3RVGA

Crystals structure of jak2 with a 1-amino-5h-pyrido[4,3-b]indol-4-carboxamide inhibitor
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
292
structure length
285
Chain Sequence
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVSPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Discovery of 1-amino-5H-pyrido[4,3-b]indol-4-carboxamide inhibitors of Janus kinase 2 (JAK2) for the treatment of myeloproliferative disorders.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK2
total genus 88
structure length 285
sequence length 292
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rvgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3rvgA01
3Q4CA 3UVQA 1WVYA 3CQWA 2W0JA 4QMTA 2J0JA 4KS8A 4APPA 1TQIA 4D0XA 5F94A 1H28A 3G9NA 5FBNC 4YP8A 4EUTA 2ZV8A 1PRYA 4ASDA 3QQUA 2W1CA 5EQYA 3K54A 1XBCA 4F09A 5CAQA 1YDTE 2PVMA 1VJYA 4PTEA 5K4JA 3GP0A 4AGDA 3U87A 4HYSA 4O6LA 1GIJA 4FG7A 3MB7A 3ZM9A 3R8LA 4DT8A 2WMWA 2PUNA 4MXAA 3SOAA 1KUTA 3ZC5A 3O7LB 3WOWA 3HMOA 3CJFA 4DGLC 3QD0A 1H26A 4DFNA 2OI4X 5CF6A 2WFYA 5CANA 5LCKA 2BFXA 1V1KA 2PZRA 3KFAA 3MPAA 4IAZA 4O91A 3PSDA 4NM0A 4Y95A 4AGCA 3MJ1A 3PY1A 1IAJA 4LFIA 3LQ3A 4IFCA 3C5IA 4GMYA 3JY0A 4A9RA 3KXXA 4XCUA 2QHMA 4U3ZA 5BVWA 1Q5KA 5TT7A 2WNTA 4TNBA 1MRYA 3UMWA 2CKEA 2YLEA 4O0TA 3SX9A 5EI6A 4QPMA 4NFNA 3UPXA 5E4HA 2W5AA 3GXLA 4OTHA 4CFFA 4FV3A 4YO4A 3LJ1A 3GCVA 1L8TA 1KV1A 2C1AA 4NYEA 4KSQA 1MRVA 4JRNA 4L8MA 1H00A 2UW8A 2VRXA 3DXQA 4WUNA 2QO9A 5BMSA 2HOGA 3AC4A 3A62A 3IW7A 1GZKA 3MH2A 5C03A 3SAYA 3ZMMA 4K1BA 2GHGA 3RZBA 4QT1A 1F5QA 4MKCA 4S30A 2VTQA 2OLCA 3EN4A 1Y6BA 3Q3BA 3AT4A 4JJRA 1JKSA 5H2UA 1FMOE 5HD7A 2GMXA 3POZA 2W17A 4AZEA 2WU6A 4R7HA 2QOLA 4Z16A 2RG5A 3R73A 4MBIA 1ZZ2A 4FK6A 5LMKC 4BZNA 4JDJA 3CGFA 4ZXTA 2UZOA 3LXNA 3N4VA 4AAAA 1GJOA 1QCFA 3VHEA 3QTRA 5AAEA 4PMSA 4BWPA 3EQRA 4IQ6A 4KIKA 1S9IA 3NIEA 1ZOEA 4CFNA 4X3JA 2ITZA 3MW1A 3P08A 5IDNA 5FTOA 3RCDA 3RI1A 2QOBA 4NWMA 3F3WA 1OM1A 4CEGA 4FV1A 3UP2A 4MXCA 5JK3A 2YM5A 3AXWA 3W8QA 2PU8A 2JIVA 3QTQA 2W7XA 5ACKA 2X4ZA 2O5KA 4D1XA 4FTTA 3QKKA 3E92A 4OTFA 1P5EA 2OZOA 4X3FB 1M7NA 3CCNA 3N51A 5GJDA 5HX6A 2PPQA 3DK6A 1XBAA 4R77A 3ERKA 2YIYA 3W18A 2X7GA 1YHWA 3MH3A 4EEVA 2A2AA 3TKIA 4ANNA 3RM6A 3CY3A 3TEIA 4C4JA 3CGOA 4OTWA 3DA6A 4YZ9A 3KULA 5FDPA 4Q9ZA 1YI6A 3THBA 3G6HA 3VUKA 3LIJA 3DBDA 3NYXA 3RAKA 2QO7A 3QFVA 4B99A 2W1FA 5CAPA 1XH5A 1CTPE 3COIA 4P90A 3ZO4A 4RWIA 5J8IA 4LMNA 1JLUE 3UIUA 5FXSA 4XP0A 3ZLYA 2C68A 4YGAA 3R8UA 4ANMA 3MA6A 5K0KA 3NR9A 4BDBA 4IVBA 4IWQA 3K5VA 3C4XA 2GS7A 3W2QA 4O38A 3AGMA 2OG8A 2XKFA 2ITQA 2B9HA 2Y4IC 3HP2A 4FV6A 4U80A 4JDKA 4WG5A 3G15A 2ZVAA 1H0VA 2WMBA 2OJJA 4V01A 5EYMA 2ITUA 3LCTA 4YC6A 3FI4A 3EKKA 5FEQA 3ET7A 4DT9A 2JIUA 4L67A 2CNVA 4K33A 4UYNA 4O0YA 3V8WA 4KIPA 5CU0A 3QXOA 1W82A 1OL6A 3F88A 2YCRA 3C5UA 2J90A 5DOSA 4GEOA 4TYHA 2CCHA 4FKVA 3TZ8A 4IM2A 3R1QA 3QL8A 3WE4A 5J7BA 4BI2A 3GFEA 5KKRC 4EOIA 4RJ5A 3D5WA 4LRJA 1Q8WA 4WO5A 4F6WA 3ETAA 4EH3A 4USFA 3IW6A 1JBPE 3H9OA 5T3QA 4MXXA 5K0XA 1CSNA 3DGKA 5KMKA 2W5BA 3QC4A 4I4FA 4ZTMA 2GU8A 4PDOA 2R3JA 2WOUA 2JAVA 4CFUA 4FV2A 1ZRZA 3P86A 5IA5A 4AFEA 1ZY5A 3R0TA 5A6NA 4CZTA 3MY0A 4BCMA 5LMBA 4EBWA 3VVHA 4Q5EA 3W8LA 4U9AA 4CLIA 2IZTA 2PMIA 4GG7A 3VRYA 4S34A 5J9ZA 3FI2A 4QTAA 4ANBA 4H3PA 4MXYA 3OW4A 3EQIA 4I6HA 2BPMA 4RMZA 2ETRA 3FLSA 5JFVA 4IM3A 3E8DA 5CQUA 3MBLA 2QLUA 3ITZA 3LZBA 3F5XA 4MAOA 3VULA 4EZ7A 5AP5A 3R1SA 2Y9QA 5EG3A 4I6QA 4XEYA 1XH7A 4M12A 5CZIA 4HVIA 2HWPA 1HCLA 2A19B 2XNOA 3R83A 2F7XE 1GY3A 3V01A 1K9AA 3MFTA 5AR2A 2WB8A 1QPJA 3PSBA 5EYDA 4A9TA 4FTIA 4R8QA 4MBJA 5EDQA 2WMTA 5KMLA 5HO6A 4YHFA 3IOPA 3TZ9A 2RSVA 3PZEA 4FODA 3P4KA 3A7GA 4L44A 4E93A 5CSPA 2VNYA 5DRDA 4XV3A 2R9SA 3R8PA 1XH9A 1YXUA 4AT4A 3QLFA 3QRTA 4USDA 3W2PA 3OF0A 4D2RA 5HE1A 3V5TA 4AOIA 1Q8ZA 4IVDA 2BDJA 3U54A 4F9BA 2WD1A 4AZTA 4I5MA 3P7AA 3VQHA 1E1XA 4YBJA 2I0EA 4NM5A 4RQVA 3OOGA 4M7IA 4L9IA 1GZ8A 3E7OA 5DT4A 3U4WA 4AACA 1ZARA 3PP1A 4EHGA 4CGAA 1JSVA 3CTHA 5CNOA 4MF1A 3VQUA 1L3RE 3KEXA 1UNLA 4ACMA 2B52A 4FV4A 3E3BX 2VAGA 2WMVA 3ORMA 4MCVA 5IQHA 2VTOA 4GJ3A 3QYZA 2DYLA 3LKMA 1Q99A 2DUVA 5E92A 4GW8A 3KXNA 4J95A 2C6KA 3OWKA 2XNMA 3W32A 4FKOA 4HGEA 3NVMB 5AV0A 1EH4A 3A7IA 3F3VA 4FTNA 3BYUA 4HJOA 4NH1A 4PPAA 4ASEA 4BGGA 3LPBA 4ZY5A 5JSMA 1XH6A 5AADA 5CEKA 3PA5A 4JRVA 4BDFA 3EQDA 4ITJA 3SD0A 3VS5A 2NNWB 2BZHB 3UPZA 4XG8A 3CQEA 5LVMA 4AT3A 2WTKC 2QOQA 5LXMA 4EH2A 3P7CA 5IH6A 3DB8A 3I4BA 2JBPA 2JKOA 3PA3A 4MF0A 1TQPA 2BAJA 4DG3E 3KULB 3BCEA 4GS6A 3OCGA 3KQ7A 2PUIA 3RHKA 5DIAA 3RAHA 5J5SA 4FVPA 2GS6A 3BBTB 4F1TA 5FBOA 4DH5A 4EOPA 4DBXA 2QHNA 4L7SA 4MD8E 4X2FA 5CXZA 1OL7A 1WAKA 3NUPA 2ZMCA 3O23A 5DN3A 1ZY4A 2YIQA 2CLQA 3C51A 3PXRA 4YURA 4FT5A 4D2WA 2QKWB 4C4EA 5C4LA 3HDMA 4TNDA 3OCBA 3UO5A 3FC2A 3KXMA 3DJ5A 3LFBA 1OVEA 4GV1A 2F2UA 4PUZA 3BEGA 3MTFA 4L52A 4MVFA 4TZRA 3PXQA 2E9UA 3R8ZA 4FKJA 4AZWA 1UKIA 1YVJA 3MVMA 1OPKA 4E8AA 5CEIA 5DMZA 4FKSA 1YHVA 4F4PA 4KB8A 4FMQA 3EQBA 4MQ2A 3R9NA 3F5UA 1J7IA 4QD6A 5CF8A 1YI3A 3PPJA 2GFCA 3EN5A 4XP3A 5ITAA 5IQEA 2W1HA 2QOIA 2R2PA 4I6BA 2BRHA 3VS4A 2EXEA 4D4YA 5E8SA 2Z02A 4EK8A 1ZYCA 4GCJA 3H0ZA 2YIWA 4GK4A 2OH0E 3QTZA 5BVNA 3MY5A 5KCVA 2CJMA 4ZK5A 3Q5IA 2BILB 4UY9A 2BVAA 5M51A 4AZFA 2YWPA 3VBQA 2YJSA 3LQ8A 2W96B 4E73A 4OT6A 4FE2A 2FA2A 2VV9A 4G3GA 3PG3A 4K0YA 4DITA 4FTCA 2VWYA 2Y8OA 2PHKA 2PL0A 3TWJA 4FEVA 5GIPE 4PDSA 4PMMA 4RA5A 5DEYA 4NM7A 1YOLA 3FDNA 4PWNA 4IX4A 3SDJA 4C2VA 4DCEA 2R3NA 4ENXA 1NW1A 1APME 4MHAA 1NVSA 4KA3A 4JT3A 5F95A 5CEQA 4D5HA 2PE1A 2JFLA 4EC8A 4F0FA 1DI8A 4PP7A 4ANOA 5CAVA 3DLSA 5IDPA 5LCJA 2X8EA 3H10A 2JIIA 5HGIA 3VS3A 4C58A 4NIFA 4I20A 2WTKB 1G5SA 4G6NA 3JVRA 4U42A 2ZM4A 2CKQA 2OJ9A 2WTCA 3Q4TA 2ITOA 3EOCA 2O0UA 5AR8A 2HXLA 2ZDTA 2FO0A 3L8PA 3QHWA 3RNYA 3ZUTA 2CMWA 5FEEA 4DGGA 3EYHA 4EUUA 1G3NA 2V7OA 3FY0A 3PJ2A 5D1JA 3PVGA 4ZTLA 5HVKA 2XP2A 1ERKA 2WMRA 4EOJA 3LMGA 2R64A 3HMIA 4RC2A 4AU8A 1BYGA 3TKUA 3UZPA 4E6QA 5M56A 4MX9A 3EZRA 3LFFA 2BRMA 4UWCA 2F49A 3BYSA 4TYJA 4W9XA 3KKVA 4RJ4A 3QD2B 3QTWA 4I5HA 4W4VA 2Y7JA 1OL2A 4MQ1A 4C36A 1YW2A 2XKCA 3O8TA 2XIXA 3T3VA 4HVHA 4XG2A 4N57A 4IB0A 5IUIA 5EW9A 3FMDA 3S3IA 3T8OA 1E9HA 4XV9A 5IA1A 3TDWA 1JSTA 4XJ0A 2CSNA 3QRJA 4XRLA 1Y8YA 3II5A 4IADA 3HV6A 3AC2A 5HLWA 4K77A 3OUKA 4FBXA 2R3MA 2PVHA 3KRRA 3OTVA 4FT9A 4RZVA 5DH3A 5F20A 4D55A 2F7ZE 4FGRA 5EW3A 5FWKK 2Y4PA 2PZ5A 4EK4A 3NGAA 3BHYA 3EL7A 4KS7A 1OIYA 4R3CA 4AUAA 4EQCA 3NUXA 4AW5A 2VTNA 2JDOA 4NZWB 5IEVA 3ENMA 4TKSA 4RRVA 4ZSEA 1FGKA 4PNIA 1WBNA 3NNVA 4O0WA 3SA0A 4D28A 2B7AA 1J1CA 2C30A 3GB2A 5D41A 3SXSA 4FIIA 2WQEA 3FY2A 2V5QA 4EH4A 2EVAA 2QNJA 4DEHA 1MUOA 2EWAA 3KK8A 3BLQA 1Q62A 4ZZMA 5A54A 1OIUA 3EJ1A 3AT2A 3HMMA 4YNOA 5J95A 3FLNC 3HZTA 2X6EA 4Y83A 3H9FA 5C01A 3IDBA 3NWWA 2ETMA 2OJFE 1K2PA 3A60A 5HU9A 3ZBFA 4ZS4A 3IKAA 5I5ZA 4X2GA 1UNHA 4FSWA 4CLJA 4FTMA 3RK5A 4DGMA 3VBYA 2IWIA 4CMTA 4CZYB 4JQ8A 4DFZE 4F6SA 5J79A 3SXFA 3PFQA 3LAUA 3BGZA 2UZUE 3FE3A 2CNUA 1UWJA 5AR3A 3V3VA 3WZKA 2X8DA 4BL1A 3AMBA 5IQGA 3ZZEA 2DWBA 3CY2A 4ACDA 3EQFA 3FSKA 5HO8A 4UMPA 5K5XA 5ICPA 3FJQE 4K2RA 3BGQA 3ORKA 4FTOA 4K6ZA 4YR8A 4G6LA 3F5GA 4EYJA 5M4IA 4TPTA 4FKIA 1BX6A 2H34A 4D0WA 3I6WA 3HV5A 4RX5A 5FD2A 3R8MA 2ZV7A 1H1SA 4KKEA 3ZOSA 3UG2A 4U0IA 2C6DA 3D7TA 4JI9A 1M52A 5M4FA 5IQIA 4V0GB 2C5YA 1IRKA 4O83A 3MDYA 3SLSA 4FIFA 5DEWA 1VR2A 2WKMA 4EK3A 2C6OA 2VWBA 4C61A 4L3LA 1Q8YA 3L9LA 4IAYA 1R3CA 3UNJA 3V51A 2VZ6A 4AXAA 4DN5A 1S9JA 4BCKA 4RBLA 3RP9A 5KE0A 5TKDA 3LFDA 3GENA 5JFXA 4BRXA 1JKLA 4I0TA 3Q9YA 2CGVA 4TN6A 1YDRE 3UOLA 3C4CA 2UZBA 3OD6X 3QCSA 3G51A 5HIBA 1RQQA 3QZGA 4BIEA 5KHXA 3ZEWA 2R0UA 3COKA 3EQCA 3NW7A 4DTKA 1LR4A 1IR3A 1WBSA 2BROA 4AX8A 3MWUA 4I5CA 3OWJA 5F9EA 5BYLA 1U54A 4FSMA 4FL3A 4C8BA 4EORA 5DVRA 2XNPA 4L00A 2JITA 5IA4A 3ZFMA 4WA9A 3ZSHA 2VTJA 5AV1A 5HCYA 4S2ZA 4U8ZA 4DA5A 2R3OA 5H8EA 3E64A 4FX3A 4CFWA 3A99A 3W33A 3KMUA 4IAIA 5CQWA 1TQMA 3GVUA 1FGIA 3GUBA 3Q04A 3UOKA 3CD8A 3LCOA 4I23A 2REIA 3UVPA 1OIQA 3F69A 4NU1A 4ZJJA 4EC9A 4F65A 2P2HA 3SKCA 4YPSA 1P4FA 4QMUA 4UXLA 3QQJA 5IZFA 2ITYA 4RJ3A 1PXNA 3LFQA 4M0YA 3FPMA 3GCSA 5D12A 3EQPA 4LM5A 3HECA 2JBOA 2Y4IB 4LG4A 4OR5A 3FQSA 3M2WA 5CU2A 1Q97A 3VC4A 5IUGA 4HYIA 4RT7A 3UNKA 1H07A 4H3QA 5M55A 2XZSA 4GFGA 5CAOA 2YM3A 3WZUA 3AMYA 4C3FA 4DFXE 3PIXA 4F1OA 3UIXA 1VYWA 5JGAA 3LCKA 4G3CA 2ITVA 3NEWA 5EI8A 3FYJX 3UC3A 1PW2A 5HNIX 1PKDA 5A4TA 2OFUA 3KVWA 4MNFA 3NAXA 5L6PA 2XM9A 4UB7A 2R3IA 3H0YA 4HZRA 3UE4A 2E9OA 5AUVA 4JNWA 4IBMA 4IZ5A 4EH8A 5JT2A 1H25A 1Q8UA 3FKOA 4FSYA 4XLVA 3VUIA 2HXQA 4QP7A 4BKYA 3LM0A 4C0TA 3ID6C 5JGDA 5KUPA 3RPOA 2J0KA 4AGUA 2Z2WA 4E6AA 3WZEA 3C4EA 2WTIA 2ZV2A 2XCHA 4M97A 3QTIA 3LLAA 3N4UA 1JVPP 3QU0A 2W99B 4BICA 3SRVA 2HELA 1J91A 3NYNA 4A9UA 4ZIMA 3ORNA 5CSHA 1NVQA 4U79A 4LGGA 4ASXA 3GOPA 5HBJA 1AGWA 4ZOGA 4ANSA 3IO7A 4X7QA 2Q0NA 1SVEA 2Y6MA 4FOBA 2EUFB 3VW8A 2W06A 4RSSA 4FTJA 5AUUA 5FP5A 3DKGA 4D58A 5HU3A 4JDIA 4RX7A 2QG7A 3HRBA 4AOJA 4YNEA 4RC3A 3OG7A 2WQBA 3LHJA 5BVEA 3ZZWA 2YDKA 3NUAA 4Z3VA 4DF3A 4M67A 2WIHA 4DEBA 3CQUA 1OIRA 4WRSA 5L6WL 2BDFA 2GHLA 4IB3A 4XX9A 2WHBA 4BIBA 4DEEA 2CGXA 3U6IA 4YBKA 2FSMX 1GOLA 5M53A 4LQMA 3QAME 5HVJA 1CKIA 4BZOA 1BI8A 3MA3A 3Q53A 1JQHA 4BWKA 1YOMA 2OZAA 4WG3A 5DR2A 1VZOA 3RWQA 4IJ9A 5EDRA 3DOGA 4W9WA 4OBQA 1BI7A 3OFMA 5EK7A 3NMUF 5FRIA 5HCXA 3QA8A 3SXRA 4CT1A 3R7YA 1XBBA 4QP6A 3KN5A 5J9YA 3GOKA 2ITWA 4RIYA 4D5KA 1I44A 1J3HA 5CVGA 3KA0A 3RPVA 4B7TA 3C4WA 4FSRA 4BBEA 2A0CX 3OBGA 1OMWA 4O86A 5AR5A 4YZMA 4YC3A 3ZO3A 4R5SA 3HA8A 4G9RA 3VJOA 2JAMA 3PY3A 2W9FB 2J7TA 3UP7A 3GU8A 3ZSIA 4P5QA 4B6LA 3B8QA 3E7VA 4BCIA 2XIZA 4IEBA 4AA4A 4NKSA 2RFEA 4HNIA 3LQ5A 4DGNA 5E8XA 2J0MB 3HL7A 3Q2MA 4FZDB 5GINE 4E6DA 1BMKA 1YWVA 2RF9A 1XO2B 3ATTA 3AD5A 4EK5A 4J8MA 2XIKA 2C0OA 2UW3A 4TRLA 4BDDA 1SVHA 4KD1A 4YJVA 3FHRA 3C7QA 2BRNA 3HUCA 5K3YA 3HDNA 3K5UA 4I0SA 2YZAA 4L43A 1ZMUA 1MQBA 4RX9A 4UBAA 4MK0A 3QWKA 1OPLA 1BL7A 4RIOA 3D15A 3ANQA 1NVRA 3L9PA 4PRJA 4XH6A 4C34A 5M08A 1WVWA 4F9WA 3KK9A 3NUUA 4U44A 4N70A 5I9YA 4PTCA 4WSQA 5AAFA 1MRUA 4NCTC 4ERKA 2BHEA 2WGJA 2CGUA 3UQGA 5I9VA 4OTGA 4G1WA 4O81A 4M3QA 1RDQE 4HGSA 4RVMA 5H8BA 3H4JA 3DDQA 4JG7A 5HE0A 3VUDA 5KMIA 2BKKA 2HY81 4IZ7A 4QP8A 2OWBA 5HG9A 2G2HA 4N6ZA 4ZTNA 4NJDA 5BMMA 4DYMA 4EBVA 1OZ1A 4DTAA 3LW0A 4QTCA 3LCDA 4RA4A 4MNEB 3Q9XA 4WT6A 3HAMA 3F7WA 4RJ6A 3OOMA 4QYYA 1A9UA 5IISA 5LVNA 1PXJA 5FUTA 4PX6A 2X2LA 3DNEA 4WHZA 5CU6A 3RPYA 4AN9A 2AC5A 2ITPA 2P2IA 2IZSA 4IZYA 2PVKA 4JL9A 5I9WA 2IG7A 4YZDA 4KWPA 3DZQA 2PMOX 3PRFA 3UGCA 4PNKA 4OW8A 2HW7A 3GQLA 4R3RA 3R22A 4RC4A 5FXRA 4I0RA 4M69A 3D7ZA 4X0MA 5HNGA 3SQQA 4ONAA 4R78A 3V5QA 4I6FA 2PYWA 1H0WA 5GIOE 2PZYA 5DR6A 2ZB1A 4PL4A 5HICA 3OY3A 3A4OX 3LCSA 3IONA 2BZKB 4FT7A 4G16A 3OBJA 4HW7A 3ENHA 3QGYA 3IG7A 2R5TA 4O0UA 3WIKA 3DAEA 3UIMA 4ZTHA 2I40A 3OHTA 4FL2A 4HNFA 3WI6A 1MP8A 2WQOA 4CV9A 2QURA 5IQCA 2JKQA 3BX5A 5FTQA 2LAVA 5HG5A 1B6CB 3R71A 4LL5A 3BBWA 5AP0A 4BR3A 2BHHA 3BGPA 3FPQA 3FZSA 2XS0A 1ZLTA 4IX5A 5ANEA 1SMHA 4ZLOA 4ZJIA 3RM7A 4AG8A 4O22A 3MS9A 4GUEA 1HOWA 2RFSA 1URWA 5CEPA 5HBHA 4CFMA 3FZTA 3GI3A 4BDGA 1GAGA 4EOQA 3ACJA 2IZUA 2XNEA 1M2QA 3K3IA 2HCKA 4U43A 2PE0A 2WQMA 4K11A 5B7VA 3CEKA 2HIWA 3ZXZA 3AOXA 3QZIA 5IA0A 3N9XA 4YJTA 5L6OA 5AEPA 4IE9A 2CKOA 4JIAA 2XNNA 2YAAA 3REPA 4D2SA 4OTIA 4HVGA 4PPBA 3PYYA 4FTKA 4UV0A 2OZAB 5L4QA 3OCTA 4RZWA 4NK9A 5AIKA 3U6HA 3F3UA 3CXWA 1WZYA 4GK3A 4FKQA 4BGQA 5T6KA 3K3JA 2I6LA 3PWDA 3QCXA 1Y8GA 3VUMA 3ZXTA 2X39A 2JC6A 4NTTA 5A46A 4O0XA 3BKBA 1PMUA 4BTMA 2Z7SA 2Z7QA 3PLSA 3GEQA 5IMXA 1K3AA 2X8IA 3R6XA 5AWMA 4LMUA 4EYMA 4DFYA 2G2FA 5IKWA 3ORTA 1BLXA 3KXZA 3F66A 1ZWSA 3KXGA 3R01A 2XBAA 3PZHA 5KMNA 3MI9A 4E4NA 4E5BA 2RFNA 2UVZA 3BV2A 3F6XA 4J98A 4ZZNA 4JVGA 4FR4A 3CE3A 2ZMDA 3VS2A 3GU5A 3I79A 4DEDA 1PF8A 4GT3A 5B2MA 4KIKB 4ACCA 1LEWA 2BRGA 2CDZA 4FT0A 2BMCA 2FSOX 4NSTA 4RFYA 3OC1A 1UU3A 1P14A 5J7HA 2QG5A 3QKMA 2PWLA 1OBDA 3E87A 3JS2A 2YCQA 2B9FA 4G5JA 4QPSA 2BTSA 3UMXA 3R9DA 1DS5A 4AE6A 3DBCA 4FG8A 1YKRA 4IM0A 4AOTA 4ZY4A 1IA9A 3I6UA 4L46A 2C69A 4YZNA 2X81A 4IANA 3TN8A 2B9JA 4LUDA 4L68A 4B8MA 5DLSA 4RIWB 3RHXA 4BTKA 5D11A 2GQSA 2HW6A 1PXMA 3TXOA 4I5PA 4GU9A 4YZBA 1DM2A 3SOCA 4GIIA 2WMAA 4J1RA 4J8NA 1OL5A 3U51A 4WRGA 5L3AA 1ZYLA 3R7OA 4TWPA 3B8RA 3BU3A 2C6EA 4QO9A 4AQCA 5GZAA 4JQEA 4ENYA 3TG1A 3GT8A 3QTXA 3RWPA 4DEGA 4XYFA 3SRVB 4KNBA 3HX4A 3OUNB 2XK6A 2OF2A 3TJCA 5GZ9A 5JGBA 2O65A 5LMKA 4OBOA 3DBFA 5E7RA 4BN1A 1SNUA 4UMUA 4FOCA 4M13A 3R8VA 4F9CA 4BIDA 1OKZA 4UWBA 5JH6A 3DKFA 4P4CA 4EOSA 4JR3A 4YHTA 5AJQA 4ZSGA 3IS5A 3ZLWA 4X2NA 4IDTA 3DBEA 2W4JA 4P5ZA 4Q9SA 5IA2A 1UU8A 4YLKA 5HBEA 3FQEA 1YXSA 3LMIA 3F7ZA 1OPJA 4HYUA 5EW8A 1OI9A 4F70A 1FMKA 3S1HA 1NY3A 2GQRA 3ODZX 5IQFA 1DI9A 4OT5A 4X3FA 4DFLA 1KE5A 2HY0A 2G1TA 2GTMA 3BLRA 4JX3A 2HENA 3CIKA 3KXHA 4QQ5A 3MPMA 1QL6A 2GNJA 2ITNA 1F3MC 4TYHB 5AX3A 5J5TA 3A7HA 4Q5HA 4B8LA 5AV3A 1CKPA 5FTGA 2VTLA 3RK9A 3BWFA 2RL5A 4PTGA 4NL0A 2UZNA 4O1OA 5LVOA 2OF4A 4KIOA 3LMHA 3D9VA 4NKAA 4LRKA 4C4IA 1Q24A 5DFPA 1OKWA 4C33A 1AD5A 3LM5A 4FYNA 3T9IA 1BKXA 4GSBA 1NXKA 2YHVA 5ANOA 5AX9A 1PMVA 2FUMA 2YERA 5EHOA 3QD4A 2JD5A 4D9UA 2JKMA 4NEUA 3PTGA 1PKGA 4BZDA 3S4QA 5C26A 3VJNA 3W55A 4C4FA 5CT0A 4YJUA 3W1FA 3CLYA 4E3CA 4EOMA 3O17A 1PY5A 3VF8A 4RVTA 4FUXA 4YSMA 4FKLA 2XK4A 3RVGA 4L7FA 4C38A 3GQIA 3TACA 3BWJA 2XK9A 4CMOA 2WELA 3NUYA 5CU4A 4F7NA 3NUNA 5CYIA 4DE4A 2OIDA 4C4HA 3C0HA 4YO6A 4KAOA 2PVFA 5DHJA 4PL5A 2YACA 3CTJA 2I0YA 2UZLA 2WMXA 3H9RA 3R00A 3G90X 3DK7A 4LL0A 2HZ4A 5T68A 4EH7A 4EOLA 4X2KA 4O6EA 4ITHA 1SVGA 4FVQA 4YJSA 2FH9A 2C5OA 2V7AA 2GNLA 3TL8A 1YDSE 4OUCA 5HTBA 2OH4A 2QODA 3KRLA 3QQLA 5EYKA 3HV7A 1KOBA 3IOKA 5AUZA 4E5WA 2VTSA 3DKCA 4FNZA 3RPSA 1PYXA 4NT4A 3TI1A 3V6SA 1WBWA 4BBMA 2H8HA 4G3FA 4C3RA 3VHKA 3F82A 1T46A 4EHVA 3E63A 4QQJA 4CRLA 2FVDA 2ITXA 1M2PA 5A9UA 4UALA 3VS6A 3GCQA 1URCA 2PSQA 3EFLA 4B4LA 4IW0A 4BDHA 4F64A 1FINA 4IVAA 5BQ0A 4GKHA 4DINA 3ZS5A 1V0PA 2VTTA 4E6CA 2VTPA 3C0GA 4BCFA 3L8XA 4LGHA 2OXXA 3D5UA 3WF9A 4ZTSA 5CAUA 3BEAA 3DTWA 4O2PA 4RQKA 5LARA 3R7IA 3ZSGA 2CN5A 4DEIA 4E4XA 5C4KA 2XMYA 4RGJA 5CSVA 5D7AA 2X2MA 3TNIA 1QPCA 5JRQA 3ROCA 4FNWA 4CD0A 4ASZA 5I4NA 3EN9A 4S31A 4PP9A 3NDMA 4XG9A 1Q3DA 3V8SA 4JX7A 1KE8A 3WILA 3BYOA 2WAJA 3R02A 2QQ7A 4XG4A 3TDVA 3D2IA 1G8AA 2XUUA 4J99A 5TOZA 4EOOA 1V0OA 4ZTRA 2J4ZA 4MWIA 5CLPA 5CZHA 5CF5A 3FXXA 3D2KA 2VNWA 3FZPA 3OT8A 5LWNA 2B55A 3VN9A 4BWXA 4BGHA 5DBXA 3U9NA 3TZ7A 1IG1A 2UW9A 2YZLA 3KF4A 1WCCA 2QI8A 3RCJA 4KABA 3A8WA 3Q5ZA 4CMUA 5HIDA 4YJRA 1UU9A 3QTUA 3R21A 3MV5A 5KZIA 3R7VA 4DG0E 1BUHA 5AUWA 3V5JA 5KNJA 4YPDA 4FC0A 1YI4A 5J1VA 3BIZA 3ORPA 3TIZA 5AV4A 4TYEA 4XV1A 4BB4A 2W05A 4M69B 3TV7A 3VO3A 5EM7A 3CTQA 4BDAA 2UZWE 2Y6OA 4TT7A 5HE3A 3ZRMA 3S2PA 3WE8A 2VUWA 3PDTA 3R1NA 3NNXA 5L2WA 4ALWA 3PPZA 5LVPA 2UW0A 5DT3A 5GJFA 4ZAUA 3HA6A 1MQ4A 3HMNA 3U9CA 3I5NA 3LXLA 3EWHA 4FEQA 2UW6A 4O2ZA 4II5A 2X9EA 4I4EA 3PXYA 4QYFA 4PDYA 3JR1A 1SYKA 4MNEA 2OW3A 4FV9A 4MYGA 3NVKI 3BQRA 3F5PA 3OMVA 2BUJA 4CKJA 4BCJA 3IK3A 4O96A 2G01A 4RWJA 3UQFA 3GCPA 3ANRA 2C0IA 5BYZA 4F6UA 4O7YA 4U3YA 4FKGA 2J51A 1H27A 5KBQA 3DPKA 4O7LA 3QTSA 4CG8A 1U5RA 2KULA 3RAIA 1KE9A 3PLAE 2IN6A 1DAWA 4WNMA 1B38A 4S32A 4QMWA 4FTRA 3QBNA 1FVVA 3BPRA 3W2OA 3T3UA 4ACGA 2O63A 4FSUA 4RVKA 2J0LA 4HCVA 4QQCA 1OUYA 3GU4A 5AMNA 4ZLYA 4GT5A 3L9NA 3KCKA 2XJ2A 3RNIA 4AS0A 5DNRA 4I94A 3OEFX 2QONA 1O6YA 5HOAA 4R6VA 4Y72A 1W84A 5HESA 2IJMA 5IMEA 4BI1A 2HZNA 5EQEA 4H05A 2P3GX 3RPRA 4ACHA 5IQAA 4I22A 2GNIA 2YISA 4QRCA 4G5PA 2X2KA 5EOLA 5JQ5A 3FMKA 4HZSA 5HNBA 1UV5A 4TYIA 5AA9A 2WQNA 5B2KA 4LYNA 2WTVA 3BHUA 4IACA 3TV4A 3JXWA 4W4XA 2G9XA 5EFQA 4WNKA 3QX2A 1CKJA 5CNNA 4F7LA 5J9LA 4OAUC 5BVFA 4AGWA 2C3LA 5AUYA 3UDBA 4PY1A 2UZEA 2X1NA 4PV0A 4BKZA 4BF2A 3QQFA 4Q2AA 2P55A 1OECA 3WF8A 3HMPA 3FLYA 2LGCA 1TVOA 2VTIA 3C0IA 5E8TA 3F3ZA 5M44A 3R1YA 3U55A 2PK9A 3QUEA 4JR7A 4MXOA 5JMSA 3RJCA 4FTLA 4CV8A 3UZRA 5E1EA 3QZHA 3RALA 1FVRA 5I9ZA 4GUBA 2QU6A 2X7OA 2Z7RA 3U8WA 2XNGA 3Q2JA 3UC4A 4EI4A 4UN0C 5BYYA 4CTBA 3R2BA 3QHRA 3PSCA 4QP2A 2W5HA 3FMLA 5DA3A 3E3PA 4GRBA 3UJGA 3QRUA 4WIHA 4IX3A 2IW9A 5GNKA 4C3PA 2ZOQA 4I93A 3NLBA 2J6MA 2I0VA 4YJNA 3NAYA 3RINA 3HP5A 1WBVA 1FOTA 5AP4A 1LPUA 4ID7A 2W1IA 5AM6A 4MXZA 4AF3A 4M84A 3W2CA 1GZNA 2I7QA 2XK3A 5M09A 3NUSA 4FSZA 4BBFA 3QZFA 3R7GA 2ETKA 3HGKA 3S0OA 1YXTA 5EM5A 4A4LA 4UX9A 3A4PA 3DY7A 4LOPA 3ZRKA 3VBTA 3MVLA 5FDXA 5BVKA 4FL1A 3O8UA 4BKJA 2PVYA 1ZOGA 4UYAA 4IHPA 4W8EA 4QTEA 2UW5A 4EZ5A 2ERKA 2GFSA 4BHNA 5FEDA 2QOFA 1PXPA 2QOHA 3OXIA 4CZUA 3UQCA 4FIJA 4C4GA 2KTYA 4RLLA 3ULIA 3PJ3A 2E9PA 2XA4A 4RIXB 3ZUVA 2NRUA 2PZIA 4N0SA 2YDIA 3ZFYA 4G34A 4ZY6A 4GFOA 4I41A 5JZNA 3NPCA 4DH1A 4MD9E 3NCZA 3FMEA 2GPHA 3O8PA 2WMQA 3WARA 3DTCA 3W2SA 4FV5A 2UVYA 2OJIA 2BZJA 2XEYA 5KMMA 4QP9A 3ELJA 4ZSJA 4WBOA 2PY3A 1FVTA 3ACKA 4CXAA 5CASA 4LRMA 4WNPA 2ITTA 1GIIA 1IEPA 2PVLA 3BV3A 4AZSA 4EH6A 2P4IA 3O0GA 5AAGA 4YTFA 5KX8A 1O9UA 1PXOA 4RWKA 4CFXA 3DAKA 2BTRA 2JDSA 1JPAA 2NPQA 2QCSA 4N4SA 5K4IA 5G1XA 2WU7A 4M68A 3I60A 4I3ZA 2YM8A 3MB6A 1CM8A 4MTAA 3POOA 5L8KA 2QKRA 1A06A 1XQZA 5ETCA 3ORLA 3IDPA 5KMJA 5L2TA 2JKKA 3KF7A 1PMEA 1CMKE 5HORA 3SHEA 2X0GA 3SV0A 3N4TA 3LE6A 3KRXA 4XMOA 3UG1A 4KBKA 5C27A 2WO6A 2B53A 2C0TA 4RX8A 2OK1A 4AW1A 3EFWA 4U5JA 3V5LA 4ARKA 4C37A 5EKNA 4XHKB 3KN6A 2BIKB 2C5NA 2R3PA 5CF4A 1STCE 4BYIA 3NW6A 3FI8A 3OEZA 3LVPA 4HPUE 3Q32A 3Q60A 1XJDA 3TTJA 5C8MA 3AC3A 4EONA 5K5NA 3EYGA 1GNGA 3DFAA 3V6RA 2V62A 4J71A 3FHIA 2XH5A 1Y6AA 4O0RA 4R3PA 3DT1A 2VWVA 2ZV9A 3HLLA 3PIYA 3MY1A 4JQ7A 5CS6A 3MSSA 1PHKA 3PVBA 3HRFA 3WYYA 4O27B 3PE1A 3CPBA 2GTNA 4O7TA 2ZM3A 1YQJA 2AYPA 4FF8A 4CT2A 4F0IA 2E9NA 3ORXA 3AC1A 1UNGA 2VX1A 2PVJA 3H3CA 4ALUA 4O82A 2R3RA 2QLQA 3DCVA 3M1SA 4U81A 5LWMA 4O7VA 5HEZA 3KREA 3WZDA 5LJJA 2YCFA 3MJ2A 2DQ7X 3I81A 5CI7A 4YLLA 4ZJVA 2WXVA 3Q9WA 4XG7A 3VNTA 2PMLX 4Z55A 5HZNA 5HHWA 5CENA 3LJ0A 5JKGA 2E9VA 3OROA 4ZSLA 4PL3A 5DT0A 5F4NA 3FL4A 4EHZA 4DLIA 3UZTA 3BRBA 4TW9A 3CP9A 3JY9A 3FMNA 3G9LX 3HV3A 3KU2A 4Y46A 4C7TA 2H6DA 4ITIA 4F63A 1WBPA 2Q0BA 1ZMVA 4AP7A 3HRCA 1KE7A 4DCAA 2FB8A 2IVTA 4IAFA 1Q61A 4QMNA 3K2LA 4OBPA 4OTQA 4UEUA 2A1AB 2XIYA 3R28A 4CYIA 5HIEA 4FT3A 4AN2A 4YMJA 2P33A 5M07A 3IGOA 4YC8A 5IF1A 4EKLA 4DC2A 3PE2A 2VWIA 3EKNA 4RJ8A 3I7CA 3ZU7A 5E8VA 2UW4A 2EB3A 1LP4A 4D2VA 2XBJA 3KRJA 1OUKA 2ONLA 2H96A 2I0HA 3QKLA 4G3EA 5EYCA 3ZTXA 4F7JA 4DTBA 4LI5A 4I21A 4FICA 1GIHA 2R7BA 3IDCA 4M15A 4CCUA 3QCQA 3OT3A 3Q4UA 1PYEA 4XUFA 3FSFA 3PA4A 3ZLXA 4EQUA 1H1PA 3ZLSA 4CFVA 2WEVA 2FSLX 4UMTA 5CT7A 2BDWA 1F0QA 4FYOA 4UXQA 3NSZA 5L2SA 5E8UA 3PUPA 4WG4A 2OJGA 4JBPA 4XBUA 2FGIA 4BCQA 4C35A 3DV3A 5LQFA 1LUFA 4AN3A 5IPJA 4BCGA 2YDJA 2J5EA 3FZOA 2ZB0A 3QUPA 4UZHA 1FBNA 4WUAA 4O7NA 4W4YA 3VS7A 2C3IB 2W1DA 3FXWA 4QMPA 4IAKA 4BFMA 3D7TB 2V0DA 2X4FA 4FIEA 2OBJA 2B1PA 5A14A 5BUIA 2EXCX 4JXFA 4XNEA 2I1MA 3KGAA 1FPUA 3AC5A 1OGUA 3BU6A 2H9VA 2J50A 4RFZA 4QYGA 3FMJA 2B0QA 4U7ZA 4BCPA 1VYZA 3RBWA 3G0EA 3FKNA 3HEGA 4IZAA 3PPKA 3P1AA 1A48A 2OSCA 2VTHA 3BLHA 4KRCA 4QMSA 1H8FA 3LOKA 4D2PA 5JFSA 3G5DA 4GYGA 4F1MA 2XCKA 2AUHA 5L2IA 3LFAA 1FQ1B 5J1WA 4Z9LA 4C59A 4CKIA 4C57A 5IEYA 4QOXA 4BCHA 3MFRA 2C47A 1R0EA 3LJ2A 3PJCA 1XH4A 5GJGA 1Q3WA 2IVSA 1J7UA 4DLJA 2XM8A 2BFYA 2W4KA 3E88A 2W4OA 4OGRA 3WYXA 4CRSA 2XKDA 4CG9A 2R3FA 5EHYA 1JKKA 3BZ3A 2YIXA 1R1WA 3UTOA 2PVRA 1LEZA 4QMVA 5A4QA 2ZM1A 4WBBB 3I0QA 5HKMA 1XWSA 4OLIA 1UWHA 1AQ1A 1M7QA 2G2IA 4K9YA 5AP6A 3VIDA 2JLDA 3AG9A 5D7VA 4GJ2A 2XNBA 4BTFA 3EH9A 2A4LA 3VS1A 4FKUA 4O1PA 5L2QA 4BTJA 5CSXA 5JRSA 3JPVA 5KZ0A 3VUGA 4YTCA 4TY1A 3A8XA 5BX0A 4M66A 3AC8A 3ALOA 4W8DA 4BDEA 4U40A 3NRMA 4XV2A 3BHTA 4CQEA 3P7BA 4APCA 3NNWA 2UUEA 4YZCA 5FM3A 4I1ZA 1W0XC 4L53A 5CWZA 3VRZA 4L42A 4MWHA 4O7ZA 4D2TA 2YLFA 4QPAA 2HWOA 4CNHA 3SGCA 5ANKA 2R7IA 4ZMEA 1W98A 2G15A 3PVUA 1M2RA 4IFGA 3TJDA 3ZONA 5ANGA 3EHAA 2WEIA 4QMXA 3FQHA 4BCOA 2OGVA 2VX3A 1REKA 4G9CA 5ACBC 3PIZA 4FG9A 4GG5A 4TL0A 3A2CA 2IVVA 2J0IA 4XBRA 2YM6A 3FWQA 3QWJA 3V5PA 4J97A 2IVUA 2VWXA 4FV8A 3WIGA 4F0GA 4DG2E 4WKQA 1V0BA 3IECA 3QGWA 4EZ3A 5FM2A 1PJKA 2QD9A 2VD5A 4USEA 4AWIA 4NW5A 4BVUA 4UMRA 4AE9A 3FMMA 3FBVA 4OTPA 3AMAA 1OBGA 5HCZA 3RGFA 2CLXA 4IIRA 2W9ZB 3MFUA 5CVHA 1U46A 4IC8A 2EB2A 3C4FA 3KMWA 4YLJA 5FXQA 4EWQA 3FMHA 3TV6A 2R3GA 4N6YA 4L3PA 3AD4A 1WBOA 2XRUA 4I92A 1YOJA 5K9IA 3SG9A 4A9YA 4LV5A 2IPXA 2YN8A 3NZ0A 4X6QC 5CALA 3F61A 3DNDA 2WMUA 4YSJA 4WD5A 1GZOA 2HAKA 2RKUA 2ZYBA 4HYHA 3BHHA 3TUDA 4O7WA 2VO0A 2YFXA 4L3JA 3V04A 4EKKA 3FUPA 5KBRA 4RG0A 1P2AA 4F7SA 2OIQA 2WTDA 4AA0A 2ZDUA 4C02A 1Z57A 3F9NA 2GHMA 4QP4A 1KV2A 2VN9A 3MIAA 5M4CA 2CGWA 3DKOA 2XJ1A 4ZEGA 3P9JA 4E20A 2BALA 2IW6A 5AR7A 3L1SA 3ZYAA 4MD7E 2VWZA 3NCGA 4NM3A 4V05A 3NW5A 4A4OA 4DAWA 5AIRA 3DXNA 5ANIA 4O21A 3QQHA 1IASA 1ZZLA 2WTWA 3R04A 5DI1A 5DE2A 1H1WA 3AQVA 4G6OA 4D4VA 5IG1A 5IA3A 4HCTA 3LXPA 3RK7A 4BI0A 4IJPA 4L01A 5JQ8A 2C3KA 5TR6A 5EHLA 4RJ7A 4P7EA 3G2FA 4BDIA 2YWVA 3QXPA 2F2CB 2BRBA 3MFSA 2Z7LA 4KBCA 4YU2A 3HAVA 4F9AA 4W4WA 2WIPA 4A07A 4IWPA 4TWCA 5CY3A 1M14A 1XR1A 5B2LA 3PXZA 1JNKA 4HCUA 5CX9A 3F3TA 3P78A 4H1JA 4TYGA 3E8CA 4FUYA 1YWRA 3BE9A 4FKWA 4OTRA 4YJOA 4ORKA 3EIDA 5EKOA 4WSYA 4IWOA 3MN3A 3R63A 3I5ZA 4KBAA 4BDJA 4R1YA 5IH4A 4FI1A 1RE8A 3E8EA 3IQ7A 2YA9A 4MH7A 4QP3A 5LMAA 3UYTA 3ZDUA 3FXZA 1QPEA 3UODA 2V55A 3DJ6A 3G0FA 4KKGA 3KL8A 4BCNA 2YEXA 2VO7A 4FEWA 1UU7A 2VGOA 3WF6A 2WZJA 5M06A 5M4UA 3A7FA 5HG8A 3VAPA 3ZHPC 1ZOHA 3E5AA 3CC6A 2OO8X 4H58A 4J96A 3QALE 4O0SA 4AT5A 1UA2A 3CR0A 5AV2A 3B2WA 4YJQA 3MTLA 5JFWA 3ZDIA 2C1BA 4NIFB 3F2NA 4ERWA 2HZ0A 2GS2A 4XOYA 3ULZA 4E4LA 2EU9A 3OCSA 1ZYSA 4AA5A 3OXZA 4NTSA 2OICA 2XKEA 4QMZA 4ZLZA 4RWLA 3TUBA 4AW0A 1W83A 2J2IB 4RLKA 3BHVA 1KOAA 3EFJA 4QMYA 1P4OA 5KO1A 3MIYA 4U41A 1H1RA 4M8TA 3EQHA 4XLIA 3GC0A 4JBQA 1U59A 3C13A 2IZRA 2XK8A 3R9HA 1REJA 4MEDA 2YM4A 3R9RA 4DFUA 1E1VA 3L8VA 2YM7A 4GKIA 5ANDA 3NIZA 2VGPA 3BELA 3KVXA 3FL5A 3DQXA 3VS0A 2ERZE 4DHFA 1QPDA 3ZCLA 5HTCA 3WBLA 4Y5HA 4HOKA 2F9GA 4Z7GA 1U4DA 4H1MA 3TZMA 5DRBA 3O96A 3DZOA 5I3OA 4IDVA 4FKPA 5AUXA 4DFBA 5CTPA 1Z5MA 2VU3A 2YCSA 3HYHA 2CPKE 2IO6A 1TKIA 5ANJA 1ND4A 5DYJA 1IAHA 4FTQA 5B0XA 3OS3A 3OY1A 3QQGA 4M14A 3RTPA 3CPCA 4Y73A 4D9TA 4ZTQA 4JAIA 4CVAA 3ZFXA 4GVAA 3FYKX 4XP2A 5KHWA 3GU6A 5IH5A 4GK2A 5E8ZA 4EJ7A 4QP1A 5TE0A 1WFCA 5KKRB 4YUQA 1Y57A 3UOHA 2J5FA 2XK7A 2GNGA 3DBQA 1WMKA 2ONLC 3DB6A 3DFCB 3DQWA 2O64A 3ZO2A 2ZAZA 2XEZA 4FV7A 3TTIA 2VO6A 5CVFA 5E1SA 3F2AA 3V8TA 3IW8A 4AFJA 1G8SA 5AP1A 1U5QA 3Q9ZA 3UVRA 1CDKA 2O8YA 3LFEA 5HTIA 4CKRA 2ZJWA 4EH9A 1OITA 2VTRA 3KMMA 3D4QA 1PXKA 2EXMA 3O71A 5C8NA 5I3RA 1R78A 5H3QA 5LOHA 3HKOA 4IWDA 4P2KA 1WVXA 4IB1A 4ANLA 3TCPA 4JG6A 5GZ8A 2C6IA 2CCIA 1W7HA 2IW8A 4AZVA 5HD4A 4M0ZA 4QMQA 4F99A 3PXKA 3I0OA 2C6LA 4O84A 1Q8TA 3E8NA 4X21A 5HVYA 3VF9A 5E8WA 2W1GA 3CKXA 5BNJA 2ESMA 2C5VA 3VBWA 3JVSA 2PVNA 3MGYA 4TWNA 5BPYA 3A61A 1YRPA 3R2YA 4HGTA 4FK3A 3JUHA 3ROYA 1JAMA 1H08A 5CEMA 3GU7A 3FAAA 3QX4A 3UYSA 3OWLA 2R0IA 4CYJA 4U45A 3AT3A 5AA8A 2PZPA 3Q6WA 4FEUA 3TNPC 2P0CA 2VX0A 2VWWA 5DPVA 5HLPA 2J9MA 2XYNA 3HV4A 4FZAB 4JBOA 2XYUA 3CD3A 3D5VA 4G3DA 4QMLA 3CJGA 3EB0A 4RVLA 1B39A 1Z9XA 2VWUA 5EOBA 3NNUA 3GC7A 5EM8A 1NT2A 3FKLA 4FTAA 2R4BA 4XS2A 3D14A 4UMQA 2YAKA 4S33A 2XRWA 4CQGA 1OL1A 4UWYA 2OKRA 4FZ7A 3V5WA 4FSNA 2VTAA 4FSTA 1JOWB 5AM7A 4PDPA 1SZMA 3B2TA 3BYMA 3PG1A 1J1BA 4HGLA 4FNXA 1JSUA 4I24A 5A6OA 2YJRA 5D10A 3TT0A 4B9DA 4PPCA 2WPAA 3KCFA 2BKZA 3GCUA 3W10A 4LOOA 2ACXA 3TNWA 3L9MA 2GQGA 2XF0A 4FKTA 2R3LA 3A7JA 4NCTA 2XVDA 3QRKA 2O2UA 5C8KA 2PE2A 1I09A 3I7BA 3PJ8A 3QC9A 4EOKA 3OXTA 5J87A 2Z60A 3QUDA 4YHJA 5CI6A 5A4CA 3R7UA 4FNYA 4PMTA 3QLGA 5TO8A 2BAKA 3FLWA 3G6GA 4ANQA 4BC6A 3HVCA 2PULA 5FQDC 1YXXA 4Y8DA 4E7WA 2JGZA 2FYSA 4DBNA 4PMPA 3M11A 2GNHA 2YIRA 3E62A 5DR9A 4ZS0A 2JDVA 2QO2A 3Q96A 3DLZA 4QMOA 2YITA 1YHSA 1SNXA 5IEXA 3UBDA 3W16A 4QNYA 3TIYA 2PUPA 4D4SA 3ORIA 3MYGA 5AP7A 3L8SA 3T9TA 5E8YA 3TNHA 4D1ZA 5IUHA 4ZMFA 4F08A 2UZTA 4JAJA 3C9WA 4R1VA 5A3XA 3NS9A 4DH3A 4DGOA 2WTJA 5TF9A 2JDRA 3DJ7A 3MVJA 2XB7A 4YTIA 1IA8A 2WOTA 5HI2A 4FTUA 3ZEPA 4DH7A 2VTMA 2C3JA 4ZZOA 1OKYA 4Y5QA 3OP5A 4EK6A 3OZ6A 3EN7A 2CNQA 5DG5A 3Q4ZA 4GT4A 2BAQA 3P23A 4FVRA 3FLQA 5FLFA 2FSTX 2RFDA 5D9HA 3C50A 4J53A 2BIYA 3OW3A 1J7LA 2Y0AA 3DDPA 3PY0A 1Q41A 4NFMA 4FV0A 3DXPA 5I9UA 4IB5A 4EQMA 3LLTA 5AP3A 3MH0A 1ZMWA 3RZFA 4BDKA 5IU2A 3TUCA 1XH8A 4PF4A 3HNGA 3LXKA 4XRJA 2BZIB 2GSFA 1RW8A 2GCDA 3NYOA 2YABA 2Z8CA 5JZJA 3ZUUA 5BUJA 3EL8A 2HYYA 2PTKA 1KE6A 2PUUA 4JIKA 4E26A 3R7EA 3ZO1A 2F4JA 3DK3A 1ZYDA 2RIOA 4O0VA 2OIBA 5AFVA 3BQCA 4R5YA 2XJ0A 2WMSA 3PVWA 2QR8A 3VW6A 1NA7A 3G33A 3IW4A 4G2FA 4EH5A 4X3FC 3AGLA 4MBLA 2UZDA 5EH0A 4WOVA 1H1QA 3VUHA 3IPHA 4JS8A 2Q83A 4O7SA 4KINA 4FZ6A 2HZIA 2UV2A 5EDPA 3ORZA 5HG7A 3CSVA 3DU8A 2UW7A 3EN6A 3COHA 4JDHA 5CXHA 2OFVA 4C62A 4QTDA 3PRIA 2CKPA 4LGDA 4NW6A 4FIHA 3U6JA 5DGZA 5ETFA 1PMNA 4CCBA 3D94A 4GFMA 5H9BA 4NUSA 4Z7HA 3MPTA 4TXCA 2NP8A 2NO3A 4J7BA 4D4RA 2R3HA 3BI6A 3SC1A 5ETAA 3COMA 4IMYA 4KSPA 4U6RA 3D5XA 4RFMA 4E4MA 2B54A 5AP2A 3FC1X 2W1ZA 4FSQA 2BCJA 4FA2A 2DS1A 3P5KA 1ZYJA 1PXLA 1XHAA 3EMGA 4BDCA 4E5AX 1O6LA 1XKKA 3GC8A 4HPTE 4V0GA 4EJNA 4OAVB 2OXYA 3FLZA 4TTHB 2E2BA 4ZSAA 3VUTA 2QVSE 4L6QA 3ATSA 1H24A 4H39A 3WZJA 3HUBA 3QCYA 2W1EA 4X2JA 2QR7A 3FZRA 2PMNX 3UO6A 4IX6A 2GDOA 2X7FA 4C2WA 3RMFA 2C4GA 4RIWA 3BE2A 4A06A 3SW4A 5F1ZA 3ZC6A 2NRYA 3H30A 4WNOA 3VWAA 4H3BA 3U4UA 2AC3A 3QA0A 4IXPA 1O6KA 3DS6A 3LFSA 3P0MA 3EZVA 3O50A 3O7LD 3VBVA 4ALVA 4G31A 4IC7A 2F57A 4X6RA 4G17A 1KSWA 1QMZA 3C1XA 5KMOA 1Y91A 5CU3A 2VO3A 1JWHA 2QC6A 2F7EE 3OTUA 2QU5A 3ZH8A 2C5XA 4A4XA 1U54B 5E9EA 2HK5A 3CS9A 3PJ1A 2V22A 3M42A 1R0PA 5HQ0A 2XIRA 5FG8A 5H8GA 4CSVA 4XG3A 3SG8A 2B4SB 3EQGA 3SVVA 3GBZA 5EI2A 4K18A 1SM2A 4QQTA 5G6VA 4E1ZA 2QOKA 3QYWA 3D83A 3GC9A 3BU5A 3TM0A 4V04A 4LV8A 4CTCA 4NJ3A 1YXVA 4RIXA 3P79A 4QYEA 3KB7A 5A4EA 3RAWA 4B0GA 5BVOA 3F2RA 3TKHA 4JBVA 4U97A 4DH8A 3R30A 5EM6A 3GFWA 5GHVA 3SW7A 4O7RA 3O2MA 3GGFA 3PXFA 4QMMA 5JN2A 1M17A 3I1AA 4R7IA 1Q4LA 4UZDA 5AR4A 1X8BA 4H36A 1UVRA 1VEBA 3UIBA 3VBXA 2UZVA 2RGPA 1JKTA 2QOOA 2R3KA 3NX8A 4RIYB 3RKBA 4GL9A 4KKHA 3OVVA 5HX8A 4HVSA 2GNFA 4AW2A 3S00A 5AUTA 4FKRA 4GYIA 4JG8A 3MVHA 4QNAA 1H01A 4D1SA 5HLNA 3BYVA 3E93A 1ATPE 2B9IA 4GH2A 2UVXA 2SRCA 4RPVA 2OXDA 4XG6A 3MH1A 2CN8A 3QD3A 3AD6A 4IAAA 5FGKA 5LVLA 4IH8A 4ZP5A 4YJPA 4FZFB 3IW5A 4L45A 4EWHA 1UKHA 2BR1A 3FZ1A 4HVDA 2A27A 5HO7A 3QRIA 4J52A 3KRWA 4FIGA 3W2RA 4GIHA 4F9YA 4R7BA 5IQBA 3UO4A 3OWPA 5BVDA 3Q52A 4FGBA 3JYAA 2RG6A 2O3PA 4OTDA 3QQKA 4YTHA 3ZRLA 2R3QA 3FEGA 3LFNA 1H4LA 3IGGA 2JDTA 4K8AA 3S95A 3FI3A 1T45A 3WF5A 4IVCA 4XOZA 3D0EA 5E91A 3WF7A 4LOQA 3PWYA 1OB3A 4BY9E 2C6TA 3PP0A 3NYVA 1DAYA 5CSWA 4EHEA 3Q6UA 3ZBXA 4A9SA 1BL6A 4GVJA 4QTBA 5L8JA 3MESA 1WBTA 5BUEA 1HCKA 4JLCA 1YWNA 5A4LA 5IQDA 3ODYX 4LUEA 3GNIB 5JEBA 5DWRA 5C9CA 1KWPA 5CEOA 1ZAOA 2CHLA 5E90A 4TWOA 3CKWA 2JEDA 2JFMA 5M57A 2C6MA 3KC3A 3DAJA 4KUJA 4JOAA 2QOCA 5L8LA 4BHZA 3CBLA 4FEXA 4DEAA 4KRDA 3KY2A 5EQPA 3C4ZA 1PXIA 4EL9A 1RJBA 5I0BA 3ZM4A 3FV8A 5HE2A 4A7CA 3ALNA 4GU6A 4BYJA 2X9FA 3R9OA 4QYHA 5C1QB 3LFCA 4KIQA 5FP6A 3QF9A 3EFKA 4PQNA 5I9XA 2OU7A 1R39A 3UOJA 1ZXEA 3TNQB 2X6DA 3O51A 5ETIA 3UNZA 1OKVA 1W8CA 4Y85A
chains in the Genus database with same CATH superfamily
3Q4CA 3UVQA 1WVYA 3CQWA 2W0JA 4QMTA 2J0JA 4KS8A 4APPA 1TQIA 4D0XA 5F94A 1H28A 3G9NA 5FBNC 4YP8A 4EUTA 2ZV8A 1PRYA 4ASDA 3QQUA 2W1CA 5EQYA 3K54A 1XBCA 4F09A 5CAQA 4FJVA 1YDTE 2PVMA 1VJYA 4PTEA 5K4JA 3GP0A 4AGDA 3U87A 4HYSA 4O6LA 1GIJA 4FG7A 3MB7A 3ZM9A 3O5AA 3R8LA 4DT8A 1VLRA 2WMWA 2PUNA 4MXAA 3SOAA 1KUTA 3ZC5A 3O7LB 3WOWA 3HMOA 3CJFA 4DGLC 3QD0A 1H26A 1TZDA 4DFNA 2OI4X 5CF6A 2WFYA 5CANA 5LCKA 2BFXA 1V1KA 2PZRA 3KFAA 3MPAA 4IAZA 4O91A 3PSDA 5BV3A 4NM0A 4Y95A 4AGCA 3MJ1A 3PY1A 1IAJA 4LFIA 3LQ3A 4IFCA 3C5IA 4GMYA 3JY0A 4A9RA 3KXXA 4XCUA 2QHMA 4U3ZA 5BVWA 1Q5KA 5TT7A 2WNTA 4TNBA 1MRYA 3UMWA 4O4CA 2CKEA 2YLEA 4O0TA 3SX9A 5EI6A 4QPMA 4NFNA 3UPXA 5E4HA 2W5AA 3GXLA 4OTHA 4CFFA 4FV3A 4YO4A 3LJ1A 3GCVA 1L8TA 1KV1A 2C1AA 4NYEA 4KSQA 1MRVA 4JRNA 4L8MA 4LV7A 1H00A 2UW8A 2VRXA 3DXQA 4WUNA 2QO9A 5BMSA 2HOGA 3AC4A 3A62A 3IW7A 1GZKA 3MH2A 5C03A 3SAYA 3ZMMA 4K1BA 2GHGA 3RZBA 4QT1A 1F5QA 4MKCA 4S30A 2VTQA 2OLCA 3EN4A 1Y6BA 3Q3BA 3AT4A 4JJRA 1JKSA 5H2UA 4BJJA 1FMOE 5HD7A 2GMXA 3POZA 2W17A 4AZEA 2WU6A 4R7HA 2QOLA 4Z16A 2RG5A 3R73A 4MBIA 1ZZ2A 4FK6A 2X0QA 5LMKC 4BZNA 4JDJA 3CGFA 4ZXTA 2UZOA 3LXNA 3N4VA 4AAAA 1GJOA 1QCFA 3VHEA 3QTRA 5AAEA 4PMSA 4BWPA 3EQRA 4IQ6A 4KIKA 1S9IA 3NIEA 1ZOEA 4CFNA 4X3JA 2ITZA 3MW1A 3P08A 5IDNA 5FTOA 3RCDA 3RI1A 2QOBA 4NWMA 3F3WA 4AXEA 1OM1A 4CEGA 4FV1A 3UP2A 4MXCA 5JK3A 3ML1A 2YM5A 3AXWA 3W8QA 2PU8A 2JIVA 3QTQA 2W7XA 5ACKA 2X4ZA 2O5KA 4D1XA 4FTTA 3QKKA 3E92A 4OTFA 1P5EA 2OZOA 4X3FB 1M7NA 3CCNA 3N51A 4FRFA 5GJDA 5HX6A 3DK6A 1XBAA 2PPQA 3ERKA 4R77A 2YIYA 3W18A 2X7GA 1YHWA 3MH3A 4EEVA 2A2AA 3TKIA 4ANNA 3RM6A 3CY3A 3TEIA 4C4JA 3CGOA 4OTWA 3DA6A 4YZ9A 3KULA 5FDPA 4Q9ZA 1YI6A 3THBA 3G6HA 3VUKA 3LIJA 3DBDA 3NYXA 3RAKA 2QO7A 3QFVA 4B99A 2W1FA 5CAPA 1XH5A 1CTPE 3COIA 4P90A 3ZO4A 4RWIA 5J8IA 4LMNA 1JLUE 3UIUA 5FXSA 4XP0A 3ZLYA 2C68A 4YGAA 3R8UA 4ANMA 3MA6A 5K0KA 3NR9A 4BDBA 4IVBA 4IWQA 3K5VA 3C4XA 2GS7A 3W2QA 4O38A 3AGMA 2OG8A 2XKFA 2ITQA 2B9HA 2Y4IC 3HP2A 4FV6A 4U80A 4JDKA 4WG5A 3G15A 2ZVAA 1H0VA 2WMBA 2OJJA 4V01A 5EYMA 2ITUA 3LCTA 4YC6A 3FI4A 3EKKA 5FEQA 3ET7A 4DT9A 2JIUA 4L67A 2CNVA 4K33A 4UYNA 4O0YA 3V8WA 4KIPA 5CU0A 3QXOA 1W82A 1OL6A 3F88A 2YCRA 3C5UA 2J90A 5DOSA 4GEOA 4TYHA 2CCHA 4FKVA 3TZ8A 4IM2A 3R1QA 3QL8A 3WE4A 5J7BA 4BI2A 3GFEA 5KKRC 4EOIA 4RJ5A 3D5WA 4LRJA 1Q8WA 4WO5A 4F6WA 3ETAA 4EH3A 4USFA 3IW6A 1JBPE 3H9OA 5T3QA 4MXXA 5K0XA 1CSNA 3DGKA 5KMKA 2W5BA 3QC4A 4I4FA 4ZTMA 2GU8A 4PDOA 4JMQA 2R3JA 2WOUA 2JAVA 4CFUA 4FV2A 1ZRZA 3P86A 5IA5A 4AFEA 1ZY5A 3R0TA 5A6NA 4CZTA 3MY0A 4BCMA 5LMBA 4EBWA 3VVHA 4Q5EA 3W8LA 4U9AA 4CLIA 2IZTA 2PMIA 4GG7A 3VRYA 4S34A 5J9ZA 3FI2A 4QTAA 4ANBA 4H3PA 4MXYA 3OW4A 3EQIA 4I6HA 2BPMA 4RMZA 2ETRA 3FLSA 5JFVA 4IM3A 3E8DA 5CQUA 3MBLA 2QLUA 3ITZA 3LZBA 3F5XA 4MAOA 3VULA 4EZ7A 5AP5A 3R1SA 2Y9QA 5EG3A 4I6QA 4XEYA 1XH7A 4M12A 5CZIA 4HVIA 2HWPA 1HCLA 2A19B 2XNOA 3R83A 2F7XE 1GY3A 3V01A 1K9AA 3MFTA 5AR2A 2WB8A 1QPJA 3PSBA 5EYDA 4A9TA 4FTIA 4R8QA 4MBJA 5EDQA 2WMTA 5KMLA 5HO6A 4YHFA 3IOPA 3TZ9A 2RSVA 3PZEA 4FODA 3P4KA 3A7GA 4L44A 4E93A 5CSPA 2VNYA 5DRDA 4XV3A 2R9SA 3R8PA 1XH9A 1YXUA 4AT4A 3QLFA 3QRTA 4USDA 3W2PA 3OF0A 4D2RA 5HE1A 3V5TA 4AOIA 1Q8ZA 4IVDA 2BDJA 3U54A 4F9BA 2WD1A 4AZTA 4I5MA 3P7AA 3VQHA 1E1XA 4YBJA 2I0EA 4NM5A 4RQVA 3OOGA 4M7IA 4L9IA 1GZ8A 3E7OA 5DT4A 3U4WA 4AACA 1ZARA 3PP1A 4EHGA 4CGAA 1JSVA 3CTHA 5CNOA 4MF1A 3VQUA 1L3RE 3KEXA 1UNLA 4ACMA 2B52A 4FV4A 3E3BX 2VAGA 2WMVA 3ORMA 4MCVA 5IQHA 2VTOA 4GJ3A 3QYZA 2DYLA 2IEWA 3LKMA 1Q99A 2DUVA 5E92A 4GW8A 3KXNA 4J95A 2C6KA 3OWKA 2XNMA 3W32A 4FKOA 4HGEA 3NVMB 5AV0A 1EH4A 3A7IA 3F3VA 4FTNA 3BYUA 4HJOA 4NH1A 4PPAA 4ASEA 4BGGA 3LPBA 4ZY5A 5JSMA 1XH6A 5AADA 5CEKA 3PA5A 4JRVA 4BDFA 3EQDA 4ITJA 3SD0A 3VS5A 2NNWB 2BZHB 3UPZA 4XG8A 3CQEA 5LVMA 4AT3A 2WTKC 2QOQA 5LXMA 4EH2A 3P7CA 5IH6A 3DB8A 3I4BA 2JBPA 2JKOA 3PA3A 4MF0A 1TQPA 2BAJA 4DG3E 3KULB 3BCEA 4GS6A 3OCGA 3KQ7A 2PUIA 3RHKA 5DIAA 3RAHA 5J5SA 4FVPA 2GS6A 3BBTB 4F1TA 5FBOA 4DH5A 4EOPA 4DBXA 2QHNA 4L7SA 4MD8E 4X2FA 5CXZA 1OL7A 3AKJA 1WAKA 3NUPA 2ZMCA 3O23A 5DN3A 1ZY4A 2YIQA 2CLQA 3C51A 1XMLA 3PXRA 4YURA 4FT5A 4D2WA 2QKWB 4C4EA 5C4LA 3HDMA 4TNDA 3OCBA 3UO5A 3FC2A 3KXMA 3DJ5A 3LFBA 1OVEA 4GV1A 2F2UA 4PUZA 3BEGA 3MTFA 4L52A 4MVFA 3W0PA 4TZRA 3PXQA 2E9UA 3R8ZA 4FKJA 4AZWA 1UKIA 1YVJA 3MVMA 1OPKA 4E8AA 5CEIA 5DMZA 4FKSA 1YHVA 4F4PA 4KB8A 4FMQA 3EQBA 4MQ2A 3R9NA 3F5UA 1J7IA 4QD6A 5CF8A 1YI3A 3PPJA 2GFCA 3EN5A 4XP3A 5ITAA 5IQEA 2W1HA 2QOIA 2R2PA 4I6BA 2BRHA 3VS4A 2EXEA 4D4YA 5E8SA 2Z02A 4EK8A 1ZYCA 4GCJA 3H0ZA 2YIWA 4GK4A 2OH0E 3QTZA 5BVNA 3MY5A 5KCVA 2CJMA 4ZK5A 3Q5IA 2BILB 4UY9A 2BVAA 5M51A 4AZFA 2YWPA 3VBQA 2YJSA 3LQ8A 2W96B 4E73A 4OT6A 4FE2A 2FA2A 2VV9A 4G3GA 3PG3A 4K0YA 4DITA 4FTCA 2VWYA 2Y8OA 2PHKA 2PL0A 3TWJA 4FEVA 5GIPE 4PDSA 4PMMA 4RA5A 5DEYA 4NM7A 1YOLA 3FDNA 4PWNA 4IX4A 3SDJA 4C2VA 4DCEA 2R3NA 4ENXA 1NW1A 1APME 4MHAA 1NVSA 4KA3A 4JT3A 5F95A 5CEQA 4D5HA 2PE1A 2JFLA 4EC8A 4F0FA 1DI8A 4PP7A 4ANOA 5CAVA 3DLSA 5IDPA 5LCJA 2X8EA 3H10A 2JIIA 5HGIA 3VS3A 4C58A 4NIFA 4I20A 2WTKB 1G5SA 4G6NA 3JVRA 4U42A 2ZM4A 2CKQA 2OJ9A 2WTCA 3Q4TA 2ITOA 3EOCA 2O0UA 5AR8A 2HXLA 2ZDTA 2FO0A 3L8PA 3QHWA 3RNYA 3ZUTA 2CMWA 5FEEA 4DGGA 3EYHA 4EUUA 1G3NA 2V7OA 3FY0A 3PJ2A 5D1JA 3PVGA 4ZTLA 5HVKA 2XP2A 3BL7A 1ERKA 2WMRA 4EOJA 3LMGA 2R64A 3HMIA 4RC2A 4AU8A 1BYGA 3TKUA 3UZPA 4E6QA 5M56A 4MX9A 3EZRA 3LFFA 2BRMA 4UWCA 2F49A 3BYSA 4TYJA 4W9XA 3KKVA 4RJ4A 3QD2B 3QTWA 4I5HA 4W4VA 2Y7JA 1OL2A 4MQ1A 4C36A 1YW2A 2XKCA 3O8TA 2XIXA 3T3VA 4HVHA 4XG2A 4N57A 4IB0A 5IUIA 5EW9A 3FMDA 3S3IA 3T8OA 1E9HA 4XV9A 5IA1A 3TDWA 1JSTA 4XJ0A 2CSNA 3QRJA 4XRLA 1Y8YA 3II5A 4IADA 3HV6A 3AC2A 5HLWA 4K77A 3OUKA 4FBXA 2R3MA 2PVHA 3KRRA 3OTVA 4FT9A 4RZVA 5DH3A 5F20A 4D55A 2F7ZE 4FGRA 5EW3A 5FWKK 2Y4PA 2PZ5A 4EK4A 3NGAA 3BHYA 3EL7A 4KS7A 1OIYA 4R3CA 4AUAA 4EQCA 3NUXA 4AW5A 2VTNA 2JDOA 4NZWB 5IEVA 3ENMA 4TKSA 4RRVA 4ZSEA 1FGKA 4PNIA 1WBNA 3NNVA 4O0WA 3SA0A 4D28A 2B7AA 1J1CA 2C30A 3GB2A 5D41A 3SXSA 4FIIA 2WQEA 3FY2A 2V5QA 4EH4A 2EVAA 2QNJA 4DEHA 1MUOA 2EWAA 3KK8A 3BLQA 1Q62A 4ZZMA 5A54A 1OIUA 3EJ1A 3AT2A 3HMMA 4YNOA 5J95A 3FLNC 3HZTA 2X6EA 4Y83A 3H9FA 5C01A 3KIOC 3IDBA 3NWWA 2ETMA 2OJFE 1K2PA 3A60A 5HU9A 3ZBFA 4ZS4A 3IKAA 5I5ZA 4X2GA 1UNHA 3BL9A 4FSWA 4CLJA 4FTMA 3RK5A 4DGMA 3VBYA 2IWIA 4CMTA 4CZYB 4JQ8A 4DFZE 4F6SA 5J79A 3SXFA 3PFQA 3LAUA 3BGZA 2UZUE 3FE3A 2CNUA 1UWJA 5AR3A 3V3VA 3WZKA 2X8DA 4BL1A 3AMBA 5IQGA 3ZZEA 2DWBA 3CY2A 4ACDA 3EQFA 3FSKA 5HO8A 4UMPA 5K5XA 5ICPA 3FJQE 4K2RA 3BGQA 3ORKA 4FTOA 4K6ZA 4YR8A 4G6LA 3F5GA 4EYJA 5M4IA 4TPTA 4FKIA 1BX6A 2H34A 4D0WA 3I6WA 3HV5A 4RX5A 5FD2A 3R8MA 2ZV7A 1H1SA 4KKEA 3ZOSA 3UG2A 4U0IA 2C6DA 3D7TA 4JI9A 1M52A 5M4FA 5IQIA 4V0GB 2C5YA 1IRKA 4O83A 3MDYA 3SLSA 4FIFA 5DEWA 1VR2A 2WKMA 2A98A 4EK3A 4AXFA 2C6OA 2VWBA 4C61A 4L3LA 1Q8YA 3L9LA 4IAYA 1R3CA 3UNJA 3V51A 2VZ6A 4AXAA 4DN5A 1S9JA 4BCKA 4RBLA 3RP9A 5KE0A 5TKDA 3LFDA 3GENA 5JFXA 4BRXA 1JKLA 4I0TA 3Q9YA 2CGVA 4TN6A 1YDRE 3UOLA 3C4CA 2UZBA 3OD6X 3QCSA 3G51A 5HIBA 1RQQA 3QZGA 4BIEA 5KHXA 3ZEWA 2R0UA 3COKA 3EQCA 3NW7A 4DTKA 1LR4A 1IR3A 1WBSA 2BROA 4AX8A 3MWUA 4I5CA 3OWJA 5F9EA 5BYLA 3VONA 1U54A 4FSMA 4FL3A 4C8BA 4EORA 5DVRA 2XNPA 4L00A 2JITA 5IA4A 3ZFMA 4WA9A 3ZSHA 2VTJA 5AV1A 5HCYA 4S2ZA 4U8ZA 4DA5A 2R3OA 5H8EA 3E64A 4FX3A 4CFWA 3A99A 3W33A 3KMUA 4IAIA 5CQWA 1TQMA 3GVUA 1FGIA 3GUBA 3Q04A 3UOKA 3CD8A 3LCOA 4I23A 2REIA 3UVPA 1OIQA 3F69A 4NU1A 4ZJJA 4EC9A 4F65A 2P2HA 3SKCA 4YPSA 1P4FA 4QMUA 4UXLA 3QQJA 5IZFA 2ITYA 4RJ3A 1PXNA 3LFQA 4M0YA 3FPMA 3GCSA 5D12A 3EQPA 4LM5A 3HECA 2JBOA 2Y4IB 4LG4A 4OR5A 3FQSA 3M2WA 5CU2A 1Q97A 3VC4A 5IUGA 4HYIA 4RT7A 3UNKA 1H07A 4H3QA 5M55A 2XZSA 4GFGA 5CAOA 2YM3A 3WZUA 3AMYA 4C3FA 4DFXE 3PIXA 4F1OA 3UIXA 1VYWA 5JGAA 3LCKA 4G3CA 2ITVA 3NEWA 5EI8A 3FYJX 3UC3A 1PW2A 5HNIX 1PKDA 5A4TA 2OFUA 3KVWA 4MNFA 3NAXA 5L6PA 2XM9A 4UB7A 2R3IA 3H0YA 4HZRA 3UE4A 2E9OA 5AUVA 4JNWA 4IBMA 4IZ5A 4EH8A 5JT2A 1H25A 1Q8UA 3FKOA 4FSYA 4XLVA 3VUIA 2HXQA 4QP7A 4BKYA 3LM0A 4C0TA 3ID6C 5JGDA 5KUPA 3RPOA 2J0KA 4AGUA 2Z2WA 4E6AA 3WZEA 3C4EA 2WTIA 2ZV2A 2XCHA 4M97A 3QTIA 3LLAA 3N4UA 1JVPP 3QU0A 2W99B 4BICA 3SRVA 2HELA 1J91A 3NYNA 4A9UA 4ZIMA 3ORNA 5CSHA 1NVQA 4U79A 4LGGA 4ASXA 3GOPA 5HBJA 1AGWA 4ZOGA 4ANSA 3IO7A 4X7QA 2Q0NA 1SVEA 2Y6MA 4FOBA 2EUFB 3VW8A 2W06A 4RSSA 4FTJA 5AUUA 5FP5A 3DKGA 4D58A 5HU3A 4JDIA 4RX7A 2QG7A 3HRBA 4AOJA 4YNEA 4RC3A 3W0SA 3OG7A 2WQBA 3LHJA 5BVEA 3ZZWA 2YDKA 3NUAA 4Z3VA 4DF3A 4M67A 2WIHA 4DEBA 3CQUA 1OIRA 4WRSA 5L6WL 2BDFA 2GHLA 4IB3A 4XX9A 2WHBA 4BIBA 4DEEA 2CGXA 3U6IA 4YBKA 2FSMX 1GOLA 5M53A 4LQMA 3QAME 5HVJA 1CKIA 4BZOA 1BI8A 3MA3A 3Q53A 1JQHA 4BWKA 1YOMA 2OZAA 4WG3A 5DR2A 1VZOA 3RWQA 4IJ9A 5EDRA 3DOGA 4W9WA 2AQXA 1BI7A 3OFMA 4OBQA 5EK7A 3NMUF 5FRIA 5HCXA 3QA8A 3SXRA 4CT1A 3R7YA 1XBBA 4QP6A 3KN5A 5J9YA 3GOKA 2ITWA 4RIYA 4D5KA 1I44A 1J3HA 5CVGA 3KA0A 3RPVA 4B7TA 3C4WA 4FSRA 4BBEA 2A0CX 3OBGA 1OMWA 4O86A 5AR5A 4YZMA 4YC3A 3ZO3A 4R5SA 3HA8A 4G9RA 3VJOA 2JAMA 3PY3A 2W9FB 2J7TA 3UP7A 3GU8A 3ZSIA 4P5QA 4B6LA 3B8QA 3E7VA 4BCIA 2XIZA 4IEBA 4AA4A 4NKSA 2RFEA 4HNIA 3LQ5A 4DGNA 5E8XA 2J0MB 3HL7A 3Q2MA 4FZDB 5GINE 4E6DA 1BMKA 1YWVA 2RF9A 1XO2B 3ATTA 3AD5A 4EK5A 4J8MA 2XIKA 2C0OA 2UW3A 4TRLA 4BDDA 1SVHA 4KD1A 4YJVA 3FHRA 3C7QA 2BRNA 3HUCA 5K3YA 3HDNA 3K5UA 4I0SA 2YZAA 4L43A 1ZMUA 1MQBA 4RX9A 4UBAA 4MK0A 3QWKA 1OPLA 1BL7A 4RIOA 3D15A 3ANQA 1NVRA 3L9PA 4PRJA 4XH6A 4C34A 5M08A 1WVWA 4F9WA 3KK9A 3NUUA 4U44A 4N70A 5I9YA 4PTCA 4WSQA 5AAFA 1MRUA 4NCTC 4ERKA 2BHEA 2WGJA 2CGUA 3UQGA 5I9VA 4OTGA 4G1WA 4O81A 4M3QA 1RDQE 4HGSA 4RVMA 5H8BA 3H4JA 3DDQA 4JG7A 5HE0A 3VUDA 5KMIA 2BKKA 2HY81 4IZ7A 4QP8A 2OWBA 5HG9A 2G2HA 4N6ZA 4ZTNA 4NJDA 5BMMA 4DYMA 4EBVA 1OZ1A 4DTAA 3LW0A 4QTCA 3LCDA 4RA4A 4MNEB 3Q9XA 4WT6A 3HAMA 3F7WA 4RJ6A 3OOMA 4QYYA 1A9UA 5IISA 5LVNA 1PXJA 5FUTA 4PX6A 2X2LA 3DNEA 4WHZA 5CU6A 3RPYA 4AN9A 2AC5A 2ITPA 2P2IA 2IZSA 4IZYA 2PVKA 4JL9A 5I9WA 2IG7A 4YZDA 4KWPA 3DZQA 2PMOX 3PRFA 3UGCA 4PNKA 4OW8A 2HW7A 3GQLA 4R3RA 3R22A 4RC4A 5FXRA 4I0RA 4M69A 3D7ZA 4X0MA 5HNGA 3SQQA 4ONAA 4R78A 3V5QA 4I6FA 2PYWA 1H0WA 5GIOE 2PZYA 5DR6A 2ZB1A 4PL4A 5HICA 3OY3A 3A4OX 3LCSA 3IONA 2BZKB 4FT7A 4G16A 3OBJA 4HW7A 3ENHA 3QGYA 3IG7A 2R5TA 4O0UA 3WIKA 3DAEA 3UIMA 4ZTHA 2I40A 3OHTA 4FL2A 4HNFA 3WI6A 1MP8A 2WQOA 4CV9A 2QURA 5IQCA 2JKQA 3BX5A 5FTQA 2LAVA 5HG5A 1G8KA 3TYKA 1B6CB 3R71A 4LL5A 3BBWA 5AP0A 4BR3A 2BHHA 3BGPA 3FPQA 3FZSA 2XS0A 1ZLTA 4IX5A 5ANEA 1SMHA 4ZLOA 4ZJIA 3RM7A 4AG8A 4O22A 3MS9A 4GUEA 1HOWA 2RFSA 1URWA 5CEPA 5HBHA 4CFMA 3TMOA 3FZTA 3GI3A 4BDGA 1GAGA 4EOQA 3ACJA 2IZUA 2XNEA 1M2QA 3K3IA 2HCKA 4U43A 2PE0A 2WQMA 4K11A 5B7VA 3CEKA 2HIWA 3ZXZA 3AOXA 3QZIA 5IA0A 3N9XA 4YJTA 5L6OA 5AEPA 4IE9A 2CKOA 4JIAA 2XNNA 2YAAA 3REPA 4D2SA 4OTIA 4HVGA 4PPBA 3PYYA 4FTKA 4UV0A 2OZAB 5L4QA 3OCTA 4RZWA 4NK9A 5AIKA 3U6HA 3F3UA 3CXWA 1WZYA 4GK3A 4FKQA 4BGQA 5T6KA 3K3JA 2I6LA 3PWDA 3QCXA 1Y8GA 3VUMA 3ZXTA 2X39A 2JC6A 4NTTA 5A46A 4O0XA 3BKBA 1PMUA 4BTMA 2Z7SA 2Z7QA 3PLSA 3GEQA 5IMXA 1K3AA 2X8IA 3R6XA 5AWMA 4LMUA 4EYMA 4DFYA 2G2FA 5IKWA 3ORTA 1BLXA 3KXZA 3F66A 1ZWSA 3KXGA 3R01A 2XBAA 3PZHA 5KMNA 3PUFC 3MI9A 4E4NA 4E5BA 2RFNA 2UVZA 3BV2A 3F6XA 4J98A 4ZZNA 4JVGA 4FR4A 3CE3A 2ZMDA 3VS2A 3GU5A 3I79A 4DEDA 1PF8A 4GT3A 5B2MA 4KIKB 4ACCA 1LEWA 2BRGA 2CDZA 4FT0A 2BMCA 2FSOX 4NSTA 4RFYA 3OC1A 1UU3A 1P14A 5J7HA 2QG5A 3QKMA 2PWLA 1OBDA 3E87A 3JS2A 2YCQA 2B9FA 4G5JA 4QPSA 2BTSA 3UMXA 3R9DA 1DS5A 4AE6A 3DBCA 4FG8A 1YKRA 4IM0A 4AOTA 4ZY4A 1IA9A 3I6UA 4L46A 2C69A 4YZNA 2X81A 4IANA 3TN8A 2B9JA 4LUDA 4L68A 4B8MA 5DLSA 4RIWB 3RHXA 4BTKA 5D11A 2GQSA 2HW6A 1PXMA 3TXOA 4I5PA 4GU9A 4YZBA 1DM2A 3W0NA 3SOCA 4GIIA 2WMAA 4J1RA 4J8NA 1OL5A 3U51A 4WRGA 5L3AA 1ZYLA 3R7OA 4TWPA 3B8RA 3BU3A 2C6EA 4QO9A 4AQCA 5GZAA 2XANA 4JQEA 4ENYA 3TG1A 3GT8A 3QTXA 3RWPA 4DEGA 4XYFA 3SRVB 4KNBA 3HX4A 3OUNB 2XK6A 2OF2A 3TJCA 5GZ9A 5JGBA 2O65A 5LMKA 4OBOA 3DBFA 5E7RA 4BN1A 1SNUA 4UMUA 4FOCA 4M13A 3R8VA 4F9CA 4BIDA 1OKZA 4UWBA 5JH6A 3DKFA 4P4CA 4EOSA 4JR3A 4YHTA 5AJQA 4ZSGA 3IS5A 3ZLWA 4X2NA 4IDTA 3DBEA 3UDTA 2W4JA 4P5ZA 4Q9SA 5IA2A 1UU8A 4YLKA 5HBEA 3FQEA 1YXSA 3LMIA 1OPJA 3F7ZA 4HYUA 5EW8A 2XAMA 1OI9A 4F70A 1FMKA 3S1HA 1NY3A 2GQRA 3ODZX 5IQFA 1DI9A 4OT5A 4X3FA 4DFLA 1KE5A 2HY0A 2G1TA 2GTMA 3BLRA 4JX3A 2HENA 3CIKA 3KXHA 4QQ5A 3MPMA 1QL6A 2GNJA 2ITNA 1F3MC 4TYHB 5AX3A 5J5TA 3A7HA 4Q5HA 4B8LA 5AV3A 1CKPA 5FTGA 2VTLA 3RK9A 3BWFA 2RL5A 4PTGA 4NL0A 2UZNA 4O1OA 5LVOA 2OF4A 4KIOA 3LMHA 3D9VA 4NKAA 4LRKA 4C4IA 1Q24A 5DFPA 1OKWA 4C33A 1AD5A 3LM5A 4FYNA 3T9IA 1BKXA 4GSBA 1NXKA 2YHVA 5ANOA 5AX9A 1PMVA 2FUMA 2YERA 5EHOA 3QD4A 2JD5A 4D9UA 2JKMA 4NEUA 3PTGA 1PKGA 4BZDA 3S4QA 5C26A 3VJNA 3W55A 4C4FA 5CT0A 4YJUA 3W1FA 3CLYA 4E3CA 4EOMA 3O17A 1PY5A 3VF8A 4RVTA 4FUXA 4YSMA 4FKLA 2XK4A 3RVGA 4L7FA 4C38A 3GQIA 3TACA 3BWJA 2XK9A 4CMOA 2WELA 3NUYA 5CU4A 4F7NA 3NUNA 5CYIA 4DE4A 2OIDA 4C4HA 4AXDA 3C0HA 4YO6A 4KAOA 2PVFA 5DHJA 4PL5A 2YACA 3CTJA 2I0YA 2UZLA 2WMXA 3H9RA 3R00A 3G90X 3DK7A 4LL0A 2HZ4A 5T68A 4EH7A 4EOLA 4X2KA 4QEBA 4O6EA 4ITHA 1SVGA 4FVQA 4YJSA 2FH9A 2C5OA 2V7AA 2GNLA 3TL8A 1YDSE 4OUCA 5HTBA 2OH4A 2QODA 3KRLA 3QQLA 5EYKA 3HV7A 1KOBA 3IOKA 5AUZA 4E5WA 2VTSA 3DKCA 4FNZA 3RPSA 1PYXA 4NT4A 3TI1A 3V6SA 1WBWA 4BBMA 2H8HA 4G3FA 4C3RA 3VHKA 3F82A 1T46A 4EHVA 3E63A 4QQJA 4CRLA 2FVDA 2ITXA 1M2PA 5A9UA 4UALA 3VS6A 3GCQA 1URCA 2PSQA 3EFLA 4B4LA 4IW0A 4BDHA 4F64A 1FINA 4IVAA 5BQ0A 4GKHA 4DINA 3ZS5A 1V0PA 2VTTA 4E6CA 2VTPA 3C0GA 4BCFA 3L8XA 4LGHA 2OXXA 3D5UA 3WF9A 4ZTSA 5CAUA 3BEAA 3DTWA 4O2PA 4RQKA 5LARA 3R7IA 3ZSGA 2CN5A 4DEIA 4E4XA 5C4KA 2XMYA 4RGJA 5CSVA 5D7AA 2X2MA 3TNIA 1QPCA 5JRQA 3ROCA 4FNWA 4CD0A 4ASZA 5I4NA 3EN9A 4S31A 4PP9A 3NDMA 4XG9A 1Q3DA 3V8SA 4JX7A 1KE8A 3WILA 3BYOA 2WAJA 3R02A 2QQ7A 4XG4A 3TDVA 3D2IA 1G8AA 2XUUA 4J99A 5TOZA 4EOOA 1V0OA 4ZTRA 2J4ZA