2UW5A

Structure of pka-pkb chimera complexed with (r)-2-(4-chloro-phenyl)- 2-(4-1h-pyrazol-4-yl)-phenyl)-ethylamine
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
336
structure length
333
Chain Sequence
VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLTKLEFSFKDNSNLYMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLMIDQQGYIKVTDFGFAKRVKGRTWLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVINEKCGKEFSEF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/inhibitor
molecule keywords CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC SUBUNIT
publication title Identification of Inhibitors of Protein Kinase B Using Fragment-Based Lead Discovery
pubmed doi rcsb
source organism Bos taurus
total genus 107
structure length 333
sequence length 336
ec nomenclature ec 2.7.11.11: cAMP-dependent protein kinase.
pdb deposition date 2007-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2uw5A01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2uw5A02
1ZXEA 5M4CA 3PA3A 4M68A 5G6VA 3UNJA 4AZTA 4D2SA 3VS4A 3WILA 2W17A 3A7FA 3NIZA 5KMNA 2CGVA 2W7XA 5KKRB 4FTRA 1XH6A 4WO5A 4FF8A 5IMXA 4F1TA 4WNPA 5AUXA 5JN2A 1A48A 2VWBA 4UV0A 5CY3A 4DG3E 5KCVA 1QPCA 3EQDA 5DPVA 5IA2A 5AP5A 3IONA 3O50A 4NCTC 2VWVA 5CI7A 4AFEA 5JKGA 3IPHA 4KKEA 3KN6A 2PMIA 3NIEA 4MEDA 1M7QA 5EHLA 3Q96A 1PXOA 4FTUA 3QCQA 1JLUE 4IX6A 4PX6A 5CZIA 4IZ7A 4F7LA 5CAVA 2H6DA 2X8DA 3U6IA 3NYNA 4FSTA 3TUDA 1IR3A 4W8EA 4IJ9A 4DTBA 2C3KA 1JKLA 2VGOA 4ALUA 5J8IA 5D41A 1XHAA 5E8XA 3MVHA 2JITA 5C9CA 3EWHA 3LCDA 5FTGA 4FSQA 3U54A 4YSJA 3D7ZA 2OU7A 2O2UA 2PE0A 5GZ8A 3DAJA 4C8BA 4YZNA 1UV5A 1H1PA 3EFKA 5E8UA 2B9JA 2XNOA 3U55A 5GJFA 1H1SA 2A27A 4XG6A 3HMPA 2EU9A 3AG9A 2Z60A 5K3YA 4RIYA 5L2WA 2I0YA 2WOTA 3W16A 4PNIA 4CRSA 4JBVA 3JS2A 2JFMA 4U8ZA 3GC9A 2WTWA 4QTAA 4LL0A 4FKOA 3I0QA 5LVNA 2OIDA 3RWPA 5HHWA 3TG1A 3VUTA 1ZMUA 4CGAA 5M06A 3MIAA 2PE1A 3DTCA 4ID7A 2O65A 5IUIA 3HUCA 2UZDA 4Z55A 3K2LA 2PZYA 2GFCA 4PMMA 4LGDA 5IH6A 3QTZA 2XS0A 4M66A 5A4QA 3AOXA 2J50A 2IO6A 3IDBA 4FKRA 2VRXA 5ACKA 4D28A 5C1QB 4E20A 4YJPA 5I9UA 3QTSA 4U97A 3T3UA 2W1FA 3C0IA 1R78A 3PE2A 1WBVA 4PUZA 3K3IA 3G0EA 3NUNA 2HWPA 1GIJA 3QKMA 3Q9WA 4MCVA 4C4IA 3I7BA 1YWVA 2R3IA 4NT4A 3V04A 2HY81 4UYNA 2R0IA 3NAYA 3KC3A 5E92A 4YJQA 2R3FA 3H0ZA 3RPYA 5CSVA 1JNKA 4DBNA 2GQSA 5GINE 2QG5A 2VO0A 2XA4A 3OD6X 4BZOA 4G34A 3DTWA 1M52A 3C4CA 3P4KA 2B55A 4MXOA 3VUKA 5J1VA 4E5BA 5HE2A 4N70A 3VBWA 2B53A 2X7FA 2ZAZA 3D5XA 3ETAA 3R1SA 4H3PA 1YKRA 5HO6A 4FT0A 2HAKA 3F7ZA 3ZHPC 3ZO3A 5FDPA 5JQ8A 2XH5A 5GIPE 4OTPA 1OKWA 3EYGA 3U4WA 3ZUVA 2Z02A 2JDTA 3NX8A 4K2RA 2VTMA 5L2QA 4D1ZA 4DC2A 3ZDUA 3CLYA 3QKLA 5KMMA 1JKSA 4EZ3A 4O0RA 5CNNA 4BCFA 3K3JA 4BTKA 2B9FA 3PXZA 4F64A 4RIXA 1YHVA 3JVSA 5BVDA 5KMKA 4C61A 4U3YA 5HLPA 5EW3A 4KB8A 4ASXA 3CJGA 4BCJA 3H10A 4QP4A 3FHRA 2R2PA 2XM8A 5EDRA 3COKA 1IRKA 4RZWA 4IB0A 4AE9A 1XKKA 1ZOEA 4ZAUA 2BHEA 2RGPA 3NEWA 4AN9A 3OEFX 3HV5A 3HEGA 4KUJA 4IACA 4XG2A 5D12A 3MB7A 1OUYA 1ZRZA 4L43A 5B2MA 2W5HA 4IDVA 3BWFA 2GU8A 4BTJA 3NCGA 3ORXA 4W4XA 4Y73A 4JOAA 4F63A 1URCA 3Q6WA 4IIRA 3SXSA 2GHLA 3IDPA 1TQIA 3NUSA 4G6NA 4UY9A 2CN8A 3LXKA 2QODA 4QMSA 5BVNA 4RMZA 3EKKA 1OVEA 4AGCA 3UP2A 4NWMA 4HJOA 4QPAA 5F95A 5EW8A 4O7LA 3OCBA 1PXNA 4IVAA 2EB2A 4O6LA 4PQNA 3F5PA 5E7RA 4YTFA 1H24A 5IUGA 2GHMA 4YJSA 3W55A 3ZU7A 5HZNA 3BCEA 3TUBA 4GVAA 3SGCA 5EFQA 3UJGA 3UIBA 2ITNA 3OW3A 5CANA 3MJ1A 3LKMA 4Y5HA 4WNKA 3ROCA 4HYHA 4PMTA 3WE4A 4DH1A 1Q41A 2DUVA 2YERA 4ZS4A 5DI1A 1QCFA 5LVPA 3GCUA 4BCQA 4X3FC 5EOLA 5FP5A 2BRBA 3F3WA 4FG8A 2PPQA 4XV9A 3DXNA 5I4NA 1SYKA 3ZZWA 2XVDA 2F7ZE 4MXCA 3DV3A 4GJ2A 4EHGA 2ERKA 2G15A 4CMUA 3H4JA 2JDSA 2XIZA 1YDSE 3MW1A 3U6HA 5E91A 5LCKA 2W1HA 4FKSA 4RLLA 4FV9A 4JLCA 2XIRA 3OY1A 4M3QA 3V5LA 5K9IA 1DI8A 4R7HA 3KF4A 3UYTA 4TYEA 1PYXA 2O3PA 3H9RA 3Q3BA 1QMZA 2VNWA 1H01A 4JG6A 1YWNA 5M4UA 4QOXA 4RQKA 3WZUA 4XG8A 5TO8A 4CZYB 3LCKA 4EOPA 5DRBA 5HD7A 3R7IA 1KE8A 2XKDA 4YTIA 1WVYA 4AZFA 5FXSA 4RX5A 4BCOA 2VX1A 4CD0A 3ANRA 4JBPA 4O1OA 4E4MA 3KRXA 1B6CB 3R1YA 4OBPA 3C0HA 1H25A 3FMDA 5HI2A 3OROA 3QXPA 4PTGA 3NWWA 4QMUA 3R9HA 4GFOA 1P4FA 1ZMWA 3BZ3A 4DT9A 4XLVA 5J5TA 3VF9A 3CIKA 3SV0A 3PY0A 3QFVA 5A4EA 3DK7A 3PVUA 1PRYA 3QZHA 1G8SA 4AZVA 4F0FA 4W9XA 3FKLA 2XYNA 3O71A 1PHKA 3DKGA 4IBMA 4J8MA 3W32A 1UU9A 4ANOA 1FPUA 4UWCA 1Q5KA 5AV3A 4R8QA 4FZFB 4D0WA 4CYIA 3TJCA 3ZXZA 4LI5A 5JGAA 2QD9A 1YOLA 2QR7A 2GS7A 4J96A 4ANBA 4WA9A 5A4LA 2W1IA 2W1EA 2B4SB 1UU3A 1GIHA 3DGKA 2XK7A 1NVRA 3PRIA 2W1ZA 3R1NA 2BMCA 4K1BA 4U3ZA 2X0GA 3UTOA 2P55A 4C4GA 2YHVA 5EHYA 4F6WA 4C4HA 4EOKA 2VGPA 3CR0A 3C4XA 5GJDA 4F1OA 4QMNA 4N4SA 2PHKA 1WFCA 2C1BA 1Q8WA 4L67A 3PLSA 3DBFA 3WF8A 5EYKA 4O7ZA 2VN9A 4GCJA 4AF3A 3COMA 1ZZLA 3CTQA 3VBYA 4CRLA 3PE1A 1OECA 5AUZA 4IDTA 4B99A 3ULZA 5FQDC 4WD5A 5M07A 5LWNA 1JPAA 4FSWA 3GENA 3QQFA 4E5WA 3FQHA 4TZRA 3OUKA 1UKHA 2R7BA 3GC0A 4JX3A 4CSVA 1Z5MA 4EKKA 4BI0A 5AA8A 4JAIA 3UG1A 3UVRA 5FBNC 2E9NA 3NR9A 3Q9XA 3PXKA 1U5QA 3DKCA 5DT0A 4EHZA 1URWA 4AS0A 3RTPA 2XNMA 1RQQA 3P1AA 4K11A 4DF3A 3SW4A 5LMKA 3ORMA 3QL8A 3LFSA 4AGUA 4MF1A 3IW5A 3F3UA 3NZ0A 4CCUA 4ZLOA 4LOOA 2ONLA 3CSVA 3DFCB 2RG6A 3HGKA 5DGZA 3Q4TA 3ANQA 5H3QA 3EQPA 4KBCA 4KAOA 3RWQA 3R7YA 3PXYA 2B7AA 2ITZA 3GNIB 1NY3A 3TIZA 4X7QA 4GVJA 2XJ0A 5HE3A 4DFZE 2P2HA 4YNEA 5M53A 3G9NA 4ANLA 2OK1A 3UNZA 3VS0A 5CXHA 3ZONA 3CY2A 4FSZA 3OY3A 3KULA 3FPMA 5IQDA 2W1DA 2GNJA 3WZKA 3DBEA 4P5ZA 3WYXA 2WKMA 3R28A 4K6ZA 3BELA 4KIPA 4R5SA 5IF1A 3PG1A 4DITA 4U9AA 4EK3A 1RW8A 3I81A 2UW4A 4FTLA 2X9EA 5K5XA 2ITVA 5L4QA 5M09A 1TVOA 3GEQA 4WG5A 2I0HA 3RAWA 1K2PA 3VBVA 2H9VA 4PMPA 3POZA 3QTXA 5AR4A 3OG7A 3GC8A 4BDJA 2UZLA 1VJYA 2FGIA 2BRGA 5DHJA 3MSSA 3R2YA 4FKTA 3AC1A 3FI2A 4NFNA 2WEVA 4WT6A 5E8SA 4FVRA 2JLDA 3QU0A 5E1SA 3BEAA 2G2HA 2IPXA 2I0EA 2PY3A 2PULA 2R9SA 4YGAA 2R3PA 2Y8OA 2DS1A 3R02A 4ORKA 4CFFA 5AA9A 3WI6A 3B8QA 1UU7A 4HYIA 3MH1A 1APME 5M08A 5KNJA 4U5JA 4ZLZA 3ZO1A 3ZLYA 3AC3A 4YLKA 4FV5A 2WAJA 4MVFA 4RC4A 2ZV2A 4MBLA 5FEQA 5DEWA 5F94A 5ETIA 4EHVA 4PDOA 4J97A 1H0VA 2EXMA 3IO7A 3AD6A 3K54A 2QNJA 3AGMA 2GNGA 2CGUA 4E1ZA 3FLZA 3EB0A 4YZCA 3I5ZA 4HGEA 4RX9A 2VWWA 3POOA 3R8ZA 4AT5A 4R78A 1H8FA 3D2IA 1ZOGA 3I5NA 2YIRA 4O0UA 3S2PA 2C6IA 2WMSA 3H9OA 3KK8A 4E8AA 4F99A 4FTNA 3TIYA 4BICA 2VTOA 2GSFA 1Y91A 2ETRA 3FI3A 4FV6A 4IX3A 5DIAA 2GTNA 5ANDA 4BF2A 4MH7A 2IZRA 3THBA 2PUNA 4FEXA 4W4VA 4DFXE 4AFJA 3E92A 3QUPA 1OBDA 3MFRA 3PXQA 3I6WA 3KCFA 2FUMA 5CF8A 5ETCA 3PPZA 3R22A 4ZTNA 2X2MA 5FTQA 2X8IA 3C4FA 4MXYA 1O6LA 4AACA 5F20A 4H36A 1RE8A 4D1SA 5ANGA 1WBPA 3LQ8A 3UOJA 2PSQA 3RAIA 4O7YA 2XIKA 3PYYA 4J53A 5EKNA 1QPEA 2NRUA 2XNEA 3NMUF 3BU5A 3AD5A 2XCHA 2ACXA 1KE7A 2CN5A 2EB3A 2QOQA 2A19B 3CXWA 3FQSA 4IAKA 3DK3A 2KTYA 3ZRMA 4DT8A 3OOGA 2GNLA 3PIYA 3CKWA 3DJ6A 1HCKA 4IC8A 2WMUA 5DT3A 5C8MA 3DKFA 3FMHA 4DAWA 3E8CA 4XCUA 3R83A 3LFNA 5DBXA 1DS5A 2A0CX 5I9VA 3CJFA 4PDYA 3VJOA 3QLGA 4MBIA 4BZNA 3WF6A 1OIYA 3SG9A 4FV2A 2WQOA 5D1JA 5B0XA 3DZOA 2QQ7A 4L3LA 4G3FA 4ZJVA 3RZBA 5TKDA 3EYHA 3QGWA 5HG5A 1YI4A 3FLSA 4EH5A 4F4PA 2WOUA 4B0GA 4IC7A 3TJDA 1ZMVA 2IN6A 5J95A 2VWYA 4XEYA 5HCYA 4P5QA 1RDQE 4JDKA 1Y8YA 1UNLA 2VV9A 5CNOA 4BBEA 2YZLA 3HKOA 3OUNB 1SVGA 4II5A 4MQ1A 4RZVA 2BZHB 2QCSA 3T3VA 4O2ZA 1IAJA 3PRFA 3QYWA 5AP2A 4U42A 3ZBXA 1M17A 4BY9E 3TNHA 2OF4A 1I44A 4FVQA 3VS5A 2C3LA 3N51A 3RALA 5DE2A 4TL0A 1Q8TA 1AD5A 1BI8A 4Y72A 4MBJA 3CQUA 3VS2A 1U54A 4HW7A 5M57A 1O6KA 3LE6A 2JD5A 3ACJA 5CENA 4QYGA 4O0XA 4FG7A 2BRNA 1BYGA 4D2PA 3MPAA 4DGNA 5J7BA 1NXKA 2CGXA 3C4WA 3QQLA 3U87A 5A54A 1XBBA 2ZYBA 2OXDA 4XV1A 3GQIA 1JVPP 2XK8A 5DRDA 3NUPA 3UQGA 4IM0A 4WSQA 3FV8A 4U0IA 3ZZEA 3ENHA 4RG0A 3OVVA 1NA7A 4YC3A 3LMHA 3CPCA 5ETAA 4FTCA 4DEIA 3D4QA 4M14A 3UP7A 2J5FA 3U6JA 5FLFA 4ACHA 3DXPA 4UWBA 2WQNA 1UU8A 2W4KA 3BI6A 1PKGA 3Q9ZA 4BCKA 3DJ5A 4HVGA 3DB8A 4U80A 2OJIA 2YLFA 3W2QA 4L45A 4QD6A 3SQQA 4GT3A 4BDFA 3LFEA 4EOSA 4RPVA 2GNIA 5EHOA 1TKIA 1ZWSA 3O2MA 4G3DA 1A06A 4J71A 3DA6A 3DU8A 4CFWA 5K5NA 4GRBA 2BHHA 4DFNA 4FTKA 4FYOA 1W8CA 3P9JA 4IWOA 3W8LA 4BCIA 3G6GA 1OPJA 5HKMA 4FL1A 2ZOQA 1PF8A 3LLTA 4XOZA 4FE2A 2JAVA 5E8ZA 4MF0A 2UW3A 3MPMA 5CTPA 4M7IA 2FSMX 2XK4A 4NZWB 4JDJA 2VTJA 3LCSA 5K4IA 5AUUA 4GK3A 3FSFA 4QO9A 3II5A 4Q5EA 2ZB1A 4DINA 4F6SA 4JRVA 2J51A 4O82A 5GNKA 4M69A 3FC2A 3FMNA 2PZPA 4EOIA 4IZAA 2QO2A 5JT2A 4DG0E 4EYJA 3H3CA 1DI9A 2IZTA 2Z8CA 4ALWA 2W1CA 4CXAA 4EI4A 3R00A 3LIJA 3VUHA 4E4NA 3WZDA 2HWOA 4FZAB 3AT2A 4OTQA 2RIOA 1IEPA 4BCNA 2X2KA 4NIFB 4Y8DA 1XR1A 3OZ6A 4PPAA 3FL5A 2WELA 3HLLA 2QURA 2HELA 3EQFA 5HORA 1W83A 3PA5A 3UOLA 2QOHA 3ZRLA 4BFMA 4DGMA 2Z2WA 2VU3A 4FK6A 4QP3A 4C57A 4EH2A 3E87A 2YAAA 1LUFA 4I23A 1ZZ2A 4W4YA 5EKOA 2H96A 2GTMA 3V6RA 4DEHA 4Q9ZA 2J9MA 2PZ5A 3BYOA 3HRFA 3ZCLA 4TYGA 2WTJA 4FL3A 4A9YA 3NW5A 5A4CA 5AP4A 4NK9A 3CBLA 2J4ZA 3C0GA 2RFNA 4V0GB 2YCSA 2ITWA 2VNYA 1BI7A 5KHXA 3AT4A 1GNGA 5KX8A 3CEKA 5IA1A 3M42A 4ZXTA 3PXFA 4PL5A 3OT3A 3LJ1A 3E7VA 3G90X 4IE9A 4TWOA 4ENXA 2G01A 4EK6A 3HA6A 4I3ZA 1PXLA 3E64A 4IVBA 4ZTMA 3LLAA 4N6YA 4EH9A 2XB7A 3EN7A 3OBJA 1V0PA 3M2WA 4FZ7A 4S32A 2YAKA 3OMVA 5EYMA 4YNOA 3RI1A 4FOCA 2GDOA 3BGZA 3ORZA 3LFDA 3PPKA 1OBGA 3ZO4A 3MIYA 1Q61A 4FBXA 2UW0A 3F2NA 3GUBA 4O38A 2VWXA 3HRBA 5KZ0A 4WG3A 4Y95A 4C2VA 4O0WA 4LFIA 2WPAA 1ZARA 4YURA 4N0SA 1ZAOA 2X7GA 2IVTA 4FSMA 4D0XA 2UZNA 1OKYA 2AYPA 3FYJX 3O8PA 1Q3DA 3QRIA 3W1FA 4QTEA 5HBJA 2BPMA 4FVPA 5IG1A 4JBQA 4BKZA 2JAMA 2C68A 4YR8A 1IASA 3PWYA 2F7XE 3UZRA 3KL8A 3FQEA 4BIDA 3OS3A 1UWJA 3FLNC 4HVIA 1O9UA 2WHBA 3OTUA 2YCRA 3R04A 4IB5A 4S30A 5BPYA 4GG7A 4KBAA 3DKOA 4Y46A 3UNKA 2B52A 2ZMCA 3GGFA 3BLRA 5BVFA 1YXTA 2F49A 4E6DA 2BZIB 3ORIA 3OXIA 4GYGA 2OLCA 4WNOA 3JXWA 2YISA 3OWLA 3TNWA 3ZC5A 1E1XA 3QTIA 5M56A 2I6LA 4JNWA 2V7AA 3CD8A 4FKWA 5BVEA 3SKCA 4EK8A 5I9XA 3OT8A 4U44A 4YC6A 4GEOA 5IUHA 2OICA 4OTHA 3S4QA 3V6SA 3ORKA 3F7WA 4G1WA 2OJ9A 4DTKA 3F69A 4NJDA 3FZPA 4GT5A 4XRJA 3RPOA 5K4JA 2XBJA 2WTKC 4J95A 4I93A 3OWJA 3R7GA 4WUAA 4ZJIA 3VAPA 3MH0A 5I9YA 1OL2A 4UB7A 4HZRA 4NEUA 4NM0A 1M14A 4E5AX 1OIRA 4IJPA 2YM3A 3BLQA 1G3NA 3O7LD 4OT5A 3JVRA 3HMOA 3GBZA 3TNQB 2GNHA 2J5EA 4NU1A 3GFWA 4KRDA 2G2FA 3FSKA 3TTJA 2UZVA 5CVGA 5CAUA 3ATSA 4HGSA 4RIWB 2CKEA 5HVJA 2WQEA 3TDVA 1WBTA 5EH0A 2J0JA 5JK3A 3VO3A 3OXZA 3UZTA 1KV2A 2ITYA 2ZV9A 2PUPA 3EHAA 4AZSA 4O83A 5J9LA 4PPCA 4F09A 1ZYDA 5AV1A 5CF5A 2GS2A 3BGQA 4CT2A 1IAHA 3P7AA 4MQ2A 4MWIA 4PF4A 3G33A 4KIKB 2I0VA 2FYSA 4FEWA 4NSTA 3L9NA 4FC0A 2J0MB 3PWDA 4GV1A 2QVSE 4CMOA 4DLIA 1NVSA 3FMLA 3QKKA 4P90A 1G8AA 2XJ2A 4M67A 3UPZA 5GIOE 4F7SA 3KXGA 4D5HA 5H8BA 2C0OA 3I6UA 4EH8A 1T46A 5LJJA 2XIYA 1PXPA 4FTTA 4BZDA 4AAAA 3Q2JA 3WF7A 4BGHA 3NDMA 1H26A 3QD3A 2BDFA 3F3ZA 1LR4A 3PUPA 3HP2A 4FIFA 4AX8A 4JG7A 5HE1A 4HPUE 3AXWA 3F82A 5ACBC 3TNPC 4PV0A 2Y4IB 3ACKA 3I60A 3KGAA 3MA6A 2YACA 4R6VA 4QMVA 3DBDA 5DNRA 3GCSA 4GK4A 4ZTQA 4BDIA 4YUQA 5IDNA 2C6OA 2GS6A 5AUTA 2PUIA 4MK0A 3HRCA 5D7AA 2ZDUA 2PVNA 3H9FA 2X6EA 3IGOA 2WMVA 4CFNA 1SMHA 4TNBA 4BDAA 4C4JA 5HU9A 3BYUA 3TKIA 1Q97A 5H2UA 2F9GA 4I21A 4APPA 4DGGA 3MFSA 5IA0A 3MS9A 3CPBA 3HECA 4F7NA 4F9CA 4DFUA 4DGLC 2HZ0A 1K9AA 2C0TA 3MGYA 2A2AA 5A6OA 3RM7A 1PJKA 1W7HA 1KOBA 1EH4A 3MVJA 2IWIA 4OTGA 4XH6A 1E1VA 3ET7A 3IW4A 4NM5A 2YA9A 3F2RA 2ITTA 3DNEA 4GG5A 1YXVA 2Z7SA 3BHUA 4UMRA 4X6QC 3UG2A 4IB1A 1JSTA 4IVCA 5M4IA 4FSUA 5CEIA 3LOKA 3HP5A 3V5TA 3Q60A 2JDOA 3R8UA 2Y6OA 3QLFA 5HGIA 2QONA 3EIDA 3FL4A 3IW7A 3DQXA 4USEA 5EQYA 4YJNA 5FUTA 3UO5A 3QRJA 1XH7A 4XG4A 5FEDA 5JGBA 1BLXA 3BX5A 2W05A 3BQRA 3Q6UA 3GC7A 3LM5A 3UDBA 3KVXA 4KS8A 2VZ6A 3RHXA 1YDRE 3RPRA 3WZEA 2CNQA 3N4VA 5AX9A 1WVXA 1GZOA 3BE9A 3KB7A 3MESA 4L53A 4L44A 1KWPA 4QP6A 1FQ1B 4KIQA 4ZEGA 3D5UA 3CKXA 3R2BA 3UODA 2V0DA 5HQ0A 3TWJA 4I5PA 4PTCA 3BIZA 5CT0A 2B9HA 4MNFA 1OPKA 2PZRA 5C8NA 4QTCA 4W9WA 4ZMFA 3SG8A 2HW6A 4QTBA 2V22A 4BDGA 4Q5HA 3RHKA 4QP9A 2NRYA 2F4JA 2XEYA 4BDBA 1REKA 4RIWA 4LUEA 1GOLA 4PWNA 2YABA 5BYYA 3RK5A 3FMJA 5HLWA 3L8SA 1WBNA 1Y8GA 4D4VA 4CMTA 3LJ2A 3QRKA 5CU0A 4XBRA 3VS1A 3VS3A 1GAGA 1OKZA 3AT3A 3MY1A 3DXQA 5IISA 4AW0A 4DE4A 2ERZE 3FXXA 4XP3A 5IA4A 5B2KA 3UGCA 5JEBA 2YM7A 4GU9A 2BDWA 4FICA 3MVLA 1YOJA 1UNGA 3DAEA 4LL5A 4ZK5A 3R9DA 4A4OA 2VTLA 4FIGA 5ICPA 3BYMA 4BB4A 1B39A 2I1MA 3KXZA 4FZDB 1SNUA 2IVUA 4ACMA 5KO1A 4QYFA 3Q53A 1KE6A 4NTSA 3D14A 1Q8UA 4RA4A 3GT8A 3R7UA 3W2PA 5CXZA 3EN9A 2CKQA 3A2CA 5IQFA 4RQVA 1FGIA 5IH4A 2IW6A 5AP3A 4ARKA 4AN3A 3VF8A 3CTHA 4QNYA 4YO4A 4O96A 1XWSA 4WIHA 3CC6A 3PJ3A 1P2AA 4R1YA 3Q52A 3QZGA 4CLJA 4ZY4A 2YIXA 2IW9A 5J7HA 2VTAA 5A6NA 4IZYA 5CYIA 5AR2A 5DH3A 3VQUA 1Q4LA 4JL9A 3UOHA 2P4IA 4RBLA 2CGWA 2VTPA 3LXLA 2UW7A 4DFLA 4HPTE 1G5SA 3WIKA 4C02A 3BV2A 5JFWA 4XJ0A 3WE8A 3OBGA 4WSYA 2UW8A 1YI3A 3FMKA 2XM9A 3FI8A 4RWKA 4A4XA 4QNAA 2WIHA 3CTJA 4AZEA 4DYMA 3VS7A 4EC8A 3IGGA 3HNGA 3VBXA 1KSWA 4I0RA 3Q4ZA 4X2NA 3JYAA 2OH4A 3PY3A 3ZOSA 1J7LA 2WTDA 4QP2A 4YZDA 4BI1A 3F5XA 2BCJA 4WRSA 4ANQA 5E8YA 4NKSA 4A7CA 2C5NA 3MN3A 4GKIA 2UV2A 3EFLA 4WNMA 5HTIA 1R1WA 3FZTA 4X6RA 2OKRA 4MTAA 3FWQA 2JEDA 3FKNA 4FMQA 5D7VA 5IQBA 4K9YA 2GFSA 1YHSA 3TN8A 2JKOA 3UPXA 3BYVA 4PL4A 4ASEA 4UMPA 2QU6A 3IDCA 4FX3A 4GIHA 2KULA 4YHFA 4AW1A 1XH4A 1CDKA 3D5WA 3PIXA 4KKHA 4OTWA 4AUAA 2RSVA 4UALA 3R8PA 5DA3A 1M2RA 3EH9A 3HX4A 4E4LA 3C51A 1JKTA 3QYZA 3MBLA 4J99A 4RX8A 2UW5A 5I3RA 1STCE 4CKRA 1H00A 3TZ9A 5DEYA 5FEEA 2UZTA 3PTGA 4ZSEA 4F7JA 3A61A 3D7TB 4EK5A 4TNDA 1VZOA 4A9RA 5IKWA 3W2CA 4NM7A 3O23A 3VHEA 3D5VA 2Q0NA 4FV7A 1PXKA 1VEBA 4QMXA 4BCGA 5CEPA 5IZFA 2IVVA 4BVUA 4CZUA 1YOMA 2UW6A 3KY2A 1R0PA 3BBTB 3HMMA 3ORPA 3UIXA 5AADA 4NUSA 5HIDA 4G31A 4I1ZA 5HVKA 3BE2A 3CCNA 3HV3A 3KRLA 3LQ5A 3PZHA 3ZEWA 3RNYA 5BYZA 2YEXA 3PVWA 3VN9A 1YQJA 4PRJA 4AT4A 4GUBA 3MH2A 1H27A 3FE3A 3UO4A 4B7TA 4B9DA 3HL7A 3QQKA 4IXPA 4LGGA 2RKUA 4BDEA 4E73A 4GMYA 3CD3A 5CEMA 4IEBA 2CCIA 2HZ4A 5LCJA 4QQTA 2IG7A 3ZC6A 2QOFA 4G3GA 3B2WA 3EOCA 4WKQA 4HVHA 2CPKE 1Q99A 2QLQA 4ACDA 4M15A 4AGDA 4GJ3A 3VW8A 4EJNA 4FG9A 3I79A 3W33A 2I7QA 5DWRA 3ENMA 3O8TA 5GZ9A 5AV4A 4BDDA 4R7IA 3LFQA 3W2SA 3HA8A 1DAWA 5T68A 4K18A 2UZBA 1R0EA 4YZ9A 3TV6A 3A7GA 2YJSA 2WMXA 4EBVA 2BFYA 5I9ZA 3KU2A 5HVYA 4O2PA 1OITA 5FXQA 2LAVA 3R8MA 1Q62A 4FKQA 2HZNA 4LGHA 3T9IA 2C5VA 3QD0A 4JQ8A 4ERWA 4RT7A 1H4LA 5L8KA 3KVWA 1J7IA 4DTAA 3W10A 2RG5A 2W99B 3D2KA 3DBCA 4LUDA 2QOOA 5CI6A 3G15A 4HOKA 3EFWA 5HG7A 3L8XA 4CFXA 4ZMEA 2BZJA 2J2IB 4AOIA 3VBQA 5JFSA 4HNFA 1NT2A 3QX4A 3EMGA 1PY5A 1CTPE 3UIUA 3TNIA 3VIDA 3ZTXA 3I4BA 4BYJA 2JBPA 1ZYSA 4PTEA 5ANJA 4F6UA 4NL0A 4R7BA 3C4ZA 3HZTA 4NM3A 4YLJA 2YWPA 3R9RA 3ZSGA 2Z7QA 5ANKA 2VTRA 2HYYA 2BILB 2XEZA 3I1AA 3DZQA 3UYSA 3BPRA 3F6XA 3WYYA 2FB8A 3PJ1A 4CFUA 4PMSA 4XBUA 2VTQA 2O0UA 5FGKA 4FUXA 3F88A 5LWMA 3S1HA 3WZJA 2XK3A 4G9CA 2ZV7A 2C3IB 1OUKA 3KMUA 4O1PA 2HY0A 3AC2A 4ZSLA 3ZBFA 5FXRA 3EN6A 5AR5A 2JGZA 4QP8A 3QZIA 2WMTA 3BKBA 2VUWA 5L6WL 3COHA 3PVBA 4GKHA 2HZIA 2VO3A 1ND4A 2BIKB 3EL7A 5HG9A 3R73A 4M84A 5CZHA 4CKJA 3ID6C 5CVFA 4IVDA 4R3PA 2IJMA 4G2FA 4AXAA 1FGKA 2C3JA 5KBQA 2PL0A 4UZDA 4E26A 1P5EA 5AX3A 3ROYA 5GHVA 4NYEA 3TZ8A 3ZO2A 2OF2A 5E4HA 2ZM1A 4FTAA 3BWJA 3DY7A 4U43A 2NP8A 4HZSA 3WOWA 3DLSA 1MQBA 2YN8A 3FJQE 4FYNA 3GI3A 5JZJA 4X3FB 2QO9A 2HOGA 1TQPA 2QOIA 3FHIA 4FIIA 4H1MA 2W0JA 5CVHA 4QQ5A 1MQ4A 3LFFA 2XNNA 2YM4A 4RJ5A 5FP6A 5IU2A 3SRVB 3E8DA 1QL6A 4EOOA 1Y6BA 2Y7JA 3Q4CA 4AP7A 3DDQA 5I3OA 5KMLA 3DFAA 3AMYA 2R3RA 2YFXA 3BHHA 2R3MA 4FNZA 4NH1A 1XH9A 4P4CA 2PVKA 3PSBA 3LCTA 3D0EA 3B8RA 2XBAA 4D5KA 3L8PA 5ITAA 3QALE 5AP0A 2XKCA 1F3MC 2FSOX 2GCDA 2C5XA 3GU4A 3KXHA 4H58A 4JIAA 4QMWA 3WF9A 2ZV8A 3ODYX 1UNHA 4LOPA 3R7EA 4ASZA 4FNYA 4M0ZA 4RWIA 3C4EA 1LEZA 3FKOA 3OTVA 1T45A 2OXYA 2DQ7X 4BCPA 2OO8X 1REJA 3R7OA 4KNBA 4CNHA 2C47A 5HNGA 2R7IA 4KINA 3V5JA 2VX0A 5TF9A 4BIEA 3GOKA 5AEPA 4HVSA 4JG8A 4EQMA 1ZLTA 4RLKA 3OC1A 3SVVA 2WB8A 5H8EA 4RJ3A 3RK9A 1SZMA 4U40A 1FBNA 2QLUA 3QD4A 3PA4A 1BMKA 5HNIX 2Y6MA 4TWNA 3SLSA 3SOAA 4EUUA 3T9TA 4KBKA 4TYIA 2WTVA 5EYDA 4C3FA 4V04A 4APCA 4BC6A 4O7SA 2E9VA 3GFEA 2PMNX 3CQWA 4MNEB 4D2VA 5BVOA 4JRNA 3ZEPA 4XV3A 1JSVA 1FMKA 3FI4A 4MXAA 4I22A 4D2RA 3TZ7A 2W5AA 4QMZA 2VWUA 4J98A 1ZYCA 3FLQA 4MWHA 4RFMA 3M1SA 5ANIA 2AC5A 5TE0A 4BDKA 4D9TA 2JDVA 2X9FA 3F5GA 5F4NA 4S2ZA 2IZUA 1WBSA 3C1XA 4WHZA 3MVMA 1PXMA 4AGWA 1PYEA 3E3PA 2YIWA 2PE2A 2Y9QA 3VVHA 4AE6A 2R3GA 2R5TA 4F9YA 1JBPE 1JWHA 3BGPA 5D11A 4USFA 5HNBA 5AMNA 3NVKI 2UZWE 4MXXA 4Z9LA 4FODA 3V5PA 2BRHA 3IECA 3AQVA 3N4TA 4EH4A 4IQ6A 5IH5A 4OTRA 3E63A 4B8MA 2PVLA 3KRWA 2CNVA 3ZRKA 1HCLA 3UIMA 3DNDA 3U9CA 2JIIA 3EKNA 4D55A 5HE0A 2WFYA 5JQ5A 2OW3A 1O6YA 1ERKA 2J0KA 3DJ7A 5EI2A 5AV0A 4TW9A 4ZTSA 2BAQA 3DB6A 2JFLA 2V55A 5AWMA 5BUIA 4UMUA 2GNFA 4G6OA 5HCXA 2O64A 3ZM4A 4EQCA 4XV2A 3CGOA 1WBWA 4O7TA 3Q2MA 4LG4A 2ZMDA 2YJRA 4U6RA 5HO7A 2J0IA 4ZTLA 4C4FA 3EJ1A 4J52A 4O7NA 3DPKA 5BVWA 4FEVA 2FH9A 3AC4A 2ETMA 4LOQA 3TKHA 4YJUA 4U81A 3FBVA 3S3IA 1YHWA 5EW9A 3OFMA 3IW6A 4L68A 3EQGA 4YZBA 3NUUA 4FSNA 3KREA 4ANNA 4C34A 3RKBA 2YDJA 4IMYA 3QCXA 4DEEA 1TQMA 3P08A 3R7VA 3T8OA 4ZZNA 1V0OA 4ZSJA 2PK9A 3EQCA 4X3FA 2OIBA 4BCHA 2BKZA 3L9PA 1BX6A 3NLBA 3QTUA 3WBLA 5JMSA 3E93A 2OZAB 4QRCA 3ODZX 4B8LA 4CFMA 4M0YA 4A06A 5CEOA 1VYWA 5EQPA 2F2UA 2GPHA 2ZVAA 2X81A 4FK3A 5HTCA 5EM7A 4S33A 4BKJA 4TY1A 3QCYA 4G5PA 3WARA 5I5ZA 5DFPA 5EDPA 4HYSA 3GB2A 5M4FA 1JQHA 4KSQA 1WZYA 4H3BA 4UWYA 3AC8A 1GY3A 3KXXA 4C3PA 3Q9YA 4AN2A 2BUJA 4PDPA 4AOTA 4I6FA 4C37A 5IEYA 2VTTA 3LPBA 5CU4A 3S95A 5DMZA 4F9AA 1B38A 2JDRA 4W8DA 4CTBA 2XK9A 5LVOA 3QQGA 3S0OA 5ETFA 2JC6A 2Y0AA 2PWLA 3QWKA 2WQMA 4G9RA 2C6KA 2XJ1A 4MXZA 2GHGA 4RIYB 4KD1A 4ZJJA 4KABA 1UKIA 2W06A 4D4RA 4E6QA 3W8QA 3HMIA 4MYGA 3I7CA 3ZFMA 4YTCA 1JKKA 5LMAA 3QQHA 4UX9A 2OH0E 4O27B 2WU6A 5EOBA 5LMKC 2V7OA 2BIYA 4YJVA 3VJNA 3A8XA 2ONLC 4XG3A 4O22A 3ZS5A 5EDQA 4YZMA 4WOVA 5FD2A 5HIEA 3FLYA 4BDHA 3MTLA 2OG8A 3UMXA 2B1PA 4IADA 4QMPA 5DG5A 2Z7LA 3DOGA 4BWPA 5LQFA 2ZM4A 4UYAA 3COIA 4A07A 4FKVA 5E8VA 1WVWA 3QCSA 4YHTA 1KUTA 3GU5A 3LFBA 4FKGA 1AGWA 4IHPA 2C0IA 1GIIA 1LEWA 4NW6A 4O84A 5LVLA 3KKVA 3TM0A 3K5VA 1CKPA 3HV7A 2UVYA 4K77A 2RFSA 1VR2A 2BKKA 2R3OA 4C3RA 1Y57A 3BV3A 5JGDA 4TWPA 4G16A 3AMBA 4QQCA 2W5BA 4IFGA 3UMWA 4DFBA 3ZLXA 4FOBA 5E8TA 1CKIA 2YIYA 3KRRA 3TT0A 3UZPA 4MX9A 3P86A 3KA0A 2QOBA 2CSNA 3K5UA 4ANMA 2P0CA 3WF5A 4ALVA 1IA8A 3QRUA 3QTRA 1WCCA 2OGVA 4UEUA 2VX3A 3GCVA 3NW6A 4LRJA 4L46A 4QP1A 2XKFA 4OUCA 4CTCA 2O5KA 2CLXA 4C38A 4D4SA 2HXQA 3FY0A 5L6PA 4IAYA 3ZH8A 4ITIA 4ACCA 4CT1A 4DEBA 2C1AA 3NYOA 3FPQA 1OIUA 5B7VA 3VNTA 5KMOA 3PP1A 5FWKK 2UVXA 2XP2A 3Q5ZA 5AFVA 4RIXB 4XX9A 2PVMA 3NGAA 5JRSA 1SVHA 3L8VA 3V5QA 4GL9A 5M55A 3EZVA 3PDTA 2PVFA 5C26A 2VTIA 4KIOA 3LFCA 4TYJA 3UC3A 4EUTA 4KKGA 4WRGA 5IEXA 4JDIA 4DCAA 4KA3A 4UMQA 3LXPA 4XS2A 2X8EA 3ORTA 3WIGA 4UXLA 4JI9A 4TPTA 3Q32A 4ERKA 5DR6A 4CV8A 2O63A 3A60A 3V8WA 4CLIA 3D15A 3VS6A 3W2OA 3S00A 4PNKA 3P23A 3F66A 5EK7A 4IWQA 5HTBA 2OZAA 4C35A 1Z9XA 3P78A 3E8EA 4FTIA 4NIFA 1W84A 5M44A 3C5IA 3NPCA 4QMQA 5ANOA 4LMUA 4E93A 5HBHA 3FYKX 5LMBA 5GJGA 1R3CA 5FRIA 1M2PA 1XJDA 3Q04A 3O8UA 2HW7A 4R3CA 5CU2A 4ZLYA 3LZBA 4XYFA 1W98A 2QR8A 3HV6A 4PL3A 2ITOA 4JR3A 1GZ8A 3OHTA 4YSMA 3SAYA 2CLQA 5CSPA 5K0KA 4L00A 4CYJA 2G1TA 3CE3A 4K0YA 4U45A 2PUUA 4GFGA 4O0YA 5L2SA 3OCGA 1XH8A 3HDMA 4GFMA 3MTFA 4V0GA 4DLJA 4RWJA 1UA2A 4FT9A 4YPSA 3BU3A 2Y4PA 3DDPA 2XYUA 2UUEA 5CEQA 3FZ1A 4AA5A 4CZTA 1H1QA 5B2LA 1V1KA 3MWUA 4RX7A 1U4DA 2WO6A 1H0WA 3OCTA 1OL7A 2FSTX 2V62A 3O17A 3R0TA 1FMOE 4G5JA 4O91A 4EWQA 4NTTA 3IK3A 4EZ5A 4AA0A 4PPBA 4XLIA 5E8WA 5KMJA 2FA2A 4CKIA 3F2AA 1VYZA 3ZYAA 1FVVA 5L6OA 2UZUE 2XIXA 3KMMA 3R21A 3PIZA 1JOWB 5E1EA 3U8WA 3QX2A 2C6LA 4TN6A 5CSHA 1YWRA 5HEZA 5CF6A 4EOMA 3LAUA 4FR4A 4U41A 1PMVA 3G5DA 5FBOA 3E8NA 4AG8A 5AAEA 3IQ7A 4E3CA 3W2RA 3LVPA 2WQBA 2XK6A 2ITXA 3GVUA 3NSZA 4XMOA 5IQAA 4EHEA 3SOCA 2W96B 3RCJA 4DH3A 3KK9A 4JDHA 3R01A 4IANA 4RVKA 4BWXA 4M97A 2F7EE 4ACGA 2BTSA 3QF9A 3P7BA 4XNEA 4QQJA 4O81A 3D9VA 4YO6A 3GCQA 1F5QA 4ASDA 4I0TA 2IW8A 1Z57A 4TT7A 1BL7A 5DN3A 3VUMA 1LP4A 2YM6A 5EI6A 4U7ZA 3SX9A 4H05A 5IQCA 5J5SA 3JPVA 4L01A 4ONAA 5AP6A 2R3KA 3TACA 3B2TA 3EQRA 2CMWA 4QPSA 4C33A 4YPDA 4DG2E 5JFXA 3ALNA 3HDNA 4QMMA 5CQUA 1KV1A 4IM3A 4CEGA 4P7EA 2YM8A 2BRMA 2QU5A 4O0VA 4H3QA 1OZ1A 4P2KA 2QKRA 3HAVA 3LFAA 4GUEA 5BUEA 2QHNA 3RM6A 3G6HA 2P33A 2XNBA 1P14A 4JBOA 4N6ZA 3PPJA 1BUHA 4QP7A 4EORA 2FO0A 2C30A 2ITQA 4FKUA 4X2KA 3CY3A 3IS5A 4RJ4A 5IA5A 2R3HA 3LHJA 4GH2A 4DH7A 1H07A 3JUHA 3DK6A 3U9NA 5HCZA 2B9IA 5H9BA 4JQ7A 4LRKA 4MD7E 2JKQA 4OTIA 3RINA 3RPVA 3D83A 5LARA 3RMFA 1MP8A 3ERKA 1FINA 2NPQA 2C5OA 3UVPA 2AC3A 4XP0A 3E5AA 4XUFA 3EL8A 2XUUA 2A4LA 1U5RA 4F0IA 2BZKB 2CHLA 1YXXA 3OCSA 3IOPA 4LYNA 5AP7A 3TDWA 2HXLA 3LM0A 4KIKA 1S9JA 5T6KA 4ZY6A 3I0OA 4RVMA 3BYSA 3IG7A 3AC5A 2WTCA 4TRLA 3PJCA 1OL5A 2R3QA 4F1MA 3MPTA 1GZKA 5D9HA 4MHAA 4UXQA 3JR1A 5T3QA 5AM6A 2ITUA 3ZMMA 2GQRA 2WZJA 2P3GX 2RFEA 2SRCA 4GW8A 4D1XA 4DN5A 1ZY5A 4QT1A 1V0BA 4HCVA 3F61A 4E6AA 4UZHA 5IQHA 4XOYA 4FIJA 4OW8A 3P7CA 4EC9A 3N4UA 4M12A 2OIQA 4Y85A 4O0TA 3MV5A 5CT7A 5CQWA 3KULB 4OT6A 4FZ6A 4H1JA 4OTFA 4FKPA 4AT3A 4Z7HA 5CALA 4A9SA 4RFYA 4QPMA 2GQGA 4IB3A 5A46A 3FDNA 4B6LA 2AUHA 3VQHA 4DEAA 2XF0A 4I6QA 3V5WA 2QKWB 4BN1A 3HVCA 4TYHB 3ZFYA 5J1WA 1XQZA 1J1CA 4YJRA 2PTKA 1PXJA 2WIPA 4X0MA 5EM5A 1K3AA 3EFJA 3ORLA 1BKXA 3QTWA 4OR5A 2WMRA 5I0BA 2CNUA 4RWLA 3KXNA 4AWIA 4EQUA 2FVDA 4ZIMA 2W4JA 4FI1A 5AIKA 3PZEA 3IKAA 3Q5IA 5AUYA 4FA2A 5A4TA 4L6QA 4I4EA 4EONA 5AAFA 2O8YA 4GU6A 4BCMA 3RP9A 4BBMA 4LQMA 3U4UA 4BTMA 4R3RA 2WTKB 4Y83A 3OW4A 2XMYA 2VAGA 4FT3A 4YBKA 5CSWA 2JIUA 3VUGA 1YDTE 2G9XA 5HD4A 2HCKA 4I6HA 4PP9A 4A4LA 4ENYA 1OM1A 3O0GA 3PP0A 1SNXA 2R64A 2XCKA 4RVTA 5EI8A 4FV0A 4CQEA 5CWZA 2JKMA 3QUDA 4X2FA 2NNWB 4OAUC 3V3VA 1XBCA 2Q0BA 3HYHA 3ZSIA 4O21A 5HX8A 3TTIA 3V8TA 5LVMA 3VUIA 4I4FA 4FUYA 4G6LA 1YI6A 5C4LA 4HYUA 3FZRA 4L9IA 1WAKA 2WD1A 4CVAA 4YHJA 2OJFE 3LJ0A 4U79A 4GK2A 1OIQA 3MI9A 2OWBA 4F9WA 2YIQA 5CAPA 5J87A 3BRBA 1Q3WA 3LCOA 1WBOA 3PFQA 3D94A 3R1QA 4GYIA 4RJ6A 2EUFB 4EWHA 3C5UA 3UBDA 4BBFA 2UVZA 4FKJA 2ITPA 1PMEA 2PMLX 4V01A 1PW2A 5CSXA 3NNUA 3G9LX 5HESA 3ORNA 4F70A 5TOZA 4IFCA 3AGLA 4IWPA 4C7TA 2CKPA 3A7JA 3PLAE 4ZZOA 4O6EA 3H0YA 3F3VA 4MAOA 5IMEA 1H08A 2C6EA 3CS9A 3RBWA 1OPLA 1YRPA 3TV4A 3PXRA 2HK5A 4X21A 3UE4A 3G0FA 3PVGA 2BVAA 2C69A 4FKIA 4KWPA 1OGUA 2J7TA 5HICA 4XG7A 4IX5A 4YJOA 2WMBA 3ATTA 2R3LA 4YU2A 4O0SA 4FGBA 4IM2A 3NUAA 3ZXTA 3EN4A 5BNJA 4XHKB 5C4KA 3R9OA 4BRXA 4EOLA 3SXFA 4A9UA 3VWAA 4F9BA 2JKKA 4ZOGA 5AUVA 4C4EA 5L3AA 3MFTA 4LRMA 1Q8ZA 4I41A 5BYLA 1J7UA 1DM2A 3A99A 3O96A 4E7WA 4L42A 5JH6A 4OTDA 2GMXA 3RVGA 3QD2B 4FEQA 5J9ZA 2CCHA 4J1RA 4FSYA 5FDXA 3REPA 4BHZA 1PMUA 3FEGA 2YCQA 4ZY5A 3PJ8A 4FIEA 4ITHA 3OWPA 2OJJA 3V51A 2RL5A 4EJ7A 4WUNA 5D10A 2YM5A 3O51A 3VRZA 3A7HA 5AR7A 3VW6A 4ZSGA 4C59A 3EZRA 3HMNA 3UO6A 2QO7A 4FT5A 4DH8A 3HAMA 3JY0A 4FIHA 4E6CA 4YLLA 5ANEA 3HV4A 4EEVA 3NVMB 2W1GA 4Q2AA 4L3JA 5E90A 3DAKA 4RC3A 2YZAA 3ALOA 3OXTA 2PZIA 4X3JA 2QOLA 1YW2A 4YP8A 2DYLA 4TXCA 3TXOA 5J9YA 2XZSA 5HLNA 3FLWA 5IPJA 4BYIA 1YXSA 3SW7A 4L8MA 4J7BA 5EM8A 3RK7A 1ZY4A 1J1BA 2BAJA 3OF0A 2OZOA 4FNWA 4I5HA 4RA5A 1U46A 4M13A 2ZM3A 3BQCA 4X2JA 2OSCA 2W9FB 3PG3A 3GXLA 2PU8A 4IAZA 4G3CA 5A14A 3GU7A 4TYHA 5FTOA 1P4OA 3RCDA 5AAGA 3QRTA 1KOAA 1U54B 3DS6A 5KBRA 1M7NA 4AA4A 1MRUA 2CJMA 5CX9A 2OXXA 3MY5A 4Z3VA 4RJ7A 2Q83A 4FGRA 5IEVA 4I5CA 4O7VA 4FTJA 1H1WA 4FSRA 5DVRA 2DWBA 1GZNA 5BUJA 3FC1X 5FG8A 2YLEA 4QMYA 3NNXA 1I09A 3IOKA 3ZSHA 5AJQA 3E7OA 2B54A 2JIVA 4I20A 1XO2B 4Q9SA 4R1VA 4EYMA 5L8LA 5L2TA 4AW2A 3KEXA 2VTSA 5G1XA 4IAAA 4JIKA 2VWZA 2YCFA 2VO7A 3CP9A 4I94A 4DGOA 3KRJA 3RAHA 1GJOA 1E9HA 1PKDA 1QPJA 3DQWA 4FTOA 3FZOA 5H8GA 3M11A 1XH5A 5CS6A 4NCTA 3P79A 3UOKA 3UQFA 2HENA 5DT4A 1CKJA 2HIWA 2OFVA 4QTDA 3VHKA 5KMIA 3R8VA 3PJ2A 1M2QA 4DA5A 4NFMA 3BHYA 4BTFA 5M51A 2VD5A 3FXWA 4JT3A 4FTMA 1FOTA 5CF4A 2ESMA 5HBEA 4QYHA 4IW0A 4JX7A 4LV5A 3ULIA 2QI8A 2ETKA 5JSMA 2XNPA 3MYGA 5AM7A 3BBWA 4Z16A 2WMQA 2WTIA 3BHTA 3H30A 3RGFA 1U59A 5IQIA 1OB3A 2C6DA 2WU7A 2YDIA 4TTHB 3D7TA 4BDCA 4LV8A 3DCVA 3JY9A 2ZB0A 4NJ3A 4GS6A 3CGFA 4QMTA 4I5MA 4EBWA 5CAOA 4FEUA 3FZSA 4IX4A 5BMMA 5L2IA 4C58A 5CLPA 2X1NA 3OP5A 4D9UA 3AD4A 3LW0A 1R39A 2H34A 3LXNA 2G2IA 4GT4A 4GSBA 2EXCX 4USDA 4C36A 2NO3A 4FT7A 4RVLA 4OAVB 3IW8A 4AW5A 4DHFA 2XRWA 2E9PA 3QC9A 4C62A 4JXFA 2ZJWA 2VO6A 2VTNA 4M69B 4PP7A 3QUEA 3RAKA 2B0QA 3ZM9A 5LOHA 4CG8A 4AOJA 4D58A 3N9XA 5DR9A 3RJCA 2UZOA 1UWHA 3SA0A 1A9UA 1NVQA 2IZSA 5CASA 4C0TA 5A9UA 4J8NA 2H8HA 3C50A 4IWDA 1QPDA 2BR1A 3LMIA 2WMAA 3FXZA 4BKYA 1YXUA 4ITJA 2PYWA 2X6DA 3QA8A 5KKRC 3SD0A 4EL9A 4ZP5A 3NUYA 4L52A 4QYEA 5KUPA 4YMJA 1IA9A 2PVJA 3MB6A 2LGCA 2FSLX 4JQEA 4X2GA 2WEIA 1DAYA 2C5YA 5HO8A 3VUDA 4BIBA 3TKUA 1IG1A 5AUWA 3LMGA 4UN0C 2C4GA 4HNIA 3BHVA 5FM3A 4EK4A 3LQ3A 4L7SA 2X7OA 3G51A 2BAKA 2PVHA 1H28A 1J3HA 3GP0A 4BI2A 4YTHA 4EKLA 4F0GA 5EYCA 3GCPA 4BGQA 3GU6A 2J0LA 3KMWA 2OBJA 4GIIA 3MH3A 3L1SA 1JAMA 1ZYLA 3C7QA 3KF7A 3R71A 3NS9A 3TEIA 4EH6A 4EZ7A 1Q24A 4PY1A 2X39A 2X4FA 3EQHA 1OKVA 4FV8A 4L3PA 4IAIA 4LM5A 5AIRA 4CCBA 3UVQA 5CEKA 2BFXA 3W18A 1HOWA 1CM8A 1FVTA 5F1ZA 3E88A 5GZAA 5CAQA 3VBTA 3R30A 1Q8YA 3CQEA 4KSPA 2QC6A 3TCPA 4O7RA 4G17A 4CQGA 2R3JA 4M8TA 3PY1A 3SHEA 5HG8A 4HGTA 4XRLA 3VULA 4CV9A 1L8TA 1MRYA 1PMNA 4N57A 3QTQA 4TWCA 2X2LA 4DH5A 5AR3A 3PSCA 3TV7A 2RF9A 3QC4A 2I40A 5C27A 1J91A 1MRVA 4K33A 4WG4A 3GOPA 4AU8A 4JVGA 3GQLA 1MUOA 1SM2A 2BROA 1CMKE 2J6MA 2R4BA 3DT1A 4JAJA 3ELJA 4YJTA 3BEGA 4YC8A 4FL2A 3SDJA 3ZFXA 5EG3A 1ZYJA 2J90A 4R77A 2Y4IC 4RIOA 4XP2A 3ZLWA 3QA0A 3QQUA 1OL1A 5C01A 3AMAA 4DEDA 4BR3A 2ZDTA 3OOMA 3TL8A 5LXMA 2YITA 2EXEA 3BU6A 4Y5QA 2WXVA 4C2WA 5DYJA 4I6BA 4ZTHA 5AP1A 3HUBA 4O86A 4D2TA 3FMEA 3A62A 4ZZMA 4E4XA 4LMNA 2UZEA 2RFDA 3ZLSA 4WBOA 4EH3A 1PXIA 4DEGA 3U51A 3QBNA 4K8AA 5KZIA 4HVDA 3FUPA 5A3XA 3E62A 2WNTA 3R8LA 3DBQA 4D4YA 4EOQA 1OL6A 1ATPE 3A4PA 4TKSA 4UMTA 4F65A 4H39A 2UW9A 3C13A 3QWJA 5C8KA 5IQEA 3A8WA 4PDSA 3NYXA 4YBJA 4DFYA 5KHWA 1H1RA 3TZMA 5DOSA 3NW7A 4FKLA 4S31A 3NYVA 2OJGA 4RC2A 3MFUA 2BALA 3FMMA 3F5UA 4BL1A 2CKOA 3SRVA 4JS8A 5EM6A 4DBXA 5CU3A 3QXOA 4IAFA 5HIBA 4RFZA 2BTRA 3MJ2A 4IH8A 1WMKA 1KE9A 3FY2A 4RRVA 3KXMA 3NNWA 4Z7GA 4MD9E 5J79A 3QHWA 2WGJA 4RGJA 4RSSA 1OMWA 2XKEA 4RJ8A 4MD8E 3KN5A 4HCTA 3VC4A 3MA3A 3MDYA 4O7WA 2C6TA 4ZTRA 1CSNA 2F57A 4QMLA 4EOJA 3QHRA 3BLHA 3L9LA 3C9WA 3DLZA 3F9NA 3P0MA 5F9EA 4ZS0A 5JRQA 5JFVA 2QOCA 4DCEA 1YVJA 2YWVA 2R0UA 4A9TA 3ZUTA 1F0QA 4MKCA 5DLSA 2P2IA 5IQGA 5AV2A 5KE0A 2QG7A 2XNGA 3V8SA 5BMSA 4ZSAA 1W0XC 3L9MA 2JBOA 2WMWA 2F2CB 4AQCA 3SXRA 4FV1A 2W4OA 3OEZA 4XG9A 4CFVA 1JSUA 3UQCA 1BL6A 3EQIA 4FTQA 3R9NA 3A7IA 4I24A 1LPUA 2QOKA 5I9WA 5TR6A 3QQJA 5CU6A 1KE5A 4FV3A 4NW5A 5HOAA 3ZUUA 2CDZA 4WBBB 1XBAA 1L3RE 4IZ5A 4W4WA 2QHMA 2REIA 3UC4A 4KRCA 4OLIA 4MNEA 5JZNA 4OBOA 4BWKA 5HU3A 5E9EA 3KFAA 5HX6A 2VTHA 5AR8A 5TT7A 3V01A 4NKAA 4ANSA 3QGYA 3R6XA 5IA3A 4FV4A 3NUXA 1FVRA 3KQ7A 2A1AB 3EQBA 1ZOHA 3GU8A 5L8JA 3VRYA 3TUCA 5BX0A 2PVRA 4S34A 3RNIA 1OI9A 2IVSA 3ITZA 4BGGA 3RZFA 3NNVA 3F3TA 3SC1A 4V05A 2VWIA 3TI1A 2E2BA 2XRUA 2R3NA 4HCUA 4HGLA 4JR7A 2V5QA 1UVRA 4QMOA 3G2FA 2PMOX 4G3EA 1Y6AA 4BHNA 1X8BA 2Z7RA 4I92A 2PVYA 3ZDIA 4CG9A 5DR2A 4AZWA 3E3BX 3EN5A 4OBQA 2E9UA 4F08A 2OFUA 3PSDA 3Q4UA 3MY0A 5C03A 4QYYA 3QAME 2BDJA 5IDPA 3OWKA 2X4ZA 2OI4X 3NAXA 3NCZA 1NW1A 4FNXA 4JJRA 5EQEA 4I0SA 3QZFA 3NRMA 4D2WA 2EWAA 2YDKA 4EH7A 1SVEA 2EVAA 4OGRA 3RPSA 1AQ1A 2W9ZB 5K0XA 3R63A 3A4OX 2C6MA 2E9OA 4UBAA 5FM2A 5BQ0A 4R5YA 3FAAA 4L7FA 3KCKA 4KS7A 1RJBA 1W82A 3P5KA 5BVKA 4B4LA 1S9IA 3O7LB
chains in the Genus database with same CATH superfamily
1ZXEA 5M4CA 3PA3A 4M68A 5G6VA 3UNJA 4AZTA 4D2SA 3VS4A 3WILA 2W17A 3A7FA 3NIZA 5KMNA 2CGVA 2W7XA 5KKRB 4FTRA 1XH6A 4WO5A 4FF8A 5IMXA 4F1TA 4WNPA 5AUXA 5JN2A 1A48A 2VWBA 4UV0A 5CY3A 4DG3E 5KCVA 1QPCA 3EQDA 5DPVA 5IA2A 5AP5A 3IONA 3O50A 4NCTC 2VWVA 5CI7A 4AFEA 5JKGA 3IPHA 4KKEA 3KN6A 2PMIA 3NIEA 4MEDA 1M7QA 5EHLA 3Q96A 1PXOA 4FTUA 3QCQA 1JLUE 4IX6A 4PX6A 5CZIA 4IZ7A 4F7LA 5CAVA 2H6DA 2X8DA 3U6IA 3NYNA 4FSTA 3TUDA 1IR3A 4W8EA 4IJ9A 4DTBA 2C3KA 1JKLA 2VGOA 4ALUA 5J8IA 5D41A 1XHAA 5E8XA 3MVHA 2JITA 5C9CA 3EWHA 3LCDA 5FTGA 4FSQA 3U54A 4YSJA 3D7ZA 2OU7A 2O2UA 2PE0A 5GZ8A 3DAJA 4C8BA 4YZNA 1UV5A 1H1PA 3EFKA 5E8UA 2B9JA 2XNOA 3U55A 5GJFA 1H1SA 2A27A 4XG6A 3HMPA 2EU9A 3AG9A 2Z60A 5K3YA 4RIYA 5L2WA 2I0YA 2WOTA 3W16A 4PNIA 4CRSA 4JBVA 3JS2A 2JFMA 1G8KA 4U8ZA 3GC9A 2WTWA 4QTAA 4LL0A 4FKOA 3I0QA 5LVNA 2OIDA 3RWPA 5HHWA 3TG1A 3VUTA 1ZMUA 4CGAA 5M06A 3MIAA 2PE1A 3DTCA 4ID7A 2O65A 5IUIA 3HUCA 2UZDA 4Z55A 3K2LA 2PZYA 2GFCA 4PMMA 4LGDA 5IH6A 3QTZA 2XS0A 4M66A 5A4QA 3AOXA 2J50A 2IO6A 3IDBA 4FKRA 2VRXA 5ACKA 4D28A 5C1QB 4E20A 4YJPA 5I9UA 3QTSA 4U97A 3T3UA 2W1FA 3C0IA 1R78A 3PE2A 1WBVA 4PUZA 3K3IA 3G0EA 3NUNA 2HWPA 1GIJA 3QKMA 3Q9WA 4MCVA 4C4IA 3I7BA 1YWVA 2R3IA 4NT4A 3V04A 2HY81 4UYNA 2R0IA 3NAYA 3KC3A 5E92A 4YJQA 2R3FA 3H0ZA 3RPYA 5CSVA 1JNKA 4DBNA 2GQSA 5GINE 2QG5A 2VO0A 2XA4A 3OD6X 4BZOA 4G34A 3DTWA 1M52A 3C4CA 3P4KA 2B55A 4MXOA 3VUKA 5J1VA 4E5BA 5HE2A 4N70A 3VBWA 2B53A 2X7FA 2ZAZA 3D5XA 3ETAA 3R1SA 4H3PA 1YKRA 4O4CA 4FT0A 2HAKA 3F7ZA 5HO6A 3ZHPC 3ZO3A 5FDPA 2XH5A 5GIPE 4OTPA 1OKWA 3EYGA 3U4WA 3ZUVA 2Z02A 2JDTA 3NX8A 4K2RA 2VTMA 5L2QA 4D1ZA 4DC2A 3ZDUA 3CLYA 3QKLA 5KMMA 1JKSA 4EZ3A 4O0RA 5CNNA 4BCFA 3K3JA 4BTKA 2B9FA 3PXZA 4F64A 4RIXA 1YHVA 3JVSA 5BVDA 5KMKA 4C61A 4U3YA 5HLPA 5EW3A 4KB8A 4ASXA 3CJGA 4BCJA 3H10A 4QP4A 3FHRA 2R2PA 2XM8A 5EDRA 3COKA 1IRKA 4RZWA 4IB0A 4AE9A 1XKKA 1ZOEA 4ZAUA 3VONA 2BHEA 2RGPA 3NEWA 4AN9A 3OEFX 3HV5A 3HEGA 4KUJA 4IACA 4XG2A 5D12A 3MB7A 1OUYA 1ZRZA 4L43A 2A98A 5B2MA 2W5HA 4IDVA 3BWFA 2GU8A 4BTJA 3NCGA 3ORXA 4W4XA 4Y73A 4JOAA 4F63A 1URCA 3Q6WA 4IIRA 3SXSA 2GHLA 3IDPA 1TQIA 3NUSA 4G6NA 4UY9A 2CN8A 3LXKA 2QODA 4QMSA 5BVNA 4RMZA 3EKKA 1OVEA 4AGCA 3UP2A 4NWMA 4HJOA 4QPAA 5F95A 5EW8A 4F78A 4O7LA 3OCBA 1PXNA 4IVAA 2EB2A 4O6LA 4PQNA 3F5PA 5E7RA 4YTFA 1H24A 5IUGA 2GHMA 4YJSA 3W55A 3ZU7A 5HZNA 3BCEA 3TUBA 4GVAA 3SGCA 5EFQA 3UJGA 3UIBA 2ITNA 3OW3A 5CANA 3MJ1A 3LKMA 4Y5HA 4WNKA 3ROCA 4HYHA 4PMTA 3WE4A 4DH1A 1Q41A 2DUVA 2YERA 4ZS4A 5DI1A 1QCFA 5LVPA 3GCUA 4BCQA 4X3FC 5EOLA 5FP5A 2BRBA 3F3WA 4FG8A 2PPQA 4XV9A 3DXNA 5I4NA 1SYKA 3ZZWA 2XVDA 2F7ZE 4MXCA 3DV3A 4GJ2A 4EHGA 2ERKA 2G15A 4CMUA 3H4JA 2JDSA 2XIZA 1YDSE 3MW1A 3U6HA 5E91A 5LCKA 2W1HA 4FKSA 4RLLA 4FV9A 4JLCA 2XIRA 3OY1A 4M3QA 3V5LA 5K9IA 1DI8A 4R7HA 3KF4A 3UYTA 4TYEA 1PYXA 2O3PA 3H9RA 3Q3BA 3ML1A 1QMZA 2VNWA 1H01A 3NFFB 4JG6A 2AQXA 1YWNA 5M4UA 4QOXA 4RQKA 3WZUA 4XG8A 5TO8A 4CZYB 3LCKA 4EOPA 5DRBA 5HD7A 3R7IA 1KE8A 2XKDA 4YTIA 1WVYA 4AZFA 5FXSA 4RX5A 4BCOA 2VX1A 4CD0A 3ANRA 4JBPA 4O1OA 4E4MA 3KRXA 1B6CB 1ST0A 3R1YA 4OBPA 3C0HA 1H25A 3FMDA 5HI2A 3OROA 3QXPA 4PTGA 3NWWA 4QMUA 3R9HA 4GFOA 1P4FA 1ZMWA 3BZ3A 3AKKA 4XLVA 5J5TA 4DT9A 3VF9A 3CIKA 3SV0A 3PY0A 2XANA 3QFVA 5A4EA 3DK7A 3PVUA 1PRYA 3QZHA 1G8SA 4AZVA 4F0FA 4W9XA 3FKLA 2XYNA 3O71A 1PHKA 3DKGA 4IBMA 4J8MA 3W32A 1UU9A 4ANOA 1FPUA 4UWCA 1Q5KA 5AV3A 4R8QA 4FZFB 4D0WA 4CYIA 3TJCA 3ZXZA 4LI5A 5JGAA 2QD9A 1YOLA 2QR7A 2GS7A 4J96A 4ANBA 4WA9A 5A4LA 2W1IA 2W1EA 2B4SB 1UU3A 1GIHA 3DGKA 2XK7A 1NVRA 3PRIA 2W1ZA 3R1NA 2BMCA 4K1BA 4U3ZA 2X0GA 3UTOA 2P55A 4C4GA 2YHVA 5EHYA 4F6WA 4C4HA 4EOKA 2VGPA 3CR0A 3C4XA 5GJDA 4F1OA 4QMNA 4O4BB 4N4SA 2PHKA 1WFCA 2C1BA 1Q8WA 4L67A 3PLSA 3DBFA 3WF8A 5EYKA 4O7ZA 2VN9A 4GCJA 4AF3A 3COMA 1ZZLA 3CTQA 3VBYA 4CRLA 3PE1A 1OECA 5AUZA 4IDTA 4B99A 3ULZA 5FQDC 4WD5A 5M07A 2NYAA 5LWNA 1JPAA 4FSWA 3GENA 3QQFA 4E5WA 3FQHA 4TZRA 3OUKA 1UKHA 2R7BA 3GC0A 4JX3A 4CSVA 1Z5MA 4EKKA 4BI0A 5AA8A 4JAIA 3UG1A 3UVRA 5FBNC 3AKJA 2E9NA 3NR9A 3Q9XA 3PXKA 1U5QA 3DKCA 5DT0A 4EHZA 1URWA 4AS0A 3RTPA 2XNMA 1RQQA 3P1AA 4K11A 4DF3A 3SW4A 5LMKA 3ORMA 3QL8A 3LFSA 4AGUA 4MF1A 3IW5A 3F3UA 3NZ0A 4CCUA 4ZLOA 4LOOA 2ONLA 3CSVA 3DFCB 2RG6A 3HGKA 4AQKA 5DGZA 3Q4TA 3ANQA 5H3QA 3EQPA 4KBCA 4KAOA 3RWQA 3R7YA 3PXYA 2B7AA 2ITZA 3GNIB 1NY3A 3TIZA 4X7QA 4GVJA 2XJ0A 5HE3A 4DFZE 2P2HA 4YNEA 5M53A 3G9NA 4ANLA 2OK1A 3UNZA 4FRFA 5CXHA 3VS0A 3CY2A 4FSZA 3ZONA 3OY3A 3KULA 3FPMA 5IQDA 2W1DA 2GNJA 3WZKA 3TMOA 3DBEA 4P5ZA 3WYXA 2WKMA 3R28A 4K6ZA 3BELA 4KIPA 4R5SA 5IF1A 3PG1A 4DITA 4U9AA 4EK3A 1RW8A 3I81A 2UW4A 4FTLA 3O5AA 2X9EA 5K5XA 2ITVA 5L4QA 5M09A 1TVOA 3GEQA 4WG5A 2I0HA 3RAWA 3P5JC 1K2PA 3VBVA 2H9VA 4PMPA 3POZA 3QTXA 5AR4A 3OG7A 3GC8A 4BDJA 2UZLA 1VJYA 2FGIA 2BRGA 5DHJA 3MSSA 3R2YA 4FKTA 3AC1A 3FI2A 4NFNA 2WEVA 4WT6A 5E8SA 4FVRA 2JLDA 3QU0A 5E1SA 3BEAA 2G2HA 2IPXA 2I0EA 2PY3A 2PULA 2R9SA 4YGAA 2R3PA 2Y8OA 2DS1A 3R02A 4ORKA 4CFFA 5AA9A 3WI6A 3B8QA 1UU7A 4HYIA 3MH1A 1APME 5M08A 5KNJA 4U5JA 4ZLZA 3ZO1A 1TFFA 3ZLYA 3AC3A 4YLKA 4FV5A 2WAJA 4MVFA 4RC4A 2ZV2A 4MBLA 5FEQA 5DEWA 5F94A 5ETIA 4EHVA 4PDOA 4J97A 1H0VA 2EXMA 3IO7A 3AD6A 3K54A 2QNJA 3AGMA 2GNGA 2CGUA 4E1ZA 3FLZA 3EB0A 4YZCA 3I5ZA 4HGEA 4RX9A 2VWWA 3POOA 3R8ZA 4AT5A 4R78A 1H8FA 3D2IA 1ZOGA 3I5NA 2YIRA 4O0UA 3S2PA 2C6IA 2WMSA 3H9OA 3KK8A 4E8AA 4F99A 4FTNA 3TIYA 4BICA 2VTOA 2GSFA 1Y91A 2ETRA 3FI3A 4FV6A 4IX3A 5DIAA 2GTNA 5ANDA 4BF2A 4MH7A 2IZRA 3THBA 2PUNA 4FEXA 4W4VA 4DFXE 4AFJA 3E92A 3QUPA 1OBDA 3MFRA 3PXQA 3I6WA 3KCFA 2FUMA 5CF8A 5ETCA 3PPZA 3R22A 4ZTNA 2X2MA 5FTQA 2X8IA 3C4FA 4MXYA 1O6LA 4AACA 5F20A 4H36A 1RE8A 4D1SA 5ANGA 1WBPA 3LQ8A 3UOJA 2PSQA 3RAIA 4O7YA 2XIKA 3PYYA 4J53A 5EKNA 1QPEA 2NRUA 2XNEA 3NMUF 3BU5A 3AD5A 2XCHA 2ACXA 1KE7A 2CN5A 2EB3A 2QOQA 2A19B 3CXWA 3FQSA 4IAKA 3DK3A 2KTYA 3ZRMA 4DT8A 3OOGA 2GNLA 3PIYA 3CKWA 3DJ6A 1HCKA 4IC8A 2WMUA 5DT3A 5C8MA 3DKFA 3FMHA 4DAWA 3E8CA 4XCUA 3R83A 3LFNA 5DBXA 1DS5A 2A0CX 5I9VA 3CJFA 4PDYA 3VJOA 3QLGA 4MBIA 4BZNA 3WF6A 1OIYA 3SG9A 4FV2A 2WQOA 5D1JA 5B0XA 3DZOA 2QQ7A 4L3LA 4G3FA 4ZJVA 3RZBA 5TKDA 3EYHA 3QGWA 5HG5A 1YI4A 3FLSA 4EH5A 4F4PA 2WOUA 4B0GA 4IC7A 3TJDA 1ZMVA 2IN6A 5J95A 2VWYA 4XEYA 5HCYA 4P5QA 1RDQE 4JDKA 1Y8YA 1UNLA 2VV9A 5CNOA 3BLAA 4BBEA 2YZLA 3HKOA 3OUNB 1SVGA 4II5A 4MQ1A 4RZVA 2BZHB 2QCSA 3T3VA 4O2ZA 1IAJA 3PRFA 3QYWA 5AP2A 4U42A 3ZBXA 1M17A 4BY9E 3TNHA 2OF4A 1I44A 4FVQA 3VS5A 2C3LA 3N51A 3RALA 5DE2A 4TL0A 1Q8TA 1AD5A 1BI8A 4Y72A 4MBJA 3CQUA 3VS2A 1U54A 4HW7A 5M57A 1O6KA 3LE6A 2JD5A 3ACJA 5CENA 4QYGA 4O0XA 4FG7A 2BRNA 4I6LA 1BYGA 4D2PA 3MPAA 4DGNA 5J7BA 1NXKA 2CGXA 3C4WA 3QQLA 3U87A 5A54A 1XBBA 2ZYBA 2OXDA 4XV1A 3GQIA 1JVPP 2XK8A 5DRDA 3NUPA 3UQGA 4IM0A 4WSQA 3FV8A 4U0IA 3ZZEA 3ENHA 4RG0A 3OVVA 1NA7A 4YC3A 3LMHA 3CPCA 5ETAA 4FTCA 4DEIA 3D4QA 4M14A 3UP7A 2J5FA 3U6JA 5FLFA 4ACHA 3DXPA 4UWBA 2WQNA 1UU8A 2W4KA 3BI6A 1PKGA 3Q9ZA 4BCKA 3DJ5A 4HVGA 3DB8A 4U80A 2OJIA 2YLFA 4BJJB 3W2QA 4L45A 4QD6A 3SQQA 4GT3A 4BDFA 3W0NA 3LFEA 4EOSA 4RPVA 2GNIA 5EHOA 1TKIA 1ZWSA 3O2MA 4G3DA 1A06A 4J71A 3DA6A 3DU8A 4CFWA 5K5NA 4GRBA 2BHHA 4DFNA 4FTKA 4FYOA 1W8CA 3P9JA 4IWOA 3W8LA 4BCIA 3G6GA 1OPJA 5HKMA 4FL1A 2ZOQA 1PF8A 3LLTA 4XOZA 4FE2A 2JAVA 5E8ZA 4MF0A 2UW3A 3MPMA 5CTPA 4M7IA 2FSMX 2XK4A 4NZWB 4JDJA 2VTJA 3LCSA 5K4IA 5AUUA 4GK3A 3FSFA 4QO9A 3II5A 4Q5EA 2ZB1A 4DINA 4F6SA 4JRVA 2J51A 4O82A 5GNKA 5JQ8A 4M69A 3FC2A 3FMNA 2PZPA 4EOIA 4IZAA 2QO2A 5JT2A 4DG0E 4EYJA 3H3CA 1DI9A 2IZTA 2Z8CA 4ALWA 2W1CA 4CXAA 4EI4A 3R00A 3LIJA 3VUHA 4E4NA 3WZDA 2HWOA 4FZAB 3AT2A 4OTQA 2RIOA 1IEPA 4BCNA 2X2KA 4NIFB 4Y8DA 1XR1A 3OZ6A 4PPAA 3FL5A 2WELA 3HLLA 2QURA 2HELA 3EQFA 5HORA 1W83A 3PA5A 3UOLA 2QOHA 3ZRLA 4BFMA 4DGMA 2Z2WA 2VU3A 4FK6A 4QP3A 4C57A 4EH2A 3E87A 2YAAA 1LUFA 4I23A 1ZZ2A 4W4YA 5EKOA 2H96A 2GTMA 3V6RA 4DEHA 4Q9ZA 2J9MA 2PZ5A 3BYOA 3HRFA 3ZCLA 4TYGA 2WTJA 4FL3A 4A9YA 3NW5A 5A4CA 5AP4A 4NK9A 3CBLA 2J4ZA 3C0GA 2RFNA 4V0GB 2YCSA 2ITWA 2VNYA 1BI7A 5KHXA 3AT4A 1GNGA 5KX8A 3CEKA 5IA1A 3M42A 4ZXTA 3PXFA 4PL5A 3OT3A 3LJ1A 3E7VA 3G90X 4IE9A 4TWOA 4ENXA 2G01A 4EK6A 3HA6A 4I3ZA 1PXLA 3E64A 4IVBA 4ZTMA 3LLAA 4N6YA 4EH9A 2XB7A 3EN7A 3OBJA 1V0PA 3M2WA 4FZ7A 4S32A 2YAKA 3OMVA 5EYMA 4YNOA 3RI1A 4FOCA 2GDOA 3BGZA 3ORZA 3LFDA 3PPKA 1OBGA 3ZO4A 3MIYA 1Q61A 4FBXA 2UW0A 3F2NA 3GUBA 4O38A 2VWXA 3HRBA 5KZ0A 4FJVA 4WG3A 4Y95A 4C2VA 4O0WA 4LFIA 2WPAA 1ZARA 4YURA 4N0SA 1ZAOA 2X7GA 2IVTA 4FSMA 4D0XA 2UZNA 1OKYA 2AYPA 3FYJX 3O8PA 1Q3DA 3QRIA 3W1FA 4QTEA 5HBJA 2BPMA 4FVPA 5IG1A 4JBQA 4BKZA 2JAMA 2C68A 4YR8A 1IASA 3PWYA 2F7XE 3UZRA 3KL8A 3FQEA 4BIDA 3OS3A 1UWJA 3FLNC 4HVIA 1O9UA 2WHBA 3OTUA 2YCRA 3R04A 4IB5A 4S30A 5BPYA 4GG7A 4KBAA 3DKOA 4Y46A 3UNKA 2B52A 2ZMCA 3GGFA 3BLRA 5BVFA 1YXTA 2F49A 4E6DA 2BZIB 3ORIA 3OXIA 2XALA 4GYGA 2OLCA 4WNOA 3JXWA 2YISA 3OWLA 3TNWA 3ZC5A 1E1XA 3QTIA 5M56A 2I6LA 4JNWA 2V7AA 3CD8A 4FKWA 5BVEA 3SKCA 4EK8A 5I9XA 3OT8A 4U44A 4YC6A 4GEOA 5IUHA 2OICA 4OTHA 3S4QA 3V6SA 3ORKA 3F7WA 4G1WA 2OJ9A 4DTKA 3F69A 4NJDA 3FZPA 4GT5A 4XRJA 3RPOA 5K4JA 2XBJA 2WTKC 1W2DA 4J95A 4I93A 3OWJA 3R7GA 4WUAA 4ZJIA 3VAPA 3MH0A 5I9YA 1OL2A 4UB7A 4HZRA 4NEUA 4NM0A 1M14A 4E5AX 1OIRA 4IJPA 2YM3A 3BLQA 1G3NA 3O7LD 4OT5A 3JVRA 3HMOA 3GBZA 3TNQB 2GNHA 2J5EA 4NU1A 3GFWA 4KRDA 2G2FA 3FSKA 3TTJA 2UZVA 5CVGA 5CAUA 3ATSA 4HGSA 4RIWB 2CKEA 5HVJA 2WQEA 3TDVA 1WBTA 5EH0A 2J0JA 5JK3A 3VO3A 3OXZA 3UZTA 1KV2A 2ITYA 2ZV9A 2PUPA 3EHAA 4AZSA 4O83A 5J9LA 4PPCA 4F09A 1ZYDA 5AV1A 5CF5A 2GS2A 3BGQA 4CT2A 1IAHA 3P7AA 4MQ2A 4MWIA 4PF4A 3G33A 4KIKB 2I0VA 2FYSA 4FEWA 4NSTA 3L9NA 4FC0A 4AAYA 2J0MB 3PWDA 4GV1A 2QVSE 4CMOA 4DLIA 1NVSA 3FMLA 3QKKA 4P90A 1G8AA 2XJ2A 4M67A 3UPZA 5GIOE 4F7SA 3KXGA 4D5HA 5H8BA 2C0OA 3I6UA 4EH8A 1T46A 5LJJA 2XIYA 1PXPA 4FTTA 4BZDA 4AAAA 3Q2JA 3WF7A 4BGHA 3NDMA 1H26A 3QD3A 2BDFA 3F3ZA 1LR4A 3PUPA 3HP2A 4FIFA 4AX8A 4JG7A 5HE1A 4HPUE 3AXWA 3F82A 5ACBC 3TNPC 4PV0A 2Y4IB 3ACKA 3I60A 3KGAA 3MA6A 2YACA 4R6VA 4QMVA 3DBDA 5DNRA 3GCSA 4GK4A 4ZTQA 4BDIA 4YUQA 5IDNA 2C6OA 2GS6A 5AUTA 2PUIA 4MK0A 3HRCA 5D7AA 2ZDUA 2PVNA 3H9FA 2X6EA 3IGOA 2WMVA 4CFNA 1SMHA 4TNBA 4BDAA 4C4JA 5HU9A 3BYUA 3TKIA 1Q97A 5H2UA 2F9GA 4I21A 4APPA 4DGGA 3MFSA 5IA0A 3MS9A 3CPBA 3HECA 1TZDA 4F7NA 4F9CA 4DFUA 4DGLC 2HZ0A 1K9AA 2C0TA 3MGYA 2A2AA 5A6OA 3RM7A 1PJKA 1W7HA 1KOBA 1EH4A 3MVJA 2IWIA 4OTGA 4XH6A 1E1VA 3ET7A 3IW4A 4NM5A 2YA9A 3F2RA 2ITTA 3DNEA 4GG5A 1YXVA 2Z7SA 3BHUA 4UMRA 4X6QC 3UG2A 4IB1A 1JSTA 4IVCA 5M4IA 4FSUA 5CEIA 3LOKA 3HP5A 3V5TA 3Q60A 2JDOA 3R8UA 2Y6OA 3PFYA 3QLFA 5HGIA 2QONA 3EIDA 3FL4A 3IW7A 3KIOC 3DQXA 4USEA 5EQYA 4YJNA 5FUTA 3UO5A 3QRJA 1XH7A 4XG4A 5FEDA 5JGBA 1BLXA 3BX5A 2W05A 3BQRA 4AXFA 3Q6UA 3GC7A 3LM5A 3W0OA 3UDBA 3KVXA 4KS8A 2VZ6A 3RHXA 1YDRE 3RPRA 3WZEA 2CNQA 3N4VA 5AX9A 1WVXA 1GZOA 3BE9A 3KB7A 3MESA 4L53A 4L44A 1KWPA 4QP6A 1FQ1B 4KIQA 4ZEGA 3D5UA 3CKXA 3R2BA 3UODA 2V0DA 5HQ0A 3TWJA 4I5PA 4PTCA 3BIZA 5CT0A 2B9HA 4MNFA 1OPKA 2PZRA 5C8NA 4QTCA 4W9WA 4ZMFA 3SG8A 2HW6A 4QTBA 2V22A 4BDGA 4Q5HA 3RHKA 4QP9A 2NRYA 2F4JA 2XEYA 4BDBA 1REKA 4RIWA 4LUEA 1GOLA 4PWNA 3W0MA 2YABA 5BYYA 3RK5A 3FMJA 5HLWA 3L8SA 1WBNA 1Y8GA 4D4VA 4CMTA 3LJ2A 3QRKA 5CU0A 4XBRA 3VS1A 3VS3A 1GAGA 1OKZA 3AT3A 3MY1A 3DXQA 5IISA 4AW0A 4DE4A 2ERZE 3FXXA 4XP3A 5IA4A 5B2KA 3UGCA 5JEBA 2YM7A 4GU9A 2BDWA 4FICA 3MVLA 1YOJA 1UNGA 3DAEA 4LL5A 4ZK5A 3R9DA 4A4OA 2VTLA 4FIGA 5ICPA 3BYMA 4BB4A 1B39A 2I1MA 3KXZA 4FZDB 1SNUA 2IVUA 4ACMA 5KO1A 4QYFA 3Q53A 1KE6A 4NTSA 3D14A 1Q8UA 4RA4A 3GT8A 3R7UA 3W2PA 5CXZA 3EN9A 1ST4A 3A2CA 2CKQA 5IQFA 4RQVA 1FGIA 2X0PA 5IH4A 2IW6A 5AP3A 4ARKA 4AN3A 3VF8A 3CTHA 4QNYA 4YO4A 4O96A 1XWSA 4WIHA 3CC6A 3PJ3A 1P2AA 4R1YA 3Q52A 3QZGA 4CLJA 4ZY4A 2YIXA 2IW9A 5J7HA 2VTAA 5A6NA 4IZYA 5CYIA 5AR2A 5DH3A 3VQUA 1Q4LA 4JL9A 3UOHA 2P4IA 4RBLA 2CGWA 2VTPA 3LXLA 2UW7A 4DFLA 4HPTE 1G5SA 3WIKA 4C02A 3BV2A 5JFWA 4XJ0A 3WE8A 3OBGA 4WSYA 2UW8A 1YI3A 3FMKA 2XM9A 3FI8A 4RWKA 4A4XA 4QNAA 2WIHA 3CTJA 4AZEA 4DYMA 3VS7A 4EC8A 3IGGA 3HNGA 3VBXA 2XARA 1KSWA 4I0RA 3Q4ZA 4X2NA 3JYAA 2OH4A 3PY3A 3ZOSA 1J7LA 2WTDA 4QP2A 4YZDA 4BI1A 3F5XA 2BCJA 4WRSA 4ANQA 5E8YA 4NKSA 4A7CA 2C5NA 3MN3A 4GKIA 2UV2A 3EFLA 4WNMA 5HTIA 1R1WA 3FZTA 4X6RA 2OKRA 4MTAA 3FWQA 2JEDA 3FKNA 4FMQA 5D7VA 5IQBA 4K9YA 2GFSA 1YHSA 3TN8A 2JKOA 3UPXA 3BYVA 4PL4A 4ASEA 4UMPA 2QU6A 3IDCA 4FX3A 4GIHA 2KULA 4YHFA 4AW1A 1XH4A 1CDKA 3D5WA 3PIXA 4KKHA 4OTWA 4AUAA 2RSVA 4UALA 3R8PA 5DA3A 1M2RA 3EH9A 3HX4A 4E4LA 3C51A 1JKTA 3QYZA 3MBLA 4J99A 3UDSA 4RX8A 2UW5A 5I3RA 1STCE 4CKRA 1H00A 3TZ9A 5DEYA 5FEEA 2UZTA 3PTGA 4ZSEA 4F7JA 3A61A 3D7TB 4EK5A 4TNDA 1VZOA 4A9RA 5IKWA 3W2CA 4NM7A 3O23A 3VHEA 3D5VA 2Q0NA 4FV7A 1PXKA 1VEBA 4QMXA 4BCGA 5CEPA 5IZFA 2IVVA 4O4FA 4BVUA 4CZUA 1YOMA 2UW6A 3KY2A 1R0PA 3BBTB 3HMMA 3ORPA 3UIXA 5AADA 4NUSA 5HIDA 4G31A 4I1ZA 5HVKA 3BE2A 3CCNA 3HV3A 3KRLA 3LQ5A 3PZHA 3ZEWA 3RNYA 5BYZA 2YEXA 3PVWA 3VN9A 1YQJA 4PRJA 4AT4A 4GUBA 3MH2A 1H27A 3FE3A 3UO4A 4B7TA 4B9DA 3HL7A 3QQKA 4IXPA 4LGGA 2RKUA 4BDEA 4E73A 4GMYA 3CD3A 5CEMA 4IEBA 2CCIA 2HZ4A 5LCJA 4QQTA 2IG7A 3ZC6A 2QOFA 4G3GA 3B2WA 3EOCA 3BL7A 4WKQA 4HVHA 2CPKE 1Q99A 2QLQA 4ACDA 4M15A 4AGDA 4GJ3A 3VW8A 4EJNA 4LV7A 4FG9A 3I79A 3W33A 2I7QA 5DWRA 3ENMA 3O8TA 5GZ9A 5AV4A 4BDDA 4R7IA 3LFQA 3W2SA 3HA8A 1DAWA 5T68A 4K18A 2UZBA 1R0EA 4YZ9A 3TV6A 3A7GA 2YJSA 2WMXA 4EBVA 2BFYA 5I9ZA 3KU2A 5HVYA 4O2PA 1OITA 5FXQA 2LAVA 3R8MA 1Q62A 4FKQA 2HZNA 4LGHA 3T9IA 2C5VA 3QD0A 4JQ8A 4ERWA 4RT7A 1H4LA 5L8KA 3KVWA 1J7IA 4DTAA 3W10A 2RG5A 2W99B 3D2KA 3DBCA 4DHZA 4LUDA 2QOOA 5CI6A 3G15A 4HOKA 3EFWA 5HG7A 3L8XA 4CFXA 4ZMEA 2BZJA 2J2IB 4AOIA 3VBQA 5JFSA 4HNFA 1NT2A 3QX4A 3EMGA 1PY5A 1CTPE 3UIUA 3TNIA 3VIDA 3ZTXA 3I4BA 4BYJA 2JBPA 1ZYSA 4PTEA 5ANJA 4F6UA 4NL0A 4R7BA 3C4ZA 3HZTA 4NM3A