPA 5I9XA 4I21A 4C3PA 2OJJA 4ZEGA 2ZV8A 3QRTA 4XV1A 4L3LA 1MRYA 1ZY5A 2GS2A 3V5PA 4F6UA 1YXUA 1KV1A 3AD6A 3CXWA 3GCPA 4NJ3A 2OICA 4XLVA 4ID7A 4CKJA 1KUTA 3F6XA 4DFZE 1ZYLA 1W7HA 4FSRA 3R9OA 3BU5A 2OLCA 3F69A 4DH7A 3HMMA 3M11A 3P5KA 3MVLA 3E7VA 3WI6A 4CT1A 4Y83A 4ZMFA 3L8PA 5M53A 3IW7A 1J7IA 1GOLA 3EFKA 3FZTA 4QYYA 4A9UA 3LFNA 1YOJA 4MNEA 2PMLX 2J0MB 3OBJA 5HLPA 1KWPA 4QMZA 4DTAA 4BZDA 1M7QA 4EHZA 4FT7A 1OIUA 3QXOA 3DDQA 2JBOA 4HCUA 4NZWB 3O0GA 4AUAA 4RWIA 5J5TA 2OJFE 4JX3A 3C4CA 3CCNA 4WIHA 1YVJA 2VV9A 3C4FA 3EN4A 4IB0A 3BGZA 3EZVA 5FM2A 4A4LA 4RMZA 1ZAOA 1OUYA 2R0UA 2R4BA 4D1SA 1DI8A 3CQEA 3FC1X 2VTJA 4R5SA 4KIKB 1XBAA 2ZMDA 3GP0A 2BKZA 2QO9A 2XNPA 4UZDA 3SHEA 2XIKA 5EI8A 3FKOA 4TZRA 2F57A 4KBCA 5IEVA 3GEQA 2UVZA 2CKQA 2JAMA 3PJCA 4FT9A 2ZOQA 3UP7A 3A8WA 3UOLA 4BVUA 4BDBA 4EHVA 5CU0A 4KRDA 4B8LA 3ULIA 3P86A 1U59A 3VS0A 2DYLA 3VS6A 3LW0A 2VWXA 4RC3A 4O86A 3HRFA 3NNVA 5CZHA 2EB2A 3C4WA 4ASEA 5I3RA 4MD8E 2HW7A 3KQ7A 2XRWA 1RDQE 3CS9A 3DS6A 4BB4A 5B7VA 3PSDA 5HU9A 3R8VA 2X2KA 1QPEA 3QTWA 1ZMVA 4KD1A 4RIOA 5HKMA 1I44A 3W1FA 2XKDA 4PNKA 3REPA 2CMWA 2PVHA 4AW5A 4F64A 4AGUA 1PMNA 1Q8TA 2EUFB 5KMNA 3PZEA 4N4SA 3L8SA 2HXLA 3QZIA 4NK9A 1IR3A 4PL5A 5E8WA 5FM3A 3QRUA 3OTUA 3R21A 5F1ZA 1ERKA 2R3LA 3FL5A 3NEWA 2BDFA 2FO0A 3RK7A 3ZS5A 3E63A 2R3RA 3BWJA 5K0KA 3UNKA 5FEEA 2V0DA 3QQGA 2G2HA 2QOOA 4RX9A 4QMLA 4BGHA 4EEVA 3UQCA 2BR1A 4DGOA 4PTCA 3RAKA 2UW5A 3BHYA 4E93A 4PMMA 5DGZA 4X2KA 5AUUA 3MSSA 3QUDA 5KMJA 4E5BA 3F3TA 3FLSA 5ANIA 3ZZWA 2G15A 2QHMA 3MYGA 5AA9A 4QTBA 2BRMA 2VWYA 4L46A 2ZM3A 4EJNA 3UO6A 5LVPA 2PVFA 1H1PA 3MTLA 4OTHA 5H9BA 3WF6A 3DB6A 3U54A 1RJBA 4TTHB 2BIYA 4USDA 3KGAA 4XUFA 1URWA 2YCRA 2Z02A 4QMVA 3Q9YA 5EDPA 4FSMA 4MK0A 3R0TA 3GU4A 3H3CA 2UZLA 3Q9WA 3ZUUA 3L1SA 3P7BA 4DEEA 5A4CA 3HP2A 2XK4A 3UG1A 2IWIA 4JDIA 3OTVA 1XH4A 4YBKA 1Q97A 3IK3A 2W4OA 4ZTQA 5BVKA 5GZAA 5AUZA 3ZONA 5M57A 4IZ7A 3EFLA 3TIZA 3IGOA 4OR5A 5I3OA 4TW9A 3FI4A 5CNOA 4PP9A 4QP3A 5IH4A 4H36A 2CGVA 2X8IA 2VTMA 3OCGA 5IEYA 3HV6A 2WTWA 5E8YA 3R9NA 1PMUA 4CG8A 3HUCA 3KVWA 4FTQA 4R8QA 3DKCA 3O8UA 2Y4PA 4ZTLA 4E6CA 3BYSA 4CG9A 4BCQA 2CCHA 2NNWB 3TV6A 1HOWA 3Q60A 3R2YA 5HGIA 4DTBA 3QCXA 4CRLA 2A2AA 2F2UA 1NT2A 3OCTA 1ATPE 4FL1A 3C0HA 3O2MA 4C59A 4H58A 4K6ZA 4HOKA 1MQ4A 2JDTA 2WXVA 4DFNA 2Y4IB 1TKIA 4XBUA 4B99A 3D15A 3F82A 4D5KA 1XHAA 1VZOA 4K11A 2JKKA 2SRCA 4ZZMA 3LFQA 4JAJA 3QC9A 3K3IA 5AV0A 4DGMA 4BWPA 1J1BA 4FZAB 5CNNA 3GNIB 3ZRLA 1AGWA 1B6CB 2PHKA 2YDJA 4HVGA 2AUHA 3QBNA 2OZAB 5E8TA 2UZEA 4O96A 5HU3A 2RFSA 3OC1A 4WNKA 5DA3A 4U81A 3WIKA 4ONAA 3BWFA 4UY9A 4S34A 5HE2A 1OB3A 3MY1A 5CSPA 1PMVA 2VWVA 1ZYJA 2YCQA 5C8KA 2FSLX 3MH2A 4FF8A 1GZKA 4F70A 3DJ7A 1XH6A 3ZUTA 3ZO2A 4P90A 4G6NA 2JIIA 3KK9A 5HTIA 2WMXA 4R1YA 4CYJA 1JOWB 4HJOA 3SV0A 2OBJA 3LXLA 4O7TA 3WZUA 1OKVA 1WBSA 2QNJA 3IDPA 4FV2A 4C2WA 4D1ZA 3ZSGA 4AE6A 2VRXA 5G1XA 2YIYA 4L53A 4DEHA 4BDJA 3R7OA 4RVTA 4I93A 2A19B 3L8VA 3N51A 3BBWA 3BQRA 5H8EA 4F65A 5A4LA 2J4ZA 4GL9A 4CZUA 3G5DA 3QXPA 2WNTA 2WKMA 4ZTRA 1Z9XA 4LQMA 4EH4A 2GS7A 2X4FA 3EYGA 1A9UA 2PVMA 4FUYA 4BBMA 2BRGA 3EH9A 2Y9QA 5D12A 2P2HA 3DBEA 3SW7A 1JQHA 5HX8A 3K2LA 3TZ8A 3QYZA 2ZM4A 3FUPA 3ZRKA 2CGUA 3I5ZA 5TE0A 1ZXEA 3FXXA 1UVRA 3FV8A 5L3AA 5JT2A 2FSTX 4YZBA 3QLGA 3QA8A 4QP6A 2FH9A 5T6KA 5CANA 4MX9A 2YWVA 3OUNB 3RPYA 3GCSA 2XBAA 2ITZA 4BGQA 4ITHA 1UWJA 4S33A 4RLLA 4F6SA 2XS0A 3GQLA 5BVEA 4RT7A 2XNEA 3ORNA 4LL5A 4OTGA 3UYSA 5AAEA 2FA2A 4JQEA 2UZOA 1NW1A 3GC7A 5L4QA 4CLJA 3TKIA 3R6XA 2XK9A 4I0SA 4CQEA 2NRYA 4N6ZA 3E8EA 3F3UA 5E8XA 3VVHA 3ENHA 2C3JA 1BI8A 4U9AA 2C47A 3NUYA 4BY9E 4JS8A 4NM3A 4EK4A 4WD5A 4AACA 3ZSIA 4E6QA 3A62A 3TTIA 2RSVA 2PE0A 3BHHA 5E1SA 4PUZA 4EH7A 3SKCA 3II5A 3MH1A 2UW0A 3P23A 3ZO1A 2WPAA 4C7TA 4G3GA 4MF0A 3QCYA 4KIKA 3R1SA 4D4YA 3QLFA 4G9CA 4NW6A 4FKVA 1M2PA 4DA5A 2ZYBA 3EFJA 3C4XA 3ALOA 3DK3A 4FGRA 3ALNA 2Y0AA 3SRVB 4ENYA 2WMRA 2C4GA 4IAIA 3FMDA 3H4JA 3ZCLA 4O7YA 1Y8YA 3PVWA 3CBLA 1U54A 4X2NA 2HZNA 1YXVA 3OXZA 2J7TA 4ASDA 2XJ0A 4ENXA 5HVYA 2V7AA 4RZVA 5CSXA 1H1SA 4LMUA 5E8ZA 4FSYA 3OEFX 1GIHA 4OTDA 2HENA 4TYHA 4L3PA 3T3UA 3OWPA 3W2SA 3UP2A 3ID6C 5EYMA 4X6RA 1H26A 1V0PA 3R63A 3LAUA 2W7XA 1PHKA 1PKGA 4HZSA 4ALVA 3KVXA 4FEQA 4EK8A 4O0XA 5IH6A 4O81A 4L43A 2WZJA 4G3DA 5BMSA 2CKEA 4PDYA 3QF9A 3AMAA 3WF5A 5AV2A 3EQGA 3QD2B 5A4TA 1H25A 5IPJA 1DS5A 3E62A 5JFSA 3QA0A 4DH8A 4MEDA 5J1VA 3KEXA 3ORIA 3DFAA 4TWPA 4HNFA 4F1MA 2B9JA 2JITA 3HECA 3G33A 3HGKA 5BVWA 4FTJA 1LEWA 4YHTA 2C6OA 2IW6A 2XUUA 3TZMA 5F9EA 5DE2A 3TI1A 2ZDTA 5CEMA 4RWLA 5AP3A 4YC8A 4IAZA 4XG6A 3U87A 2F49A 5E8VA 1Y57A 2VTPA 4FTRA 3SDJA 4J96A 5JMSA 2YM6A 2WQOA 4QMWA 2ZB1A 4OAUC 4FTNA 4WHZA 3OT3A 4MWHA 3COMA 3IKAA 3PJ8A 4KKHA 4A9TA 4LGGA 2PVNA 4QNAA 5FBOA 4BYIA 4E26A 4I22A 5FWKK 1PYXA 4CFMA 4EC8A 2WEVA 4I23A 3VS3A 4C57A 4O7NA 5BVDA 4B0GA 2R3GA 4MNFA 3VQHA 4QYHA 4BCMA 4JOAA 4CCUA 3DBDA 5AP2A 2RIOA 3I6UA 5LQFA 2W1EA 3Q04A 3NZ0A 4TNBA 5L2TA 3HRBA 4C58A 3QWJA 2Q83A 4GT5A 4X3FC 2R3JA 3DNDA 4AT5A 2OSCA 3E8DA 5GIPE 2YZAA 3C9WA 2C6TA 5DOSA 5AP5A 2O64A 3ORPA 1WVWA 1R78A 2PMOX 2WOUA 3R1YA 1F0QA 3QUEA 4YJVA 3DNEA 4H1JA 3AT4A 1XH7A 3LCOA 4PDSA 5HOAA 4RFYA 5ANJA 4M0YA 3PPKA 4U43A 1FGIA 3FC2A 3EWHA 5HD7A 4R3RA 3V5WA 2XCHA 3TWJA 1R0PA 2W5HA 3EYHA 4EORA 4I1ZA 1ZOGA 4J71A 5HLWA 2G9XA 3ZLXA 3HAMA 1W98A 4U41A 2WO6A 2B9HA 1DAWA 2E9NA 5C27A 3KMWA 3HV7A 4ANBA 5IQGA 2X9FA 2XA4A 3O71A 4CSVA 4FTCA 3RPSA 2O3PA 3I4BA 4X6QC 2BUJA 1J7UA 3IOPA 3VBYA 1UNLA 2FYSA 1YHVA 2JFLA 4R5YA 4GJ3A 4ZTNA 3BGQA 3FMMA 3D94A 2FSMX 2ESMA 4IFGA 4DGNA 2B55A 2IPXA 2RFEA 2V5QA 4EHGA 3VNTA 2IO6A 1WVYA 5AR3A 4C33A 4RJ5A 4YNEA 4FKGA 4XV3A 5ETFA 2X39A 3NUUA 2XRUA 4AGDA 5CEOA 2JDOA 2QU6A 4MNEB 2GNHA 1PYEA 4MD9E 5A3XA 2QR8A 4ZZNA 2QOLA 3ZUVA 3QZGA 5FXSA 1ZWSA 5EK7A 5L2SA 1YOLA 3OWJA 5EQYA 3PXZA 3Q6UA 2OW3A 5HORA 1KOBA 3BYVA 3HMNA 3LFFA 5E8UA 4WG3A 4C3FA 5LVNA 4FKUA 2Z7QA 2IZTA 3HMOA 4CMUA 2CNUA 5EM6A 3A8XA 4J8MA 3R71A 5DT0A 3T9IA 3QWKA 5JN2A 2Z8CA 4KS8A 3D5UA 1O6LA 3HRCA 1SNXA 4FIJA 3CC6A 4WBOA 4U0IA 1H08A 4L9IA 4IJPA 5EOBA 3VS4A 4CKIA 4EZ7A 2RG6A 3D9VA 1TVOA 5DH3A 4UXLA 4DT8A 4M15A 3P9JA 4MTAA 4YHJA 3R8LA 3UC3A 5BVNA 3OUKA 2OJGA 5J79A 3GENA 2X2LA 3PTGA 4CV9A 2E9UA 4YC6A 5D41A 5AA8A 2XH5A 2OH4A 4GW8A 4IHPA 3BE9A 4MXCA 4R7HA 5I9UA 2XMYA 4C2VA 2XIXA 3RPVA 3ZSHA 4F0GA 4H3PA 3CKXA 3HMPA 1XO2B 4FIEA 4HVSA 2J0LA 4YO4A 2O0UA 2J0IA 3UNJA 4U79A 2J90A 4XYFA 4G6OA 3Q2JA 4FKPA 2QC6A 3PY1A 4LM5A 5HG8A 4HPUE 4BF2A 4EBVA 2Z7LA 3HZTA 4APPA 1PXNA 3VIDA 3VQUA 4PMPA 4R7IA 3OS3A 1KE7A 1M7NA 3TCPA 4DGGA 1R3CA 3UTOA 3R1NA 1X8BA 4M67A 3UNZA 3F2AA 3I7BA 4L52A 2VTNA 3IQ7A 4Q5HA 1SNUA 4DC2A 5AV3A 2PUIA 3QALE 2UZBA 2C6EA 3BHUA 2OGVA 2ITVA 2DUVA 2PVKA 4N0SA 4UMQA 3POZA 4YHFA 3WARA 5AAGA 2PUNA 2XKCA 4O7VA 1P14A 4W4VA 4XRJA 3NYNA 4XLIA 4YNOA 5CENA 2OK1A 4BTFA 4XMOA 3CJGA 5I9YA 4Q2AA 2WTJA 3BYOA 3NYVA 4DBXA 3UMWA 4FNXA 4FI1A 4CEGA 2DWBA 4E6DA 5L6WL 1GNGA 2O5KA 2WFYA 1GAGA 3RK5A 3R7VA 3UGCA 2VWWA 4BCFA 4MQ2A 4EOPA 3EZRA 4UN0C 3Q5ZA 4GKHA 3C51A 3KXZA 3MI9A 4Q5EA 4ZS4A 1CTPE 3G9LX 4DG2E 4FKRA 5HO6A 4E3CA 4AP7A 3NYOA 3Q9ZA 4F7LA 3IDCA 4PPCA 1W8CA 4DT9A 3C0GA 5BYYA 2QG7A 4CD0A 1YI6A 4UWCA 2HOGA 4K9YA 3RCDA 3PVGA 4U44A 4HVIA 3QKLA 3QQLA 4O91A 5I5ZA 4KABA 2WQEA 4R3CA 4XH6A 4DEAA 5L2QA 2ONLA 2W4KA 5F4NA 3VJNA 4EOSA 1XBCA 2RG5A 4WA9A 4CFWA 5CSHA 4EL9A 5J7BA 3S3IA 1PXLA 4QYEA 2C6MA 4RIYB 1FVRA 5GJFA 3DQWA 4FT3A 4EZ5A 5HICA 4IZYA 3U4WA 4YUQA 5TR6A 3WE8A 5DEWA 2W1CA 1ZYCA 3TEIA 4ZY4A 4FEUA 3JS2A 3ORKA 3LKMA 4OUCA 5ETAA 4DYMA 2R3FA 1WBNA 2VO0A 4O0WA 4UEUA 2QOKA 1WBWA 4R3PA 4BDKA 4EH6A 4FVPA 4AW0A 3NAYA 4U5JA 5GZ8A 4D5HA 2IVSA 2ZDUA 3AC4A 2YISA 5L8KA 1RQQA 4DG0E 2KTYA 3K5VA 2JLDA 4MXAA 5A4EA 5TKDA 1PXMA 2PTKA 4FV3A 2YM4A 4ZSEA 3DLZA 4E5WA 2KULA 3IS5A 5FXQA 4RFMA 4RJ4A 4MVFA 1VR2A 1CKPA 5EFQA 4FKJA 4QP8A 3VF8A 1NVRA 3OFMA 5BVFA 4Z16A 3FBVA 4BCIA 4J7BA 2UW8A 5DNRA 5M4CA 4CGAA 3KXGA 3MPMA 4CRSA 4Q9SA 4C02A 4AZEA 3FLNC 3FAAA 4J53A 3OZ6A 1REKA 2PMNX 2PSQA 4FZ7A 3VS2A 4C4GA 2R9SA 3OD6X 1PF8A 3AMYA 4M84A 4GUBA 1YDSE 4O0UA 2OKRA 4CFUA 3BU6A 3BLHA 2YCFA 5AP0A 2GS6A 1CDKA 1H27A 5FUTA 3O23A 4BDDA 4DBNA 3ZC6A 2IJMA 3DJ6A 4AQCA 4YTHA 5BUEA 5IDPA 3IPHA 3ZEPA 1JKKA 3EQBA 3PRIA 5KZ0A 3F5GA 3U9CA 5FTGA 2ZM1A 3PSBA 2NRUA 4MXXA 1MQBA 4RJ3A 5AV1A 2JIVA 3LJ0A 3Q4TA 3TNQB 3LCTA 3EQFA 4IZ5A 2WQNA 5AFVA 1ZLTA 3P7CA 3QD4A 4BWXA 2OI4X 2PVJA 4AGWA 4D2SA 1UNGA 4YZCA 4JDKA 4ACMA 4K77A 3ATSA 3NPCA 3KRLA 2YERA 3V8TA 4ZZOA 3BKBA 5CAQA 3E8NA 3TG1A 4GT3A 1RW8A 1Q8ZA 2P55A 4YMJA 3RAHA 3PZHA 5KX8A 3ATTA 3NVKI 2JDVA 5FEDA 4BBEA 4ZSGA 1OKWA 5JH6A 3JUHA 1YHSA 2QURA 3B8QA 3UOHA 5HE3A 3W2RA 4F7JA 3DOGA 3GXLA 4TWCA 4KNBA 5LCJA 3F2NA 3Q96A 3PIYA 5AUYA 3TDVA 4X2FA 2I7QA 4F09A 5KZIA 1P4OA 2XIRA 5L8LA 4WNPA 3HP5A 4AZSA 4PX6A 5JGAA 2R3MA 3RWPA 4ACGA 2A27A 4ZS0A 3UC4A 4UALA 4ZIMA 1FVTA 1WZYA 5CXHA 2C5YA 4PL3A 3NUXA 1YWVA 4XS2A 4CV8A 3UOJA 5DBXA 1PRYA 1LEZA 4L8MA 4MBIA 3LQ5A 4A4OA 4FG9A 4M14A 3ORMA 4H05A 1UU3A 2XNMA 5EDRA 3MFUA 4H3BA 3PWYA 2X7FA 3BE2A 3LQ8A 4IEBA 3IW6A 2PZIA 3MIAA 3PXQA 4XHKB 4BDAA 2PZPA 4MBJA 4I5HA 2C6DA 1WBPA 3G0EA 3NVMB 5HQ0A 2VX0A 5KHWA 5HVKA 4W9XA 4QMXA 4FVQA 2GTNA 2PMIA 3F5PA 4GT4A 4O0TA 3FMNA 5K0XA 2Z2WA 5HTCA 3ZC5A 1WBTA 1XH9A 4KS7A 4RPVA 5M51A 4K1BA 4FIGA 1Q24A 3E8CA 4FGBA 3FPQA 4EHEA 1CSNA 2F7EE 3IO7A 4NCTA 5AIKA 3FYKX 2H34A 2JAVA 2NO3A 3I81A 2OO8X 4RLKA 4AGCA 3NX8A 3QCSA 4AWIA 2VTLA 2E9VA 3ZHPC 4QQJA 1PJKA 3F9NA 1OPKA 4C3RA 3HUBA 4KAOA 5CU4A 4GS6A 1ND4A 5FTOA 2ZJWA 1QPDA 4RIWA 1WCCA 5K3YA 4FSQA 3BIZA 4QMMA 4N57A 2XKFA 4DLIA 4IB3A 3R00A 5HE1A 1U54B 4D2RA 4IJ9A 4KIOA 5ETCA 4OLIA 3UO4A 2C5XA 4FTMA 3ZBXA 4RSSA 4E6AA 3CTJA 3RNYA 4TYHB 5J95A 3WZKA 4EK5A 3DKGA 3ROYA 4H39A 2GHLA 4L42A 3TXOA 5DHJA 3NUNA 3IONA 4ACHA 2OXYA 3ZM4A 2ITQA 4EH2A 5J1WA 2G01A 5J8IA 4BBFA 3UIUA 3Q4CA 3FXWA 4PPBA 3D7TA 4P4CA 1FOTA 4YJPA 4YSJA 4BIDA 4GCJA 4ZP5A 5KMOA 2UW4A 5EW9A 4JXFA 2W1IA 4QNYA 3QD3A 4NH1A 3GOKA 4AA5A 2QVSE 5JFWA 4DGLC 3SXRA 3QQFA 3A7FA 5CI7A 5AAFA 2UW3A 4FSUA 2ZMCA 4LV8A 4IIRA 4C61A 4EQCA 5JZJA 4LOQA 4O7LA 4X0MA 5DVRA 5AP1A 4AW2A 4R78A 4CFFA 4L45A 5CF8A 5C8MA 5IQEA 4YURA 3JY9A 5M4FA 5AR8A 1H0WA 3L9MA 4WSYA 3ZFXA 4ZSJA 3GCUA 3V8SA 2OXXA 3QZHA 4HGSA 4RJ7A 4HZRA 4PQNA 4U40A 4I6QA 2UW9A 3MFSA 3VRZA 5DI1A 2OFUA 4ZJIA 2P2IA 4E4LA 4F63A 3DBFA 3LOKA 4XBRA 1IAHA 5LJJA 4YO6A 1BL7A 5IISA 4FTUA 3C5IA 2ETRA 4APCA 2YWPA 4ZJVA 3RINA 4NIFA 4QTCA 3F61A 4CT2A 3LMHA 3CTQA 2QQ7A 5IQIA 5KBRA 5DRBA 2BCJA 5IUIA 3PYYA 3GU5A 3MESA 2F9GA 4P5QA 2OIDA 1OECA 1GY3A 4P5ZA 3MDYA 1A48A 4L00A 4YBJA 4ZTMA 2YN8A 4RIYA 4S32A 1MRUA 5DR6A 1YWNA 4F1OA 3EIDA 2ZB0A 3R8PA 4JQ7A 2XM8A 1OIRA 1KE5A 1ZMWA 3L9PA 4EH8A 1JWHA 4Z3VA 3HAVA 5JEBA 1H07A 1U46A 2GCDA 4F7SA 2OF2A 3KF7A 3QU0A 2EU9A 1DM2A 3PE2A 1Z57A 5EG3A 2VN9A 5HCZA 4J8NA 5CU6A 3G6HA 4DE4A 2PE2A 4O2PA 2QLUA 4DEIA 5HBEA 5B2KA 3SX9A 2XK7A 4OBPA 3Q32A 4FBXA 4DLJA 5KHXA 2YITA 5KNJA 5AUTA 2R0IA 5CWZA 5HNIX 2BALA 4XG8A 4P7EA 3VBQA 4I24A 3VW6A 4JR7A 1PMEA 2V22A 1FINA 4M69B 3MGYA 4U45A 2CDZA 4XRLA 1NVSA 4YPDA 3IW4A 3FKLA 3I60A 3KY2A 1PXOA 4IFCA 5IUHA 3DXQA 1B39A 2H8HA 5FEQA 1W0XC 4FV8A 3DU8A 5M4UA 3PVBA 1E1VA 2CJMA 3TZ9A 3QRKA 2QI8A 4IWDA 2WTDA 4ZK5A 5EQEA 4TT7A 3C1XA 2EWAA 4RVKA 4I92A 4W4XA 4GV1A 4NSTA 3RCJA 4EONA 5HO8A 1G8SA 3UJGA 4JI9A 4CFNA 2JDSA 4LL0A 4NM0A 4S31A 3U9NA 3E3BX 3NUAA 5CEQA 1JSVA 1KE8A 4OTFA 5CEPA 4ERWA 3KRRA 4JBOA 4JBQA 3GBZA 3CIKA 3R9DA 3TNPC 2GQSA 2PZRA 4QYFA 2XCKA 4NT4A 5DFPA 2WTKB 5T68A 3KN6A 2XBJA 3G15A 5A46A 4UMRA 3OF0A 1SYKA 2YIXA 5FP6A 5HHWA 4YJSA 3TKUA 3IECA 2QOIA 1YXXA 1YI4A 5EM5A 4D2PA 3CJFA 3LCDA 3HDNA 5GZ9A 2VTQA 3Q52A 4D28A 4E20A 5LXMA 2W1FA 3GOPA 5LMKA 3BLQA 4QPMA 5TT7A 4TWOA 3BX5A 4D4VA 3ET7A 1FVVA 1XQZA 3FQSA 4CKRA 5HG9A 3EN5A 3GB2A 2BAJA 3N9XA 4H3QA 3SLSA 3WIGA 1FQ1B 2HY81 2FVDA 4JBPA 4WRSA 4NUSA 3HVCA 1VYZA 4O1OA 4EOOA 4FKSA 4MBLA 4FNWA 3QTUA 4IX5A 2BFXA 3ZLYA 1CM8A 2UVYA 5FQDC 2O2UA 4MHAA 4NM5A 4X21A 5EH0A 3TUBA 4E4XA 3VW8A 3GI3A 4GRBA 4FKQA 3BU3A 1ZYDA 1A06A 1OGUA 3L9NA 4MD7E 4BDGA 4EOIA 4UX9A 1ZOEA 4FV7A 1BMKA 3O7LD 4M68A 3WYYA 4FIIA 5KE0A 3W8LA 3NUPA 1STCE 4U7ZA 2VTOA 3P79A 2EB3A 3VHEA 2R3PA 2YA9A 5A6NA 4BICA 2YM5A 4G2FA 3R7EA 1AD5A 3WBLA 3PSCA 2XK8A 3SG8A 4NKSA 4AE9A 4AA0A 1IAJA 3JPVA 3F5UA 4CFXA 2WTIA 3BBTB 1YXSA 5FRIA 3PIZA 2OWBA 4JL9A 4O0RA 3AC1A 2WMAA 3BYUA 3N4UA 4NYEA 3PXRA 2RL5A 3VULA 4R77A 2O8YA 3HLLA 3VUDA 5CEIA 3KF4A 3ZU7A 3GGFA 3RBWA 5M08A 3BQCA 3RALA 4QMSA 4C37A 4GG5A 3UVPA 5CQUA 3F88A 3VBTA 2HELA 2VTHA 2HIWA 3MB7A 4U3ZA 5AR4A 4OTRA 5F94A 4FIFA 2P3GX 1RE8A 4I0TA 4ZY6A 3VBXA 5EQPA 3EKKA 2ERZE 3MS9A 5CX9A 4GFOA 2XKEA 4FV6A 5IUGA 5JGBA 4OT6A 5K5XA 2NP8A 1PXPA 2BZHB 5CU3A 5AUXA 2B0QA 4IAFA 4M97A 4YJQA 4BCHA 2VGPA 5E8SA 1M2QA 1BYGA 4RGJA 3KXNA 5BUJA 4L3JA 4M3QA 4E8AA 2WTVA 5DLSA 2QOCA 4DFBA 4FTLA 4D9UA 3HL7A 3OT8A 4CNHA 5I9ZA 1R0EA 1BX6A 3BELA 5JRQA 2JIUA 3E3PA 3VUIA 4BKJA 5EYKA 2XZSA 3FMHA 4QP1A 2CN5A 5AP6A 4FICA 3IG7A 3L8XA 3LXPA 5AR7A 5AR2A 4QO9A 2GMXA 2GHMA 1ZZLA 2P33A 1WBVA 5EI2A 5ANKA 1XH5A 2GU8A 5D9HA 4TPTA 2BDJA 4UYAA 4BIEA 2XB7A 2YLEA 1QMZA 3D5WA 3FSFA 3MFTA 4QP9A 4BHNA 4BN1A 1OM1A 2QONA 2XF0A 3UZTA 2PE1A 1NY3A 2R3HA 5F95A 2IZRA 4AG8A 4KUJA 4XG7A 4XNEA 4EWQA 1Q8WA 3FLQA 5HCYA 4XEYA 4G17A 1VYWA 3QAME 4BWKA 4C8BA 5IQBA 1GIIA 2Q0BA 3AT3A 5EI6A 1SVEA 4RC2A 2PU8A 3TV4A 4FNYA 4ANOA 3GU8A 4RX8A 3CGFA 3M2WA 5LARA 3R83A 3UVRA 2X9EA 5FTQA 5DPVA 4AF3A 3OP5A 3I79A 3ODYX 3MVMA 4BTKA 2W1DA 3AQVA 5LOHA 4BR3A 1W82A 3W10A 3NCGA 4PL4A 2JDRA 1WBOA 3L9LA 3MV5A 3F3ZA 3HV5A 2PVRA 2R3NA 3ORLA 4RQVA 4GKIA 3AC2A 3N4TA 3QTQA 3ACKA 4FSTA 2BAQA 5GJDA 3TNHA 2RKUA 2W1ZA 2I6LA 4GFGA 3RK9A 4AA4A 4FKLA 3I0OA 4EJ7A 2UW7A 1LR4A 2QOQA 5HG7A 2O63A 2WU7A 1JBPE 4IXPA 3VUTA 3P0MA 3SA0A 5AJQA 4B9DA 5EOLA 4FZ6A 1CKJA 5KKRB 3IW8A 3QX2A 4M8TA 3Q2MA 5E7RA 4K0YA 1K3AA 4MCVA 3VUGA 3C13A 3CP9A 1G3NA 2ETMA 4PDPA 4AW1A 3KC3A 3EHAA 3MH3A 3QTXA 3NAXA 4FZDB 4C4IA 3IGGA 2XK6A 4I3ZA 4XG2A 4BKZA 2VTAA 4L67A 1YI3A 3JR1A 4C62A 3ZH8A 4RA4A 1ZMUA 3RPOA 4E4MA 2B54A 2OXDA 5EHYA 2XIYA 3ETAA 5CVFA 4QMUA 4JR3A 4IM3A 3PY0A 3H0ZA 5JZNA 4YTFA 3PJ2A 3B2WA 2FGIA 2ITUA 3OCSA 3ACJA 4DEBA 3F66A 4GH2A 3PXFA 4KRCA 4S2ZA 3S0OA 4O21A 5AP7A 3SC1A 2REIA 3G9NA 3FWQA 2OH0E 4D4RA 1OBGA 5AEPA 3VN9A 5T3QA 3F5XA 2J51A 5ANDA 3FLYA 5E91A 4GIIA 4YU2A 4HCVA 3V04A 2C30A 1BL6A 2J5FA 3EL8A 5KUPA 4J95A 3MPTA 1R39A 3OWLA 4FC0A 4D4SA 4CZYB 4M69A 3SAYA 3PY3A 3T3VA 2QO2A 3R2BA 4IDVA 3DTWA 2X0GA 3MH0A 1GZNA 4ZLOA 5J9YA 5CVGA 3NNXA 4TYGA 3FI8A 1FMOE 3OCBA 4E1ZA 3QGYA 2VNWA 3PUPA 4IVCA 3BEAA 2WEIA 4XCUA 4A06A 5CXZA 2GQGA 3HV3A 4IZAA 4JLCA 4EOQA 5HCXA 5CVHA 4N70A 2V62A 4FEVA 4UMUA 4ANQA 2W96B 2XNNA 3QRIA 3ZDUA 3TNIA 5JFVA 4FNZA 4B4LA 4V05A 4Y46A 2I1MA 4D1XA 2ITNA 4YJUA 3PLSA 4BCPA 4YLLA 4QQTA 4QPAA 2HZ0A 3QQHA 3R7IA 4I94A 2C1BA 5CT0A 5M55A 3S00A 3F2RA 5BNJA 3MBLA 1YHWA 3SXFA 4RRVA 3W2OA 4UWBA 3QGWA 5F20A 3ENMA 5A4QA 2IZUA 4KBAA 3U55A 3R73A 4B6LA 4BCKA 4EYJA 3PP0A 1SVHA 4KKGA 2J50A 3MJ1A 3DZOA 1KE9A 2CSNA 4HGEA 2EXCX 4O6LA 5ICPA 1E9HA 1QPCA 4Q9ZA 3E64A 1H1WA 3D5VA 3HEGA 3AGLA 4RIWB 2YAAA 2R3IA 4OTWA 4R7BA 5CAUA 4JRNA 1OL5A 4J98A 5BX0A 2H96A 5CF5A 1UNHA 4MH7A 1M17A 1SVGA 2CLXA 1ZY4A 3C0IA 4XX9A 3QKKA 1TQIA 2ITXA 4LMNA 4RJ6A 5FDXA 5IEXA 2XM9A 3MWUA 2BZIB 4XP2A 5CT7A 3LFSA 2BTSA 2F4JA 4RG0A 4LRKA 2XYNA 3DB8A 3VUMA 4M7IA 3BV3A 3GU7A 3Q4UA 2UV2A 4FK6A 4D55A 4IE9A 3Q53A 3EL7A 3LLAA 1OIYA 2G2FA 5CTPA 4YTCA 4D2WA 3D7TB 4UZHA 3QKMA 5JRSA 2XNGA 3M42A 3RP9A 4PF4A 3WF9A 2X6DA 3UZPA 1Q3WA 1APME 1Q3DA 2BPMA 4YJTA 5CQWA 4HYSA 5CALA 4I6BA 5AUWA 4YTIA 3R7UA 4HNIA 3FSKA 3SQQA 3ELJA 3W18A 5KMLA 3K54A 3FZPA 4G3CA 4YZDA 3B2TA 3MY5A 2VTIA 2W99B 3HKOA 5IMXA 3R7GA 4AN3A 4FEXA 4TYJA 3MIYA 3VS5A 4FV5A 1CMKE 4G5JA 5TF9A 5IH5A 3MN3A 4ACDA 2BKKA 3H9FA 3LE6A 3MFRA 3KB7A 2QOFA 4EOJA 4JRVA 2GNFA 4F6WA 2J5EA 4I4EA 4M66A 5ACBC 3TNWA 3TIYA 2IW9A 4K33A 2WELA 3EFWA 2J0JA 1UKIA 3JXWA 4KIQA 1MP8A 3UQGA 4D9TA 5KO1A 2CNQA 4NIFB 2BVAA 3EQRA 2C6KA 4Y73A 3LCKA 4FV0A 3PPJA 3BZ3A 3LFAA 5AP4A 5AX9A 5CYIA 4AXAA 4PMSA 2F2CB 1E1XA 4IACA 1BUHA 3ZMMA 3OOMA 4YJNA 4WBBB 4C4EA 3R01A 3TN8A 5K5NA 3ZXZA 4O83A 3CR0A 4DTKA 5IA3A 4FTAA 4GMYA 4EKLA 1IG1A 3WZDA 1Y6AA 3A4PA 2WTCA 3QFVA 2CGXA 4ZXTA 3VF9A 4AZVA 2VO6A 2XJ2A 3PJ3A 4G16A 1J91A 1LP4A 4FKOA 4CCBA 4IMYA 4QT1A 5BUIA 1Y8GA 5I9WA 4Y72A 3W2CA 2OZOA 4RIXA 1M52A 2QOBA 2YABA 3FDNA 4O2ZA 1M2RA 4X2JA 5CAPA 2XEYA 4EK3A 3OEZA 4O82A 4X7QA 4PY1A 4HYIA 5E90A 2YZLA 4FZFB 4QTAA 2JC6A 3QCQA 3T8OA 4DG3E 4L7SA 3TM0A 5D7VA 3TZ7A 2GQRA 3KCKA 5ETIA 2FSOX 4QP4A 4O7WA 3DJ5A 5AUVA 3LIJA 5IA2A 3SVVA 4BL1A 5C8NA 2QHNA 3KULA 3Q4ZA 4FYOA 2JGZA 4IC7A 4OTIA 2J0KA 2P0CA 4XG9A 2YIWA 4O6EA 4D2TA 2ITOA 5L6OA 3FMJA 1Q62A 5AM7A 2YACA 4EKKA 3FEGA 1XH8A 3ZYAA 2R3KA 1PXKA 4FT0A 2VGOA 4JIKA 3MA6A 4HVDA 3AT2A 3G0FA 2Z7RA 4PRJA 3AG9A 3VS7A 1W84A 2WQMA 4RX5A 1IEPA 3C4EA 1QL6A 5E92A 2JFMA 2W1HA 4MWIA 2Z7SA 3HMIA 4K2RA 4C4JA 3CEKA 3NWWA 1KV2A 3QYWA 4DH5A 4YGAA 2XEZA 3GC9A 1JLUE 4R6VA 3V5QA 2OJ9A 4F9BA 5KMMA 5HD4A 2VTRA 2UW6A 4RWJA 5J9ZA 1B38A 3QHRA 4KINA 4U6RA 4W4YA 5EDQA 1SZMA 4QYGA 2I40A 3COIA 3EJ1A 4CTBA 4V0GA 4F4PA 1GJOA 4OT5A 3QRJA 4H1MA 2WB8A 3DDPA 3KXMA 4XP3A 3DQXA 3R8ZA 2JD5A 4ERKA 3UQFA 5BMMA 4BI1A 2X8DA 2B52A 4LG4A 2X6EA 2OJIA 1OL2A 3KU2A 4JT3A 3D5XA 5IF1A 5DR9A 1JAMA 1LUFA 2VTSA 2J2IB 4Z9LA 3S2PA 4FG8A 4TWNA 3TKHA 3R02A 3ZOSA 1JNKA 3PPZA 3GC0A 3MW1A 2Y6MA 3RHKA 3HX4A 5FP5A 5FLFA 4J99A 4GVJA 4F7NA 1KSWA 1FBNA 3A61A 4O0YA 2BRBA 2X4ZA 5EYCA 4IAYA 3E88A 1PXIA 5AX3A 5HVJA 3AXWA 1P5EA 2C5NA 3JYAA 4PP7A 3PLAE 3CD8A 2RFNA 2R7IA 3CPCA 5JGDA 5IZFA 2F7ZE 2UZUE 4ZAUA 5EHLA 5FD2A 1OKYA 5TOZA 3TV7A 4MXYA 3RI1A 4BI2A 5JQ5A 2W5BA 4WNOA 4AN2A 2R2PA 4BI0A 3NDMA 2QR7A 1Q5KA 1J3HA 3PFQA 3AMBA 4RBLA 3WF7A 4ALUA 3VAPA 4HYUA 2BRNA 3QZFA 1KOAA 3E7OA 3G51A 3RM7A 2WQBA 2C5OA 2WMTA 1BLXA 2H6DA 4P2KA 5AADA 4F08A 4RJ8A 1BI7A 1JPAA 4AOIA 4CFVA 4DCEA 4DEDA 3U6HA 1QCFA 1Q61A 3ZLWA 3GQIA 3PA4A 2BAKA 4F9CA 4F9WA 4XG3A 4Y85A 4AOJA 4HPTE 4KA3A 4OTPA 3PA5A 4FX3A 3QTZA 1P4FA 3LJ2A 4IAKA 4NW5A 3TTJA 4IVBA 2WD1A 3WILA 3P08A 4KSPA 5JK3A 4Z55A 4LGDA 2CKPA 3AD4A 4FUXA 3A7GA 4IB1A 4TNDA 2CN8A 1XWSA 3OOGA 3MY0A 1NA7A 1OL1A 4EBWA 3FI3A 2QKRA 2YAKA 2C3LA 3ORXA 5CEKA 4IM0A 1HCKA 4LFIA 2B4SB 3A4OX 4B8MA 1WMKA 4J1RA 2UZTA 2WMQA 4I5MA 4QMTA 4JVGA 4RA5A 4U8ZA 4UB7A 4UBAA 4X2GA 3W32A 3AD5A 3FZRA 3KRJA 5HLNA 4J97A 4XV2A 4G6LA 3WF8A 2EXEA 3HDMA 2X1NA 3W55A 4F1TA 4N6YA 3DPKA 3LFDA 1HCLA 1JSUA 3LXKA 3V6SA 3ZDIA 5HI2A 3MTFA 4RFZA 4IX6A 4U80A 2W06A 4I6HA 4JNWA 2FUMA 2YEXA 5B0XA 2B1PA 5IA5A 5E4HA 3G2FA 4LUEA 3S4QA 4BYJA 5L8JA 1NVQA 2WMBA 4WKQA 4WUNA 3THBA 1I09A 4GUEA 2Y4IC 4X3FA 3WZEA 4FK3A 3DFCB 3H9RA 3GVUA 5CY3A 1H0VA 5CLPA 3SOCA 4W4WA 2A4LA 2E9PA 2GNGA 4LUDA 1FMKA 4NFMA 3H10A 2P4IA 2PPQA 3OY3A 3DT1A 3UDBA 4KIPA 3RNIA 2O65A 4TL0A 1L3RE 4FVRA 4I4FA 4O7SA 4E73A 1YQJA 2BHHA 4F0IA 4HCTA 4BFMA 3R30A 4BDFA 3A7JA 1OL7A 2B9IA 3FMKA 2I0YA 4G9RA 2WTKC 4A9SA 3LMIA 3A2CA 5M44A 4V04A 3UIMA 4A07A 2IN6A 3FKNA 1H01A 4LI5A 4ITJA 3K5UA 4GU6A 4WUAA 3F7WA 4B7TA 3KK8A 1MUOA 3QHWA 3QQJA 3VJOA 4AX8A 2YJRA 2PVLA 2RGPA 3I5NA 3V5JA 4ZSAA 3SD0A 2BTRA 3D83A 3D7ZA 4MQ1A 5J5SA 4UYNA 4M13A 4EH3A 1SMHA 3PJ1A 3O7LB 4F99A 3FZ1A 5C1QB 5FXRA 4EWHA 3COKA 5B2LA 4CMOA 4F0FA 1FGKA 4MKCA 2YIQA 1YWRA 3A7HA 3CE3A 2PYWA 1DAYA 4CXAA 3FY0A 4AN9A 1J7LA 1OMWA 2PL0A 2H9VA 2CLQA 4YPSA 3VUKA 1U4DA 1JVPP 2YLFA 3R1QA 3WYXA 4PTEA 5LCKA 3VBWA 4BGGA 4CMTA 5EYDA 3C50A 5I9VA 3P1AA 3P7AA 3R28A 4FA2A 2BIKB 4IWQA 1Q8YA 3EQPA 3PG1A 4KBKA 4DEGA 5D10A 3VO3A 2VO7A 2YM3A 3F3WA 3B8RA 3QTRA 5HIDA 3TACA 2DS1A 3CPBA 4QTEA 4CYIA 4KB8A 2HXQA 3NNWA 3NMUF 4QP2A 4ALWA 5GINE 3PIXA 4IM2A 4QMYA 3UBDA 2R3QA 5AR5A 3EB0A 3ZLSA 3ZTXA 3EN9A 4BCJA 2R64A 3S1HA 5IQCA 5IA4A 3D4QA 1S9JA 1K9AA 4GIHA 4GYGA 1YKRA 2BFYA 1UU7A 2JKOA 4Y95A 4FE2A 3FI2A 3R7YA 4HVHA 3AC8A 1H28A 4FT5A 4NTSA 1V0BA 3ZFMA 4AOTA 3RHXA 3H0YA 3FZOA 3DZQA 4EQMA 3LQ3A 4IWOA 3OHTA 3BGPA 4AT3A 3FLZA 2PZYA 2QD9A 3PRFA 1BKXA 2C6IA 4JJRA 4TYIA 4ARKA 4MXZA 4A4XA 5L2IA 4G31A 2YIRA 5HESA 3EOCA 2LGCA 2V7OA 3LJ1A 3KN5A 3ORTA 4FTOA 4FTKA 5IKWA 3G90X 5D11A 2Y6OA 2HYYA 2GFSA 1EH4A 4QMPA 3I1AA 4G1WA 4PV0A 3R9RA 3NYXA 4KWPA 3DLSA 3I6WA 3VBVA 4S30A 1UWHA 5J9LA 3BEGA 4XG4A 5DT4A 4YLJA 5EKNA 4GFMA 5C9CA 5I4NA 1MRVA 4TY1A 5EHOA 2YJSA 2ITWA 2R7BA 1Q8UA 4IWPA 2ONLC 5EKOA 4AFEA 1OVEA 3I0QA 5L2WA 2QLQA 5AM6A 4ZY5A 4QQCA 3GC8A 3Q6WA 1ZOHA 2LAVA 3AC3A 2HY0A 4NM7A 3W2PA 4I41A 1DI9A 1GZ8A 5DIAA 3NR9A 4IQ6A 1XKKA 3V8WA 4DFXE 3M1SA 2HWPA 4G3FA 3DKOA 3FQHA 2OIBA 3DGKA 4O38A 4ZSLA 2HAKA 2BDWA 4O0SA 5C01A 4EC9A 3Q3BA 4YC3A 4USFA 2GNIA 2QODA 1V1KA 3ZRMA 4KKEA 2F7XE 1ZRZA 1UU9A 5BVOA 4ZTHA 2ITYA 2QKWB 3E5AA 3QD0A 2A0CX 4D0WA 4EK6A 3DCVA 3DBQA 3EMGA 4FSWA 3R8UA 4WG4A 4BZOA 4E7WA 3ZFYA 3G6GA 3FL4A 4ZLZA 4FKWA 5HIEA 3JVRA 2GPHA 1LPUA 3MA3A 2C0TA 3JY0A 3D0EA 2VUWA 4EOKA 3D2KA 3LXNA 4PWNA 4IANA 1KE6A
chains in the Genus database with same CATH superfamily
5FBNC 4JDHA 3LPBA 4PMTA 2C3IB 4G3EA 3MPAA 3KXXA 1H24A 5HNGA 4A9YA 1T46A 2C69A 1H1QA 2R5TA 2V55A 2VWIA 2W0JA 4ANSA 5LVMA 3ZEWA 2ZAZA 3POOA 5CASA 5H8BA 3U6JA 3TUDA 2C5VA 3DXNA 2J9MA 3V51A 2BMCA 4U42A 2JKMA 2BZKB 1PY5A 5GNKA 2W05A 3OY1A 4MYGA 1YDRE 3CQUA 5DWRA 5IMEA 5DN3A 3RGFA 3QUPA 5K4IA 3KKVA 4QOXA 2J6MA 3CSVA 3V6RA 2FB8A 5EM7A 3F3VA 5DMZA 4QP7A 4ZMEA 3KL8A 4XJ0A 5KKRC 4PPAA 3UODA 1IA9A 1ST4A 1NXKA 1REJA 2YFXA 4UMTA 4YJOA 5BYZA 3ZO4A 2QOHA 3LZBA 2GTMA 4L01A 5KCVA 2GNJA 1U5RA 3W8QA 2Z60A 1V0OA 4HGTA 3KA0A 2I0EA 3FYJX 4YJRA 3FY2A 4FG7A 2IVVA 2VZ6A 3OMVA 4EZ3A 2PUUA 3GCQA 2E9OA 4BKYA 3IDBA 5BPYA 5K9IA 4FV4A 4A9RA 4AZFA 3RZBA 5JFXA 4DCAA 4YLKA 4GYIA 4JIAA 1TZDA 5HX6A 3ODZX 4CQGA 3V01A 3O51A 5IA1A 3PWDA 4DH1A 4ZLYA 2CKOA 2C6LA 1OL6A 3FHRA 3OBGA 4FYNA 4U3YA 1P2AA 5CAOA 2OFVA 5IQFA 3C4ZA 3WOWA 4RIXB 3T9TA 1L8TA 3TT0A 1XMMA 4C34A 2UZWE 1F5QA 3EQHA 1XR1A 3GT8A 3O96A 4O22A 3UIXA 3BCEA 3ZXTA 4C4HA 5HO7A 1UKHA 3PP1A 2PY3A 4ASXA 4C36A 4QRCA 2WIHA 3QL8A 4PDOA 4FKTA 4PTGA 5EW8A 2X0OA 2W4JA 3ZM9A 4BDIA 3QX4A 3RZFA 5M06A 5AV4A 1O6KA 1Y6BA 2PWLA 3D2IA 3KULB 3NCZA 4O7ZA 4F9YA 1H4LA 1Q4LA 3BLRA 4ANMA 4HGLA 4MXOA 3FXZA 3UE4A 5A9UA 4O4CA 3R22A 1URCA 4NJDA 4E5AX 3NNUA 4PNIA 4OW8A 3VS1A 3C5UA 4E4NA 3LCSA 1H8FA 3DAKA 5M07A 4UV0A 3V5TA 2UZVA 1XJDA 3H9OA 3ORZA 5CU2A 3RAIA 5H8GA 4BHZA 3ROCA 2B7AA 4NCTC 2PULA 3EN7A 2BRHA 4GSBA 4J52A 2IW8A 3RKBA 4AZWA 5GHVA 3O17A 3ITZA 4JG7A 3P78A 4X3JA 4BCNA 3ANQA 2BILB 4RQKA 1R1WA 5DYJA 3EQCA 4FKIA 4JDJA 3PE1A 4IADA 2HWOA 3LFCA 3SW4A 5K4JA 4AAYA 5LVOA 2XJ1A 4V0GB 2ZV9A 2WOTA 4I6LA 2I0VA 3FHIA 4I5PA 3O8TA 2JBPA 3CY3A 1WFCA 5A54A 4AS0A 4WNMA 2X8EA 2X7GA 5GJGA 2C1AA 4RX7A 4EH9A 1FPUA 5CAVA 3W0PA 1CKIA 3EN6A 3ZBFA 3ZO3A 3LLTA 2E2BA 3BL7A 3MB6A 4ZOGA 4NU1A 4ANNA 3U8WA 4EOLA 4YZMA 2B53A 3OW3A 2X7OA 2ETKA 2G2IA 4IVDA 4XOYA 2GFCA 2YDKA 3UG2A 4DN5A 4ORKA 4NEUA 3NW6A 2HZ4A 5AWMA 3RAWA 4MAOA 2GNLA 3KFAA 4OGRA 4WSQA 4WOVA 2ITPA 1YDTE 3DAJA 2BHEA 1OBDA 2VU3A 3BRBA 4FEWA 3A99A 2PVYA 4FTTA 4Y8DA 3S95A 4LYNA 2WU6A 3O8PA 5FG8A 2GHGA 3DK7A 5J7HA 2A1AB 2HK5A 3DAEA 5ANGA 3W33A 4ITIA 3F7ZA 1OZ1A 4BRXA 2XVDA 3GFEA 4EI4A 4WO5A 3LM5A 4JAIA 1OI9A 3K3JA 4LOOA 5HEZA 5DT3A 4WRGA 2QU5A 3KCFA 1G8AA 1OIQA 4QMNA 4FIHA 4DDIA 2OU7A 3W2QA 2CNVA 5H3QA 1TQMA 4DFYA 1Q99A 3VRYA 3KMUA 3KRWA 3DV3A 5CZIA 4O27B 4C0TA 1PKDA 3OXIA 2XK3A 4L6QA 4IH8A 5AIRA 5DG5A 3WZJA 1ZZ2A 3KREA 4HW7A 3PA3A 2WIPA 4TRLA 4D0XA 3OG7A 4BCOA 2B9FA 1VJYA 4WG5A 1GIJA 5AMNA 2CGWA 4QQ5A 4XOZA 1S9IA 3GFWA 5A14A 2WMWA 3FMEA 2DQ7X 5KMKA 3DTCA 4DINA 3NFGB 4OBOA 4WT6A 1Z5MA 2VX3A 1JKTA 3EQDA 2OZAA 4BTJA 3TUCA 4CTCA 5IG1A 4DITA 1Y91A 2ITTA 3OVVA 4ACCA 4LRJA 2AC3A 3N4VA 2EXMA 5D1JA 2AYPA 2XIZA 4I5CA 4YP8A 2UVXA 3RMFA 4FL2A 1OPLA 4GVAA 4AU8A 4V01A 1UA2A 4BTMA 4CLIA 4GJ2A 4EYMA 4QMQA 4I0RA 1QPJA 4RVLA 3UYTA 5DR2A 4GEOA 3MVJA 3D14A 4NL0A 5IU2A 4EUTA 2YM7A 1H00A 4FR4A 4FV1A 5LMBA 4ZJJA 3LMGA 3DY7A 2W17A 4K8AA 4EUUA 2X0PA 1OKZA 3OXTA 5IA0A 4QPSA 3TL8A 2JEDA 5JKGA 4DH3A 3W0SA 3DK6A 5HNBA 2QO7A 4IW0A 3NIEA 3E87A 3EQIA 5J87A 1WVXA 5JSMA 5A6OA 4RWKA 2W1GA 4BDHA 1VEBA 2QCSA 2IF8A 5LWNA 1OITA 3BPRA 3CTHA 4IBMA 2PK9A 3NUSA 4X3FB 4Y5QA 3ZZEA 3GUBA 4YZ9A 3ULZA 5LWMA 4U97A 4AZTA 4BDEA 2VWBA 1M14A 3R04A 2IG7A 1GZOA 2GDOA 3U51A 2QG5A 1JKLA 4XP0A 3LFEA 5HE0A 5CI6A 1T45A 1OUKA 2IVTA 3H30A 3O50A 3P4KA 1IA8A 2HZIA 2RF9A 3FLWA 4IC8A 4LRMA 3SXSA 2Y7JA 5CF4A 2JKQA 1XMLA 2PZ5A 3IW5A 3LVPA 5BYLA 3UPXA 3BYMA 5E9EA 3E92A 1O9UA 4USEA 4Y5HA 3VUHA 4GK2A 2W5AA 4UXQA 3TDWA 2YM8A 4AXEA 4M12A 4ASZA 1O6YA 3AGMA 3GCVA 4F9AA 2C0OA 3UZRA 3HV4A 4JG8A 4CVAA 3R8MA 4FSNA 4FSZA 3SG9A 3HNGA 3ANRA 4I6FA 3PXYA 4FOBA 3RJCA 4GK3A 3PVUA 4O84A 2R3OA 1TQPA 1Q41A 4ANLA 4UWYA 5EW3A 4DFLA 3DXPA 2Y8OA 2ZFYA 3SGCA 3HA8A 3FZSA 4EQUA 2VWZA 2ACXA 2XANA 2BROA 1U5QA 4TYEA 4YSMA 3MVHA 5LMKC 3A7IA 4FTIA 5M4IA 4EOMA 3CLYA 2YCSA 5M09A 2I0HA 3COHA 4LV5A 1YXTA 4JX7A 2VAGA 2BZJA 4AT4A 4FV9A 4AFJA 4BIBA 5KMIA 5C4LA 1WAKA 3C7QA 5ACKA 1UV5A 3UVQA 3VHKA 2WMSA 3EKNA 4G34A 2CPKE 2NPQA 4NTTA 4W9WA 4JQ8A 4BDCA 5IDNA 3QC4A 3BHTA 3NGAA 4K18A 4DHFA 2PUPA 4C4FA 2HCKA 2EVAA 1SM2A 3UDSA 3NW7A 3FE3A 3UMXA 4DF3A 3NLBA 4FOCA 3RWQA 3I7CA 4O4EA 2IZSA 5DRDA 5TO8A 5BQ0A 3TJDA 5HBHA 4DAWA 5CS6A 3KRXA 4L44A 3BV2A 2VD5A 4RVMA 5H2UA 3R9HA 3NW5A 2CCIA 3SRVA 1ZYSA 2XNBA 4BZNA 4RZWA 1W83A 3FJQE 3DBCA 3W16A 5CF6A 1G8KA 2WGJA 2WAJA 5HBJA 4IDTA 1OPJA 5HG5A 4ZTSA 4Z7GA 3JVSA 2OG8A 4II5A 5E1EA 2YHVA 5ANOA 4Z7HA 4LOPA 2ZVAA 4TXCA 4I20A 4GU9A 3CKWA 3FPMA 4R1VA 4TKSA 4QTDA 4W8DA 2C3KA 3OROA 3RTPA 5M56A 1JKSA 2UUEA 4D58A 3NS9A 3LM0A 3NRMA 3WE4A 5B2MA 5D7AA 3RVGA 3U6IA 4AAAA 2WHBA 2XYUA 3KXHA 4IAAA 4IVAA 5L6PA 2VO3A 5C4KA 1PW2A 4FL3A 2C0IA 5GIOE 5G6VA 2X2MA 3VWAA 5HZNA 3UIBA 2AC5A 2CHLA 4C38A 3A60A 5HTBA 4IX3A 3UO5A 3IOKA 4BC6A 5IQDA 4BCGA 3CQWA 3E93A 3LHJA 5LVLA 1H1RA 4OTQA 3BI6A 3CGOA 3CY2A 5JQ8A 1UU8A 3NIZA 4DFUA 3MJ2A 4TN6A 3U4UA 4M0ZA 2XNOA 4W8EA 1K2PA 3PDTA 3UPZA 3OW4A 4JG6A 1PXJA 2OF4A 4FODA 4EH5A 3CD3A 5FGKA 3PXKA 5CSWA 5C03A 3FQEA 4GG7A 5DEYA 2RFDA 4FMQA 3QQKA 1JSTA 2VNYA 4IX4A 5C26A 5ITAA 2GSFA 3TJCA 3Q5IA 2UZDA 5IQAA 4MF1A 3AOXA 3RPRA 4NKAA 2WMVA 1IRKA 3VC4A 4O7RA 1ZARA 4UMPA 3KMMA 1AQ1A 2HW6A 2ZV2A 4NFNA 2YDIA 4LGHA 5KBQA 4RC4A 4D2VA 3NSZA 2X81A 3QQUA 2C68A 4YZNA 1YRPA 5IQHA 4JBVA 2WMUA 5CSVA 3V5LA 2UZNA 2VX1A 3HA6A 3V3VA 4IB5A 2OIQA 2VWUA 3HYHA 4GK4A 4L7FA 1YOMA 2VTTA 2ERKA 4C35A 1J1CA 3ERKA 4O1PA 3SOAA 2Q0NA 5I0BA 5EM8A 3RM6A 3AC5A 3QTIA 3UOKA 3DKFA 4YR8A 4QMOA 3PG3A 4G5PA 4A7CA 3GU6A 2XP2A 2ZV7A 1IASA 3QTSA 2W9FB 3BHVA 4HYHA 1G5SA 4L68A 2W9ZB 3Q9XA 1XBBA 3LFBA 4O0VA 4XV9A 2G1TA 4OAVB 5ANEA 4NWMA 3OWKA 3FMLA 4KSQA 5HIBA 4QD6A 5LMAA 1F3MC 4CZTA 2IVUA 3DA6A 4OBQA 1YW2A 5FDPA 5I9XA 4DDGA 4I21A 4C3PA 2OJJA 4ZEGA 2ZV8A 3QRTA 4XV1A 4L3LA 1MRYA 1ZY5A 2GS2A 3V5PA 4F6UA 1YXUA 1KV1A 3AD6A 3CXWA 3GCPA 4NJ3A 2OICA 4XLVA 4ID7A 4CKJA 1KUTA 3F6XA 4DFZE 1ZYLA 1W7HA 4FSRA 3R9OA 3BU5A 2OLCA 3F69A 4DH7A 3HMMA 3M11A 3P5KA 3MVLA 3E7VA 3WI6A 4CT1A 4Y83A 4ZMFA 3L8PA 5M53A 3IW7A 1J7IA 1GOLA 3EFKA 3FZTA 4QYYA 4A9UA 3LFNA 1YOJA 4MNEA 2PMLX 2J0MB 3OBJA 5HLPA 1KWPA 4QMZA 4LDTA 4DTAA 4BZDA 1M7QA 4EHZA 4FT7A 1OIUA 3QXOA 3DDQA 2JBOA 4HCUA 4NZWB 3O0GA 4AUAA 4RWIA 5J5TA 2OJFE 4JX3A 3C4CA 3CCNA 4WIHA 1YVJA 2VV9A 3C4FA 3EN4A 4IB0A 3BGZA 3EZVA 5FM2A 4A4LA 4RMZA 1ZAOA 1OUYA 2R0UA 2R4BA 4D1SA 1DI8A 3CQEA 3FC1X 2VTJA 4R5SA 4KIKB 1XBAA 2ZMDA 3GP0A 2BKZA 2QO9A 2XNPA 5BV3A 4UZDA 3SHEA 2XIKA 5EI8A 3FKOA 4TZRA 2F57A 4KBCA 5IEVA 3GEQA 2UVZA 2CKQA 2JAMA 3PJCA 4FT9A 2ZOQA 3UP7A 3A8WA 3UOLA 4BVUA 4BDBA 4EHVA 5CU0A 4KRDA 4B8LA 3ULIA 3P86A 1U59A 3VS0A 2DYLA 3VS6A 3LW0A 2VWXA 4RC3A 4O86A 3HRFA 3NNVA 5CZHA 2EB2A 3C4WA 4ASEA 5I3RA 4MD8E 2HW7A 3KQ7A 2XRWA 1RDQE 3CS9A 3DS6A 4BB4A 5B7VA 3PSDA 5HU9A 3R8VA 2X2KA 1QPEA 3QTWA 1ZMVA 4KD1A 4RIOA 5HKMA 1I44A 3W1FA 2XKDA 4PNKA 3REPA 2CMWA 2PVHA 4AW5A 4F64A 4AGUA 1PMNA 1Q8TA 2EUFB 5KMNA 3PZEA 4N4SA 3L8SA 2HXLA 3QZIA 4NK9A 1IR3A 4PL5A 5E8WA 5FM3A 3QRUA 3OTUA 3R21A 5F1ZA 1ERKA 2R3LA 3FL5A 3NEWA 2BDFA 2FO0A 3RK7A 3ZS5A 3E63A 2R3RA 3BWJA 5K0KA 3UNKA 5FEEA 2V0DA 3QQGA 2G2HA 2QOOA 4RX9A 4QMLA 4BGHA 4EEVA 3UQCA 2BR1A 4DGOA 4PTCA 3RAKA 2UW5A 3BHYA 4E93A 4PMMA 5DGZA 4X2KA 5AUUA 3MSSA 3QUDA 5KMJA 4E5BA 3F3TA 3FLSA 5ANIA 3ZZWA 2G15A 2QHMA 3MYGA 5AA9A 4QTBA 2BRMA 2VWYA 4L46A 2ZM3A 4EJNA 3UO6A 5LVPA 2PVFA 1H1PA 3MTLA 4OTHA 5H9BA 3WF6A 3DB6A 3U54A 1RJBA 4TTHB 2BIYA 4USDA 3KGAA 4XUFA 1URWA 2YCRA 2Z02A 4QMVA 3Q9YA 5EDPA 4FSMA 4MK0A 3R0TA 3GU4A 3H3CA 2UZLA 3Q9WA 3ZUUA 3L1SA 3P7BA 4DEEA 5A4CA 3HP2A 2XK4A 3UG1A 2IWIA 4JDIA 3OTVA 1XH4A 4YBKA 1Q97A 3IK3A 2W4OA 4ZTQA 5BVKA 5GZAA 5AUZA 3ZONA 5M57A 4IZ7A 3EFLA 3TIZA 3IGOA 4OR5A 5I3OA 4TW9A 3FI4A 5CNOA 4PP9A 4QP3A 5IH4A 4H36A 2CGVA 2X8IA 2VTMA 3OCGA 5IEYA 3HV6A 2WTWA 5E8YA 3R9NA 1PMUA 4CG8A 3HUCA 3KVWA 4FTQA 4R8QA 3DKCA 3O8UA 2Y4PA 4ZTLA 4E6CA 3BYSA 4CG9A 4BCQA 2CCHA 2NNWB 3TV6A 1HOWA 3Q60A 3R2YA 5HGIA 4DTBA 3QCXA 4CRLA 2A2AA 2F2UA 1NT2A 3OCTA 1ATPE 4FL1A 3C0HA 3O2MA 4C59A 4H58A 4K6ZA 4HOKA 1MQ4A 2JDTA 2WXVA 4DFNA 2Y4IB 1TKIA 4XBUA 4B99A 3D15A 3F82A 4D5KA 1XHAA 1VZOA 4K11A 2JKKA 2SRCA 4ZZMA 3LFQA 4JAJA 3QC9A 3K3IA 5AV0A 4DGMA 4BWPA 1J1BA 4FZAB 5CNNA 3GNIB 3ZRLA 1AGWA 1B6CB 2PHKA 2YDJA 4HVGA 2AUHA 3QBNA 2OZAB 5E8TA 2UZEA 4O96A 5HU3A 2RFSA 3OC1A 4WNKA 5DA3A 4U81A 3WIKA 4ONAA 3BWFA 4UY9A 4S34A 5HE2A 1OB3A 3MY1A 5CSPA 1PMVA 2VWVA 1ZYJA 2YCQA 5C8KA 2FSLX 3MH2A 4FF8A 1GZKA 4F70A 3DJ7A 1XH6A 3ZUTA 3ZO2A 4P90A 4G6NA 2JIIA 3KK9A 5HTIA 2WMXA 4R1YA 4CYJA 1JOWB 4HJOA 3SV0A 2OBJA 3LXLA 4O7TA 3WZUA 1OKVA 1WBSA 2QNJA 3IDPA 4FV2A 4C2WA 4D1ZA 3ZSGA 4AE6A 2VRXA 5G1XA 2YIYA 4DHZA 4L53A 4DEHA 4BDJA 3R7OA 4RVTA 4I93A 2A19B 3L8VA 3N51A 3BBWA 3BQRA 5H8EA 4F65A 5A4LA 2J4ZA 4GL9A 4CZUA 3G5DA 3QXPA 2WNTA 2WKMA 4ZTRA 1Z9XA 4LQMA 4EH4A 2GS7A 2X4FA 3EYGA 1A9UA 2PVMA 4FUYA 4BBMA 2BRGA 3EH9A 2Y9QA 5D12A 2P2HA 3DBEA 3SW7A 1JQHA 5HX8A 3K2LA 3TZ8A 3QYZA 2ZM4A 3FUPA 3ZRKA 2CGUA 3I5ZA 5TE0A 1ZXEA 3FXXA 1UVRA 3FV8A 5L3AA 5JT2A 2FSTX 4YZBA 3QLGA 3QA8A 4QP6A 2FH9A 5T6KA 5CANA 4MX9A 2YWVA 3OUNB 3RPYA 3GCSA 2XBAA 2ITZA 4BGQA 4ITHA 1UWJA 4S33A 4RLLA 4F6SA 2XS0A 3GQLA 5BVEA 4RT7A 2XNEA 3ORNA 4LL5A 4OTGA 3UYSA 5AAEA 2FA2A 4JQEA 2UZOA 1NW1A 3GC7A 5L4QA 4CLJA 3TKIA 3R6XA 2XK9A 4I0SA 4CQEA 2NRYA 4N6ZA 3E8EA 3F3UA 5E8XA 3VVHA 3ENHA 2C3JA 1BI8A 4U9AA 2C47A 3NUYA 4BY9E 4JS8A 4NM3A 4EK4A 4WD5A 4AACA 3ZSIA 4E6QA 3A62A 3TTIA 2RSVA 2PE0A 3BHHA 5E1SA 4PUZA 4EH7A 3SKCA 3II5A 3MH1A 2UW0A 3P23A 3ZO1A 2WPAA 4C7TA 4G3GA 4MF0A 3QCYA 3W0QA 4KIKA 3R1SA 4MUQA 4D4YA 3QLFA 4G9CA 4NW6A 4FKVA 1M2PA 4DA5A 2ZYBA 3EFJA 3C4XA 3ALOA 3DK3A 4FGRA 3ALNA 2Y0AA 3SRVB 4ENYA 2WMRA 2C4GA 4IAIA 3FMDA 3H4JA 3ZCLA 4O7YA 1Y8YA 3PVWA 3CBLA 1U54A 4X2NA 2HZNA 1YXVA 3OXZA 2J7TA 4ASDA 2XJ0A 4ENXA 5HVYA 2V7AA 4RZVA 5CSXA 1H1SA 4LMUA 5E8ZA 4FSYA 3OEFX 1GIHA 4OTDA 2HENA 4TYHA 4L3PA 3T3UA 3OWPA 3W2SA 3UP2A 3ID6C 5EYMA 4X6RA 1H26A 1V0PA 3R63A 3LAUA 2W7XA 1PHKA 1PKGA 4HZSA 4ALVA 3KVXA 4FEQA 4EK8A 4O0XA 5IH6A 4O81A 4L43A 2WZJA 4G3DA 5BMSA 2CKEA 4PDYA 3QF9A 3AMAA 3WF5A 5AV2A 3EQGA 3QD2B 5A4TA 1H25A 5IPJA 1DS5A 3E62A 5JFSA 3QA0A 4DH8A 4MEDA 5J1VA 3KEXA 3ORIA 3DFAA 4TWPA 4HNFA 4F1MA 2B9JA 2JITA 3HECA 3G33A 3HGKA 5BVWA 4FTJA 1LEWA 4YHTA 2C6OA 2IW6A 2XUUA 3TZMA 5F9EA 5DE2A 3TI1A 2ZDTA 5CEMA 4RWLA 5AP3A 4YC8A 4IAZA 4XG6A 3U87A 2F49A 5E8VA 1Y57A 2VTPA 4FTRA 3SDJA 4J96A 5JMSA 2YM6A 2A98A 2WQOA 2ZB1A 4QMWA 4OAUC 4FTNA 4WHZA 3OT3A 4MWHA 3COMA 3IKAA 3PJ8A 4KKHA 4A9TA 4LGGA 2PVNA 4QNAA 5FBOA 4BYIA 4E26A 4I22A 5FWKK 1PYXA 4CFMA 4EC8A 2WEVA 4I23A 3VS3A 4C57A 4O7NA 5BVDA 4B0GA 2R3GA 4MNFA 3VQHA 4QYHA 4BCMA 4JOAA 4CCUA 3DBDA 5AP2A 3AKKA 4O4BB 2RIOA 3BL9A 3I6UA 5LQFA 4JMQA 2W1EA 3Q04A 3NZ0A 4TNBA 5L2TA 3HRBA 4C58A 3QWJA 2Q83A 4GT5A 4X3FC 2R3JA 3DNDA 4AT5A 2OSCA 3E8DA 5GIPE 2YZAA 3C9WA 2C6TA 5DOSA 5AP5A 2O64A 3ORPA 1WVWA 1R78A 2PMOX 2WOUA 3R1YA 1F0QA 3QUEA 4YJVA 3DNEA 4H1JA 3AT4A 1XH7A 3LCOA 4PDSA 5HOAA 4RFYA 5ANJA 4M0YA 3PPKA 4U43A 1FGIA 3FC2A 3EWHA 5HD7A 4R3RA 3V5WA 2XCHA 3TWJA 1R0PA 2W5HA 3EYHA 4EORA 4I1ZA 1ZOGA 4J71A 5HLWA 2G9XA 3ZLXA 3HAMA 1W98A 4U41A 2WO6A 2B9HA 1DAWA 3PFYA 2E9NA 5C27A 3W0OA 3KMWA 3HV7A 4ANBA 3VONA 5IQGA 3UDTA 2X9FA 2XA4A 3O71A 4CSVA 4FTCA 3RPSA 2O3PA 3I4BA 4X6QC 2BUJA 1J7UA 3IOPA 3VBYA 1UNLA 2FYSA 1YHVA 2JFLA 4R5YA 4GJ3A 4ZTNA 3BGQA 3FMMA 3D94A 2FSMX 2ESMA 4IFGA 4DGNA 2B55A 2IPXA 2RFEA 2V5QA 4EHGA 3VNTA 2IO6A 1WVYA 5AR3A 4C33A 4RJ5A 4YNEA 4FKGA 4XV3A 5ETFA 2X39A 3NUUA 2XRUA 4AGDA 5CEOA 2JDOA 2QU6A 4MNEB 2GNHA 1PYEA 4MD9E 5A3XA 2QR8A 4ZZNA 2QOLA 3ZUVA 3QZGA 5FXSA 1ZWSA 5EK7A 5L2SA 1YOLA 3OWJA 5EQYA 3PXZA 3Q6UA 2OW3A 5HORA 1KOBA 3BYVA 3HMNA 4F78A 3LFFA 5E8UA 4WG3A 4C3FA 5LVNA 4FKUA 2Z7QA 2IZTA 3HMOA 4CMUA 2CNUA 5EM6A 3A8XA 4J8MA 3R71A 5DT0A 3T9IA 3QWKA 5JN2A 2Z8CA 4KS8A 3D5UA 1O6LA 3HRCA 1SNXA 4FIJA 3CC6A 4WBOA 4U0IA 1H08A 4L9IA 4IJPA 5EOBA 3VS4A 4CKIA 4EZ7A 2RG6A 3D9VA 1TVOA 5DH3A 4UXLA 4DHIB 4M15A 4DT8A 3P9JA 4MTAA 4YHJA 3R8LA 3UC3A 5BVNA 3OUKA 2OJGA 5J79A 3GENA 2X2LA 3PTGA 4CV9A 2E9UA 4YC6A 5D41A 5AA8A 2XH5A 2OH4A 4GW8A 4IHPA 3BE9A 4MXCA 4R7HA 5I9UA 2XMYA 4C2VA 2XIXA 3RPVA 3ZSHA 4F0GA 4H3PA 3CKXA 3HMPA 1XO2B 4FIEA 4HVSA 2J0LA 4YO4A 2O0UA 2J0IA 3UNJA 4U79A 2J90A 4XYFA 4G6OA 3Q2JA 4FKPA 2QC6A 3PY1A 4LM5A 5HG8A 4HPUE 4BF2A 4EBVA 4LV7A 2Z7LA 3HZTA 4APPA 1PXNA 3VIDA 3VQUA 4PMPA 4R7IA 3OS3A 1KE7A 1M7NA 3TCPA 4DGGA 1R3CA 3UTOA 3R1NA 1X8BA 4M67A 3UNZA 3F2AA 3I7BA 4L52A 2VTNA 3IQ7A 4Q5HA 1SNUA 4DC2A 5AV3A 2PUIA 3QALE 2UZBA 2C6EA 3BHUA 2OGVA 2ITVA 2DUVA 2PVKA 4N0SA 4UMQA 3POZA 4YHFA 3WARA 5AAGA 2PUNA 2XKCA 4O7VA 1P14A 4W4VA 3KIOC 4XRJA 3NYNA 4XLIA 4YNOA 5CENA 2OK1A 4BTFA 4XMOA 3CJGA 5I9YA 4Q2AA 2WTJA 3BYOA 3NYVA 4DBXA 3UMWA 4FNXA 4FI1A 4CEGA 2DWBA 4E6DA 5L6WL 1GNGA 2O5KA 2WFYA 1GAGA 3RK5A 3R7VA 3UGCA 2VWWA 4BCFA 4MQ2A 4EOPA 3EZRA 4UN0C 3Q5ZA 4GKHA 3C51A 3KXZA 3MI9A 4Q5EA 4ZS4A 1CTPE 3G9LX 4DG2E 4FKRA 5HO6A 4E3CA 4AP7A 3NYOA 3Q9ZA 4F7LA 3IDCA 4PPCA 1W8CA 4DT9A 3C0GA 5BYYA 2QG7A 4CD0A 1YI6A 1ST0A 4UWCA 2HOGA 4K9YA 3RCDA 3PVGA 4U44A 4HVIA 3QKLA 3QQLA 4O91A 5I5ZA 4KABA 4QDEA 2WQEA 4R3CA 4XH6A 4DEAA 5L2QA 2ONLA 2W4KA 5F4NA 3VJNA 4EOSA 1XBCA 2RG5A 4WA9A 4CFWA 5CSHA 4EL9A 5J7BA 3S3IA 1PXLA 4QYEA 2C6MA 4RIYB 1FVRA 5GJFA 3DQWA 4FT3A 4EZ5A 5HICA 4IZYA 3U4WA 4YUQA 5TR6A 3WE8A 5DEWA 2W1CA 1ZYCA 3TEIA 4ZY4A 4FEUA 3JS2A 3ORKA 3LKMA 4OUCA 5ETAA 4DYMA 2R3FA 1WBNA 2VO0A 4O0WA 4UEUA 2QOKA 1WBWA 4R3PA 4BDKA 4EH6A 4FVPA 4AW0A 3NAYA 4U5JA 5GZ8A 4D5HA 2IVSA 2ZDUA 3AC4A 2YISA 5L8KA 1RQQA 4DG0E 2KTYA 3K5VA 2JLDA 4MXAA 5A4EA 5TKDA 1PXMA 2PTKA 4FV3A 2YM4A 4ZSEA 3DLZA 4E5WA 2KULA 3IS5A 4O4FA 5FXQA 4RFMA 4RJ4A 4MVFA 1VR2A 1CKPA 5EFQA 4FKJA 4QP8A 3VF8A 1NVRA 3OFMA 5BVFA 4Z16A 3FBVA 4BCIA 4J7BA 2UW8A 5DNRA 5M4CA 4CGAA 3KXGA 3MPMA 4CRSA 4Q9SA 4C02A 4AZE<