3RVGA

Crystals structure of jak2 with a 1-amino-5h-pyrido[4,3-b]indol-4-carboxamide inhibitor
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
292
structure length
285
Chain Sequence
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVSPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery of 1-amino-5H-pyrido[4,3-b]indol-4-carboxamide inhibitors of Janus kinase 2 (JAK2) for the treatment of myeloproliferative disorders.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 285
sequence length 292
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rvgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3rvgA01
4DEBA 3E7OA 3RPVA 3A99A 1FGIA 5FXSA 3GU7A 1ZY4A 2FSOX 3GC9A 4BI1A 3C9WA 1WVXA 4D2WA 1JSVA 3L8VA 4XOZA 4B99A 4DT9A 3K5UA 3Q6WA 1OKVA 3N4TA 5HVJA 4BDJA 2OXXA 3CPCA 1JOWB 4YO6A 5M44A 4LL5A 3NLBA 5FBOA 3SC1A 1HCKA 5L4QA 3CQWA 3GU4A 2IZTA 4JR7A 1JAMA 1O9UA 1Q5KA 2WEIA 4E20A 5KMLA 4Z9LA 2J0JA 3GT8A 4IH8A 2SRCA 3G15A 1OIQA 5IDNA 1MQBA 3EN4A 4BGHA 1W82A 4IHPA 2C68A 4XX9A 3P79A 4NM0A 2EVAA 2UW0A 4RVKA 5EDQA 5HG9A 3LZBA 1IAJA 3VS6A 2C47A 3AC8A 3DFAA 2WFYA 4FTLA 4FV6A 3QTIA 4O21A 4FTMA 4CQEA 5IU2A 2QO7A 3OXIA 3NUNA 2V22A 2WKMA 5FTQA 2G2FA 3FZRA 3KCKA 4E6DA 4EOOA 4O83A 3SRVA 3PG3A 3VF8A 2NPQA 2QO2A 1PMEA 3CXWA 4DG0E 4YLJA 4F9AA 3NNWA 4TN6A 3MVHA 4M69B 5CU3A 5M4CA 2QR8A 2CN5A 2W06A 1Q3DA 3GQLA 3R9NA 2VUWA 2YM5A 2V62A 4C61A 2J5FA 5HE1A 1OI9A 2CNUA 3OG7A 3TV4A 5FD2A 1Z57A 2ITTA 4QQJA 2QG7A 3E8DA 3ZLSA 5IA2A 2W1DA 3O8TA 3KMMA 1PW2A 1PXOA 2F49A 2WMQA 3MH1A 3ZOSA 3WOWA 2UW9A 1YWVA 4L3JA 2OSCA 1OITA 4BHZA 3UE4A 3QQLA 4WOVA 4EC8A 4F63A 3DXPA 3MBLA 3DK6A 3GB2A 4BTFA 2PWLA 3O8PA 4RIYB 1XKKA 2BRHA 4DEIA 5HO7A 3AD4A 4L43A 4RJ7A 4MD9E 2C1BA 2VTJA 3P0MA 4QO9A 5HO6A 4BDDA 5M51A 5CEPA 1OPKA 4FKOA 4DA5A 5HCYA 3EOCA 3A2CA 3A7GA 3E62A 2X6DA 2R3RA 3OZ6A 3SW4A 2R3IA 2ZYBA 3NDMA 2G2HA 4JVGA 4PV0A 1PMNA 3QLFA 4EZ3A 2OK1A 2Z7SA 5ANOA 1RDQE 4JLCA 3R71A 4I41A 5BUJA 3I6UA 4FSTA 3TCPA 5IQBA 2GHLA 1GOLA 4GU6A 5JQ5A 2GTMA 2GDOA 4OTHA 4BDGA 3C0IA 4EWQA 4H58A 3LJ2A 4RIYA 3SHEA 3QTZA 3UIXA 1Q62A 5E8TA 2J0LA 4JL9A 5CSHA 3RZBA 3COMA 3ZZWA 2I0YA 5AADA 1Q8UA 5HO8A 1GZ8A 2BZIB 3R6XA 4BDAA 2OJFE 3Q5IA 5AAFA 5AIRA 2B53A 1A9UA 2FUMA 2W1IA 2VD5A 5I9UA 1GZOA 1SZMA 3HVCA 4IWQA 4LFIA 3ZSIA 1KE6A 4EONA 4GK3A 1R39A 4NT4A 4IAYA 4QMYA 3SOCA 4XG7A 4JG8A 3UYSA 2XH5A 4MQ1A 4GFMA 4NJDA 5I5ZA 3QU0A 5DBXA 4R5SA 1STCE 3UBDA 2ZM3A 3PP1A 4TYIA 4FKPA 4XMOA 3HMPA 4HYSA 3O51A 2WZJA 4QTAA 4BGQA 5IH4A 4RX8A 2C6TA 3R04A 4WSQA 4D4RA 4HVGA 5FWKK 4B0GA 4V04A 4EH8A 5T68A 2C5YA 3BLHA 2FGIA 2XK4A 2XJ0A 3FI3A 4P7EA 1YXTA 3OCBA 2XM8A 3HUCA 1W8CA 1S9IA 3G6GA 3TJCA 3L1SA 4KBKA 2QOCA 4IC7A 4RQVA 4D2PA 5AR3A 4ZJJA 3AC1A 4Q2AA 4GUBA 4D4SA 3SD0A 4GRBA 4O7NA 3NYOA 3LIJA 3F3TA 4KD1A 4WKQA 3IOKA 4NFNA 5J7BA 4MXOA 3FV8A 3W18A 3SG8A 4M0ZA 3UPXA 4RGJA 2VTHA 3FWQA 5AAEA 3FHIA 1KOBA 3K3JA 4ZMEA 4XOYA 3SQQA 1YHSA 3BLQA 2EB3A 4E5WA 2WQNA 2XK8A 4X2JA 4EBWA 3GCSA 3TV7A 3R1SA 3OTUA 2B9IA 4FZDB 5AR8A 4C34A 5CF8A 3FZPA 4FC0A 4DE4A 4L42A 4O0SA 3AT4A 5JEBA 3E63A 5IH5A 3NUUA 3ZEPA 1GIJA 1O6LA 3MB6A 3BHUA 2W0JA 4S32A 4WBOA 3BGZA 5EYMA 4EOMA 1FVVA 3MFUA 3OT3A 4OTDA 3LQ3A 4LGGA 4JQEA 2EU9A 4C3PA 4G2FA 4O81A 3FSKA 4MD7E 3BQRA 5HX8A 3NW7A 3R63A 4WG3A 3V6SA 3VRZA 4DEGA 3C5IA 4OAUC 4EHZA 2O3PA 3CC6A 3MFTA 4Y8DA 1KUTA 4AW0A 2IW6A 2IW9A 4WRSA 2R2PA 5HGIA 2ETKA 4UMRA 5I4NA 3KVWA 3WZJA 2IO6A 4ANOA 3UO5A 4RIWA 3ZM4A 1H26A 1J1BA 1B39A 5HQ0A 4CKRA 4U0IA 4A4OA 2F7EE 4ARKA 4EHGA 4EOQA 5EI8A 5J79A 4ID7A 3W33A 2WXVA 3AMAA 3GC8A 3I60A 1W98A 4FUXA 4IXPA 4CFWA 1FMOE 3WF8A 3FLZA 3KB7A 1MQ4A 4DBXA 2UW6A 3NAYA 3RM7A 5LMBA 2AC3A 2XNBA 4BKYA 3MH3A 4A9RA 1XBBA 2R0IA 3KEXA 4XYFA 3COKA 3ACJA 4O0XA 4R1VA 3ZRKA 2OIQA 5HTIA 2C6LA 2VWZA 2VWVA 4RLLA 4Y95A 4ZTHA 2HZIA 4XV1A 5EW9A 2C6IA 5AR2A 3ZSGA 2XKFA 3EQGA 3MYGA 3NNUA 3RCDA 5AUVA 2PE0A 3D5WA 1BUHA 1V0PA 3GU5A 2JC6A 4I93A 5DR2A 3R9OA 3R21A 4ANMA 2V7OA 3BYSA 4S31A 4ZIMA 2XB7A 3RZFA 4RX5A 4D5KA 4FL1A 3UZRA 4HYUA 3T3UA 2LAVA 5M08A 2ONLC 1CKPA 1YI6A 1VJYA 3LFAA 4FKIA 3NIEA 3NWWA 4L3LA 3R8ZA 2B9JA 1PYXA 4O6EA 3QTUA 2J50A 3NCZA 3NZ0A 4HZSA 5CLPA 3VN9A 4UV0A 1SNUA 3OXTA 4FT5A 3TTJA 2WAJA 2BIKB 3V8TA 3BYVA 2W4JA 3MJ1A 3LE6A 3DLZA 2ETMA 3QCQA 3WI6A 3DU8A 2WQBA 4D2TA 2ETRA 4H39A 4L44A 4E4MA 1OZ1A 5F95A 5H8EA 1WBVA 2XP2A 3MY0A 4M8TA 3QBNA 5FM2A 1I44A 3ZTXA 1ZOHA 5AR7A 3RPRA 3JUHA 4ZTRA 3E8NA 2CN8A 4O96A 4C4HA 3DNDA 4BYIA 4DEAA 1KE9A 3R83A 2B9FA 1CSNA 5AR4A 3H0YA 4ZJIA 2XK9A 3H4JA 1M7QA 2UW7A 5KMKA 4LGHA 4P5ZA 4BCPA 3CR0A 4AOTA 3FLSA 3D83A 4R1YA 4KSPA 5EQYA 2HXLA 1AD5A 1H24A 3BU3A 4M97A 3TG1A 5KZIA 4CEGA 5CANA 5GZ8A 5J1VA 5AP7A 2GFCA 3NNVA 3VJOA 3ZLYA 5BUIA 4FUYA 5LQFA 3LJ0A 4FKRA 4NKAA 3GCPA 3VW6A 2WMVA 4UB7A 4HGTA 3ZUTA 4YZDA 3IKAA 3PRIA 5FP5A 3QRJA 4D1XA 3QXOA 3KK9A 3WYYA 3LFBA 2PZ5A 1DI8A 3OOGA 2CMWA 1UNGA 3G5DA 3NW5A 3PE1A 3FLQA 4FA2A 1XH7A 5TO8A 2PULA 2P2IA 3VUHA 3MPMA 4UMUA 2Q0NA 5HZNA 2PK9A 3AD6A 2A2AA 3GXLA 2O8YA 2FSTX 3C0GA 4YSMA 5B0XA 3LPBA 3NRMA 4EH6A 3QX2A 4HVDA 3O71A 5C4KA 4RWLA 4AGDA 5KUPA 4TNBA 1QPJA 3A4PA 4YLLA 4I0SA 2ITOA 4BIBA 2NRYA 2C6OA 5K9IA 3I7BA 3RPYA 4OAVB 5HLPA 3WIGA 3RJCA 5AR5A 3R7VA 5IZFA 5L6OA 4FKJA 3QRUA 2JDOA 5DYJA 1SMHA 3RNIA 4CSVA 3ORTA 3Q52A 4QNYA 4YU2A 3VQHA 2PE1A 4L7SA 2R7BA 4QMOA 2X8IA 1RJBA 3S2PA 1OL6A 3LMGA 3OS3A 2WU6A 5C01A 1E1XA 2OBJA 3R00A 1OUKA 1XH5A 4EK4A 3LCTA 5DH3A 3V5JA 2DS1A 2GSFA 2I0EA 4OTRA 4I5MA 4GT5A 5G1XA 3UODA 1OGUA 4FE2A 2W99B 4GG5A 1ZZLA 5KMIA 4ACDA 3HV7A 3VHEA 5B7VA 3R1YA 4ORKA 4J52A 4C36A 3B2WA 4YC6A 1XH4A 3H3CA 4JAJA 5B2LA 2RSVA 2BILB 2Z7QA 4CFMA 2RFDA 4G3GA 3E3PA 3PXFA 5DT0A 3R2BA 4ZAUA 3AT3A 4F9YA 4EC9A 3ROCA 4DFYA 4C3RA 3UTOA 2OWBA 1R78A 3MVJA 2Q83A 4FOCA 3F2NA 5LMKC 3EN9A 3FKLA 3G2FA 3HP2A 2Z02A 4W8EA 4LRJA 4BGGA 1NXKA 4IC8A 1JWHA 4U79A 5GJFA 2XNOA 2FH9A 2YISA 2Z7LA 3DNEA 4NJ3A 4F0GA 5ITAA 4NM7A 2IPXA 1G8AA 2C69A 4BIDA 5JN2A 1OPLA 4MKCA 3QD4A 4BVUA 5CAPA 3ROYA 3QHRA 3QAME 2XK7A 2X8EA 3KF7A 5FRIA 5FEEA 3IG7A 3RPOA 2X39A 5HLNA 1ZYDA 1BL7A 2F7XE 1E1VA 1M14A 3L9PA 4TWCA 4UWCA 3TACA 4C02A 1FINA 5CT7A 1M2PA 4F64A 3DKCA 4BZOA 5A4EA 4U3ZA 3MA6A 2PMNX 3I1AA 4LYNA 4ANQA 1GY3A 4TT7A 3OWKA 3FQSA 4FV1A 4FTAA 5E8SA 4G9RA 4YZNA 3BYUA 3IDPA 3H9RA 4NIFA 3CP9A 4KNBA 4GV1A 3DQWA 5CU6A 3P5KA 4IAIA 4KKEA 4F1TA 3OC1A 2Y7JA 4I6QA 4XBRA 1YDSE 5ETAA 5FQDC 2X8DA 4TWOA 3RBWA 2YFXA 2DUVA 3UIBA 3WARA 1DI9A 4X3JA 3DBFA 1ZMVA 4BDHA 3MV5A 4G5JA 2Y6MA 3ORMA 3ZMMA 3R8PA 3D5UA 5ANEA 3F3WA 2OLCA 1QMZA 3H0ZA 2PUNA 3K54A 4KAOA 4QMVA 4QMXA 4GK4A 3K2LA 2GQSA 4BWPA 1JKKA 4FOBA 4CT2A 5B2MA 3DKOA 5I3OA 2ERKA 1ZWSA 5CVHA 4CXAA 3POOA 3IDBA 3PLAE 3ETAA 1V0BA 2VZ6A 3LCOA 4UMQA 2W7XA 5CSPA 3ULZA 4W9XA 2QD9A 1W0XC 2VO0A 3FI2A 4ZTMA 2HELA 5TKDA 3FMKA 4HNIA 3NS9A 4NM5A 3LFEA 5CEQA 5IISA 5IMXA 4QTDA 3FMMA 3BGPA 4Y83A 3PYYA 2DYLA 3Q9YA 4G9CA 2ZMDA 3GQIA 4JBQA 4WT6A 3VS0A 3OD6X 2E9VA 1XBAA 4FKTA 4D5HA 4IAKA 4DAWA 2P33A 3RM6A 4AT3A 4L53A 4JQ8A 3FY0A 1Y91A 3G51A 3KMUA 4IE9A 4ITJA 5KE0A 4AA5A 4RFMA 3D9VA 2WOTA 3CIKA 4X2GA 2H9VA 3P78A 2XM9A 4YBKA 4PMTA 3TUCA 2FA2A 2ZAZA 2OU7A 2W17A 2YIWA 3UOKA 5D9HA 4AN9A 4ONAA 4V0GB 3OHTA 1H1QA 2XNMA 2W1GA 1YHVA 3KN5A 3DFCB 4RZVA 2QG5A 3HGKA 3KU2A 3TNQB 3A7IA 5JFVA 4YTFA 1R3CA 5EQEA 3AGMA 2WO6A 3GCVA 2YWVA 2WQEA 4TYGA 2QVSE 3GFEA 3EN6A 2Z7RA 1YHWA 4MF1A 3VUKA 3HA8A 3U6IA 3A60A 2R3HA 4DFLA 2PVFA 2BPMA 2GNHA 2GNFA 4MQ2A 1KV2A 1WCCA 4ASDA 3KC3A 4GG7A 3MS9A 2IZRA 5CI6A 3M42A 4HGLA 4X2KA 1WBNA 5KBRA 2A0CX 3OMVA 2FSLX 4UN0C 4LG4A 1AGWA 4KIQA 4YZCA 5ANKA 4DYMA 3C4WA 4XEYA 3Q4UA 3F7WA 4QP3A 1PKDA 4FT9A 4X6QC 2YIQA 1UA2A 1ZRZA 3DK7A 3MIAA 1PY5A 3EN7A 4HCUA 4CFNA 2J6MA 4OTGA 4USEA 3CSVA 4DFBA 4CKIA 2XF0A 4ZTNA 3ZHPC 2H6DA 2W96B 3DPKA 1L3RE 4CTCA 4XG3A 5AX3A 4PDYA 4NL0A 4WUNA 1P14A 4E26A 4JNWA 4BBEA 4O0UA 4CRSA 4YURA 4DGNA 3NNXA 3LOKA 3PY0A 4F9WA 3NYXA 4RG0A 2O5KA 4C8BA 5BVFA 2QCSA 4DEDA 3DV3A 5IG1A 2CJMA 3ZRMA 5FUTA 1S9JA 3T9TA 4F09A 3ORNA 1KE5A 2BRMA 4PPCA 4F0FA 3TIZA 5CAOA 4KKHA 3Q9XA 2E9OA 3UNJA 4BB4A 3UQCA 2VTMA 3DTCA 5B2KA 2RIOA 4RWIA 5TF9A 4D2SA 4BWKA 1QPDA 3SA0A 4IACA 1PMUA 3KXHA 3GI3A 3QX4A 5JFWA 2YM6A 4MWHA 1FVTA 3I0OA 5J7HA 2JIUA 3I81A 3HEGA 3Q5ZA 2QR7A 4XRJA 5BVOA 2CLQA 5ACBC 5GIPE 3FAAA 4R3PA 4YLKA 3VVHA 4M15A 5JFXA 4ENXA 4O82A 1RE8A 4GUEA 5DR6A 1M2QA 3SGCA 2X9EA 5CT0A 5I0BA 4G34A 1H27A 4G3CA 4ZEGA 2W5AA 3V5QA 2VTPA 2B0QA 1CKJA 3PVGA 3QUEA 4GMYA 4AZTA 2C5OA 5F94A 3RVGA 1LP4A 5JZNA 1B38A 3RHKA 2XIKA 2EXCX 3ORPA 4FTUA 4BRXA 4DG3E 4XNEA 4IQ6A 4UXLA 5DHJA 2R9SA 2OH0E 3QKLA 3UPZA 3ZONA 4ACCA 3A7JA 3PY3A 4WD5A 5EHLA 3CY2A 3PXQA 1BMKA 4DN5A 2BRNA 2Y8OA 3R73A 2P4IA 3LFSA 1KE8A 3FZ1A 5CS6A 3ENMA 2PVMA 3TDWA 3GUBA 3SKCA 3U4UA 1BL6A 4C4JA 3FKOA 3W2PA 1XH8A 1QPCA 2YHVA 3QD3A 4UY9A 3H9OA 3W2QA 5LVOA 1J7LA 4IX4A 4D4YA 5LCKA 5I9VA 5FLFA 4ALVA 3PTGA 2JDVA 2WEVA 2XCKA 4FIEA 1PYEA 3E8CA 2ZB1A 3QYWA 1IEPA 2OH4A 3NYNA 4B8LA 2JKKA 2WU7A 3PIXA 4L3PA 3TN8A 4RRVA 4GJ2A 5AUZA 2VO6A 4D0WA 2CLXA 3I79A 4OTFA 2OJIA 2W5HA 3HMMA 3HL7A 4PWNA 3TJDA 4X3FC 5DVRA 3EL7A 5E92A 1JKLA 5FDXA 4NCTA 3UOJA 5J9LA 1OVEA 1H00A 2LGCA 3F66A 3PWYA 3SV0A 1Y8GA 5JSMA 2R0UA 3A7FA 4MHAA 3IK3A 4MNEB 5BNJA 4KBCA 3FPQA 2J51A 1WBOA 1UU3A 4B4LA 2Y6OA 4JRVA 5FBNC 2FYSA 4NW6A 5HD4A 4KRCA 3ANQA 4FTCA 2B1PA 2ZMCA 4LRKA 2YLFA 1Q24A 4TWPA 2VO7A 5AV0A 3U6HA 2HZ4A 2GU8A 5HBHA 1WBTA 3LM5A 3PXRA 2DWBA 4RFYA 5ANDA 3AD5A 3TKHA 4JDJA 5HU9A 4FF8A 3W2CA 5JKGA 4RA4A 3DCVA 4BZDA 3VBYA 3WF6A 4FKGA 4ZSJA 1LEZA 4U81A 5IPJA 5HE3A 1R0PA 3QXPA 4E6AA 2CCIA 3MIYA 4OLIA 2PPQA 2OIBA 2YWPA 4I6HA 3FUPA 1OB3A 3FLYA 3FYJX 3UYTA 4E4XA 4QMPA 1E9HA 5AP2A 1ZZ2A 3QZFA 2WELA 1IAHA 3ZBXA 4CCBA 4L46A 3BYOA 3ZCLA 3C13A 3MWUA 3PVBA 4NUSA 4QD6A 4X7QA 3EQCA 4YTIA 2XVDA 4ZSEA 1SVHA 4HPUE 3CEKA 5A4TA 5IH6A 4R7BA 2PSQA 3EFJA 2W1CA 3QZGA 4O2ZA 3TI1A 1IRKA 4C38A 4QTEA 3ATTA 4PQNA 2XK3A 2PVLA 4NEUA 1M2RA 4M66A 4I21A 4FEUA 5IQFA 4WRGA 3DGKA 5DT3A 3ELJA 5GJGA 4R3CA 2XKDA 3EYGA 3ORKA 4IANA 1Q8WA 1ZYSA 1VEBA 4O7ZA 4TW9A 4BBFA 1UNHA 4QP9A 3R8LA 4RX9A 4I92A 3OCSA 4RIXA 3F2RA 4G3FA 4TL0A 4AZSA 3AMYA 5DEYA 3RK7A 1OKYA 4U97A 3OWLA 2XK6A 3IW8A 1QCFA 3BBTB 2BRBA 4RC3A 5I9XA 1ZYCA 4AP7A 2YCRA 4IM0A 4O86A 3OY1A 3R2YA 1LPUA 4I6BA 2J0MB 4PF4A 1NT2A 3QWJA 3LFNA 2VN9A 4EORA 2C3IB 2UV2A 4YO4A 1J91A 1A48A 3G9LX 3EHAA 3QRTA 5DG5A 4BTKA 2XYUA 3PJ1A 3UIMA 4M12A 3REPA 3MVLA 4H1JA 5L3AA 3OFMA 4IFGA 3KK8A 4QTCA 4KUJA 4JAIA 3P1AA 2VWIA 4GW8A 3CGFA 5LCJA 4XG2A 3UOLA 1BYGA 4X6RA 4X3FB 1F5QA 1P4FA 4GVAA 3OXZA 1Q61A 4EOJA 4DCAA 3NX8A 4XG6A 1JSTA 2UZLA 2WMAA 1Q4LA 3JVRA 3UC3A 4E8AA 5ANIA 4FSYA 4RPVA 3RWPA 1YW2A 4M69A 2C1AA 3KVXA 5H8BA 5J8IA 3R7GA 2BHEA 2C0IA 5BVDA 4XHKB 3DS6A 2EB2A 2EWAA 4FNZA 3QQUA 3CE3A 3W8LA 2OICA 1H1RA 4FT0A 3MPTA 2VTQA 4ZTQA 4L68A 5DIAA 4LUEA 5IF1A 4UYAA 2OFVA 3W10A 4DH5A 1JKSA 2X4ZA 3VNTA 3QQFA 2WNTA 1PXIA 5I3RA 3F69A 4X0MA 4TKSA 5FXQA 4AE6A 1PXNA 4UEUA 4USDA 3ZXTA 2W9ZB 4K33A 2HWOA 4LRMA 4WNKA 5HEZA 4NKSA 3LFCA 4IWOA 4BCHA 5DR9A 2R3NA 4DGGA 2JFLA 4ZZNA 4J96A 3TNWA 3CD3A 1OL2A 2X81A 3PUPA 4OUCA 2Z60A 5EG3A 3VUDA 5L2SA 1WVYA 2VAGA 3F3ZA 2WMWA 3PZEA 2ITNA 5HG7A 2GFSA 3M1SA 4U41A 3E5AA 4F7SA 3OOMA 1SM2A 4MTAA 3U4WA 4EZ7A 4OGRA 2AYPA 4IW0A 4RZWA 5DLSA 5BYZA 4I1ZA 4TYEA 2UZEA 3O17A 2VWYA 3HV4A 2VTRA 3IGOA 5E1EA 2W5BA 5KBQA 3RPSA 3HMNA 4ZMFA 3LKMA 2F7ZE 2JKQA 5EHOA 3NVKI 4FI1A 1YRPA 4O22A 4G6NA 5CF5A 3PP0A 3CGOA 3FBVA 5HU3A 1GZKA 2F2CB 3TNIA 4OW8A 3NCGA 4ZY6A 1NY3A 1U54B 3QCSA 4J99A 4PL5A 3ZO2A 4ZSAA 5E9EA 2PYWA 3BHHA 3DBCA 2YLEA 3ATSA 3H9FA 1SVEA 4PTGA 3MESA 4QYEA 5DN3A 4O7RA 3MY1A 4KBAA 4KIPA 5T6KA 2BZHB 4EK3A 2HWPA 1PKGA 5DRBA 3CTJA 3UG1A 5IA4A 2PUUA 4ENYA 4K8AA 3V5PA 3BI6A 5EI6A 1HCLA 4XCUA 5LWMA 3FQHA 1JNKA 3SDJA 2W4OA 2RG6A 3S1HA 2IW8A 3ZO3A 3SLSA 3DA6A 4AFJA 1WVWA 3NUPA 4USFA 3D7TB 3EN5A 5J1WA 3NW6A 4LV8A 4E3CA 5HE0A 4NTSA 3C4FA 4EOIA 4GH2A 4EBVA 4YUQA 3QA8A 4WG4A 4MBJA 3PLSA 4RVTA 4S33A 3WZKA 2UZDA 4D2VA 5CYIA 3THBA 3OEFX 4J53A 4C0TA 3OVVA 1BLXA 2R64A 3QD2B 3QCXA 4FTKA 4R8QA 1OM1A 3D2KA 5GHVA 3LMIA 3IO7A 3OCGA 4OTQA 3OF0A 2XNGA 5AFVA 4M0YA 2J4ZA 3VAPA 2BDFA 2QC6A 2J90A 3W2RA 1JPAA 4B9DA 3POZA 4FK6A 4BCOA 3ZRLA 2KTYA 3FZSA 1CM8A 3HP5A 4FYOA 1W83A 1QL6A 4C35A 5E90A 5HBJA 4BI2A 4D9UA 4I4EA 3E8EA 2BKZA 2PVKA 4XP2A 4V01A 4RIOA 3L8XA 4RJ8A 1JSUA 3C7QA 3KFAA 3Q9WA 1UU7A 1F0QA 2XBAA 3TUBA 4KWPA 4FKWA 2W1FA 2C6KA 4AGCA 3JY0A 3FZOA 3LCSA 3LQ5A 5H2UA 3GOPA 4APPA 3OEZA 5DWRA 5M4UA 2CDZA 2VTLA 4W4XA 3U8WA 2YCFA 2B7AA 3PSBA 4C7TA 4BTMA 3TNHA 4RMZA 3ZUVA 2VX3A 4FNYA 2BFXA 1U5QA 4J71A 1OPJA 1UNLA 3TTIA 5J5SA 1BKXA 3N9XA 2VTNA 3LFQA 3QYZA 4JT3A 4MBLA 4Q5HA 3WF7A 2ERZE 4BDKA 5FTGA 4U80A 3U51A 3OW4A 2XNPA 4MX9A 2VWUA 3VW8A 4J1RA 4KB8A 2PU8A 2WD1A 4K77A 4BDIA 4E93A 3U54A 2YM4A 3R7EA 2CKQA 4PUZA 5BMSA 5FEDA 2WIPA 4QPAA 1DAYA 1ZOEA 5FTOA 5BMMA 3VC4A 4HVHA 1RQQA 2WOUA 4G3EA 5A6NA 3ITZA 1GIHA 3F2AA 4B8MA 1YI4A 2VU3A 3R28A 4QP4A 5GJDA 5HIBA 4CQGA 2PHKA 4QQCA 5HE2A 2YABA 4W8DA 3RGFA 3OT8A 3F7ZA 2I1MA 3HX4A 4PL3A 4F9CA 3CPBA 3JS2A 3PJ2A 4UZHA 3PPJA 2VTOA 4YJQA 5FEQA 1G8SA 3D4QA 3NAXA 3UMWA 3Q96A 4FG7A 5CWZA 3HRCA 5LVNA 2Y9QA 3BLRA 4DFZE 4A4LA 4DFXE 1ERKA 4ALUA 1DS5A 3MH0A 4F1MA 3LM0A 3RAWA 3UZTA 4EJNA 3ZDIA 5HOAA 3GVUA 5KMJA 4FVPA 3WZUA 2AC5A 2QU5A 4H36A 4EKLA 2BUJA 2YERA 1UKHA 5J87A 5G6VA 5M4IA 5A4QA 4KRDA 2ITWA 3SXRA 1PJKA 1BX6A 2VO3A 4QPSA 4CG9A 5CSVA 2GS2A 4BTJA 5CEMA 3I5NA 2X2KA 4LMNA 4P2KA 1VZOA 3KULB 4FV7A 4K11A 1J7IA 3O7LB 4TTHB 3DLSA 3DDPA 4WSYA 5ANJA 1P2AA 3MN3A 1MRYA 2VGPA 3FZTA 4UMTA 1ZMWA 4OR5A 4D55A 2XEYA 3HECA 2OFUA 4NTTA 4ZOGA 3OWJA 4RT7A 3LCDA 3LXLA 2BFYA 4EWHA 3EQDA 5CF6A 3DXNA 5ETFA 3EZRA 3ZUUA 4U40A 3CD8A 5DNRA 4XH6A 1OMWA 3MVMA 3OCTA 1YVJA 5LMAA 3VBWA 4FTNA 4NH1A 3DXQA 3U87A 3DZQA 2WMXA 5EW3A 4YNEA 4DCEA 2HIWA 4FNXA 4AG8A 2HAKA 3DAJA 2VTIA 3FHRA 4Y46A 4ANBA 3PDTA 3QUPA 3NGAA 3C5UA 3FY2A 3IPHA 4CKJA 3DBQA 4MYGA 4CTBA 1TVOA 2PZPA 1CDKA 5BQ0A 3BIZA 5A6OA 5JFSA 5K4IA 4XV9A 3BYMA 1SYKA 3QD0A 1UU8A 2Q0BA 4MCVA 4EKKA 5KX8A 2CNVA 3Q04A 4F4PA 4EH3A 2H96A 2GTNA 3FMLA 5JGBA 5ETCA 1W7HA 2QI8A 3JVSA 3IW5A 4KIOA 4WA9A 5CAUA 1YOLA 2J9MA 4MD8E 2XYNA 4YNOA 3W2SA 4Z3VA 4IAZA 1IA9A 2VWBA 4TZRA 2EUFB 2UZWE 3ZO1A 4E73A 4KINA 1XHAA 5KZ0A 2VNWA 3EQBA 4QMWA 3PY1A 4EK6A 2Y4IC 4PNKA 4DBNA 4X21A 2I0VA 2HY0A 3QQJA 3BWJA 2RFSA 3K3IA 4CYJA 4MEDA 3R30A 2NNWB 3C4XA 5J9YA 2NO3A 3UO6A 3ZH8A 4AF3A 4MWIA 3ZO4A 4FIJA 3FQEA 2UW5A 2ONLA 5M55A 5CVGA 3QQHA 3EZVA 3OUKA 2QONA 3DK3A 4IVAA 1ZYLA 3BBWA 3NIZA 4YHJA 3F88A 4JI9A 4AT4A 3R7IA 5M07A 4CV9A 2WB8A 1OUYA 3CKWA 4YZMA 5AJQA 3IW7A 2XMYA 3FXZA 4ZSLA 4M7IA 5A4CA 2OF4A 2PTKA 3KF4A 4ZS0A 4O0YA 4FV2A 5D1JA 3RMFA 4GL9A 5CEIA 4BCGA 4U5JA 5AA9A 4FT7A 4APCA 1IA8A 3I4BA 2X4FA 4JIKA 5AV1A 1NW1A 3DKFA 1YKRA 3TT0A 2CGXA 4AE9A 4YJPA 2ITQA 1Q8YA 4NZWB 5KMNA 1PXKA 2GCDA 3MY5A 4LV5A 1DAWA 3RAKA 1JVPP 3BU5A 3W2OA 4R5YA 4NSTA 2C0OA 2ZVAA 3FEGA 3EKNA 5CF4A 2QHNA 5IA5A 4ZLYA 3OW3A 1OECA 2Y0AA 3E64A 2OZAB 2R3LA 3GU8A 5KHWA 3NYVA 4I24A 4IMYA 4C4FA 4DFNA 5C8NA 4IVDA 2KULA 1WAKA 2X2LA 4H3PA 4QP2A 2G9XA 3QRIA 3C0HA 3NEWA 4I6FA 4FSMA 3TWJA 5AWMA 4QP1A 4XP3A 3VS4A 4A9YA 3VUMA 4BCNA 2R3KA 1BI7A 2JD5A 2VNYA 2XNNA 3AOXA 5E1SA 2BIYA 3VQUA 4E4LA 4G17A 3RHXA 5J5TA 1Y57A 2VWWA 5BUEA 2BZKB 2ITZA 5IUIA 2HW7A 2E9NA 3CTQA 4FGRA 3G6HA 3ERKA 3VS1A 1TQIA 4CV8A 2XIYA 2YIYA 4J7BA 4MXYA 3UOHA 4EQUA 4O6LA 2ITVA 3P9JA 3Q4ZA 3R9RA 5IQHA 3F5PA 2WIHA 2OZAA 5JRSA 3O0GA 1EH4A 3QQGA 1APME 4CMTA 3UZPA 2JBOA 2JFMA 2BMCA 1O6KA 3L8PA 3WZDA 3VBTA 1PXMA 4AWIA 3LXPA 2UZUE 4AZVA 4EH2A 3BV3A 2UUEA 2IJMA 3PE2A 4HZRA 3QGWA 4EYJA 2A1AB 4O1OA 3MW1A 3B2TA 4HW7A 4WO5A 3NVMB 1M7NA 3EJ1A 4QMZA 5D11A 5CENA 5A4LA 4HNFA 3T3VA 5M09A 2GNIA 4QP7A 3VF9A 1O6YA 4UX9A 1NA7A 2WTIA 2G01A 3R01A 4QNAA 5D41A 4TYJA 4O0WA 5C4LA 3MH2A 1PXLA 2GHGA 4XV3A 5GINE 4BDCA 3WBLA 4TYHB 4F6UA 4ZZOA 2PY3A 2O64A 1BI8A 2QKRA 4JDKA 4M68A 2X7OA 5HNIX 5EI2A 2XIZA 5AP5A 4U9AA 4WUAA 4FIIA 4IVBA 4L45A 1RW8A 5CEOA 4C4GA 1XQZA 5HICA 3D5VA 3KMWA 5IUHA 5KKRC 3FDNA 5E8WA 5IQDA 2BTRA 3EFLA 3BX5A 3EYHA 5L2QA 2JITA 1QPEA 2QLQA 3OROA 5K3YA 3PWDA 2XS0A 1Z5MA 5EYDA 4V0GA 1FVRA 4RFZA 4G6OA 4NYEA 5E7RA 5FG8A 2XIRA 3LW0A 3LCKA 5EM5A 5HCZA 4DC2A 3WZEA 3DJ7A 5LMKA 4CG8A 3AC2A 4BCQA 2OO8X 4Z7HA 3SW7A 4AZFA 4E1ZA 2FVDA 2E2BA 3GNIB 5BYYA 4NW5A 2GQRA 3PZHA 4RJ4A 4ZTSA 2IVUA 2VTTA 2OJ9A 2WQMA 5C03A 4TWNA 2CGUA 3FYKX 3RALA 3BCEA 2W9FB 4UWBA 3TKUA 5IA3A 4ANNA 4UBAA 1MRVA 4O0TA 2JKOA 4Q9SA 2WTDA 4A7CA 4B6LA 4H1MA 1H0WA 3H10A 5CX9A 4EEVA 2GPHA 3FMDA 2PZRA 4S2ZA 3R7OA 4DHFA 3S95A 5E8XA 3IDCA 5AP3A 3PFQA 4D4VA 3IW6A 1ATPE 4EUUA 2UZOA 2C5VA 4F6WA 3PA3A 3E92A 3FE3A 3FI8A 2HZ0A 4MXZA 4HCVA 5ETIA 3HV3A 2XJ1A 4ALWA 1Q99A 5EK7A 5JK3A 4Q5EA 4K1BA 3R8VA 4LOPA 4JJRA 4D58A 4IX6A 3OTVA 4EQMA 5CQWA 3HLLA 4YGAA 4DITA 4ZJVA 3QCYA 4YBJA 3BZ3A 2HOGA 1PXJA 2JIIA 3O96A 4FTOA 3FI4A 3P08A 4FTTA 5LWNA 3KREA 4II5A 4FIGA 5CNOA 4OBQA 2PVRA 2GHMA 2GNGA 2QLUA 4FKUA 4DG2E 3O2MA 4F9BA 3FMEA 2YZAA 4PRJA 5E91A 3DT1A 4GJ3A 3V04A 4GFGA 3DBEA 2A4LA 2YCQA 3U9NA 4FICA 1WBPA 2YITA 4BCFA 5LJJA 4FVQA 2CCHA 3KXMA 4E6QA 4IVCA 4A06A 5K4JA 3H30A 4R7HA 1OIRA 2RFEA 3HUBA 2J0KA 2PVYA 3CCNA 4BICA 2XJ2A 3G33A 4L67A 2HENA 3O7LD 4XLVA 5EOBA 4A9SA 4D28A 4FEVA 4JG7A 2I6LA 4YC3A 5CU2A 4I5PA 5L8KA 5AUWA 5BX0A 3P23A 3LHJA 2YIRA 2UW8A 1OKWA 1VR2A 5D10A 3DZOA 4FZFB 5KKRB 2Z8CA 2X7GA 4QMSA 4AZEA 4F1OA 3AC3A 3Q6UA 4MNFA 2XRUA 4OTIA 1OL7A 4FKSA 4HVIA 4Y72A 2WTWA 3V3VA 3HDNA 3LVPA 4O0VA 4ACMA 5CAVA 5IEYA 1R0EA 5DT4A 1SNXA 4BBMA 1NVSA 5BPYA 5IUGA 3LMHA 4FEQA 5CSXA 3L9LA 1FGKA 3CBLA 3VRYA 3WF9A 1XJDA 4AA0A 3PSDA 5I9YA 5EM6A 4ZZMA 5CNNA 4AW2A 4C4IA 5AP4A 4JR3A 4C4EA 4CYIA 3KKVA 4G6LA 4XBUA 4M3QA 1H4LA 2QNJA 1YXUA 4R6VA 4YR8A 4BDFA 2QURA 3UGCA 4W4VA 4CZYB 3QTQA 3A4OX 3D5XA 2QOHA 4LM5A 4BDBA 3QQKA 4JBPA 3ZDUA 4RX7A 4PPBA 3P7BA 3P7CA 2ESMA 1FPUA 4FK3A 4YHTA 3KXNA 3CQEA 2IZSA 2WTJA 1JKTA 2C5XA 2UVXA 4FSRA 3UVQA 3VS5A 4CD0A 2OI4X 4NK9A 1U46A 1FBNA 2JEDA 5IQCA 1YXVA 2JKMA 2YM8A 2OG8A 3PPZA 4HJOA 4MVFA 1M52A 2YIXA 4KKGA 1T46A 3NUSA 4PP7A 3MGYA 3AMBA 1YDRE 4FL3A 4MNEA 4ZS4A 2OXDA 5A3XA 2G2IA 2BHHA 2OF2A 4CRLA 1ZMUA 2O65A 3UNKA 4FEXA 4QYFA 3QTWA 4PP9A 1H07A 2FSMX 2ITPA 4FODA 3QFVA 2WQOA 4F7NA 5LVLA 4FSNA 4YTCA 5D7AA 4Z55A 5CZHA 3Q60A 5K0XA 4WBBB 4EOLA 3BHYA 3I5ZA 5HIEA 3EQFA 2O63A 2C3JA 2B55A 3ZFYA 3A7HA 3COIA 4RBLA 1PHKA 3GFWA 4K0YA 4EH9A 1B6CB 3F3UA 2C6MA 4HYIA 4FL2A 4GEOA 3SAYA 3CQUA 1UV5A 4RQKA 4QYYA 2PUIA 2ITYA 5F9EA 2YZLA 4JOAA 2XNEA 4PL4A 2XRWA 2V0DA 3BE9A 3SRVB 3NUYA 4U7ZA 5ICPA 3D14A 1URCA 3IECA 4AX8A 5EH0A 5EOLA 2W1ZA 2YM7A 4K18A 2HK5A 3FMJA 4F0IA 3UJGA 3OUNB 4DH3A 2CKPA 3PVWA 4I5CA 4RJ3A 4CMOA 4O84A 1K9AA 4UWYA 2P55A 3ZBFA 3N4VA 4JRNA 3R22A 4JS8A 3Q53A 4IB0A 4AGUA 3QTXA 2QOKA 3A61A 4FX3A 3JXWA 1KOAA 3AG9A 4W9WA 4ASZA 5M57A 1L8TA 4L52A 4X2FA 1U4DA 5IA0A 4PNIA 4C57A 3BHVA 4QPMA 3AC4A 2IVTA 5FDPA 4LOQA 3RK9A 4L8MA 4DF3A 3CJGA 5L2TA 4IEBA 1V1KA 2JBPA 2OZOA 5EM7A 2X7FA 3G0FA 3M2WA 3W55A 4I0TA 1U59A 4O7LA 5IA1A 4MXXA 3F6XA 2PL0A 4FKVA 2WGJA 2ZV2A 4IB5A 5EDPA 3AT2A 2J0IA 3QKKA 5F1ZA 2W1HA 5FXRA 4FYNA 4KA3A 3COHA 4MXAA 1Y6BA 3MJ2A 4FV8A 2RFNA 2Y4PA 1LUFA 3C4CA 3NSZA 4FVRA 4BY9E 1FQ1B 2I7QA 4BCJA 4QP6A 4MF0A 4BKJA 3D0EA 3U9CA 4KS7A 2YDKA 4RLKA 1V0OA 5I9ZA 3R8MA 4P90A 3RP9A 4X3FA 5IMEA 3R7YA 5IQGA 3P86A 3I0QA 3GCUA 2CSNA 2RKUA 1YI3A 4IJPA 4A9UA 4QQTA 5AV4A 3LJ1A 3IQ7A 5EDRA 4DGOA 2P2HA 2QOQA 5AUUA 3HAMA 1K3AA 3D15A 1UU9A 3E7VA 5C1QB 5K5NA 3KL8A 4F08A 2UVYA 4AOJA 3N4UA 3D2IA 3QZHA 3MFSA 4JBVA 3ZXZA 4L7FA 2CGWA 2C4GA 5HHWA 4F6SA 5LVMA 5LVPA 5HORA 4Y73A 5BYLA 4WHZA 3Q2JA 2C0TA 4C58A 1Y8YA 3EFKA 1YOJA 4CFVA 4G3DA 4FG8A 3EKKA 4O2PA 5CQUA 5CU0A 3D7ZA 3O8UA 4FBXA 4FZAB 4QQ5A 3KA0A 4IIRA 4C3FA 3N51A 5CSWA 4EYMA 4ZY5A 4C59A 4E4NA 3BQCA 4XG8A 3WE8A 3OY3A 4PMPA 5AAGA 2QO9A 4O7WA 1GIIA 2BTSA 3GOKA 1T45A 5J95A 2F4JA 4EZ5A 2GQGA 2X1NA 3Q32A 1J7UA 4V05A 1CMKE 2BAJA 3ODZX 4M13A 2BAQA 3VO3A 4EHVA 1KE7A 4N6ZA 3UVPA 4ANLA 1AQ1A 3O23A 5HI2A 4DINA 5JZJA 1OIUA 3HV5A 3LXNA 2BAKA 4YJRA 3L9NA 3ZC6A 3ENHA 5M53A 4PMMA 1REJA 4IADA 3WF5A 3F5UA 1XWSA 4YHFA 3C1XA 4BCKA 3KN6A 3FC2A 1H0VA 3BV2A 1ZYJA 3WILA 4JDHA 4O7TA 3HMIA 1ZARA 1H1SA 4MK0A 5GIOE 4PDOA 3UC4A 2UVZA 3A8WA 4AGWA 1H08A 4TXCA 2ZB0A 3A62A 1ZY5A 1HOWA 3KQ7A 4J8MA 3TKIA 3V5LA 1U54A 2ITXA 5CI7A 2C6EA 4ZP5A 5AMNA 4LOOA 4IB3A 4OTWA 5FP6A 4EH5A 4F99A 5JGDA 3MTLA 2RF9A 4Y85A 4JQ7A 3G0EA 3BWFA 3W32A 4AACA 1CTPE 4O38A 1ZAOA 4YC8A 3VJNA 4MAOA 1IG1A 4H3QA 2UZNA 1G3NA 3EH9A 3PIZA 4HGSA 4I20A 3PPKA 4DEHA 4DH1A 2R3OA 3FMHA 2PZIA 3TZ7A 5IQAA 4N70A 3UDBA 4RIWB 3VWAA 4BHNA 4C37A 3PIYA 4IAFA 3TZ8A 5DE2A 3V6RA 3OP5A 3W1FA 3DB6A 2FO0A 5LOHA 5IQIA 5TE0A 3RI1A 3PG1A 2QOIA 3D7TA 4IBMA 3FSFA 2ZV8A 3OBGA 4FIFA 3QC9A 5A46A 4RVLA 5CXHA 4FV4A 3QL8A 4IDVA 5LARA 4BCMA 4YJNA 5L8LA 3HMOA 3HAVA 3VHKA 4CFFA 3RINA 3DY7A 4YPSA 4RWJA 3TDVA 5EFQA 5AV3A 3RAHA 3QLGA 4PDPA 2C5NA 3DQXA 4YJUA 1Q8TA 4GU9A 3R8UA 4CCUA 2J2IB 5EM8A 3HRFA 4FTIA 1UVRA 3LLTA 3SXSA 5HG8A 5BVKA 2EXEA 3BHTA 1TQPA 2UZTA 1OBDA 3C51A 4QMTA 2BROA 2W05A 3FLWA 3W8QA 4TY1A 5HNBA 2QOOA 4LQMA 5TR6A 3KXXA 3RNYA 4BF2A 2XZSA 4GK2A 4D2RA 3ORIA 4YJOA 5GZ9A 3F82A 1YWNA 1P4OA 2ZV9A 4YSJA 3UO4A 3FL4A 4GSBA 5AM7A 4FT3A 3GC0A 1NVQA 4FV0A 4Y5QA 5CY3A 5CZIA 3UIUA 4CFXA 4L9IA 3P7AA 3T9IA 4DLJA 1PRYA 3HNGA 4ZSGA 4QYHA 5HG5A 4L01A 4NU1A 1A06A 5H9BA 2CHLA 4XUFA 4DLIA 5EKNA 3GC7A 4QMNA 3AGLA 3ZLWA 2C3LA 4G31A 2ZM4A 4DGMA 5EQPA 2HCKA 4IZAA 4J8NA 3A8XA 2CNQA 3NUAA 1OL1A 3IS5A 4CMUA 4F7JA 1YDTE 2BVAA 4U6RA 2A19B 4CT1A 3PA4A 5HESA 1H1WA 2OIDA 3C4ZA 2PVNA 4F70A 3DJ5A 3IW4A 3ORLA 4HCTA 4RSSA 3ORXA 5CEKA 4MXCA 3UNZA 3VBVA 4ANSA 3S00A 3S0OA 1JQHA 4XG9A 2GNLA 3VULA 2G15A 4HVSA 1DM2A 4EOKA 3U55A 3KXZA 4W4WA 2IWIA 3E93A 3S3IA 2GNJA 4L6QA 5HX6A 3I7CA 5L8JA 4IB1A 3PXYA 2WTCA 3LFFA 3O50A 3QRKA 4FV5A 4K2RA 4KIKB 3QZIA 4QYGA 4J98A 4X2NA 5AP0A 4JIAA 4GIHA 3VS7A 3II5A 3VBQA 4QRCA 2WMUA 4PMSA 1XH6A 3V01A 4C2WA 4DH8A 5KMMA 4Z16A 3IONA 5E8ZA 3MTFA 2PVJA 3ACKA 3FXWA 4G5PA 3R9DA 1YXXA 3MSSA 4FV9A 4CZUA 1LEWA 4YJTA 5AV2A 3HA6A 5AP1A 3CY3A 3PSCA 5J9ZA 2XUUA 2YM3A 2JDSA 5KO1A 2HW6A 3FLNC 4PX6A 3TEIA 5HLWA 4F7LA 3EFWA 4IJ9A 3SOAA 4Q9ZA 3FMNA 4U3YA 4C2VA 3P4KA 3ET7A 3QGYA 4KIKA 4J97A 4DGLC 3TUDA 3VS3A 4YMJA 1WBWA 2R3JA 3UMXA 3F5GA 4GKHA 4PDSA 5C8KA 2XKEA 4PY1A 4AXAA 3NMUF 3UQGA 4TNDA 3BRBA 5FM3A 4CVAA 4CLJA 3L8SA 1F3MC 4CGAA 3DAKA 3JR1A 2V55A 3ALOA 1J1CA 3QA0A 1ZOGA 3QUDA 3IOPA 3ZZEA 1WFCA 4I94A 3VBXA 2ZM1A 3HYHA 4U45A 5ACKA 4DTKA 2F57A 5KNJA 3KULA 2XKCA 3Q9ZA 5CAQA 4I23A 5AUTA 5KMOA 5BVEA 3BKBA 3G90X 3KCFA 4WG5A 4EK5A 2C30A 5DFPA 3ULIA 3AXWA 3C50A 5E8YA 4ASEA 3PA5A 4XS2A 2H8HA 2QODA 3D94A 1H01A 1R1WA 4XRLA 4AZWA 5IDPA 3CS9A 3FKNA 3TZMA 4A9TA 4O7YA 2H34A 4ITIA 1XBCA 5IEXA 4N0SA 3MDYA 4AT5A 2OJJA 4BDEA 1U5RA 5TT7A 4FSWA 2YN8A 3FL5A 3AC5A 4FV3A 4MBIA 3R1QA 4BC6A 4WIHA 4FG9A 1PMVA 4ZK5A 2JLDA 2ACXA 5D7VA 4QT1A 4XG4A 2X2MA 2QOBA 4LMUA 2W1EA 4D9TA 2JAVA 4ASXA 5AIKA 4XV2A 3ZYAA 4HPTE 2BKKA 2F2UA 2IVVA 4FMQA 4TPTA 1VYZA 3ZFXA 4EH4A 3KGAA 2HXQA 5HD7A 3EWHA 4ZLOA 3OBJA 4D0XA 4EOSA 2WTKC 3AQVA 2YACA 2X9FA 4AA4A 3HKOA 4FTRA 4DTAA 3RKBA 5K0KA 1SVGA 2ZDTA 4BR3A 2X0GA 4M14A 4IZ7A 1J3HA 4F65A 4I4FA 4K9YA 2PZYA 3GENA 3GBZA 2WMTA 5M06A 3TZ9A 2W4KA 4BFMA 3JPVA 2B52A 4GVJA 1Q8ZA 3PJ8A 3HV6A 4NM3A 4CLIA 4UXQA 4U44A 4N57A 3Q4CA 2F9GA 5GNKA 3W16A 4RJ6A 1MUOA 4TRLA 4KSQA 4RWKA 4OBPA 1FOTA 2I0HA 3QWKA 4R3RA 4AS0A 3BPRA 1GAGA 5C26A 1YXSA 3DAEA 3EL8A 4OT5A 1JLUE 4NIFB 3V8SA 3G9NA 2A27A 4QOXA 4AOIA 5L6PA 3KRXA 2VTAA 3OWPA 4BCIA 3DJ6A 1MP8A 4C33A 2QOFA 4M84A 5H3QA 3UVRA 4E5AX 2R5TA 2QQ7A 2WMBA 4GCJA 3DOGA 5EKOA 2ZJWA 5HNGA 4AN3A 3NPCA 4J95A 4QMLA 2OGVA 3ZFMA 1K2PA 4U8ZA 4B7TA 5ANGA 3VUGA 1PF8A 1UWJA 2PMOX 5HVKA 4FKQA 2WTVA 1IASA 1TQMA 4C62A 5HIDA 2VX0A 1ND4A 2FB8A 4WNMA 5DRDA 4DT8A 4JDIA 4XP0A 4GYGA 3F3VA 2EXMA 5HBEA 1MRUA 4N4SA 4I5HA 4O1PA 1WZYA 3R0TA 4A07A 4BI0A 4CNHA 4I22A 1I09A 3GP0A 3L9MA 2BR1A 4UMPA 1Z9XA 4DH7A 5EYKA 1LR4A 3LFDA 4FEWA 3EMGA 4JXFA 2J5EA 2PVHA 3KRRA 5M56A 1W84A 3ORZA 1YQJA 4CFUA 5IKWA 4IDTA 3C4EA 4FGBA 2WHBA 4OBOA 5CTPA 1XO2B 2AUHA 2JDRA 4RVMA 4AW5A 1H28A 2WMSA 1P5EA 2R3FA 2X6EA 1G5SA 3GGFA 4PTEA 4G1WA 5DEWA 2HZNA 2ZV7A 2O2UA 2Y4IB 3F61A 2P3GX 5CASA 4QTBA 3DTWA 5DMZA 4DEEA 5JGAA 3EB0A 1XR1A 1OBGA 1GZNA 3BGQA 3SX9A 1NVRA 2WTKB 4JX3A 2PMIA 4HOKA 2JIVA 3VIDA 4EJ7A 2CKEA 2WMRA 1ZXEA 2QU6A 2YJSA 3FXXA 4RA5A 4WNOA 5AX9A 3KRJA 1WMKA 3NR9A 2GS7A 5KHXA 3QHWA 3ODYX 1Y6AA 4NFMA 4ZTLA 3EQIA 2ITUA 5HCXA 3TL8A 3VUTA 5C27A 4BN1A 3R9HA 4EHEA 1X8BA 3QTSA 4EI4A 2QOLA 3EQRA 4YPDA 4BZNA 4S30A 5H8GA 3HZTA 4PTCA 1XH9A 2BDJA 4YJSA 3E87A 5JT2A 4FZ6A 3KXGA 2XEZA 2V5QA 3BEAA 3DB8A 2VX1A 4FR4A 4IZYA 4ZY4A 4AUAA 4I0RA 2VV9A 5K5XA 2XBJA 3ZEWA 2HYYA 3PJCA 3RK5A 3NUXA 3MFRA 4GT3A 1YOMA 2XA4A 4NCTC 4D1SA 3SG9A 2NP8A 3JY9A 3ZLXA 3LXKA 5JH6A 3BEGA 4TYHA 3PJ3A 4YJVA 2YA9A 5DGZA 4EOPA 4ZLZA 4IM3A 4O7VA 3LAUA 4AU8A 4OTPA 2YAKA 4S34A 2BDWA 1Q41A 4FTQA 2WPAA 2BCJA 1ZLTA 3MI9A 2GS6A 4Z7GA 3MA3A 3GCQA 3RTPA 4IWPA 4BL1A 4O27B 4ERKA 4CZTA 1H25A 3BELA 4M67A 3LQ8A 3Q4TA 5AP6A 4YZBA 3ZS5A 4AW1A 3UQFA 4O7SA 3LLAA 1VYWA 4EL9A 4EK8A 1URWA 3IGGA 2CKOA 1UKIA 2OW3A 3F5XA 2B9HA 3PXKA 3R1NA 1M17A 2YAAA 5IEVA 1OIYA 5HVYA 2XCHA 2O0UA 4KABA 4O0RA 3BE2A 4U43A 5E8VA 5C9CA 2RL5A 4IFCA 2UZBA 2YCSA 3BU6A 4WNPA 1H1PA 4K6ZA 2RGPA 4IM2A 3HRBA 2BALA 1OKZA 2OKRA 3ZU7A 3EQPA 1UWHA 3MPAA 3QKMA 4LGDA 4O91A 3V5WA 4A4XA 3QTRA 5AA8A 2IG7A 1WBSA 2HY81 3Q2MA 4XJ0A 3RCJA 2VGOA 3E3BX 4E6CA 2Z2WA 2QKWB 4ZXTA 3KRLA 2RG5A 4MH7A 4QMUA 4H3BA 2DQ7X 2CGVA 2G1TA 2P0CA 4GKIA 1FMKA 2UW3A 5DPVA 3WE4A 3MB7A 2JDTA 2YJRA 4GIIA 4I3ZA 3I6WA 5HTCA 1TKIA 5HKMA 3ID6C 4FSUA 4GT4A 4BKZA 5KCVA 2JGZA 4IX3A 2UW4A 5CALA 5HTBA 5IQEA 3R7UA 4AAAA 2VRXA 5DI1A 4JX7A 2VTSA 4HYHA 4IZ5A 4NWMA 5T3QA 5F4NA 4P4CA 3ZSHA 2C3KA 3GEQA 3PRFA 4BYJA 4HGEA 3WYXA 4LI5A 5JQ8A 1GJOA 2PMLX 5A54A 2V7AA 2B54A 5AUXA 4BWXA 4QP8A 2IN6A 1PXPA 3ZM9A 3HDMA 5D12A 4E7WA 5AUYA 5A14A 1H8FA 3EIDA 3FC1X 5CVFA 5BVNA 4OT6A 5JMSA 2GMXA 3RWQA 3FJQE 4R7IA 4AN2A 3ANRA 3ALNA 4RC2A 3CLYA 4FIHA 2OJGA 2C6DA 4N6YA 2IZUA 5A9UA 4EQCA 4UALA 5FGKA 4GYIA 2YDJA 4R77A 2ZOQA 5AM6A 3VS2A 2NRUA 1REKA 3GU6A 3JYAA 2E9PA 4EH7A 3EQHA 4FTJA 1Q97A 4IWDA 4RJ5A 3TXOA 4R78A 2ZDUA 3ZC5A 5GZAA 4UZDA 4L00A 3UP7A 1JBPE 3K5VA 3V51A 4ERWA 2REIA 5EHYA 4XLIA 1KV1A 3KRWA 3SXFA 2VWXA 3CJFA 3KY2A 4IX5A 3RAIA 3Q3BA 2R3GA 5F20A 4QMQA 4FSQA 4KS8A 2BRGA 2BZJA 4YZ9A 2PUPA 2OXYA 3QF9A 4AQCA 5L2IA 3DKGA 3M11A 3V8WA 4LL0A 3E88A 4GS6A 3F9NA 1KWPA 3DBDA 4QMMA 1CKIA 4Y5HA 1Q3WA 4ITHA 5I9WA 3QC4A 3DDQA 1GNGA 3SVVA 2XIXA 4PPAA 1OL5A 2R7IA 4ACHA 3PVUA 4FSZA 2IVSA 5DA3A 3CKXA 5L6WL 5TOZA 3B8QA 5EYCA 2R3MA 2QHMA 3U6JA 4GFOA 4AFEA 4JG6A 4LUDA 5CXZA 2UZVA 4FKLA 3TV6A 3UP2A 5M4FA 4D1ZA 4FNWA 5E8UA 5JRQA 3FPMA 4ACGA 3TM0A 4BIEA 3PXZA 3UG2A 3TIYA 3TNPC 1YWRA 4EUTA 3V5TA 1IR3A 2CPKE 3WIKA 1KSWA 2I40A 4FZ7A 3R02A 4P5QA 3B8RA 2YDIA 5DOSA 5LXMA 5CU4A 2E9UA 2R3QA 2R4BA 4IAAA 4H05A 2J7TA 4RC4A 5AEPA 5C8MA 2B4SB 4W4YA 4JBOA 5BVWA 3T8OA 2R3PA 2PE2A 3QALE 4YTHA 4E5BA 5E4HA 4DTBA 4YP8A 2YEXA 3S4QA 4G16A 4U42A 3VUIA 4UYNA 4DFUA 3CTHA 5L2WA 2JAMA 5EW8A 4RIXB
chains in the Genus database with same CATH superfamily
4DEBA 3E7OA 3RPVA 3A99A 1FGIA 5FXSA 1XMMA 3GU7A 1ZY4A 2FSOX 3GC9A 4BI1A 3C9WA 1WVXA 4D2WA 1JSVA 3L8VA 4XOZA 4B99A 4DT9A 3K5UA 3Q6WA 1OKVA 3N4TA 5HVJA 4BDJA 2OXXA 3CPCA 1JOWB 4YO6A 5M44A 4LL5A 3NLBA 5FBOA 3SC1A 1HCKA 5L4QA 3CQWA 3GU4A 2IZTA 4JR7A 1JAMA 1O9UA 1Q5KA 2WEIA 4E20A 5KMLA 4Z9LA 2J0JA 3GT8A 4IH8A 2SRCA 3G15A 1OIQA 5IDNA 1MQBA 3EN4A 4BGHA 4QDEA 1W82A 4IHPA 2C68A 4XX9A 3P79A 4NM0A 2EVAA 2UW0A 4RVKA 5EDQA 5HG9A 3LZBA 1IAJA 3VS6A 2C47A 3AC8A 3DFAA 2WFYA 4FTLA 4FV6A 3QTIA 4O21A 4FTMA 4CQEA 5IU2A 2QO7A 3OXIA 3NUNA 2V22A 2WKMA 5FTQA 2G2FA 3FZRA 3KCKA 4E6DA 4EOOA 4O83A 3SRVA 3PG3A 3VF8A 2NPQA 2QO2A 1PMEA 3CXWA 4DG0E 4YLJA 4F9AA 3NNWA 4TN6A 3MVHA 4M69B 5CU3A 5M4CA 2QR8A 2CN5A 2W06A 1Q3DA 3GQLA 3R9NA 2VUWA 2YM5A 2V62A 4C61A 2J5FA 5HE1A 1OI9A 2CNUA 3OG7A 3TV4A 5FD2A 1Z57A 2ITTA 4QQJA 2QG7A 3E8DA 3ZLSA 5IA2A 2W1DA 3O8TA 3KMMA 1PW2A 1PXOA 2F49A 2WMQA 3MH1A 3ZOSA 3WOWA 2UW9A 1YWVA 4L3JA 2OSCA 1OITA 4BHZA 3UE4A 3QQLA 4WOVA 4EC8A 4F63A 3DXPA 3MBLA 3DK6A 3GB2A 4BTFA 2PWLA 3O8PA 4RIYB 1XKKA 2BRHA 4DEIA 5HO7A 3AD4A 4L43A 4RJ7A 4MD9E 2C1BA 2VTJA 3P0MA 4QO9A 5HO6A 4BDDA 5M51A 5CEPA 1OPKA 4FKOA 4DA5A 5HCYA 3EOCA 3A2CA 3A7GA 3E62A 2X6DA 2R3RA 3OZ6A 3SW4A 2R3IA 2ZYBA 3NDMA 2G2HA 4JVGA 4PV0A 1PMNA 3QLFA 4EZ3A 2OK1A 2Z7SA 5ANOA 1RDQE 4JLCA 3R71A 4I41A 5BUJA 3I6UA 4FSTA 3TCPA 5IQBA 2GHLA 1GOLA 4GU6A 5JQ5A 2GTMA 2GDOA 4OTHA 4BDGA 3C0IA 4EWQA 4H58A 3LJ2A 4RIYA 3SHEA 3QTZA 3UIXA 1Q62A 5E8TA 2J0LA 4JL9A 5CSHA 3UDSA 3RZBA 3COMA 3ZZWA 2I0YA 5AADA 1Q8UA 5HO8A 1GZ8A 2BZIB 3R6XA 4BDAA 2OJFE 3Q5IA 5AAFA 5AIRA 2B53A 1A9UA 2FUMA 2W1IA 2VD5A 5I9UA 1GZOA 1SZMA 3HVCA 4IWQA 4LFIA 3ZSIA 1KE6A 4EONA 4GK3A 1R39A 4NT4A 4IAYA 4QMYA 3SOCA 4XG7A 4JG8A 3UYSA 2XH5A 4MQ1A 4GFMA 4NJDA 5I5ZA 3QU0A 5DBXA 4R5SA 1STCE 3UBDA 2ZM3A 3PP1A 4TYIA 4FKPA 4XMOA 3HMPA 4HYSA 3O51A 2WZJA 4QTAA 4BGQA 5IH4A 4RX8A 2C6TA 3R04A 4WSQA 4D4RA 4HVGA 5FWKK 4B0GA 4V04A 4EH8A 5T68A 2C5YA 3BLHA 2FGIA 2XK4A 2XJ0A 3FI3A 4P7EA 1YXTA 3OCBA 2XM8A 3HUCA 1W8CA 1S9IA 3G6GA 3TJCA 3L1SA 4KBKA 2QOCA 2XAOA 4IC7A 4RQVA 4D2PA 5AR3A 4ZJJA 3AC1A 4Q2AA 4GUBA 4D4SA 3SD0A 4GRBA 4O7NA 3NYOA 3LIJA 3F3TA 4KD1A 4WKQA 3IOKA 4NFNA 5J7BA 4MXOA 3FV8A 3W18A 3SG8A 4M0ZA 3UPXA 4RGJA 2VTHA 3FWQA 5AAEA 3FHIA 1KOBA 3K3JA 4ZMEA 4XOYA 3SQQA 1YHSA 3BLQA 2EB3A 4E5WA 2WQNA 2XK8A 4X2JA 4EBWA 3GCSA 3TV7A 3R1SA 3OTUA 2B9IA 4FZDB 5AR8A 4C34A 5CF8A 3FZPA 4FC0A 4DE4A 4L42A 4O0SA 3AT4A 5JEBA 3E63A 5IH5A 3NUUA 3ZEPA 4DDGA 1GIJA 1O6LA 3MB6A 3BHUA 2W0JA 4S32A 4WBOA 3BGZA 5EYMA 4EOMA 1FVVA 3MFUA 3OT3A 4OTDA 3LQ3A 4LGGA 4JQEA 2EU9A 4C3PA 4G2FA 4O81A 1TFFA 3FSKA 4MD7E 3BQRA 5HX8A 3NW7A 3R63A 4WG3A 3V6SA 3VRZA 4DEGA 3C5IA 4OAUC 4EHZA 2O3PA 3CC6A 3MFTA 4Y8DA 1KUTA 4AW0A 2IW6A 2IW9A 4WRSA 2R2PA 5HGIA 2ETKA 4UMRA 5I4NA 3KVWA 3WZJA 2IO6A 4ANOA 3UO5A 4RIWA 3ZM4A 1H26A 1J1BA 1B39A 5HQ0A 4CKRA 4U0IA 4A4OA 2F7EE 4ARKA 4EHGA 4EOQA 5EI8A 5J79A 4ID7A 3W33A 2WXVA 3AMAA 3GC8A 3I60A 1W98A 4FUXA 4IXPA 4CFWA 1FMOE 3WF8A 3FLZA 3KB7A 1MQ4A 4DBXA 2UW6A 3NAYA 3RM7A 5LMBA 2AC3A 2XNBA 4BKYA 3MH3A 4A9RA 1XBBA 2R0IA 3KEXA 4XYFA 3COKA 3ACJA 4O0XA 4R1VA 3ZRKA 2OIQA 5HTIA 2C6LA 2VWZA 2VWVA 4RLLA 4Y95A 4ZTHA 2HZIA 4XV1A 5EW9A 2C6IA 5AR2A 3ZSGA 2XKFA 3EQGA 3MYGA 3NNUA 3RCDA 5AUVA 2PE0A 3D5WA 1BUHA 1V0PA 3GU5A 2JC6A 4I93A 5DR2A 3R9OA 3R21A 4ANMA 2V7OA 3BYSA 4S31A 4ZIMA 2XB7A 3RZFA 4RX5A 4D5KA 4FL1A 3UZRA 4HYUA 3T3UA 2LAVA 5M08A 2ONLC 1CKPA 3W0OA 1YI6A 1VJYA 3LFAA 4FKIA 3NIEA 3NWWA 4L3LA 3R8ZA 2B9JA 1PYXA 4O6EA 3QTUA 2J50A 3NCZA 3NZ0A 2A98A 4HZSA 5CLPA 3VN9A 4UV0A 1SNUA 3OXTA 4FT5A 3TTJA 2WAJA 2BIKB 3V8TA 3BYVA 2W4JA 3MJ1A 3LE6A 3DLZA 2ETMA 3QCQA 3WI6A 3DU8A 2WQBA 4D2TA 2ETRA 4H39A 4L44A 4E4MA 1OZ1A 5F95A 4DDIA 5H8EA 1WBVA 2XP2A 3MY0A 4M8TA 3QBNA 5FM2A 1I44A 3ZTXA 1ZOHA 5AR7A 3RPRA 3JUHA 4ZTRA 3E8NA 2CN8A 4O96A 4C4HA 3DNDA 4BYIA 4DEAA 1KE9A 3R83A 2B9FA 1CSNA 3UDZA 5AR4A 3H0YA 4ZJIA 1G8KA 2XK9A 3H4JA 1M7QA 2UW7A 5KMKA 4LGHA 4P5ZA 4BCPA 3CR0A 4AOTA 3FLSA 3D83A 4R1YA 4KSPA 5EQYA 2HXLA 1AD5A 1H24A 3BU3A 4M97A 3TG1A 5KZIA 4CEGA 5CANA 5GZ8A 5J1VA 5AP7A 2GFCA 3NNVA 3VJOA 3ZLYA 5BUIA 4FUYA 5LQFA 3LJ0A 4FKRA 4NKAA 3GCPA 3VW6A 2WMVA 4UB7A 4HGTA 3ZUTA 4YZDA 3IKAA 3PRIA 5FP5A 3QRJA 4D1XA 3QXOA 3KK9A 3WYYA 3LFBA 2PZ5A 1DI8A 3OOGA 2CMWA 1UNGA 3G5DA 3NW5A 3PE1A 3FLQA 4FA2A 1XH7A 5TO8A 2PULA 2P2IA 3VUHA 3MPMA 4UMUA 2Q0NA 5HZNA 2PK9A 3AD6A 3ML1A 2A2AA 3GXLA 2O8YA 2FSTX 3C0GA 4YSMA 5B0XA 3LPBA 3NRMA 4EH6A 3QX2A 4HVDA 3O71A 5C4KA 4RWLA 4AGDA 5KUPA 4TNBA 1QPJA 3A4PA 4YLLA 4I0SA 2ITOA 4BIBA 2NRYA 2C6OA 5K9IA 3I7BA 3RPYA 4OAVB 5HLPA 3WIGA 3RJCA 5AR5A 3R7VA 5IZFA 5L6OA 4FKJA 3QRUA 2JDOA 5DYJA 1SMHA 3RNIA 4CSVA 3ORTA 3Q52A 4QNYA 4YU2A 3VQHA 2PE1A 4L7SA 2R7BA 4QMOA 2X8IA 1RJBA 3S2PA 1OL6A 3LMGA 3OS3A 2WU6A 5C01A 1E1XA 2OBJA 3R00A 1OUKA 1XH5A 4EK4A 3LCTA 5DH3A 3V5JA 2DS1A 2GSFA 2I0EA 4OTRA 4I5MA 4GT5A 5G1XA 3UODA 1OGUA 4FE2A 2W99B 4GG5A 1ZZLA 5KMIA 4ACDA 3HV7A 3VHEA 5B7VA 3R1YA 4ORKA 4J52A 4C36A 3B2WA 4YC6A 1XH4A 3H3CA 4JAJA 5B2LA 2RSVA 2BILB 2Z7QA 4CFMA 2RFDA 4G3GA 3E3PA 3PXFA 5DT0A 3R2BA 4ZAUA 3AT3A 4F9YA 4EC9A 3ROCA 4DFYA 4C3RA 3UTOA 2OWBA 1R78A 3MVJA 2Q83A 4FOCA 3F2NA 5LMKC 3EN9A 3FKLA 3G2FA 3HP2A 2Z02A 4W8EA 4LRJA 4BGGA 1NXKA 4IC8A 1JWHA 4U79A 5GJFA 2XNOA 2FH9A 2YISA 2Z7LA 3DNEA 4NJ3A 4F0GA 5ITAA 1ST4A 4NM7A 2IPXA 1G8AA 2C69A 4BIDA 5JN2A 1OPLA 4MKCA 3QD4A 4BVUA 5CAPA 3ROYA 3QHRA 3QAME 2XK7A 2X8EA 3KF7A 5FRIA 5FEEA 3IG7A 3RPOA 2X39A 5HLNA 1ZYDA 1BL7A 2F7XE 1E1VA 1M14A 3L9PA 4TWCA 4UWCA 3TACA 4C02A 1FINA 5CT7A 1M2PA 4F64A 3DKCA 4BZOA 5A4EA 4U3ZA 3MA6A 2PMNX 3I1AA 4LYNA 4ANQA 1GY3A 4TT7A 3OWKA 3FQSA 4FV1A 4FTAA 5E8SA 4G9RA 4YZNA 3BYUA 3IDPA 3H9RA 4NIFA 3CP9A 4KNBA 4GV1A 3DQWA 5CU6A 3P5KA 4IAIA 4KKEA 4F1TA 3OC1A 2Y7JA 4I6QA 4XBRA 1YDSE 5ETAA 5FQDC 2X8DA 4TWOA 3RBWA 2YFXA 2DUVA 3UIBA 3WARA 1DI9A 4X3JA 3DBFA 1ZMVA 4BDHA 3MV5A 4G5JA 2Y6MA 3ORMA 3ZMMA 3R8PA 3D5UA 5ANEA 3F3WA 2OLCA 1QMZA 3H0ZA 2PUNA 3K54A 4O4FA 4KAOA 4QMVA 4QMXA 4GK4A 3K2LA 2GQSA 4BWPA 1JKKA 4FOBA 4CT2A 5B2MA 3DKOA 5I3OA 2ERKA 1ZWSA 5CVHA 4CXAA 3POOA 3IDBA 3PLAE 3ETAA 1V0BA 2VZ6A 3LCOA 4UMQA 2W7XA 5CSPA 3ULZA 4W9XA 2QD9A 1W0XC 2VO0A 3FI2A 4ZTMA 2HELA 5TKDA 3FMKA 4HNIA 3NS9A 4NM5A 3LFEA 5CEQA 5IISA 5IMXA 4QTDA 3FMMA 3BGPA 4Y83A 3PYYA 2DYLA 3Q9YA 4G9CA 2ZMDA 3GQIA 4JBQA 4WT6A 3VS0A 3OD6X 2E9VA 1XBAA 4FKTA 4D5HA 4IAKA 4DAWA 2P33A 3RM6A 4AT3A 4L53A 4JQ8A 3BL9A 3FY0A 1Y91A 3G51A 3KMUA 4IE9A 4ITJA 5KE0A 4AA5A 4RFMA 3D9VA 2WOTA 3CIKA 4X2GA 2H9VA 3P78A 2XM9A 4YBKA 4PMTA 3TUCA 2FA2A 2ZAZA 2OU7A 2W17A 2YIWA 3UOKA 5D9HA 4AN9A 4ONAA 4V0GB 3OHTA 1H1QA 2XNMA 2W1GA 1YHVA 3KN5A 3DFCB 4RZVA 2QG5A 3HGKA 3KU2A 3TNQB 3A7IA 5JFVA 4YTFA 1R3CA 5EQEA 3AGMA 2WO6A 3GCVA 2YWVA 2WQEA 4TYGA 2QVSE 3GFEA 3EN6A 2Z7RA 1YHWA 4MF1A 3VUKA 3HA8A 3U6IA 3A60A 2R3HA 4DFLA 1W2FA 2BPMA 2GNHA 2PVFA 2GNFA 4MQ2A 1KV2A 1WCCA 4ASDA 3KC3A 4GG7A 3MS9A 2IZRA 5CI6A 3M42A 4I6LA 4HGLA 4X2KA 1WBNA 5KBRA 2A0CX 3OMVA 2FSLX 4UN0C 4LG4A 1AGWA 4KIQA 4YZCA 5ANKA 4DYMA 3C4WA 4XEYA 3Q4UA 3F7WA 4QP3A 1PKDA 4FT9A 4X6QC 2YIQA 1UA2A 1ZRZA 3DK7A 3MIAA 1PY5A 3EN7A 4HCUA 4CFNA 2J6MA 4OTGA 4USEA 3CSVA 4DFBA 4CKIA 2XF0A 4ZTNA 2AEGA 3ZHPC 2H6DA 2W96B 3DPKA 1L3RE 4CTCA 4XG3A 5AX3A 4PDYA 4NL0A 4WUNA 1P14A 4E26A 4JNWA 4BBEA 4O0UA 4CRSA 4YURA 4DGNA 3NNXA 3LOKA 3PY0A 4F9WA 3NYXA 4RG0A 2O5KA 4C8BA 5BVFA 2QCSA 4DEDA 3DV3A 5IG1A 2CJMA 3ZRMA 5FUTA 1S9JA 3T9TA 3W0SA 4F09A 3ORNA 1KE5A 2BRMA 4PPCA 4F0FA 3TIZA 5CAOA 4KKHA 3Q9XA 2E9OA 3UNJA 4BB4A 3UQCA 2VTMA 3DTCA 5B2KA 2RIOA 4RWIA 5TF9A 4D2SA 4BWKA 1QPDA 3SA0A 4IACA 1PMUA 3KXHA 3GI3A 3QX4A 5JFWA 2YM6A 4MWHA 1FVTA 3I0OA 5J7HA 2JIUA 3I81A 3HEGA 3Q5ZA 2QR7A 4XRJA 5BVOA 2CLQA 5ACBC 5GIPE 3FAAA 4R3PA 4YLKA 3PFYA 3VVHA 4M15A 5JFXA 4ENXA 4O82A 1RE8A 4GUEA 5DR6A 1M2QA 3SGCA 2X9EA 5CT0A 5I0BA 4G34A 1H27A 4G3CA 3W0QA 4ZEGA 2W5AA 3V5QA 2VTPA 2B0QA 1CKJA 3PVGA 3QUEA 4GMYA 4AZTA 2C5OA 5F94A 3RVGA 1LP4A 5JZNA 1B38A 3RHKA 2XIKA 2EXCX 3ORPA 4FTUA 4BRXA 4DG3E 4XNEA 4IQ6A 4UXLA 5DHJA 2R9SA 2OH0E 3QKLA 3UPZA 3ZONA 4ACCA 3A7JA 3PY3A 4WD5A 5EHLA 3CY2A 3PXQA 1BMKA 4DN5A 2BRNA 2Y8OA 3R73A 2P4IA 3LFSA 1KE8A 3FZ1A 5CS6A 3ENMA 2PVMA 3TDWA 3GUBA 3SKCA 3U4UA 1BL6A 4C4JA 3FKOA 3W2PA 1XH8A 1QPCA 2YHVA 3QD3A 4UY9A 3H9OA 3W2QA 5LVOA 1J7LA 4IX4A 4D4YA 5LCKA 5I9VA 5FLFA 4ALVA 3PTGA 2JDVA 2WEVA 2XCKA 4FIEA 1PYEA 3E8CA 2ZB1A 3QYWA 1IEPA 2OH4A 3NYNA 4B8LA 2JKKA 2WU7A 3PIXA 4L3PA 3TN8A 4RRVA 4GJ2A 5AUZA 2VO6A 4D0WA 2CLXA 3I79A 4OTFA 2OJIA 2W5HA 3HMMA 3HL7A 4PWNA 3TJDA 4X3FC 5DVRA 3EL7A 5E92A 1JKLA 5FDXA 4NCTA 3UOJA 5J9LA 1OVEA 1H00A 2LGCA 3F66A 3PWYA 3SV0A 1Y8GA 5JSMA 2R0UA 3A7FA 4MHAA 3IK3A 4MNEB 5BNJA 4KBCA 3FPQA 2J51A 1WBOA 1UU3A 4B4LA 2Y6OA 4JRVA 5FBNC 2FYSA 4NW6A 5HD4A 4KRCA 3ANQA 4FTCA 2B1PA 2ZMCA 4LRKA 2YLFA 1Q24A 4TWPA 2VO7A 5AV0A 3U6HA 2HZ4A 2GU8A 5HBHA 1WBTA 3LM5A 3PXRA 2DWBA 4RFYA 5ANDA 3AD5A 3TKHA 4JDJA 5HU9A 4FF8A 3W2CA 5JKGA 4RA4A 3DCVA 4BZDA 3VBYA 3WF6A 4FKGA 4ZSJA 1LEZA 4U81A 5IPJA 5HE3A 1R0PA 3QXPA 4E6AA 2CCIA 3MIYA 4OLIA 2PPQA 2XANA 2OIBA 2YWPA 4I6HA 3FUPA 1OB3A 3FLYA 3FYJX 3UYTA 4E4XA 4QMPA 1E9HA 5AP2A 1ZZ2A 3QZFA 2WELA 1IAHA 3ZBXA 4CCBA 1OGYA 4L46A 3BYOA 3ZCLA 3C13A 3MWUA 3PVBA 4NUSA 4QD6A 4X7QA 3EQCA 4YTIA 2XVDA 4ZSEA 1SVHA 4HPUE 3CEKA 5A4TA 5IH6A 4R7BA 2PSQA 3EFJA 4BJJA 2W1CA 3QZGA 4O2ZA 3TI1A 1IRKA 4C38A 4QTEA 3ATTA 4PQNA 2XK3A 2PVLA 4NEUA 1M2RA 4M66A 4I21A 4FEUA 5IQFA 4WRGA 3DGKA 5DT3A 3ELJA 5GJGA 4R3CA 2XKDA 3EYGA 3ORKA 4IANA 1Q8WA 1ZYSA 1VEBA 4O7ZA 3W0RA 4TW9A 4BBFA 1UNHA 4QP9A 3R8LA 4RX9A 4I92A 3OCSA 4RIXA 3F2RA 4G3FA 4TL0A 4AZSA 3AMYA 5DEYA 3RK7A 1OKYA 4U97A 3OWLA 2XK6A 3IW8A 1QCFA 3BBTB 2BRBA 4RC3A 5I9XA 1ZYCA 4AP7A 2YCRA 4IM0A 4O86A 3OY1A 3R2YA 1LPUA 4I6BA 2J0MB 4PF4A 1NT2A 3QWJA 3LFNA 2VN9A 4EORA 2C3IB 4DHZA 2UV2A 4YO4A 1J91A 1A48A 3G9LX 3EHAA 3QRTA 5DG5A 4BTKA 2XYUA 3PJ1A 3UIMA 4M12A 3REPA 3MVLA 4H1JA 5L3AA 3OFMA 4IFGA 3KK8A 4QTCA 4KUJA 4JAIA 3P1AA 2VWIA 4GW8A 3CGFA 5LCJA 4XG2A 3UOLA 1BYGA 4X6RA 4X3FB 1F5QA 1P4FA 4GVAA 3OXZA 1Q61A 4EOJA 4DCAA 3NX8A 4XG6A 1JSTA 2UZLA 2WMAA 1Q4LA 3JVRA 3UC3A 4E8AA 5ANIA 4FSYA 4RPVA 3RWPA 1YW2A 4M69A 2C1AA 3KVXA 5H8BA 5J8IA 3R7GA 2BHEA 2C0IA 5BVDA 4XHKB 3DS6A 2EB2A 2EWAA 4FNZA 3QQUA 3CE3A 3W8LA 2OICA 1H1RA 4FT0A 3MPTA 2VTQA 4ZTQA 4L68A 5DIAA 4LUEA 5IF1A 4UYAA 2OFVA 3W10A 4DH5A 1JKSA 2X4ZA 3VNTA 3QQFA 2WNTA 1PXIA 5I3RA 3F69A 4X0MA 4TKSA 5FXQA 4AE6A 1PXNA 4UEUA 4USDA 3ZXTA 2W9ZB 4K33A 2HWOA 4LRMA 4WNKA 5HEZA 4NKSA 3LFCA 4IWOA 4BCHA 5DR9A 2R3NA 4DGGA 2JFLA 4ZZNA 4J96A 3TNWA 3CD3A 1OL2A 2X81A 3PUPA 4OUCA 2Z60A 5EG3A 3VUDA 5L2SA 1WVYA 2VAGA 3F3ZA 2WMWA 3PZEA 2ITNA 5HG7A 2GFSA 3M1SA 4U41A 3E5AA 4F7SA 3OOMA 1SM2A 4MTAA 3U4WA 4EZ7A 4OGRA 2AYPA 4IW0A 4RZWA 5DLSA 5BYZA 4I1ZA 4TYEA 2UZEA 3O17A 2VWYA 3HV4A 2VTRA 3IGOA 5E1EA 2W5BA 5KBQA 3RPSA 3HMNA 4ZMFA 3LKMA 2F7ZE 2JKQA 5EHOA 3NVKI 1TZDA 4FI1A 1YRPA 4O22A 4G6NA 5CF5A 3PP0A 3CGOA 3FBVA 5HU3A 1GZKA 2F2CB 3TNIA 4OW8A 3NCGA 4ZY6A 1NY3A 1U54B 3QCSA 4J99A 4PL5A 3ZO2A 4ZSAA 5E9EA 3TYKA 2PYWA 3BHHA 3DBCA 2YLEA 3ATSA 3H9FA 1SVEA 4PTGA 3MESA 4QYEA 5DN3A 4O7RA 3MY1A 4KBAA 4KIPA 5T6KA 2BZHB 4EK3A 2HWPA 1PKGA 5DRBA 3CTJA 3UG1A 5IA4A 2PUUA 4ENYA 4K8AA 1ST0A 3V5PA 3BI6A 5EI6A 1HCLA 4XCUA 5LWMA 3FQHA 1JNKA 3SDJA 3O5AA 1G8JA 2W4OA 2RG6A 3S1HA 2IW8A 3PUFC 3ZO3A 3SLSA 3DA6A 4AFJA 1WVWA 3NUPA 4USFA 3D7TB 3EN5A 5J1WA 3NW6A 4LV8A 4E3CA 5HE0A 4NTSA 3C4FA 4EOIA 4GH2A 4EBVA 4YUQA 3QA8A 4WG4A 4MBJA 3PLSA 4RVTA 4S33A 3WZKA 2UZDA 4D2VA 5CYIA 3THBA 3OEFX 4J53A 4C0TA 3OVVA 1BLXA 2R64A 3QD2B 3QCXA 4FTKA 4R8QA 1OM1A 3D2KA 5GHVA 3LMIA 3IO7A 3W0MA 3OCGA 4OTQA 3OF0A 2XNGA 5AFVA 4M0YA 2J4ZA 3VAPA 2BDFA 2QC6A 2J90A 3W2RA 1JPAA 4B9DA 3POZA 4FK6A 4BCOA 3ZRLA 2KTYA 3FZSA 1CM8A 3HP5A 4FYOA 1W83A 1QL6A 4C35A 5E90A 5HBJA 4BI2A 4D9UA 4I4EA 3E8EA 2BKZA 2PVKA 4XP2A 4V01A 4RIOA 3L8XA 4RJ8A 1JSUA 3C7QA 3KFAA 3Q9WA 1UU7A 1F0QA 2XBAA 3TUBA 4KWPA 4FKWA 2W1FA 2C6KA 4AGCA 3JY0A 3FZOA 3LCSA 3LQ5A 5H2UA 4AQKA 3GOPA 4APPA 3OEZA 5DWRA 5M4UA 2CDZA 2VTLA 4W4XA 3U8WA 2YCFA 2B7AA 3PSBA 4C7TA 4BTMA 3TNHA 4RMZA 3ZUVA 2VX3A 4FNYA 3P5JC 2BFXA 1U5QA 4J71A 1OPJA 1UNLA 3TTIA 5J5SA 1BKXA 3N9XA 2VTNA 3LFQA 3QYZA 4JT3A 4MBLA 4Q5HA 3WF7A 2ERZE 4BDKA 5FTGA 3NFFB 4U80A 3U51A 3OW4A 2XNPA 4MX9A 2VWUA 3VW8A 4J1RA 4KB8A 2PU8A 2WD1A 4K77A 4BDIA 4E93A 3U54A 2YM4A 3R7EA 2CKQA 4PUZA 5BMSA 5FEDA 2WIPA 2X0QA 4QPAA 1DAYA 1ZOEA 5FTOA 5BMMA 3VC4A 4HVHA 1RQQA 2WOUA 4G3EA 5A6NA 3ITZA 1GIHA 3F2AA 4B8MA 3AKJA 1YI4A 2VU3A 3R28A 4QP4A 5GJDA 5HIBA 4CQGA 2PHKA 4QQCA 3KIOC 5HE2A 2YABA 4W8DA 3RGFA 3OT8A 3F7ZA 2I1MA 3HX4A 4PL3A 4O4BB 4F9CA 3CPBA 3JS2A 3PJ2A 4UZHA 3PPJA 2VTOA 4YJQA 5FEQA 1G8SA 3D4QA 3NAXA 3UMWA 3Q96A 4AAYA 4FG7A 5CWZA 3HRCA 5LVNA 2Y9QA 3BLRA 4DFZE 4A4LA 4DFXE 1ERKA 4ALUA 1DS5A 3MH0A 4F1MA 3LM0A 3RAWA 3UZTA 4EJNA 3ZDIA 5HOAA 3GVUA 5KMJA 4FVPA 3WZUA 2AC5A 2QU5A 4H36A 4EKLA 2BUJA 2YERA 1UKHA 5J87A 5G6VA 5M4IA 5A4QA 4KRDA 2ITWA 3SXRA 1PJKA 1BX6A 2VO3A 4QPSA 4CG9A 5CSVA 2GS2A 4BTJA 5CEMA 3I5NA 2X2KA 4LMNA 4P2KA 1VZOA 3KULB 4FV7A 4K11A 1J7IA 3O7LB 4TTHB 3DLSA 3DDPA 4WSYA 5ANJA 1P2AA 3MN3A 1MRYA 2VGPA 3FZTA 4UMTA 1ZMWA 4OR5A 4D55A 1XMLA 2XEYA 3HECA 2OFUA 4NTTA 4ZOGA 3OWJA 4RT7A 3LCDA 3LXLA 2BFYA 4EWHA 3EQDA 5CF6A 3W0PA 3DXNA 5ETFA 3EZRA 3ZUUA 4U40A 3CD8A 5DNRA 4XH6A 1OMWA 3MVMA 3OCTA 1YVJA 5LMAA 3VONA 3VBWA 4FTNA 4NH1A 3DXQA 3U87A 3DZQA 2WMXA 5EW3A 4YNEA 4DCEA 2HIWA 4FNXA 4AG8A 2HAKA 3DAJA 2VTIA 3FHRA 4Y46A 4ANBA 3PDTA 3QUPA 3NGAA 3C5UA 3FY2A 4O4DA 3IPHA 4CKJA 3DBQA 4MYGA 4CTBA 1TVOA 2PZPA 1CDKA 5BQ0A 3BIZA 5A6OA 5JFSA 5K4IA 4XV9A 3BYMA 1SYKA 3QD0A 1UU8A 2Q0BA 4MCVA 4EKKA 5KX8A 2CNVA 3Q04A 4F4PA 4EH3A 2H96A 2GTNA 3FMLA 5JGBA 5ETCA 1W7HA 2QI8A 3JVSA 3IW5A 4KIOA 4WA9A 5CAUA 1YOLA 2J9MA 4MD8E 2XYNA 4YNOA 3W2SA 4Z3VA 4IAZA 1IA9A 2VWBA 4TZRA 2EUFB 2UZWE 3ZO1A 4E73A