3RVGA

Crystals structure of jak2 with a 1-amino-5h-pyrido[4,3-b]indol-4-carboxamide inhibitor
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
292
structure length
285
Chain Sequence
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVSPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery of 1-amino-5H-pyrido[4,3-b]indol-4-carboxamide inhibitors of Janus kinase 2 (JAK2) for the treatment of myeloproliferative disorders.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 88
structure length 285
sequence length 292
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rvgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3rvgA01
5I3OA 5I5ZA 5HE1A 4O22A 2UW5A 2OU7A 1CKPA 4H1JA 4X3FC 5KE0A 2QLQA 2XKFA 3TZ7A 4EBVA 5AAGA 2PZRA 3W2CA 3MH3A 3BIZA 2OG8A 5EKOA 4BCNA 2HZIA 3FMJA 4F9AA 1YDSE 2E2BA 4H1MA 4JI9A 2VO6A 1XHAA 2E9VA 1Q8YA 5ETFA 4FKWA 4DEIA 4FV0A 5LWNA 3GNIB 2WTWA 2PUUA 3HV6A 4DFUA 2W1IA 1YXVA 3CQUA 4PWNA 4YUQA 3BHUA 3FZ1A 3HV3A 5HNGA 3L8XA 5AV2A 2WIHA 3BHTA 5DFPA 5EQPA 2QKWB 4M69B 4X2FA 5HTBA 1ZAOA 3QD2B 3QA8A 2UVYA 3R02A 4R3RA 1QL6A 4UMQA 2QO7A 2J51A 3EFKA 4M68A 3NUUA 4JAIA 5HO8A 5IKWA 4Q5HA 5IA2A 3TJDA 2I7QA 1W98A 3Q2JA 5FEEA 5JEBA 3AC1A 5J7HA 2XKCA 3ACKA 3JY9A 3Q4UA 3R8LA 5EG3A 4DFNA 5J1WA 2Z60A 3EQCA 3F5PA 3G0FA 2YWVA 4EOMA 2EB2A 3EQBA 5IA1A 3R1SA 3C7QA 3BE9A 3V5PA 3ZRMA 4E6AA 4DGMA 1JVPP 1Q8TA 3MY5A 5CU6A 4U45A 3D83A 2HELA 3Q4TA 4FIHA 3Q6UA 1ZYLA 3DDPA 3WOWA 4E26A 2C4GA 4MXAA 4N4SA 3WIKA 3LPBA 3EFLA 4NSTA 5FBOA 2BIYA 1O6LA 3ZS5A 5EW3A 4WNMA 2ZM4A 2OBJA 5J5SA 2WQEA 4RX7A 5FUTA 5ANJA 3V5WA 4L52A 4EWHA 3HZTA 3EMGA 1GZKA 1TKIA 1L3RE 3D2IA 3NNVA 4NM3A 4AZWA 4BWXA 4YHFA 4ZSJA 4RIYA 2ZV2A 2QNJA 3B8QA 4G2FA 4IVDA 4C36A 2BRGA 5C27A 4IW0A 2W1HA 3MFRA 4IAIA 2XIXA 1HOWA 1TVOA 3PJ3A 3SXSA 4PX6A 3WILA 2OIQA 3QUEA 5M57A 2BCJA 5M09A 2XIZA 2ITPA 3DZOA 3QCQA 3HRFA 3NRMA 3HVCA 4HGLA 2PPQA 3SGCA 5IEYA 4CSVA 3DLZA 3HNGA 4Z7GA 2B55A 3A99A 5AMNA 4RLLA 1GOLA 3AC2A 5C01A 1NVRA 1OL6A 2JAMA 3KVXA 4YJRA 5DG5A 3VBTA 4ARKA 3H9OA 3HV7A 3FI4A 1YHVA 4CZUA 5K0XA 3QTXA 3E62A 1NY3A 1JSUA 2XUUA 2FSOX 3GI3A 3OT8A 4OTGA 4Y73A 2R3FA 2YM8A 4IVCA 2J90A 3ELJA 4O2ZA 5EH0A 5ETAA 2Z02A 2E9PA 2QOHA 2P55A 4AE6A 4L43A 4QPSA 1PYEA 2XBAA 3VF9A 1OL1A 3JR1A 2HZ0A 4RQKA 5EM7A 4FMQA 1ZYJA 4O7RA 5AR7A 3Q9WA 2ITYA 5EYKA 2X6EA 5I9VA 5KCVA 2DWBA 2OJJA 5EHYA 1PF8A 2NRYA 3DJ7A 4JDJA 2V22A 4F7LA 2UVZA 2I0YA 3KCKA 1RDQE 2I1MA 1KSWA 2F2CB 5LVLA 3LHJA 4KIKA 5BUJA 4JDIA 2W1CA 4FIFA 3ALOA 2Y8OA 2O63A 1R78A 4QMUA 4U80A 4QYFA 1FOTA 4DTBA 5D12A 3LFBA 1Q8UA 1WVYA 2EU9A 3FV8A 3S2PA 4BGHA 4YTHA 4L42A 3UE4A 3FXWA 2XM9A 3FDNA 3RPRA 3KFAA 1K9AA 3R1QA 3VS3A 3C50A 1VJYA 2QONA 2XRWA 2J50A 3A61A 3A4PA 4NFMA 1W7HA 4GYIA 3TACA 2B9JA 3R7GA 5AX3A 4DFBA 3OUKA 3BQRA 3COHA 4M14A 3TDWA 3FLYA 4IMYA 4CRSA 4C7TA 4L45A 3V01A 2CMWA 4QNYA 4KBAA 5EI6A 2R9SA 2YWPA 4RX8A 4CG8A 1LP4A 3W2QA 3A7JA 4K33A 3OG7A 2RFDA 3DBEA 3ORLA 4MX9A 4C4HA 5L8KA 3FAAA 3UNKA 4J96A 1P4FA 3MY0A 1GJOA 4FZ7A 4AW0A 4PMMA 4AW5A 3Q96A 4A4OA 1VYWA 3EB0A 5CX9A 1ZOEA 3C9WA 4YC3A 3CKXA 2X8IA 5AV1A 2BZJA 2DS1A 3BYVA 2OLCA 3QGWA 4O81A 3FMLA 3BV2A 1OUYA 3NEWA 4G34A 3VQHA 4IM3A 3QHWA 1V0BA 3WIGA 3ZRKA 3NCZA 3KB7A 4GJ3A 4ASZA 4ACMA 3DNEA 4TN6A 4F0GA 1XQZA 5A4LA 3CTHA 3SDJA 5CZHA 3GOPA 1Y91A 2PMNX 3MTFA 3FEGA 5LJJA 2YCFA 3V51A 1DM2A 1YOLA 4C3PA 4YR8A 3QX2A 1MRUA 3ET7A 3K5VA 3IW4A 5DWRA 3AT2A 3DBFA 2HXLA 3QQUA 4LI5A 4BYIA 2C6LA 4KINA 3AMYA 4U43A 3CQEA 4LGDA 2Z7LA 3QTWA 2BRNA 3BELA 2OJFE 3ZUVA 3CCNA 1SZMA 4FT5A 1TQIA 4WIHA 3C4ZA 3F82A 3SV0A 4FIGA 2PZIA 4YTIA 3QZIA 5AR8A 4WNOA 3UC3A 4BCKA 4ZY6A 4GUBA 3COMA 2CN8A 5HIDA 4FKPA 4KS8A 4XV3A 4O96A 4J95A 4PNIA 5L2IA 4C4IA 4DE4A 4EOJA 4I24A 4D55A 4A07A 2AC5A 3R9OA 3MH0A 4FV9A 4NZWB 4OGRA 2VTAA 2YM6A 1A9UA 2F57A 1DS5A 3LE6A 2R0IA 3TV7A 1XH5A 3PUPA 2QO9A 3O23A 3UZTA 1OPKA 3POZA 5HLNA 5HU3A 1G5SA 2VX0A 5T68A 2CCHA 2XRUA 3DK3A 3NZ0A 3PVWA 4BCGA 1SNXA 4V04A 4C02A 2P4IA 1NT2A 5DI1A 2ITOA 4IHPA 3U87A 1Y8YA 2CLQA 4FV8A 4GT3A 3MPAA 2XIKA 3C4XA 4AFEA 3Q4ZA 4CYIA 2OGVA 3FSFA 1UKHA 4XUFA 4CV9A 1IAHA 4IZYA 4IADA 4GKHA 2J0JA 3HUBA 4XJ0A 4O82A 4CYJA 5BVDA 1JAMA 2C5XA 3UGCA 4J97A 1H0VA 3T9IA 4O0VA 3QLFA 5CASA 3OCTA 3FMMA 4RJ7A 4O21A 4P4CA 1LPUA 4MD8E 4RIWA 3ZCLA 3NPCA 4B99A 1MP8A 2X8EA 3E7VA 3HECA 3PIXA 4KAOA 4NT4A 1WMKA 5GINE 3SRVA 4RX5A 4O0UA 4QPMA 4TT7A 3S0OA 1PXLA 3CR0A 3W8QA 1V0PA 2JFMA 2O5KA 4BCPA 2YACA 4WA9A 2OWBA 5DT3A 4X21A 5DH3A 4CCUA 1FMKA 4TW9A 2YM7A 2OJIA 3K5UA 4H3BA 3O0GA 3UVQA 4FT0A 3M2WA 3R7OA 3LFDA 3TZMA 3BGQA 4E6CA 5JGAA 4ASXA 4QYHA 4CMUA 3FXXA 3JUHA 4NCTA 3UIBA 4CFNA 3VUGA 2BROA 4QMZA 2CN5A 3EYHA 4RZWA 3BV3A 2X1NA 3C13A 3N4VA 5CALA 3P4KA 4TYGA 4D1SA 3EZRA 2J4ZA 1JBPE 4YNEA 3NMUF 4GJ2A 3ZLYA 4F7JA 2BDWA 4GKIA 3TJCA 4IZAA 4YTFA 2Z2WA 4ANMA 1APME 2XKEA 3F2RA 3ZBFA 2VTLA 3OCGA 4BCOA 4ZIMA 4L9IA 2QVSE 4IVAA 4F6WA 3GQLA 1W82A 4XG3A 3RAKA 4EK8A 3VS7A 3ZZEA 3AC8A 4IDTA 3IOKA 4EH4A 5LMBA 3BE2A 4EK4A 2VTRA 3GEQA 1K3AA 2PL0A 5J7BA 5BYLA 4HW7A 1FGIA 1FGKA 3C4CA 4IBMA 4O0XA 4YZMA 3PA5A 5HGIA 4BC6A 4BI0A 2UZVA 4DH1A 1M2PA 4DINA 4WHZA 4F65A 2J0KA 2X7GA 5AA9A 1SVEA 2W1EA 3PJ2A 4PMPA 4YTCA 3NSZA 2QC6A 4H36A 3LM0A 4Q5EA 4I5MA 4LRMA 3PWYA 2WQOA 3MA6A 4EYMA 3FLZA 4IB1A 4AT3A 3DDQA 4IX3A 2C1AA 3GOKA 3PA4A 4KBCA 5AUZA 3NNWA 5BVOA 3E63A 3KCFA 2CGXA 4HNFA 3TTIA 4ZJJA 4PMSA 2C0IA 5TKDA 3FL5A 2VTNA 5HNBA 3QC9A 2JKQA 4GG7A 3GU8A 2ZYBA 3I7BA 3IGOA 2RGPA 3SG8A 1OKYA 3QYWA 1OKZA 1K2PA 4BVUA 3N4UA 2CGWA 5CVFA 3A7IA 3ZO4A 4O83A 4FKSA 4FSWA 2B7AA 3O50A 2IVSA 4FG9A 5CZIA 2VTTA 2RG6A 5AR2A 5CF6A 5CSVA 2C3IB 2YM5A 5CQWA 3C1XA 3E7OA 2HIWA 4CFWA 3MPTA 3NYNA 3RK7A 5A9UA 3SW4A 4R78A 2GSFA 3G33A 4X6RA 2UW9A 3E87A 3LQ8A 4XCUA 3OP5A 4YMJA 2QQ7A 5EOBA 4L44A 5ANIA 4V05A 4D9TA 4F9YA 4E6DA 3VF8A 3RI1A 4X2GA 4G16A 1H07A 3NIZA 2EWAA 3ZDUA 3BYSA 2WIPA 4U42A 2YIXA 3VS1A 4XOYA 3AMAA 5CT0A 3RZFA 3D7ZA 3NIEA 4V0GA 4DEGA 1JLUE 3EJ1A 4F1MA 2YEXA 5FBNC 3QQFA 5G1XA 4EKLA 1WBWA 4PRJA 2CKOA 2J6MA 2IO6A 4BTJA 3VUHA 3NR9A 2YLFA 3HAVA 4ZSAA 4RPVA 4C2VA 5KO1A 3KXHA 3RMFA 2J0MB 4Y5QA 5IUIA 4BI1A 2XCHA 2ZV7A 4DG2E 4FTKA 2QR7A 5J9ZA 5CEMA 5AV0A 4D58A 2I0VA 4USFA 3UQFA 1JOWB 3PZHA 5FXRA 4GFMA 4BN1A 4EYJA 3QRKA 3TUDA 4UWBA 5E8ZA 5E91A 2WQBA 2QR8A 3TDVA 4RQVA 1KUTA 2G9XA 1T46A 2EB3A 3LCDA 2GMXA 1FVVA 4EOPA 2YCQA 5AP0A 3DA6A 3SX9A 4QRCA 5LVMA 4K18A 5F94A 3IW8A 3QZFA 3DOGA 4HNIA 4BY9E 5D7AA 2KULA 5KKRC 5B2LA 5AP1A 3FSKA 2VTOA 3KGAA 1E1VA 2YITA 1H1RA 4EH9A 4EUUA 4F0FA 2QHNA 4IWPA 1YI3A 5HBHA 3CD3A 3F6XA 2BILB 2V55A 5DEWA 4EK6A 4IAYA 4LQMA 2V0DA 3LM5A 5GHVA 3E8EA 3FY2A 3FQSA 3LJ2A 3I4BA 5HQ0A 1VR2A 5D9HA 5HHWA 5EDRA 1PY5A 1YHWA 4S31A 5JN2A 2OZAB 5CEIA 4AA5A 2VX3A 3CPBA 3EFWA 4AWIA 5D10A 3U9NA 4I22A 4W8DA 2Y6OA 4IE9A 5KHWA 1MRYA 2UZWE 2J0LA 5IUGA 4MXOA 2PSQA 2YERA 4A4XA 4CFMA 2X0GA 4ZTNA 5HX6A 2HENA 3F2NA 2XNOA 2XCKA 5CF4A 4OLIA 4EHZA 4FV6A 4NW5A 4FEXA 4ITJA 2X9EA 3PPJA 5D11A 4GV1A 3OXTA 1Q4LA 3AMBA 3AGLA 5G6VA 3HEGA 4DH3A 5KMNA 2X8DA 3Q2MA 1U54B 1W0XC 2C68A 2VNYA 2VWVA 3P0MA 4U5JA 3UIUA 4XEYA 2ONLC 2QLUA 5HBJA 3R71A 3P7AA 5M44A 3EN5A 4MNEB 3ULZA 5IA3A 4Y5HA 4QMNA 2O8YA 5EM5A 1MRVA 3OT3A 4GVAA 2R3PA 2GNIA 2YIRA 5CI7A 3DT1A 5H2UA 2XS0A 3KEXA 3OFMA 4AG8A 4BZNA 3CPCA 3LKMA 3HMOA 4HZRA 3UTOA 5HO7A 3LVPA 2VWWA 1O6KA 3MH2A 4EZ7A 3D15A 4FTOA 4AQCA 4DN5A 5AUWA 3ZEPA 4RJ8A 4C38A 2HK5A 3F3UA 3UOHA 5CSXA 2Y0AA 4FYOA 4MYGA 2G1TA 3ZTXA 4EZ3A 3LQ3A 3MSSA 4ASDA 5EDQA 1PHKA 1JKLA 2FB8A 3PJ8A 1P2AA 5BVWA 3E3PA 5KMIA 3LMHA 2YLEA 4L7SA 3HUCA 2HW6A 2X9FA 4JQEA 3GGFA 4AGWA 3FZTA 4RIXB 4TL0A 2R5TA 4ZY5A 2XYUA 3F88A 3F5GA 4U3YA 3D7TB 4G9CA 1OECA 4A9TA 4AA4A 2FVDA 3PY1A 4YJQA 3LLTA 1CTPE 5IISA 5KUPA 5BPYA 3LJ0A 3ACJA 5LARA 5DYJA 3Q6WA 2B9HA 2QHMA 4MF0A 1OITA 4BHNA 3R2BA 3W16A 1OMWA 2BMCA 4I6BA 5A6OA 4BTMA 4KIPA 5A4CA 2VTPA 4C62A 2OF4A 2F49A 1PXIA 5CXZA 3HMMA 3OS3A 4M3QA 3ZMMA 2PMOX 3R73A 2C6KA 2VGOA 4NM0A 3GU4A 4J52A 4YO6A 4GU9A 4OTIA 2X4ZA 3GFWA 5EOLA 3MIYA 2R3KA 3HA8A 4JBVA 2W99B 4UB7A 5TT7A 3PFQA 3CTQA 1PXMA 3LJ1A 2WMSA 5E90A 3HA6A 3VJNA 3QKMA 5C8KA 2WMVA 3DXQA 4IWQA 5DOSA 2PVLA 4LMNA 4BKJA 3GP0A 2IZUA 2I0EA 4QP8A 1ZYDA 3B8RA 3ORPA 2NNWB 1DAYA 4FVRA 4D2VA 4JG7A 2C6TA 2V62A 2Z7RA 4XG6A 1ZLTA 2JD5A 2O2UA 2WZJA 3NW7A 4FG8A 4JX3A 5HCYA 3OZ6A 3UNJA 3V8SA 4C4GA 3JVRA 3P23A 4GK3A 3NUYA 2C5NA 3TTJA 4GEOA 4ANSA 2IWIA 4XG4A 4V01A 1U5RA 3QD3A 4XRLA 4CZYB 3PG3A 3FC1X 4NFNA 4FKLA 5EM8A 3FI2A 4M69A 4M8TA 4EQCA 4MVFA 4PDYA 4CTCA 4JRNA 3IDBA 2JIIA 5HIBA 3RWPA 4JT3A 3V8TA 4FC0A 3C5IA 2AUHA 2FSMX 3EN7A 4J8NA 3CP9A 4OT6A 5AUYA 3ENMA 3EWHA 4WRGA 3UMWA 5C4KA 5CU2A 4PL5A 5I9UA 3SXRA 3Q9YA 3QTZA 2Z8CA 2YJSA 4FG7A 4FZFB 4IJ9A 4N6ZA 5AWMA 2VO0A 2XM8A 5CQUA 3NNXA 2WMXA 3AC3A 3QHRA 4I93A 4XG7A 4A9SA 4BIBA 4C33A 5E1SA 4EK5A 4I6FA 4AFJA 4BGGA 4DEHA 3DV3A 4PV0A 4EH3A 4EJ7A 5C9CA 3PXZA 4F08A 3ZLXA 3R6XA 3NUNA 5E8YA 2IVVA 4CTBA 3BX5A 2WOUA 4H3PA 3RPYA 2XK9A 1KOBA 3UPXA 4EH2A 5DIAA 5FXSA 3ULIA 1S9JA 2RIOA 2VN9A 3CS9A 2ZM3A 4XG9A 3FMNA 3LFEA 1Z5MA 4BHZA 2YISA 4Y83A 3VS2A 5DPVA 5AAEA 3V5QA 4KB8A 4HZSA 1YDRE 1VYZA 5T3QA 3FKLA 5TO8A 4PF4A 4FKIA 2W9FB 1IG1A 3UQCA 4RVMA 3QGYA 2E9UA 2JKKA 2OIDA 2R2PA 3A2CA 3O8UA 4DH8A 2W1FA 5H8GA 4IWDA 4FIIA 4QMLA 1XKKA 3ORXA 3R00A 2OIBA 3Q52A 4MKCA 5FM3A 2PUPA 2JLDA 1PW2A 1U4DA 3SXFA 3F69A 3IONA 3IOPA 4AS0A 3EQDA 5K5XA 3K3JA 3ZYAA 4R5SA 1IRKA 4GIIA 4WNKA 3R9DA 3MVHA 2I6LA 3Q3BA 4M0YA 2ITXA 3WF5A 4BDBA 2XVDA 5JH6A 4RIOA 2VV9A 2Q83A 1PKGA 4M66A 4W9WA 5M07A 2JDOA 5FG8A 2Y4IB 3PWDA 4R1VA 5TF9A 1BMKA 4IB5A 1QMZA 2ETKA 4IC7A 3RAIA 2R3QA 2UZTA 3EQRA 2JDVA 4WSYA 1M14A 4K11A 4NTTA 5M56A 2UW3A 1ZOHA 1I09A 2WELA 3PDTA 4DT9A 5IQFA 1PXNA 3R21A 5H8BA 3VS4A 3UO4A 3UBDA 5HX8A 1XH6A 3ZM9A 1WBSA 2HCKA 4FZ6A 2CJMA 3RM6A 2YA9A 2W1GA 3RNYA 4GW8A 3GC8A 3E64A 3MESA 3VHEA 1IR3A 2XIYA 1UNGA 1ZOGA 3FE3A 5FGKA 2ESMA 3DAEA 3BWFA 3ORMA 2GNFA 4GK2A 3HYHA 4TXCA 3KXMA 5IQHA 2J2IB 4UEUA 2B53A 3UIMA 2FSTX 4EH5A 5CY3A 1B38A 4LL0A 2C3LA 2ZMDA 3BU3A 4FYNA 4DEEA 4YZBA 4XV1A 3IW7A 2CLXA 4ZEGA 3DNDA 3LFCA 3QRUA 3R1YA 4J98A 1R3CA 4QYGA 4D0WA 3WYYA 3QCSA 4ALWA 4NYEA 3ODYX 1KV2A 2FGIA 3RTPA 4FKQA 4ZP5A 4FSUA 2P0CA 3LFQA 4D5HA 1FMOE 3FYJX 3OTUA 4D4RA 2GDOA 1CDKA 4YLKA 3FC2A 5HICA 5CANA 4H05A 4ZS4A 2OXDA 3D5UA 2GNHA 4QP9A 4WUAA 3FZSA 3MA3A 4BDGA 3FZRA 3OVVA 3QAME 3QQKA 3ORIA 4YZCA 4O91A 3BI6A 4AZSA 4K6ZA 3DBDA 5IA5A 4EWQA 4IX6A 1YXSA 3SVVA 3LCTA 2BTSA 4FTQA 4YGAA 3WBLA 1KOAA 1IEPA 5J8IA 1MUOA 4KSPA 4I6QA 5HG8A 4AZFA 4BDFA 2JIUA 2XMYA 3O96A 5I9YA 4OUCA 4RC2A 2G2HA 3HLLA 4W4XA 2WMAA 4TWNA 4RWJA 3V3VA 3D4QA 3ZFXA 1PRYA 1NA7A 4DF3A 4RFMA 5JGDA 2PHKA 3RNIA 4FKRA 5DMZA 1UA2A 2C6DA 2XJ2A 3KRLA 4NWMA 5CXHA 3R1NA 2O3PA 1P4OA 2R7IA 3BLQA 2ETRA 5A3XA 4B8LA 4RWKA 4KWPA 1TQMA 1ATPE 5CU3A 4YBKA 2UZDA 5BX0A 4IXPA 4PP7A 3U6JA 4DGOA 5BUEA 3QUDA 4WD5A 5CEPA 4KA3A 4U40A 4CQEA 3EN6A 2BKKA 3G9LX 3UP7A 3MN3A 4RG0A 2X81A 1SM2A 4UMUA 4OAVB 4APPA 2A27A 3KVWA 3OHTA 3CXWA 4K2RA 1EH4A 1JSVA 4GSBA 5DEYA 3QA0A 3UODA 4AGDA 2PMIA 5C8NA 2R64A 3DU8A 2XNEA 4NM7A 3R04A 1ERKA 3RP9A 4OTDA 1Q41A 3HRBA 5BMMA 1H26A 4P5QA 3O17A 1YWNA 5AV3A 3CE3A 1BL7A 2JKMA 2WD1A 4OTQA 3ANQA 2CGVA 3PE1A 1OL7A 2YIYA 1FBNA 4I23A 4D4SA 5J79A 5IEXA 4OTRA 4K0YA 3FPMA 4USEA 3TV6A 3BGZA 3MB7A 3BLRA 3D9VA 1V0OA 2C5YA 4K8AA 2CHLA 2CSNA 2PZYA 3OBGA 4HGEA 4H39A 4XP2A 4A9RA 4FZDB 3UOJA 4IDVA 2XEZA 4KNBA 1KE6A 4MF1A 4EORA 4OTFA 1FPUA 2XK8A 5E8VA 1KE9A 1PXJA 2VWBA 3DKCA 4ZXTA 4CFFA 1H08A 4KRDA 4R6VA 1Y8GA 4G3CA 3FPQA 3VBQA 2WMQA 3R28A 4DCAA 4QTAA 3H0YA 4MEDA 2W5HA 4E73A 4WUNA 3U54A 4S34A 3UOKA 4UWYA 4YSJA 4G6NA 4FE2A 1KE8A 1PMNA 4ANLA 2B0QA 3OMVA 5I9XA 4NH1A 3UQGA 4X3FB 3HGKA 4L67A 3KA0A 3HX4A 3TNHA 3BCEA 1UU7A 5IEVA 3EQIA 3EL7A 4C61A 1R1WA 4BDAA 5FDPA 2QCSA 4HCVA 5AUUA 4QNAA 4DA5A 2WU7A 3HMPA 4MD7E 1Q8WA 5CSWA 3F3WA 2V7OA 4S32A 2OI4X 4OW8A 4IEBA 4RGJA 1Y6AA 1MQ4A 5HE3A 5BVKA 2IW9A 5DE2A 2DYLA 5IA0A 1GY3A 3UYSA 4R3PA 3W1FA 2WPAA 4QTDA 3EYGA 3E8DA 3UO6A 1BL6A 3TKIA 2WMWA 3CGFA 1UU8A 4O0RA 5FDXA 3DJ5A 4IZ7A 2WB8A 3CBLA 3ODZX 3S95A 4FGRA 1Q62A 2C30A 3I6UA 4MNFA 2HY81 5DLSA 5DT0A 3C5UA 4RVLA 3V6RA 3FLNC 5EM6A 2VO7A 3T9TA 3KU2A 4F99A 1ZRZA 4I1ZA 3SAYA 5BMSA 3O7LB 3TV4A 4JBOA 3R8MA 3V5TA 4BYJA 3I60A 1J3HA 4WG4A 5EYDA 3PJCA 5A46A 4LMUA 2ZOQA 2VAGA 5J9YA 2FA2A 4QP3A 2ITWA 4H3QA 2P2IA 3N4TA 4JOAA 1IA8A 4PY1A 4YP8A 5J5TA 2JDRA 5ANOA 1OPLA 2H34A 5AEPA 1Q99A 4I92A 5HE2A 3TXOA 1M52A 4EK3A 4FTMA 2YM4A 3R7YA 2PYWA 3Q5ZA 4AE9A 2OKRA 4L3LA 4TWCA 5AADA 4QP1A 4WG5A 3MTLA 3UIXA 3U8WA 3L9LA 5DRBA 2C0TA 3IW5A 4FSTA 2AC3A 3U6IA 4X0MA 4MXYA 4O27B 1UNHA 3VVHA 2J0IA 2YIWA 4EL9A 3SD0A 1H25A 1UWHA 2UW0A 5DA3A 4B0GA 3PPZA 1QPCA 3QCXA 3WZUA 3NLBA 3ZSHA 4IVBA 2GNGA 3GENA 3AOXA 5AP4A 2GQSA 1BUHA 5CI6A 3NAYA 4S30A 3MFTA 5HTCA 1U46A 4YJTA 4NCTC 1WAKA 4OBQA 2G2IA 4BZOA 5IQDA 4FIEA 4Z3VA 5C26A 1V1KA 4O7YA 4F1OA 3OWPA 4NM5A 5CU4A 4QP4A 4ITIA 3PRFA 2YFXA 3P79A 4F9BA 2WTIA 3ZXTA 4ZSGA 4HVDA 4LL5A 4RC3A 2R3HA 4FKOA 2O65A 3JVSA 4W4WA 4YZNA 3EN9A 3FWQA 5JKGA 4FOBA 5M55A 4ORKA 4YU2A 3LFSA 3PLSA 4XRJA 3QUPA 2XA4A 4KSQA 4RMZA 5IDPA 3P7BA 3KXGA 5L8JA 4HYIA 1RW8A 4CRLA 3PXRA 4R7HA 1H0WA 5E8WA 3VN9A 3OWJA 4I4EA 3VS5A 4DH5A 2CGUA 4N57A 4L3JA 2IPXA 3G15A 4LOPA 3GXLA 5HLPA 2JAVA 5CU0A 3NYXA 4AT5A 2WTJA 2E9NA 5H3QA 1H1QA 3DTWA 4I5HA 4WSQA 1LUFA 2C5OA 4FI1A 1YI4A 3ZZWA 4ZY4A 4R8QA 4QYEA 4B4LA 2GHGA 4LV8A 3DKFA 4YPSA 3EOCA 4DEDA 4FA2A 4O7SA 1J7IA 5HVYA 2XZSA 3QXPA 5DT4A 2LAVA 3TL8A 5CVHA 4EOIA 3VUKA 1H27A 2VTMA 2EUFB 2Z7QA 3QRJA 5HCZA 2VTSA 3RPVA 1M17A 3ZONA 3V5LA 3KREA 5JZNA 3L9MA 4J1RA 3W10A 4BB4A 2A2AA 2EXMA 3L8SA 4FTRA 4QMYA 4WRSA 2GFSA 4DITA 4ZSEA 5LQFA 1YOMA 4CFXA 3FI3A 3NUAA 3TN8A 4AZTA 3QLGA 3RWQA 2CNVA 3C0HA 4F63A 4F70A 4MWIA 3W2PA 3T3VA 5IF1A 1BX6A 1OKWA 2B9FA 4IM2A 4QT1A 1E9HA 4KIQA 3WZKA 5IQCA 5LVOA 3KY2A 4QMVA 5BYYA 5GIOE 4CGAA 2UZOA 2W9ZB 3IQ7A 4G9RA 3GCSA 1CSNA 3AD4A 3ETAA 4HPUE 4AN9A 3JXWA 5KMKA 2WO6A 1QPDA 2UW6A 3SLSA 3EQGA 3LCKA 4U7ZA 5CSHA 1UVRA 3ANRA 3ZM4A 3DK7A 4I0TA 5LXMA 4FV1A 3AD6A 5FTGA 3A8WA 4NU1A 3QU0A 3CQWA 4FEQA 3FXZA 3KKVA 2ITUA 4YPDA 3UG2A 3NVMB 1NVSA 3SC1A 2WFYA 2OZAA 4FTJA 4JVGA 3F7ZA 3NYVA 2UW7A 4F6SA 3MV5A 2VGPA 1AGWA 4YLJA 5DRDA 3P7CA 5AA8A 4BF2A 2QOQA 3F9NA 4JQ8A 3CJGA 3EN4A 2I0HA 4PPBA 4JJRA 1CMKE 1FINA 2XNNA 4BBEA 3ID6C 3D5WA 2OSCA 3LQ5A 4JS8A 4X2NA 4X2KA 5ANGA 4B6LA 2JBPA 2XJ0A 2XEYA 5ETCA 5CAVA 1GZOA 1JKTA 2OH0E 3I0OA 4JL9A 1LEWA 2NO3A 4ERWA 4QMTA 3G6GA 3UC4A 1UV5A 3UP2A 4ACCA 3TKUA 4CV8A 4JBPA 3H4JA 4O7NA 2W1DA 4XHKB 4MNEA 2PVHA 2PVNA 3QBNA 4HVGA 4NKAA 2V5QA 5CLPA 3DKGA 4EH7A 1ZYCA 4DTKA 3VBXA 3BRBA 1REJA 2G15A 3ZUTA 2OW3A 4O7VA 1QPJA 1H4LA 3AT4A 4NL0A 4BTKA 2AYPA 2PE0A 3IDPA 1Q3DA 4IFCA 3REPA 4AA0A 4F9CA 3DCVA 3LZBA 3DFAA 1OZ1A 2R3OA 3R30A 4MK0A 2R3JA 3SRVB 4MBJA 3CTJA 5HKMA 4RFYA 1REKA 4MXCA 4G17A 3WZJA 4BCQA 4RZVA 2XIRA 2OF2A 3O2MA 4ZZMA 4AGUA 5JT2A 2LGCA 4QTCA 3VUIA 4JDHA 4ZSLA 1PKDA 1GNGA 2WMTA 3RALA 3VWAA 3Q5IA 3VNTA 4BDKA 4U6RA 5GIPE 5JMSA 4YLLA 2R3NA 1W84A 3C0IA 2XK6A 3UZPA 5GJGA 2WMRA 4BDJA 4ZLOA 4RIXA 4FTNA 4ONAA 2V7AA 5HD7A 4BDEA 5CTPA 4HVSA 3AD5A 3PSDA 5L4QA 4DHFA 4MHAA 3D7TA 5A54A 2VWZA 3PY0A 3WF9A 4QMOA 4DLJA 1HCLA 4PTGA 2A19B 4TNDA 4EONA 4HVIA 4XYFA 2OFUA 3QKLA 4KKEA 4L6QA 4L01A 1KV1A 5ANDA 4D2SA 3UG1A 2X7FA 4FV4A 4CLJA 5JGBA 1IA9A 3DBQA 2GPHA 5HIEA 1CKJA 3OROA 4RVTA 3PSCA 2C3KA 3DFCB 3PXFA 1ZMWA 4R5YA 5EFQA 4UMRA 3BZ3A 3PA3A 1YKRA 4IC8A 2WTKC 2PUIA 4U9AA 5M06A 3FJQE 1Z57A 5GNKA 4IJPA 3KXZA 4C4EA 5E8XA 1OI9A 2GHLA 3I0QA 4PQNA 2CKQA 4ZLZA 3BKBA 3G5DA 5FWKK 3K3IA 3FKOA 3GU7A 4QMQA 3S1HA 3NCGA 2GFCA 2GS7A 4I3ZA 3ZC6A 4ASEA 4O7ZA 3HV5A 3MJ1A 3PXKA 4GT5A 4MD9E 3UDBA 4AW1A 4E4MA 5HU9A 5EW9A 1LR4A 1O6YA 3FLQA 5IUHA 2A4LA 4ZTMA 2RFNA 4PPCA 3U51A 4DFZE 3IGGA 5E92A 3A8XA 4UXLA 1URCA 4BCMA 3QTUA 5HNIX 2XYNA 1WVXA 4YC8A 5K4IA 1M2QA 4EKKA 3JY0A 3QALE 5DVRA 3GU5A 1GIHA 1M7NA 3A62A 3OOMA 4IX5A 3GQIA 4AGCA 3UZRA 3W33A 4N0SA 2C6IA 2JKOA 1AQ1A 4IQ6A 3THBA 4EOLA 5M4CA 4IWOA 4M0ZA 4HPTE 5E1EA 3LCOA 1J7LA 2VD5A 5CAQA 1YW2A 5E8TA 1T45A 3HP2A 2JGZA 3HDMA 3OUNB 2YCSA 4E1ZA 5IDNA 4EQMA 3VIDA 2ITQA 5IG1A 3NGAA 2B54A 3OW3A 3ATSA 5TR6A 4K77A 4ENYA 4BGQA 3ZH8A 4HOKA 2HWOA 3GBZA 4D2TA 2GNJA 5HBEA 5L2WA 2X39A 3PXYA 4BKZA 4F7SA 4KRCA 3L9PA 3QFVA 5CT7A 3MJ2A 3PG1A 4ANOA 4R7BA 4GL9A 1O9UA 2BIKB 3N9XA 3U4UA 3TNPC 2WOTA 4QP7A 4QPAA 3BHHA 5KMJA 3PIZA 4YC6A 5I4NA 5B2KA 3TNWA 3GU6A 5HO6A 4BIEA 3H9FA 2OXXA 4RJ6A 3R7VA 4G3EA 5GZ8A 3NUXA 4ZTQA 1BYGA 2BR1A 4TNBA 2CKPA 2X2LA 3HL7A 1KE5A 4FZAB 4B8MA 4O7LA 4YJOA 5K4JA 4DBXA 4FBXA 4TZRA 2SRCA 2VO3A 3QWJA 4DEBA 4GFGA 4ACDA 2OJ9A 5A4QA 3FZPA 1FVRA 2OK1A 2UZEA 4CT1A 2Y4IC 1YQJA 4II5A 4JNWA 3UMXA 5A4EA 3DY7A 5I3RA 5LVPA 2ZAZA 3KULB 4GG5A 4AACA 4PDPA 4B9DA 1TQPA 3AC4A 4DYMA 4LUDA 5BUIA 1SYKA 2EXCX 2VWXA 2IW8A 3E92A 4R1YA 3SA0A 3AC5A 4ANBA 1PXOA 1PJKA 4I5CA 4TWOA 3KRWA 4C2WA 3P9JA 4FX3A 5GZ9A 4J53A 3CKWA 5FD2A 3EHAA 4DTAA 4CEGA 1ND4A 1U5QA 5HTIA 1JSTA 5LMKA 2OJGA 4Y95A 2WAJA 3HKOA 3ORTA 3RBWA 3SOAA 2BFYA 3S4QA 4XBUA 3OEFX 5F95A 5K3YA 5F1ZA 2ZB1A 3C4WA 4O0WA 2YDJA 4FUYA 4DGGA 1FQ1B 1SNUA 3BPRA 2R3MA 3K2LA 3TZ8A 4J99A 5H9BA 3SG9A 4D1ZA 1Q61A 3QYZA 3DAKA 5DNRA 2VX1A 3LOKA 1STCE 3D2KA 4WT6A 1YOJA 4DFLA 4UZHA 4ANQA 3VULA 4AW2A 3OCSA 3QTRA 3N51A 1PXPA 3UVRA 4FTAA 2PTKA 4TYHB 5F20A 4ZLYA 5KKRB 2GHMA 3U9CA 2C3JA 3AG9A 3QCYA 4LGHA 1HCKA 4L53A 3VQUA 2W5BA 3ZC5A 3AQVA 3DXNA 4AN2A 1SVGA 3BBWA 3I79A 4IANA 3BU6A 3I5NA 4BDHA 4E5BA 3R9HA 4P5ZA 3OY3A 3W32A 4CD0A 1J7UA 2W4JA 3T8OA 1KE7A 4I4FA 4UMTA 4KKHA 5T6KA 3MB6A 4RVKA 4EZ5A 4AXAA 4IAFA 3E5AA 5KNJA 4FNXA 4D28A 5KX8A 4OTHA 3R8PA 4C8BA 3HDNA 4UY9A 3O51A 4TPTA 5M08A 3S00A 4MBIA 4JBQA 4UALA 4BWKA 4D0XA 3RCDA 2XH5A 4EBWA 4GT4A 1WVWA 3EKKA 4EOSA 4O0YA 4IX4A 4KUJA 3EIDA 2B1PA 1U59A 5ITAA 3OXIA 4FIJA 4F09A 4O86A 1JNKA 5D41A 2VZ6A 3FUPA 2H6DA 5IQGA 3H9RA 5GZAA 2R3LA 1P14A 5AP2A 3RHXA 3EQFA 5K5NA 4NUSA 2CNQA 3VS0A 4UMPA 1NVQA 3H0ZA 1IASA 3WZDA 4FNWA 3RKBA 3OC1A 2W0JA 2HY0A 1Q97A 4OBPA 5CNOA 4CMOA 4MAOA 3TUCA 3QQGA 3ZFYA 1GIJA 3LLAA 4C37A 4OTWA 3MYGA 4KBKA 3KL8A 4BTFA 2GQRA 4PMTA 5ICPA 2BVAA 5ACBC 2RG5A 3SQQA 4APCA 1OBDA 3QRTA 3GCUA 4JRVA 4ZTSA 4E5WA 4HCTA 5EKNA 5CAOA 4FSQA 5FTQA 4GS6A 4O7WA 1UWJA 4O1OA 2BTRA 4J8MA 4AOIA 5HORA 3OWLA 4FTTA 4CKRA 3T3UA 2HOGA 4EQUA 5DR2A 4CFVA 1A48A 3G6HA 4CLIA 5CVGA 3L1SA 4G5PA 3OEZA 4L3PA 4ZZOA 5IH4A 4BR3A 3ENHA 4MQ2A 5I9WA 5IU2A 2W5AA 1URWA 5FP5A 4USDA 2PVRA 3W18A 4I6HA 2CDZA 2XK3A 3JS2A 3LXPA 2W1ZA 3FI8A 1WZYA 3E8NA 3LCSA 1VZOA 1IAJA 5J95A 4RJ3A 5EYCA 4NW6A 3P78A 2H9VA 2BZIB 2OXYA 4N70A 4CCBA 3ZO1A 4BIDA 4YZDA 3LXNA 3UNZA 4L7FA 2J9MA 4HYHA 5HD4A 3QXOA 2QI8A 4WNPA 4ANNA 1XH9A 4BDIA 4GK4A 1JKSA 3BBTB 3HV4A 4F0IA 4XG8A 3PLAE 4BDCA 3FMDA 3IK3A 4ZTLA 3ZU7A 1H01A 4UZDA 3IG7A 4O6EA 4W4VA 4Q9ZA 4WBOA 4CFUA 1YXUA 1OUKA 4F1TA 3TNQB 2J7TA 3MGYA 5HE0A 4DGLC 4FICA 4LOQA 3ZXZA 4D4VA 1DAWA 4A06A 3QC4A 3E3BX 4RA4A 4S2ZA 1X8BA 2P2HA 3KN6A 2ZVAA 3RK5A 3IPHA 4IM0A 2ZM1A 4LRKA 3VAPA 2Y6MA 5GJFA 4X3JA 3WI6A 5BNJA 1PXKA 1JQHA 1P5EA 2REIA 3E8CA 1M2RA 2Y7JA 5DGZA 5CF8A 5L6WL 3LXKA 5CWZA 4OBOA 4TRLA 5IMEA 1S9IA 2BZKB 3V04A 3IW6A 2WGJA 3ZUUA 4PL3A 3NWWA 2F7ZE 4DFXE 4X3FA 2WQMA 4Q9SA 4QMXA 3OD6X 3RZBA 4ALUA 2PZPA 4JIAA 4C57A 3GCVA 4G31A 3Q32A 4HJOA 2C6MA 5J9LA 1PMUA 4RBLA 4U41A 4R77A 5EQYA 3NAXA 1OIQA 4PUZA 5E7RA 4P2KA 5GJDA 3O71A 4CMTA 4YURA 3ERKA 3R7IA 3LAUA 4D4YA 3MVJA 1H1PA 2HZNA 3MVMA 4E6QA 3OBJA 5CSPA 3WE8A 4ACHA 1H28A 2G01A 4FT7A 2WMUA 4OT5A 4C4FA 3FQHA 4CKIA 3OF0A 4RJ5A 2BRHA 4BDDA 3ZO3A 3KRRA 4A9UA 2YM3A 2IW6A 4ZK5A 2DUVA 2JBOA 4FTIA 3VS6A 4EC9A 4I41A 2YZLA 1UU9A 3CJFA 3IO7A 3S3IA 3TI1A 3ZBXA 4AAAA 3PVBA 4XLVA 4UX9A 3RK9A 3PVGA 4RA5A 4CXAA 4ACGA 2YHVA 4GUEA 3PP1A 4Y8DA 3I7CA 2KTYA 1GZ8A 2YABA 4HYUA 4Z55A 5JFWA 3DB6A 4F9WA 3IECA 5EDPA 2R4BA 2WMBA 3DS6A 3IKAA 4FR4A 4CZTA 3RAHA 2IZSA 3MW1A 3NW5A 4JXFA 4FGBA 3ZFMA 2UVXA 2WTVA 3GCPA 4DCEA 3ZOSA 4BWPA 2ZMCA 4NIFB 4ERKA 2WQNA 1G3NA 2WU6A 4RLKA 5E9EA 4EH8A 2Q0BA 4G3FA 2XBJA 3Q53A 5FRIA 2IVTA 2YAKA 5HZNA 1H1SA 3VBYA 3DZQA 3KXNA 5FQDC 4M97A 2QKRA 4EHGA 4FUXA 2QURA 4LYNA 2R7BA 2RFEA 4U81A 1WBVA 3A7GA 3CD8A 3LW0A 4RRVA 3B2WA 5ANEA 4PTCA 3KC3A 1XBAA 1XWSA 1WBNA 2ITNA 4LG4A 1XJDA 2IJMA 2W06A 3Q04A 3TUBA 4UBAA 4IIRA 4OAUC 5EYMA 2XNGA 4G5JA 4E5AX 5AV4A 3ZDIA 1KWPA 5LVNA 4R3CA 2BDFA 3ZHPC 2EXEA 4C58A 2YIQA 4U79A 3P5KA 5EHOA 4I20A 2WHBA 4FV5A 2OFVA 3EKNA 2HZ4A 3I6WA 4X6QC 5C8MA 3BWJA 2GS2A 3PYYA 3D14A 3ALNA 2JIVA 3FQEA 3KRXA 3MH1A 4YJVA 3OWKA 5DR9A 4LUEA 5IA4A 4NJDA 5TE0A 4QTEA 3V8WA 3VW8A 3GC0A 3VRYA 3W55A 5B2MA 4WO5A 5IMXA 4E8AA 5KBRA 2CCIA 5H8EA 4E3CA 1QPEA 4GIHA 3D94A 3RPSA 4QMSA 4CVAA 5LCKA 4FNYA 4EJNA 5F9EA 4L8MA 3F5UA 2XNPA 3KMUA 5EI8A 4HYSA 3NUSA 5EI2A 3MPMA 4O6LA 4IACA 3MBLA 1LEZA 3I1AA 3II5A 2GNLA 3ITZA 1I44A 4LRJA 3MWUA 4RIYB 4MXXA 1XBCA 3DQXA 1E1XA 5AR3A 4F64A 4UN0C 4NEUA 3F66A 2ITTA 4L00A 2QODA 3EZVA 4ENXA 3B2TA 2BUJA 2RKUA 4C3FA 3P08A 5AFVA 3PIYA 5IQIA 2ERZE 3FMEA 3AT3A 4WOVA 3QF9A 4XNEA 1MQBA 2PVKA 4KIOA 2QG5A 5K0KA 5J1VA 3DXPA 5JFSA 5L3AA 5KMLA 1OKVA 1M7QA 1ZMUA 4MCVA 4FL1A 5EHLA 1BLXA 1Z9XA 4FK3A 2X2KA 2IVUA 3QD4A 1F0QA 4FKJA 4X7QA 5KMMA 1ZYSA 1NW1A 2R3GA 5D1JA 4FEVA 4AOJA 4E20A 2BRBA 2XB7A 3HRCA 3KXXA 3QZGA 5M4IA 5M4UA 3RINA 2ERKA 3NX8A 5HEZA 4FTUA 4YHJA 3V6SA 5AR5A 4EEVA 3GVUA 5JRSA 4RSSA 4FTCA 3Q9ZA 4HGTA 1OL2A 2QOIA 2W96B 2Y9QA 2VTHA 3M42A 4BI2A 5CAUA 5L2SA 3ATTA 4CKJA 2BRMA 4EH6A 4BCJA 3R8ZA 2UZNA 4PTEA 4D2PA 4DG0E 2ZB0A 3NW6A 4K9YA 2W4KA 1AD5A 2ACXA 4FOCA 3FLSA 4XP0A 4IH8A 3VJOA 4O7TA 5JFXA 3R01A 4XX9A 5AIRA 4FKGA 4I0SA 2BFXA 4KIKB 3RPOA 3ZEWA 3TM0A 4C34A 3ORKA 4IB3A 1BKXA 1WBTA 2ITZA 5HVKA 3UJGA 3QD0A 3QL8A 4FSZA 3UOLA 2PE1A 5BVEA 4M84A 3A60A 5L8LA 3BU5A 4TY1A 4YJNA 2PVYA 2XF0A 3QRIA 4O0TA 1CM8A 5EK7A 3TEIA 3ZO2A 4MXZA 4FVPA 4W8EA 4FKTA 3DKOA 4Z7HA 3GCQA 4BFMA 3O8TA 3WZEA 5AR4A 4PDOA 2JDSA 3U55A 3GB2A 3RAWA 4G6LA 5B7VA 1Q5KA 3PVUA 1ZXEA 2WTCA 1XH8A 3R7EA 1F5QA 4I5PA 4DG3E 1XR1A 3OXZA 5DHJA 4AT4A 4BCFA 4HVHA 3HAMA 3QTQA 5HG5A 1WFCA 2A1AB 2HW7A 2A0CX 2R0UA 2PVJA 4FSNA 2GTMA 5D7VA 5LMAA 4LOOA 1XH4A 2HXQA 2C5VA 3KK8A 3DJ6A 3VUDA 2XK7A 2QG7A 3NNUA 2IG7A 1OIUA 2J5FA 3GT8A 1H00A 4FSMA 1G8SA 3PE2A 2P33A 4LFIA 2ZJWA 2W17A 4EOOA 2C47A 2WTDA 1ZZ2A 3OW4A 4GMYA 3MVLA 2PMLX 4D9UA 3LIJA 3ZLWA 2RFSA 3DGKA 1B39A 3FY0A 3R9NA 1JPAA 3COIA 1ZARA 2OH4A 3F3ZA 3FL4A 3MFSA 4JQ7A 4AZEA 5KBQA 3AGMA 1YXXA 5LWMA 2GCDA 2BAKA 3OY1A 3QQJA 2X2MA 2XNBA 4O38A 4EUTA 2YDIA 3KMWA 3SW7A 3AXWA 3PSBA 3SOCA 1YDTE 4UV0A 1SVHA 3RGFA 2FH9A 4QD6A 5ANKA 5HI2A 3CY3A 4ZTHA 3UYTA 2YZAA 4FV7A 1PMVA 3L9NA 5AM6A 2HYYA 5E8SA 4ZS0A 3PY3A 3ZRLA 5A6NA 1YXTA 4Y85A 2DQ7X 5KZ0A 5CENA 3TKHA 5JZJA 4WBBB 4JX7A 5AJQA 3FKNA 3PRIA 4TTHB 1YRPA 5FXQA 3GUBA 2BZHB 4O2PA 4BZDA 4XS2A 2E9OA 1BI8A 2QU6A 4FODA 3ROYA 2I40A 1YWRA 3CY2A 3GFEA 2X7OA 2QO2A 2XK4A 4PL4A 3DPKA 4JAJA 4DC2A 2C69A 3RHKA 2IZRA 3EH9A 3BHVA 5EW8A 2ZV9A 2ITVA 4QTBA 3TG1A 4PPAA 1OIYA 2FUMA 3QTIA 4I21A 5F4NA 4HCUA 3P1AA 3R22A 4BBFA 2P3GX 3QTSA 4M15A 4CT2A 3H30A 3G9NA 4GFOA 2IZTA 4NKSA 3Q9XA 3EQHA 3F7WA 2OO8X 5FEQA 3I5ZA 3Q60A 3NYOA 5HESA 2R3RA 3TNIA 3RCJA 4JIKA 5AAFA 4BICA 2NPQA 2O0UA 2UZUE 4E7WA 1RE8A 4UWCA 3PJ1A 3TT0A 4TYJA 1SMHA 3KQ7A 5L6PA 1U54A 5DN3A 4FKUA 3WARA 4CQGA 3QQHA 4E4XA 5JQ5A 4YNOA 3OTVA 2PVMA 4MWHA 3WF7A 4YSMA 3A7HA 4BCHA 4CNHA 3V5JA 3ZSGA 4QP6A 4G3GA 5ETIA 5LCJA 4QMMA 1B6CB 2G2FA 2C1BA 4ZAUA 3COKA 4RIWB 1YHSA 4IAZA 1UU3A 3BLHA 2UZLA 5B0XA 4IZ5A 4Z16A 5DBXA 1R0EA 3E88A 4ZJIA 3FHRA 3Q4CA 4GVJA 4E93A 4RWLA 4CG9A 1OPJA 3FMHA 4W9XA 1PMEA 3W8LA 1GAGA 2C0OA 3HMNA 4YO4A 3F3VA 3F2AA 2C6OA 3RM7A 3F5XA 1OGUA 3VHKA 4W4YA 4XG2A 5CEQA 3C4EA 4IAKA 4K1BA 4BKYA 3VO3A 1YWVA 4GRBA 3DLSA 4P7EA 3DBCA 3QQLA 3RJCA 4QYYA 2Y4PA 4RJ4A 2XKDA 4C3RA 3MFUA 4QQTA 2BAQA 4DBNA 4E4NA 1XO2B 4OTPA 3D0EA 4ID7A 5FTOA 3KULA 1Q24A 3DAJA 3R83A 4M13A 4YZ9A 3BEAA 5BVNA 1OB3A 1L8TA 4FEWA 4DH7A 3SHEA 3MY1A 1R39A 3CEKA 2UW8A 4AP7A 2XP2A 4FSRA 3H3CA 5CEOA 2PULA 3R2YA 2YDKA 2F7EE 3TIZA 4FT3A 4S33A 2BHHA 3PPKA 1J1CA 4PNKA 4X2JA 3D5XA 4FEUA 3CSVA 3WF8A 3CIKA 2RSVA 3SKCA 5CAPA 4AOTA 1G8AA 1DI8A 4FV2A 5E8UA 5C03A 2XJ1A 2RL5A 2W05A 4FL2A 4FVQA 4GH2A 5LOHA 4LV5A 4KD1A 4ZOGA 4DGNA 5CYIA 1UNLA 2VTIA 3U4WA 2R3IA 1A06A 3VBVA 2BHEA 3GC9A 5M4FA 3EFJA 4AF3A 2ETMA 5AP5A 4IB0A 5HG9A 3ORNA 5M51A 2W4OA 4A4LA 1YVJA 4G1WA 1XBBA 2PE2A 3GC7A 3LFAA 3LFFA 4DFYA 4ALVA 3MS9A 3EL8A 3K54A 4TYHA 4B7TA 3TWJA 4F6UA 3P86A 4PP9A 5FM2A 3L8PA 4YBJA 4AN3A 3QZHA 4FF8A 4XP3A 3ORZA 5BYZA 1FVTA 4ZMFA 4XH6A 4EC8A 4RWIA 3POOA 1R0PA 5HVJA 4U3ZA 2EVAA 4UYAA 5BVFA 2Q0NA 5M53A 4YJSA 4AU8A 4R7IA 4XBRA 4F7NA 3UVPA 3PP0A 1H24A 3KF7A 3MI9A 3F3TA 3FZOA 3NVKI 5C4LA 2GTNA 2W7XA 4TWPA 3F61A 4M12A 5A4TA 2B4SB 4KS7A 3LXLA 3LMIA 3VW6A 1OIRA 2BKZA 4RX9A 3BYMA 3NUPA 5IZFA 1ZY5A 5AM7A 2PK9A 2F2UA 2VU3A 2YN8A 3JYAA 3R0TA 2QOBA 2VRXA 3A7FA 1Y6BA 5FLFA 4EOKA 5L2TA 4V0GB 4HGSA 3KRJA 1ZMVA 1PYXA 4IFGA 3DK6A 2CKEA 2QD9A 4LGGA 4MBLA 4QP2A 4RC4A 4RFZA 5J87A 3ZSIA 4TKSA 4DEAA 1JKKA 4WG3A 4TYEA 1OBGA 4ZJVA 5I9ZA 4UXQA 3C4FA 3TZ9A 4L68A 1OVEA 4EI4A 4C4JA 4BRXA 5CEKA 5TOZA 5LMKC 4FKVA 3UO5A 5IQEA 3IDCA 5C1QB 3G0EA 3MDYA 4H58A 4Y72A 3HP5A 4OR5A 5A14A 4TYIA 2ONLA 4G6OA 5AP3A 3QX4A 5IH6A 2VTQA 5IPJA 3E93A 1W83A 3I81A 3JPVA 4J71A 3W2RA 2BDJA 2B52A 2OICA 4U8ZA 5HLWA 3QWKA 4JG6A 4QMPA 5KHXA 2BAJA 2QOOA 2PVFA 4YJUA 4BCIA 2GS6A 5KMOA 1F3MC 1H8FA 3FMKA 2F9GA 5FP6A 4I94A 2HWPA 2UZBA 3C0GA 4U0IA 4FSYA 3OOGA 2GU8A 5K9IA 4XOZA 3FYKX 4O84A 4C35A 2H8HA 4D5KA 2BPMA 4YHTA 3HMIA 4JR3A 5I0BA 3WE4A 4KKGA 2QOCA 2VWUA 3C51A 5E4HA 1GZNA 3NS9A 1DI9A 2FYSA 2JDTA 2WXVA 4FT9A 4YJPA 3R8VA 3WF6A 4EHVA 2UW4A 1UKIA 2UUEA 5JFVA 3FBVA 3KK9A 3LMGA 3O7LD 4EOQA 5DR6A 4NK9A 1GIIA 3ROCA 4GYGA 1OL5A 3BQCA 2JITA 4NJ3A 4JLCA 5HG7A 4I0RA 5AUVA 1ZWSA 5JK3A 2JEDA 5IQBA 2WEIA 3BGPA 4O0SA 5JQ8A 2WNTA 3D5VA 2PU8A 2VTJA 3R63A 3QKKA 5AP7A 3RVGA 4MH7A 4QQ5A 1CKIA 4O1PA 4QMWA 3UPZA 3FHIA 2PY3A 3CLYA 4QQCA 2WEVA 1ZY4A 3BYOA 2C6EA 4DAWA 1RQQA 4PDSA 2WTKB 4LM5A 4G3DA 1WCCA 5AP6A 1Q3WA 2WKMA 3VBWA 1NXKA 4A7CA 3OCBA 2PZ5A 3FLWA 1BI7A 2BALA 3BYUA 4XMOA 5FEDA 1Q8ZA 3WYXA 2GQGA 5L2QA 4A9YA 2ZDTA 2NRUA 4MTAA 2X6DA 3A4OX 2VWIA 4N6YA 2QOFA 4C59A 5IH5A 4U97A 3U6HA 3R9RA 5L6OA 2RF9A 4AZVA 2O64A 4NTSA 4GCJA 5ACKA 4BBMA 1XH7A 3O8PA 4MQ1A 5EQEA 2OZOA 2CPKE 4KABA 3NDMA 2F4JA 3G51A 4FTLA 1J91A 4F4PA 2X4FA 5JSMA 3R8UA 4Z9LA 3ZLSA 1QCFA 2F7XE 4FV3A 2QOKA 2QU5A 1ZZLA 3EQPA 3L8VA 3G2FA 1WBPA 3KN5A 4QQJA 5CS6A 4L46A 4DT8A 2VWYA 1OM1A 3CC6A 4QO9A 5AX9A 2IN6A 2NP8A 3W2OA 4IAAA 2Z7SA 1H1WA 2XNMA 3R7UA 3H10A 4E4LA 3M11A 3PTGA 4M7IA 2VNWA 3VUTA 5IQAA 4ZTRA 1JWHA 1W8CA 3KMMA 4J7BA 3VUMA 5HCXA 4RT7A 4GU6A 2ZDUA 4XLIA 1J1BA 2B9IA 2YAAA 4XV2A 2QOLA 1WBOA 3VRZA 4D2RA 4JR7A 4EHEA 3KF4A 3TIYA 4AUAA 2VUWA 2JC6A 3G90X 4JG8A 4Q2AA 5AUTA 2JFLA 2FO0A 5JRQA 4D1XA 5CF5A 4ITHA 2ZV8A 3DQWA 4QOXA 3DB8A 4FK6A 3W2SA 5BQ0A 4ZMEA 4XV9A 3M1SA 2YJRA 3BHYA 4FNZA 4P90A 5AUXA 3TCPA 4FL3A 5HOAA 2HAKA 3CGOA 1RJBA 2YCRA 4M67A 5KZIA 5CNNA 1YI6A 2H96A 3VC4A 1VEBA 2PWLA 4U44A 3PZEA 4ZZNA 3LFNA 2UV2A 4DLIA 2CNUA 4NIFA 1Y57A 4C0TA 2J5EA 4AX8A 4Y46A 4JDKA 4UYNA 3PXQA 5AIKA 3BEGA 3MIAA 4BL1A 4D2WA 2PUNA 4WKQA 3IS5A 3DTCA 2FSLX
chains in the Genus database with same CATH superfamily
5I3OA 5I5ZA 5HE1A 4O22A 2UW5A 2OU7A 1CKPA 4H1JA 4X3FC 5KE0A 2QLQA 2XKFA 3TZ7A 4EBVA 5AAGA 2PZRA 3W2CA 3MH3A 3BIZA 2OG8A 5EKOA 4BCNA 2HZIA 3FMJA 4F9AA 1YDSE 2E2BA 4H1MA 4JI9A 2VO6A 1XHAA 2E9VA 1Q8YA 5ETFA 4FKWA 4DEIA 4FV0A 5LWNA 3GNIB 2WTWA 2PUUA 3HV6A 4BJJB 4DFUA 2W1IA 1YXVA 3CQUA 4PWNA 4YUQA 3BHUA 3FZ1A 3HV3A 5HNGA 3L8XA 5AV2A 2WIHA 3BHTA 5DFPA 5EQPA 2QKWB 4M69B 4X2FA 5HTBA 1ZAOA 3QD2B 3QA8A 2UVYA 3R02A 4R3RA 1QL6A 4UMQA 2QO7A 2J51A 3EFKA 4M68A 3NUUA 4JAIA 5HO8A 5IKWA 4Q5HA 5IA2A 3TJDA 2I7QA 1W98A 3Q2JA 5FEEA 5JEBA 3AC1A 5J7HA 2XKCA 3ACKA 3JY9A 3Q4UA 3R8LA 5EG3A 4DFNA 5J1WA 2Z60A 3EQCA 3F5PA 3G0FA 2YWVA 4EOMA 2EB2A 3EQBA 5IA1A 3R1SA 3C7QA 3BE9A 3V5PA 3ZRMA 4E6AA 4DGMA 1JVPP 1Q8TA 3MY5A 5CU6A 4U45A 3D83A 2HELA 3Q4TA 4FIHA 3Q6UA 1ZYLA 3DDPA 3WOWA 4E26A 2C4GA 4MXAA 4N4SA 3WIKA 3LPBA 3EFLA 4NSTA 5FBOA 2BIYA 1O6LA 3ZS5A 5EW3A 4WNMA 2ZM4A 2OBJA 1TZDA 2WQEA 5J5SA 4RX7A 5FUTA 5ANJA 3V5WA 4L52A 4EWHA 3HZTA 3EMGA 1GZKA 1TKIA 1L3RE 3D2IA 3NNVA 4NM3A 4AZWA 4BWXA 4YHFA 3UDTA 4ZSJA 4RIYA 2ZV2A 2QNJA 3B8QA 4G2FA 4IVDA 4C36A 2BRGA 5C27A 4IW0A 2W1HA 3MFRA 4IAIA 2XIXA 1HOWA 1TVOA 3PJ3A 3SXSA 4PX6A 3WILA 2OIQA 3QUEA 5M57A 2BCJA 5M09A 2XIZA 2ITPA 3DZOA 3QCQA 3HRFA 3NRMA 3HVCA 4HGLA 2PPQA 3SGCA 5IEYA 4CSVA 3DLZA 3HNGA 4Z7GA 2B55A 3A99A 5AMNA 4RLLA 1GOLA 3AC2A 5C01A 1XMLA 1NVRA 1OL6A 3BL9A 2JAMA 3KVXA 4YJRA 5DG5A 3VBTA 4ARKA 3H9OA 3HV7A 3FI4A 1YHVA 4CZUA 5K0XA 3QTXA 3E62A 1NY3A 1JSUA 2XUUA 2FSOX 3GI3A 3OT8A 4OTGA 4Y73A 2R3FA 2YM8A 4IVCA 2J90A 3ELJA 4O2ZA 5EH0A 5ETAA 2Z02A 2E9PA 2QOHA 2P55A 4AE6A 4L43A 4QPSA 1PYEA 2XBAA 3VF9A 1OL1A 3JR1A 2HZ0A 4RQKA 5EM7A 4FMQA 1ZYJA 4O7RA 5AR7A 3Q9WA 2ITYA 5EYKA 2X6EA 5I9VA 5KCVA 2DWBA 2OJJA 5EHYA 1PF8A 2NRYA 3DJ7A 4JDJA 2V22A 4F7LA 2UVZA 2I0YA 3KCKA 1RDQE 2I1MA 1KSWA 2F2CB 5LVLA 3LHJA 4KIKA 5BUJA 4JDIA 2W1CA 4FIFA 3ALOA 2Y8OA 2O63A 1R78A 4QMUA 4U80A 4QYFA 1FOTA 4DTBA 5D12A 3LFBA 1Q8UA 1WVYA 2EU9A 3FV8A 3S2PA 4AQKA 4BGHA 4YTHA 4L42A 3UE4A 3FXWA 2XM9A 3FDNA 3RPRA 3KFAA 1K9AA 3AKJA 3R1QA 3VS3A 3C50A 1VJYA 2QONA 2XRWA 2J50A 3A61A 3A4PA 4NFMA 1W7HA 4GYIA 3TACA 2B9JA 3R7GA 5AX3A 4DFBA 3OUKA 3BQRA 3COHA 4M14A 3TDWA 3FLYA 4IMYA 4CRSA 4C7TA 4L45A 3V01A 2CMWA 4QNYA 4KBAA 5EI6A 2R9SA 2YWPA 4RX8A 4CG8A 1LP4A 3W2QA 3A7JA 4K33A 3OG7A 2RFDA 3DBEA 3ORLA 4MX9A 4C4HA 5L8KA 3FAAA 3UNKA 4J96A 1P4FA 3MY0A 1GJOA 4FZ7A 4AW0A 4PMMA 4AW5A 3Q96A 4A4OA 1VYWA 3EB0A 5CX9A 1ZOEA 3C9WA 4YC3A 3CKXA 2X8IA 5AV1A 2BZJA 2DS1A 3BYVA 2OLCA 3QGWA 4O81A 3FMLA 3BV2A 1OUYA 3NEWA 4G34A 3VQHA 4IM3A 3QHWA 1V0BA 3WIGA 3ZRKA 3NCZA 3KB7A 4GJ3A 4ASZA 4ACMA 3DNEA 4TN6A 4F0GA 4LDTA 1XQZA 5A4LA 3CTHA 3SDJA 5CZHA 3GOPA 1Y91A 2PMNX 3MTFA 3FEGA 5LJJA 2YCFA 3V51A 1DM2A 1YOLA 4C3PA 4YR8A 3QX2A 1MRUA 3ET7A 3K5VA 3IW4A 5DWRA 3AT2A 3DBFA 2HXLA 3QQUA 4LI5A 4BYIA 2C6LA 4KINA 3AMYA 4U43A 3CQEA 4LGDA 2Z7LA 3QTWA 2BRNA 3BELA 2OJFE 3ZUVA 3CCNA 1SZMA 4FT5A 1TQIA 4WIHA 3C4ZA 3F82A 3SV0A 4FIGA 2PZIA 4YTIA 3QZIA 5AR8A 4WNOA 3UC3A 4BCKA 4O4CA 4ZY6A 4GUBA 3COMA 2CN8A 5HIDA 4FKPA 4KS8A 4XV3A 4O96A 4J95A 4PNIA 5L2IA 4C4IA 4DE4A 4EOJA 4I24A 4D55A 4A07A 2AC5A 3R9OA 3MH0A 4FV9A 4NZWB 4OGRA 2VTAA 2YM6A 1A9UA 2F57A 1DS5A 3LE6A 2R0IA 3TV7A 1XH5A 3PUPA 2QO9A 3O23A 3UZTA 1OPKA 3POZA 5HLNA 5HU3A 1G5SA 2VX0A 5T68A 2CCHA 2XRUA 3DK3A 3NZ0A 3PVWA 4BCGA 1SNXA 4V04A 4C02A 2P4IA 1NT2A 5DI1A 2ITOA 4IHPA 3U87A 1Y8YA 2CLQA 4FV8A 4GT3A 3MPAA 2XIKA 3C4XA 4AFEA 3Q4ZA 4CYIA 2OGVA 3FSFA 1UKHA 4XUFA 4CV9A 1IAHA 4IZYA 4IADA 4GKHA 2J0JA 3HUBA 4XJ0A 4O82A 4CYJA 5BVDA 1JAMA 2C5XA 3UGCA 4J97A 1H0VA 3T9IA 4O0VA 3QLFA 5CASA 3OCTA 3FMMA 4AAYA 4RJ7A 4O21A 4P4CA 1LPUA 4MD8E 4RIWA 3ZCLA 3NPCA 4B99A 1MP8A 2X8EA 3E7VA 3HECA 3PIXA 4KAOA 4NT4A 1WMKA 5GINE 3SRVA 4RX5A 4O0UA 4QPMA 4TT7A 3S0OA 1PXLA 3CR0A 3W8QA 1V0PA 1VLRA 2JFMA 2O5KA 4BCPA 2YACA 4WA9A 2OWBA 5DT3A 4X21A 5DH3A 4CCUA 1FMKA 4TW9A 2YM7A 2OJIA 3K5UA 4H3BA 3O0GA 3UVQA 4FT0A 3M2WA 3R7OA 3LFDA 3TZMA 3BGQA 4E6CA 5JGAA 4ASXA 4QYHA 4CMUA 3FXXA 3JUHA 4NCTA 3UIBA 4CFNA 3VUGA 2BROA 4QMZA 2CN5A 3EYHA 4RZWA 3BV3A 2X1NA 3C13A 3N4VA 5CALA 3P4KA 4TYGA 4D1SA 3EZRA 2J4ZA 1JBPE 4YNEA 3NMUF 4GJ2A 3ZLYA 4FRFA 4F7JA 2BDWA 4GKIA 3TJCA 4IZAA 4YTFA 2Z2WA 4ANMA 1APME 2XKEA 3F2RA 3ZBFA 4QEBA 3W0PA 2VTLA 3OCGA 4BCOA 4ZIMA 4L9IA 2QVSE 4IVAA 4F6WA 3GQLA 1W82A 4XG3A 3RAKA 4EK8A 3PFYA 3VS7A 3ZZEA 3AC8A 4IDTA 3IOKA 4EH4A 5LMBA 3BE2A 4EK4A 2VTRA 3GEQA 1K3AA 2PL0A 5J7BA 5BYLA 4HW7A 1FGIA 1FGKA 3C4CA 4IBMA 4O0XA 4YZMA 3PA5A 5HGIA 4BC6A 4BI0A 2UZVA 4DH1A 1M2PA 4DINA 4WHZA 4F65A 2J0KA 2X7GA 5AA9A 1SVEA 2W1EA 3PJ2A 4PMPA 4YTCA 3NSZA 2QC6A 4H36A 3LM0A 4Q5EA 4I5MA 4LRMA 3PWYA 2WQOA 3MA6A 4EYMA 3FLZA 4IB1A 4AT3A 3DDQA 4IX3A 2C1AA 3GOKA 3PA4A 4KBCA 5AUZA 3NNWA 5BVOA 3E63A 3KCFA 2CGXA 4HNFA 3TTIA 4ZJJA 4PMSA 2C0IA 5TKDA 3FL5A 2VTNA 5HNBA 3QC9A 2JKQA 4GG7A 3GU8A 2ZYBA 3I7BA 3IGOA 2RGPA 3SG8A 1OKYA 3QYWA 1OKZA 1K2PA 4BVUA 3N4UA 2CGWA 5CVFA 3A7IA 3ZO4A 4O83A 4FKSA 4FSWA 2B7AA 3O50A 2IVSA 4FG9A 5CZIA 2VTTA 2RG6A 5AR2A 5CF6A 5CSVA 2C3IB 2YM5A 5CQWA 3C1XA 3E7OA 2HIWA 4CFWA 3MPTA 3NYNA 3RK7A 5A9UA 3SW4A 4R78A 2GSFA 3G33A 4X6RA 2UW9A 4DHJA 3E87A 3LQ8A 4XCUA 3OP5A 4YMJA 2QQ7A 5EOBA 4L44A 5ANIA 4V05A 4D9TA 4F9YA 4E6DA 3VF8A 3RI1A 4X2GA 4G16A 1H07A 3NIZA 2EWAA 3ZDUA 3BYSA 2WIPA 4U42A 2YIXA 3VS1A 4XOYA 3AMAA 5CT0A 3RZFA 3D7ZA 3NIEA 4V0GA 4DEGA 1JLUE 3EJ1A 4F1MA 2YEXA 5FBNC 3QQFA 5G1XA 4EKLA 1WBWA 4PRJA 2CKOA 2J6MA 2IO6A 4BTJA 3VUHA 3NR9A 2YLFA 3HAVA 4ZSAA 4RPVA 4C2VA 5KO1A 3KXHA 3RMFA 2J0MB 4Y5QA 5IUIA 4BI1A 2XCHA 2ZV7A 4DG2E 4FTKA 2QR7A 5J9ZA 5CEMA 5AV0A 4D58A 2I0VA 2NYAA 4USFA 3UQFA 1JOWB 3PZHA 5FXRA 4GFMA 4BN1A 4EYJA 3QRKA 3TUDA 4UWBA 4AXFA 5E8ZA 5E91A 2WQBA 2QR8A 3TDVA 4RQVA 1KUTA 2G9XA 1T46A 2EB3A 3LCDA 2GMXA 1FVVA 1W2CA 4EOPA 2YCQA 5AP0A 3DA6A 3SX9A 4QRCA 5LVMA 4K18A 5F94A 3IW8A 3QZFA 3DOGA 4HNIA 4BY9E 5D7AA 2KULA 5KKRC 5B2LA 5AP1A 3FSKA 2VTOA 3KGAA 1E1VA 2YITA 1H1RA 4EH9A 4EUUA 4F0FA 2QHNA 4IWPA 1YI3A 5HBHA 3CD3A 3F6XA 2AEGA 2BILB 2V55A 5DEWA 4EK6A 4IAYA 4LQMA 2V0DA 3LM5A 5GHVA 3E8EA 3FY2A 1ST0A 3FQSA 3LJ2A 3I4BA 5HQ0A 1VR2A 5D9HA 5HHWA 5EDRA 1PY5A 1YHWA 4S31A 5JN2A 2OZAB 5CEIA 4AA5A 2VX3A 3CPBA 3EFWA 4AWIA 5D10A 3U9NA 4I22A 4W8DA 2Y6OA 4IE9A 5KHWA 1MRYA 2UZWE 2J0LA 5IUGA 4MXOA 2PSQA 2YERA 4A4XA 4CFMA 2X0GA 4ZTNA 5HX6A 2HENA 3F2NA 2XNOA 2XCKA 5CF4A 4OLIA 4EHZA 4FV6A 4NW5A 4FEXA 4ITJA 2X9EA 3PPJA 5D11A 4GV1A 3OXTA 1Q4LA 3AMBA 3AGLA 5G6VA 3HEGA 4DH3A 5KMNA 2X8DA 3Q2MA 1U54B 1W0XC 2C68A 2VNYA 2VWVA 3P0MA 4U5JA 3UIUA 4XEYA 2ONLC 2QLUA 5HBJA 3R71A 3P7AA 5M44A 3EN5A 4MNEB 3ULZA 4LV7A 5IA3A 4Y5HA 4QMNA 2O8YA 5EM5A 1MRVA 3OT3A 4GVAA 2R3PA 2GNIA 2YIRA 5CI7A 3DT1A 5H2UA 2XS0A 3KEXA 3OFMA 4AG8A 4BZNA 3CPCA 3LKMA 3HMOA 4HZRA 3UTOA 5HO7A 3LVPA 2VWWA 1O6KA 3MH2A 4EZ7A 3D15A 4FTOA 1TFFA 4AQCA 4DN5A 5AUWA 3ZEPA 4RJ8A 4C38A 2HK5A 3F3UA 3UOHA 5CSXA 2Y0AA 4FYOA 4MYGA 2G1TA 3ZTXA 4EZ3A 3LQ3A 3MSSA 4ASDA 5EDQA 1PHKA 1JKLA 2FB8A 3PJ8A 1P2AA 5BVWA 3E3PA 5KMIA 3LMHA 2YLEA 4L7SA 3HUCA 2HW6A 2X9FA 4JQEA 3GGFA 4AGWA 3FZTA 4RIXB 4TL0A 3W0RA 2R5TA 4ZY5A 2XYUA 3F88A 3F5GA 4U3YA 3D7TB 4G9CA 1OECA 4A9TA 4AA4A 2FVDA 3PY1A 4YJQA 3LLTA 1CTPE 5IISA 5KUPA 5BPYA 3LJ0A 3ACJA 5LARA 5DYJA 3Q6WA 2B9HA 2QHMA 4MF0A 1OITA 4BHNA 3R2BA 3W16A 1OMWA 2BMCA 4I6BA 5A6OA 4BTMA 4KIPA 3AKLA 5A4CA 3ML1A 2VTPA 4C62A 2OF4A 2F49A 1PXIA 5CXZA 3HMMA 3OS3A 4M3QA 3ZMMA 2PMOX 3R73A 2C6KA 2VGOA 4NM0A 3GU4A 3O5AA 4J52A 4YO6A 4GU9A 4OTIA 2X4ZA 3GFWA 5EOLA 3MIYA 2R3KA 3HA8A 4JBVA 2W99B 4UB7A 5TT7A 3PFQA 3CTQA 1PXMA 3LJ1A 2WMSA 5E90A 3HA6A 3VJNA 3QKMA 5C8KA 2WMVA 3DXQA 4IWQA 5DOSA 2PVLA 4LMNA 4BKJA 3GP0A 2IZUA 2I0EA 4QP8A 1ZYDA 3B8RA 3ORPA 2NNWB 1DAYA 4FVRA 4D2VA 4JG7A 2C6TA 2V62A 2Z7RA 4XG6A 1ZLTA 2JD5A 2O2UA 2WZJA 3NW7A 4FG8A 4JX3A 5HCYA 3OZ6A 3UNJA 3V8SA 4C4GA 3JVRA 3P23A 4GK3A 3NUYA 2C5NA 3TTJA 4GEOA 4ANSA 2IWIA 4XG4A 4V01A 1U5RA 3QD3A 4XRLA 4CZYB 3PG3A 3FC1X 4NFNA 4FKLA 5EM8A 3FI2A 4M69A 4M8TA 4EQCA 4MVFA 4PDYA 4CTCA 4JRNA 3IDBA 2JIIA 5HIBA 3RWPA 4JT3A 3V8TA 4FC0A 3C5IA 2AUHA 2FSMX 3EN7A 4J8NA 3CP9A 4OT6A 5AUYA 3ENMA 3EWHA 4WRGA 3UMWA 5C4KA 5CU2A 4PL5A 5I9UA 3SXRA 3Q9YA 3QTZA 2Z8CA 2YJSA 4FG7A 4FZFB 4IJ9A 4N6ZA 5AWMA 2VO0A 2XM8A 5CQUA 3NNXA 2WMXA 3AC3A 3QHRA 4I93A 4XG7A 4A9SA 4BIBA 4C33A 5E1SA 4EK5A 4I6FA 4AFJA 4BGGA 4DEHA 3DV3A 4PV0A 4EH3A 4EJ7A 5C9CA 3PXZA 4F08A 3ZLXA 3R6XA 3NUNA 5E8YA 2IVVA 4CTBA 3BX5A 2WOUA 4H3PA 3RPYA 2XK9A 1KOBA 3UPXA 4EH2A 5DIAA 5FXSA 3ULIA 1S9JA 2RIOA 2VN9A 3CS9A 2ZM3A 4XG9A 3FMNA 3LFEA 1Z5MA 4BHZA 2YISA 4Y83A 3VS2A 5DPVA 5AAEA 3V5QA 4KB8A 4HZSA 1YDRE 1VYZA 5T3QA 3FKLA 5TO8A 4PF4A 4FKIA 2W9FB 1IG1A 3UQCA 4RVMA 3QGYA 2E9UA 2JKKA 2OIDA 2R2PA 3A2CA 3O8UA 4DH8A 2W1FA 5H8GA 4IWDA 4FIIA 4QMLA 1XKKA 3ORXA 3R00A 2OIBA 3Q52A 4MKCA 5FM3A 2PUPA 2JLDA 1PW2A 1U4DA 3SXFA 3F69A 3IONA 3IOPA 4AS0A 3EQDA 5K5XA 3K3JA 3ZYAA 4R5SA 1IRKA 4GIIA 4WNKA 3R9DA 3KIOC 3MVHA 2I6LA 3Q3BA 4M0YA 2ITXA 3WF5A 4BDBA 2XVDA 5JH6A 4RIOA 2VV9A 2Q83A 1PKGA 4M66A 4W9WA 5M07A 2JDOA 5FG8A 2Y4IB 3PWDA 4R1VA 5TF9A 1BMKA 4IB5A 1QMZA 2ETKA 4IC7A 3RAIA 2R3QA 2UZTA 3EQRA 2JDVA 4WSYA 1M14A 4K11A 4NTTA 5M56A 2UW3A 1ZOHA 1I09A 2WELA 3PDTA 4DT9A 5IQFA 1PXNA 3R21A 5H8BA 3VS4A 3UO4A 3UBDA 5HX8A 1XH6A 3ZM9A 1WBSA 2HCKA 4FZ6A 2CJMA 3RM6A 2YA9A 2W1GA 3RNYA 4GW8A 3GC8A 3E64A 3MESA 3VHEA 3W0SA 1IR3A 2XIYA 1UNGA 1ZOGA 3FE3A 5FGKA 2ESMA 3DAEA 3BWFA 3ORMA 2GNFA 4GK2A 3HYHA 4TXCA 3KXMA 5IQHA 2J2IB 4UEUA 2B53A 3UIMA 2FSTX 4EH5A 5CY3A 1B38A 4LL0A 2C3LA 2ZMDA 3BU3A 4FYNA 4DEEA 4YZBA 4XV1A 3IW7A 2CLXA 4ZEGA 3DNDA 3LFCA 3QRUA 3R1YA 4J98A 1R3CA 4QYGA 4D0WA 3WYYA 3QCSA 4ALWA 4NYEA 3ODYX 1KV2A 2FGIA 3RTPA 4FKQA 4ZP5A 4FSUA 2P0CA 3LFQA 4D5HA 1FMOE 3FYJX 3OTUA 4D4RA 3AKKA 2GDOA 1CDKA 4YLKA 3FC2A 5HICA 5CANA 1W2DA 4H05A 4ZS4A 2OXDA 3D5UA 2GNHA 4QP9A 4WUAA 3FZSA 3MA3A 4BDGA 3FZRA 3OVVA 3QAME 3QQKA 4DDGA 3ORIA 4YZCA 4O91A 3BI6A 4AZSA 4K6ZA 2XALA 3DBDA 5IA5A 4EWQA 4IX6A 1YXSA 3SVVA 3LCTA 2BTSA 4FTQA 4YGAA 3WBLA 1KOAA 4AXEA 1IEPA 5J8IA 1MUOA 4KSPA 4I6QA 5HG8A 4AZFA 4BDFA 2JIUA 2XMYA 3O96A 5I9YA 4OUCA 4RC2A 2G2HA 3HLLA 4W4XA 2WMAA 4TWNA 4RWJA 3V3VA 3D4QA 3ZFXA 1PRYA 1NA7A 4DF3A 4RFMA 5JGDA 2PHKA 3RNIA 4FKRA 5DMZA 1UA2A 2C6DA 2XJ2A 3KRLA 4NWMA 5CXHA 3R1NA 2O3PA 1P4OA 2R7IA 3BLQA 2ETRA 5A3XA 4B8LA 4RWKA 4KWPA 1TQMA 1ATPE 5CU3A 4YBKA 2UZDA 5BX0A 4IXPA 4PP7A 3U6JA 4DGOA 5BUEA 3QUDA 4WD5A 5CEPA 4KA3A 4U40A 4CQEA 3EN6A 2BKKA 3G9LX 3UP7A 3MN3A 4RG0A 2X81A 1SM2A 4UMUA 4OAVB 4APPA 2A27A 3KVWA 3OHTA 3CXWA 4O4BB 4K2RA 1EH4A 1JSVA 4GSBA 5DEYA 3QA0A 3UODA 4AGDA 2PMIA 5C8NA 2R64A 3DU8A 2XNEA 4NM7A 3R04A 1ERKA 3RP9A 3BLAA 4OTDA 1Q41A 3HRBA 5BMMA 1H26A 4P5QA 3O17A 1YWNA 5AV3A 3CE3A 1BL7A 2JKMA 2WD1A 4OTQA 3ANQA 2CGVA 3PE1A 3W0QA 1OL7A 2YIYA 1FBNA 4I23A 4D4SA 5J79A 5IEXA 4OTRA 4K0YA 3FPMA 4USEA 3TV6A 3BGZA 3MB7A 3BLRA 3D9VA 1V0OA 2C5YA 4K8AA 2CHLA 2CSNA 2PZYA 3OBGA 4HGEA 4H39A 4XP2A 4A9RA 4FZDB 3UOJA 4IDVA 2XEZA 4KNBA 1KE6A 4MF1A 4EORA 4OTFA 1FPUA 2XK8A 5E8VA 1KE9A 1PXJA 2VWBA 3DKCA 4ZXTA 4CFFA 1H08A 4KRDA 4R6VA 1Y8GA 4G3CA 3FPQA 3VBQA 2WMQA 3R28A 4DCAA 4QTAA 3H0YA 4MEDA 2W5HA 2A98A 4E73A 4WUNA 3U54A 4S34A 3UOKA 4UWYA 4YSJA 2XARA 4G6NA 4FE2A 1KE8A 1PMNA 4ANLA 2B0QA 3OMVA 5I9XA 4NH1A 3UQGA 4X3FB 3HGKA 4L67A 3KA0A 3HX4A 3TNHA 3BCEA 1UU7A 5IEVA 3EQIA 3EL7A 4C61A 1R1WA 4BDAA 5FDPA 2QCSA 4HCVA 5AUUA 4QNAA 4DA5A 2WU7A 3HMPA 4MD7E 1Q8WA 5CSWA 3F3WA 2V7OA 4S32A 2OI4X 4OW8A 4IEBA 4RGJA 1Y6AA 1MQ4A 5HE3A 5BVKA 2IW9A 4QDVA 5DE2A 2DYLA 5IA0A 1GY3A 3UYSA 4R3PA 3W1FA 2WPAA 4QTDA 3EYGA 3E8DA 3UO6A 1BL6A 4JMQA 3TKIA 3PUFC 2WMWA 3CGFA 1UU8A 4O0RA 5FDXA 3DJ5A 4IZ7A 2WB8A 3CBLA 3ODZX 3S95A 4FGRA 1Q62A 2C30A 3I6UA 4MNFA 2HY81 5DLSA 5DT0A 3C5UA 4RVLA 3V6RA 3FLNC 5EM6A 2VO7A 3T9TA 3KU2A 4F99A 1ZRZA 4I1ZA 3SAYA 5BMSA 3O7LB 3TV4A 4JBOA 3R8MA 3V5TA 4BYJA 3I60A 1J3HA 4WG4A 5EYDA 3PJCA 5A46A 4LMUA 2ZOQA 2VAGA 5J9YA 2FA2A 4QP3A 2ITWA 4H3QA 2P2IA 3N4TA 4JOAA 1IA8A 4PY1A 4YP8A 5J5TA 2JDRA 5ANOA 1OPLA 2H34A 5AEPA 1Q99A 4I92A 5HE2A 3TXOA 1M52A 4EK3A 4FTMA 2YM4A 3R7YA 2PYWA 3Q5ZA 4AE9A 2OKRA 4L3LA 4TWCA 5AADA 4QP1A 4WG5A 3MTLA 3UIXA 3U8WA 3L9LA 5DRBA 2C0TA 3IW5A 4FSTA 2AC3A 3U6IA 4X0MA 4MXYA 4O27B 1UNHA 3VVHA 2J0IA 2YIWA 4EL9A 3SD0A 1H25A 1UWHA 2UW0A 5DA3A 4B0GA 3PPZA 1QPCA 3QCXA 3WZUA 3NLBA 3ZSHA 4IVBA 2GNGA 3GENA 3AOXA 5AP4A 2GQSA 1BUHA 5CI6A 3NAYA 3UDSA 4S30A 3MFTA 5HTCA 1U46A 4YJTA 4NCTC 1WAKA 4OBQA 2G2IA 4BZOA 5IQDA 4FIEA 4Z3VA 5C26A 1V1KA 4O7YA 4F1OA 3OWPA 4NM5A 5CU4A 4QP4A 4ITIA 3PRFA 2YFXA 3P79A 4F9BA 2WTIA 3ZXTA 4ZSGA 4HVDA 4LL5A 4RC3A 2R3HA 4FKOA 2O65A 3JVSA 4W4WA 4YZNA 3EN9A 3FWQA 5JKGA 4FOBA 5M55A 4ORKA 4YU2A 3LFSA 3PLSA 4XRJA 3QUPA 2XA4A 4KSQA 4RMZA 5IDPA 3P7BA 3KXGA 5L8JA 4HYIA 1RW8A 4CRLA 3PXRA 4R7HA 1H0WA 5E8WA 3VN9A 3OWJA 4I4EA 3VS5A 4DH5A 2CGUA 4N57A 4L3JA 2IPXA 3G15A 4LOPA 3GXLA 5HLPA 2JAVA 5CU0A 3NYXA 4AT5A 2WTJA 2E9NA 5H3QA 1H1QA 3DTWA 4I5HA 4WSQA 1LUFA 2C5OA 4FI1A 4QDEA 1YI4A 3ZZWA 4ZY4A 4R8QA 4QYEA 4B4LA 2GHGA 4LV8A 3DKFA 4YPSA 3EOCA 4DEDA 4FA2A 4O7SA 1J7IA 5HVYA 2XZSA 3QXPA 5DT4A 1XMMA 2LAVA 3TL8A 5CVHA 4EOIA 3VUKA 1H27A 2VTMA 2EUFB 2Z7QA 3QRJA 5HCZA 2VTSA 3RPVA 1M17A 3ZONA 3V5LA 3KREA 1W2FA 3L9MA 5JZNA 4J1RA 3W10A 4BB4A 2A2AA 2EXMA 3L8SA 4FTRA 4QMYA 4WRSA 2GFSA 4DITA 4ZSEA 5LQFA 1YOMA 4CFXA 3FI3A 3NUAA 2X0QA 3TN8A 4AZTA 3QLGA 3RWQA 2CNVA 3C0HA 4F63A 4F70A 4MWIA 3W2PA 3T3VA 5IF1A 1BX6A 1OKWA 2B9FA 4IM2A 4QT1A 1E9HA 4KIQA 3WZKA 5IQCA 5LVOA 3KY2A 4QMVA 5BYYA 5GIOE 4CGAA 2UZOA 2W9ZB 3IQ7A 4G9RA 3GCSA 1CSNA 3AD4A 3ETAA 4HPUE 4AN9A 3JXWA 5KMKA 2WO6A 1QPDA 2UW6A 3SLSA 3EQGA 3LCKA 4U7ZA 5CSHA 1UVRA 3ANRA 3ZM4A 3DK7A 4I0TA 5LXMA 4FV1A 3NFFB 3AD6A 5FTGA 3A8WA 4NU1A 3QU0A 3CQWA 4FEQA 3FXZA 3KKVA 2ITUA 4YPDA 3UG2A 3NVMB 1NVSA 3SC1A 2WFYA 2OZAA 4FTJA 4JVGA 3F7ZA 3NYVA 2UW7A 4F6SA 3MV5A 2VGPA 1AGWA 4YLJA 5DRDA 3P7CA 5AA8A 4BF2A