3RVGA

Crystals structure of jak2 with a 1-amino-5h-pyrido[4,3-b]indol-4-carboxamide inhibitor
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
292
structure length
285
Chain Sequence
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVSPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase/transferase inhibitor
molecule keywords Tyrosine-protein kinase JAK2
publication title Discovery of 1-amino-5H-pyrido[4,3-b]indol-4-carboxamide inhibitors of Janus kinase 2 (JAK2) for the treatment of myeloproliferative disorders.
pubmed doi rcsb
source organism Homo sapiens
total genus 88
structure length 285
sequence length 292
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2011-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3rvgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3rvgA01
3WZJA 2QC6A 2RG6A 2FSLX 3L8VA 3MPMA 5IF1A 4JXFA 3W32A 3NSZA 4C7TA 2GNLA 4N57A 4QRCA 3RGFA 2P2IA 4MF0A 5EHYA 3R7OA 4FYNA 3R63A 3OHTA 3A7HA 4FG8A 3QWJA 4I5CA 1H28A 1W8CA 4JS8A 5ANDA 5E8TA 3V5JA 3NNUA 3E87A 5I9XA 3FLZA 4O0RA 3P9JA 3KEXA 4CV9A 4BR3A 4UMTA 3EQFA 3NCGA 3DFAA 3MVJA 3QRTA 4K8AA 4D28A 4JIKA 5TF9A 5BYLA 1J91A 3QTSA 3B8RA 2CKEA 4FKIA 3ZEPA 3HRBA 5CAQA 2ZDTA 2GS7A 2QODA 2VTNA 4YTHA 2VU3A 4U43A 5FUTA 4MXYA 3FEGA 3DOGA 2WTCA 4O7VA 2B7AA 3P86A 4CZUA 3FHIA 4NCTC 4RX7A 2XK3A 4BDBA 3ZFMA 4C3FA 5JFWA 4U9AA 3KF4A 5AP5A 2Z60A 4CLIA 5KNJA 3D5UA 1FGKA 1M17A 3IDPA 5AR2A 3PVBA 3ZLYA 4ENXA 4M12A 2FB8A 5AX3A 2Z7RA 3ORPA 4DFZE 1H01A 2YITA 3P1AA 4YC6A 1U4DA 4FIEA 1STCE 3RKBA 2XVDA 3ZRKA 4IACA 4II5A 1PXLA 2QO2A 3WZUA 3H30A 3Q32A 2GNJA 3PWDA 2CNQA 3Q2JA 4L7FA 4RWJA 4MEDA 5CXHA 5EK7A 3EQPA 5HTCA 1GZ8A 3FYJX 4U40A 3U4WA 1FMOE 4DGNA 4Z3VA 5LJJA 2JDOA 3DFCB 4O0VA 3PDTA 1WAKA 4GJ2A 2C4GA 3GENA 4YC8A 2W1ZA 2OJFE 3Q53A 1AGWA 3TIZA 3W8LA 3KU2A 4TPTA 5D1JA 1NA7A 2JAVA 4K6ZA 4PMMA 5AR7A 5H2UA 3SRVA 2R4BA 3NYXA 3EQRA 3JXWA 4L43A 4O2PA 2WELA 4BGQA 2CNVA 4NW6A 4IQ6A 2XNEA 4RVTA 4PDYA 2VGPA 4MXZA 2Y8OA 4IEBA 4RIWA 3R8MA 1H4LA 1OKWA 4IVBA 3ZO4A 2CNUA 1TQMA 3D15A 3PVUA 4MTAA 3FMMA 4JG7A 5H8GA 1KOBA 4KBCA 2PHKA 3MGYA 3CD3A 3LMGA 4D4RA 4LGDA 3LKMA 4L9IA 5DH3A 1U59A 4TRLA 4RIXB 5L2TA 4E6AA 3HAVA 2QU6A 2OU7A 3MH1A 4R1YA 5CVFA 4HYIA 2XNMA 4FL1A 5BQ0A 3QBNA 2V62A 4KWPA 3VW8A 5A4EA 5CWZA 3GUBA 1YI3A 4RZVA 4C4FA 4DFUA 4EZ7A 1WBSA 3FPQA 3JY0A 3QTUA 3THBA 2GQGA 3ZZWA 4KB8A 3OBJA 3Q4TA 5CAOA 3QKMA 4L3LA 1PXOA 3PY1A 4HVSA 1RQQA 4FZ6A 4BB4A 4J95A 2EXEA 3CTJA 2R64A 3ZBXA 5FGKA 4O81A 3W2CA 4BI0A 1VYWA 1CKPA 4BZOA 4J8MA 4X3FA 4BCOA 4ZAUA 2F49A 4QQJA 5CU3A 4C37A 3FL4A 3V5LA 3MY1A 4AGWA 2SRCA 2XA4A 3S0OA 3LW0A 4CTBA 3QQLA 4KD1A 2ZM3A 1ZZ2A 3AT4A 4RJ7A 3FKNA 2AYPA 1QPCA 3ATTA 3ENHA 5EW3A 4AUAA 3G6GA 3TEIA 5HIBA 3FZPA 4EOQA 4EQCA 4YTFA 3QGYA 5AADA 4BIDA 2OBJA 2OIBA 2F57A 4L68A 2XUUA 3HX4A 2BCJA 4G6NA 5EM5A 2ZDUA 4DEIA 4I21A 3R9RA 2Q0BA 5A4LA 3N4VA 1WBTA 4FKWA 2R3NA 3MY0A 3A62A 5EFQA 3RAWA 3QF9A 5JFVA 2R3PA 4X2JA 3FLQA 3PZHA 4QMUA 4J8NA 4S33A 1FVRA 4YGAA 2YIWA 3FI8A 5K0XA 4I93A 4L53A 3NX8A 4HYSA 4LUEA 4TYIA 3WZKA 3LCOA 3QWKA 4XOZA 3CQUA 4FKSA 3OP5A 3NWWA 1OIYA 4S2ZA 2UVXA 2O8YA 2RSVA 4RC3A 3KMMA 1U46A 4L42A 4MBJA 4QMWA 4FV0A 2BHEA 5KZ0A 3PIXA 2IW8A 2W99B 3E8NA 4S32A 3SC1A 2UW7A 3QD3A 2YCRA 3ZSGA 3ENMA 4R5SA 4IZYA 3H9RA 3DU8A 4QPMA 4QQTA 4P4CA 5IA0A 3O17A 4FSZA 3VW6A 3PSBA 2YIQA 3KMWA 4JOAA 5FXSA 3SOCA 3OCGA 2W9FB 5G6VA 2IN6A 5J9YA 2WHBA 3BPRA 2KTYA 4E93A 3DBDA 3LJ0A 4U7ZA 4FIHA 5DHJA 2HY81 4ZTLA 4R78A 5ANGA 5DYJA 3CTQA 2XIXA 4HCVA 5EI6A 4IX6A 1JKKA 4G3DA 5CF5A 3RK7A 5IQHA 3OVVA 4FL2A 2CGUA 3KF7A 3DCVA 3MTFA 5CSWA 4C4HA 3MIYA 4TN6A 3D5WA 4O7ZA 2XKEA 4MD8E 2C3IB 4FTIA 4O0SA 3MESA 3MVMA 4J96A 2IW6A 1XBBA 1PYEA 5GNKA 4B6LA 4BZDA 2XIZA 3R9OA 1H25A 1Y6BA 2OICA 2X39A 3FAAA 2ONLA 3LFSA 4FIIA 3QTQA 4ZY5A 4RA5A 4EI4A 4CKJA 4NUSA 3LM5A 5I9ZA 1XJDA 3LAUA 3WZEA 3D83A 4H39A 3D2KA 4X2GA 5HEZA 4FTLA 3UOKA 4KRDA 5IA5A 4E5WA 5BNJA 3FE3A 4BDIA 5AUVA 1YRPA 4C4GA 3FMLA 3VBWA 4MK0A 3ZLSA 4JBPA 3RWPA 1Q8UA 1J7IA 2X8EA 3QTRA 2W1DA 3BV3A 3FUPA 4RJ6A 4QP6A 5CXZA 3BGQA 4FG9A 4O82A 3QCXA 2QLQA 2WZJA 2CCHA 5B2MA 2W5HA 2QOLA 2QD9A 3RTPA 2YJRA 3MPAA 4XCUA 4A9YA 3EFLA 3B2WA 2VTMA 5DIAA 1PF8A 3VS3A 5F20A 2PVLA 1Q99A 4B9DA 1SVEA 3VF8A 3GXLA 5DNRA 2BRBA 3M11A 4RRVA 4GG5A 2YERA 3DZQA 1OECA 2GNIA 2W5AA 4PPBA 4RJ8A 5GHVA 4RJ5A 5KBRA 4G6LA 4ACGA 5DR9A 5KMKA 3V8WA 3ELJA 4FTKA 4FVQA 2ITQA 4X3FC 2I40A 3FSKA 5J1VA 3I7BA 3AD6A 3EJ1A 3H9FA 3HV6A 4C59A 3DDPA 3QZFA 5L4QA 2B52A 2DUVA 4RC4A 4M14A 4I5PA 2YCQA 5CU6A 1UNGA 4O38A 5CZIA 2X7GA 2H6DA 3MFRA 3SHEA 2UZLA 3AD4A 5J7BA 1WVXA 2XJ1A 1ATPE 3D94A 4RIYB 5DR6A 4OT6A 3VQHA 3E64A 4QTCA 2QOHA 3VAPA 1NVQA 4G17A 2PVKA 2WMBA 4FTRA 3W2PA 4D58A 2WFYA 2UZNA 2OZAB 4GW8A 4NM5A 4IM2A 3AMYA 4FZFB 3KMUA 3NRMA 1GZKA 3R1QA 3MVLA 4U0IA 2VD5A 3ORKA 4XYFA 3UVRA 1DS5A 4M7IA 5DPVA 3DBFA 3IECA 3NEWA 3U9CA 4F0FA 3TM0A 4WNKA 4RGJA 5TOZA 4H58A 3S95A 2YIYA 3AC4A 5FEDA 3ZFXA 4GEOA 2EUFB 3IOPA 4MBLA 4RSSA 5AV2A 4YTCA 2O2UA 2JKQA 2OI4X 4BTFA 3FY2A 1Q8TA 2BTSA 2LAVA 3CTHA 2VNYA 3FZSA 1UKHA 1G5SA 2ETRA 2IZTA 3F3TA 3KRXA 5E8SA 3DXPA 3C7QA 5HNIX 1BL7A 5ACKA 4F63A 2W9ZB 1VEBA 2B9JA 2Y6OA 4FNZA 4KS8A 2G15A 3C4ZA 4MBIA 5IEXA 4IJPA 2YAKA 3JVSA 1QPEA 3F2AA 4OW8A 1Y57A 4O7LA 3RHXA 2JC6A 5IUIA 4CXAA 1E9HA 4RPVA 3DTWA 3A4PA 4W4WA 4EH5A 4DTBA 4FIGA 2FVDA 4UY9A 5AV1A 1ZOEA 3L9LA 4TT7A 3VHKA 1ZYCA 3ALNA 3QRUA 4FOCA 4FKLA 3VJNA 5HE0A 3BHUA 5LMAA 3QXPA 3G5DA 4X0MA 3F2RA 4XG3A 5LVLA 3R1YA 3SX9A 2ZV2A 4GVAA 4JBQA 3ZXZA 4IZ5A 3GEQA 2R3OA 3QYWA 2JAMA 4L67A 5E8XA 3QA8A 4XBUA 5AR4A 5FTOA 4RFYA 4HGTA 3EL7A 2C1BA 3KB7A 3HP5A 4AXAA 4C33A 4DFYA 5CANA 2QOFA 3KCFA 3P5KA 1KE5A 1ZY4A 3GP0A 2NPQA 4BN1A 3CD8A 1KE6A 1CDKA 3EL8A 4U79A 4DH1A 5AEPA 3OCBA 3I0QA 4WUNA 4Y95A 5EYDA 3R7EA 3SW7A 3AC5A 2XM9A 3UC4A 5I9UA 1OPLA 2GS2A 4EOSA 3FQEA 3P08A 3PRFA 3VBXA 2ESMA 2WMXA 2WMAA 3FQHA 4YC3A 1PY5A 1X8BA 2B9HA 4LL0A 4W8EA 2ONLC 2PVFA 4D4SA 4G34A 4D2PA 1YXSA 2WIPA 4QYHA 1DAYA 1G8SA 3EQIA 4E4MA 3QUEA 4LL5A 2F7ZE 5FLFA 3EH9A 1UU3A 5L3AA 4DFXE 1ZXEA 4L6QA 5CQUA 2OGVA 1WBVA 2QCSA 2VTLA 3PA5A 4K11A 4DGGA 2PE0A 2ZYBA 3FMNA 5HO7A 1REJA 4MX9A 2HY0A 4BRXA 3Q5ZA 2H34A 4M97A 5LQFA 3L8XA 3BI6A 4V01A 2VZ6A 3RPRA 2BUJA 4BKYA 5AV3A 4UMRA 3TNQB 1IA8A 2PUPA 1CKIA 4WNOA 4GRBA 4ANMA 5EQPA 4YZCA 4IHPA 5HBEA 1WBPA 4FV3A 2BVAA 3IW4A 2OJ9A 2F7EE 5JN2A 2PVYA 2WKMA 5JQ5A 3MW1A 5CENA 2WTVA 4JI9A 4F9AA 4NT4A 3ID6C 5D10A 4KIOA 3QYZA 4MD7E 4A9UA 4ANLA 5AUZA 1F0QA 2GHLA 3LJ1A 5CYIA 4P2KA 4EHGA 3CLYA 3D0EA 4G2FA 4BDDA 3OW4A 3BLQA 4H05A 3A7IA 4CYIA 1MRUA 3RNIA 3BV2A 3F88A 4D2TA 3DK6A 4K1BA 4J7BA 2BRGA 2RFNA 3ZRMA 3V8TA 1XQZA 2VTSA 5HGIA 2HELA 3F61A 4AGDA 4QP1A 4YJRA 5L2QA 3LXNA 1BYGA 4O91A 2JKOA 3QX2A 1OL1A 2V55A 3QZHA 2VWVA 5DG5A 1J7UA 4U3YA 2JIUA 3O23A 4AZTA 2WD1A 5IG1A 4FIJA 3BCEA 2F2CB 1Q5KA 2ITPA 4ID7A 1OUYA 5KO1A 1DI9A 3RK5A 3TNHA 5LXMA 3EMGA 3KREA 3NUAA 4QP9A 5HOAA 4LFIA 4WBBB 2BPMA 3VJOA 2QU5A 4YJNA 5AFVA 3DZOA 2JKKA 5CVHA 5HCZA 5B2KA 4JX3A 4Z55A 3ZSHA 4F6WA 4B0GA 4DH7A 3VBTA 4ZY4A 4I24A 4JNWA 1Q3WA 3PPKA 4FSQA 4YJOA 3FZTA 4ALWA 2XIYA 2ZVAA 4ITIA 3LFQA 4L46A 4M13A 3TN8A 3QFVA 1U5RA 1YWNA 1OIQA 3OXIA 1FINA 4D4YA 5I3RA 5AJQA 4EOJA 3PJ8A 5ETFA 1NXKA 4I6QA 3RK9A 3C5UA 2ITOA 3QLGA 4FKRA 2C6LA 4O0XA 1ZOHA 3TUBA 3TIYA 5HTBA 4FSNA 3TNPC 4JDHA 3G2FA 4D1XA 4EC9A 1H1PA 3E93A 4IX4A 2WTKC 4DYMA 4I5HA 3UIBA 4V04A 1XWSA 2ERZE 2C6OA 3SA0A 3RPVA 2EXMA 4HVIA 5AP1A 4WSYA 1A06A 4IVCA 4QP3A 5TT7A 4QTEA 3QALE 1G8AA 2YN8A 4FUXA 4MXCA 3JYAA 3MFTA 2C5YA 4IW0A 2VTQA 4UX9A 3TUDA 2J50A 3MPTA 4X2KA 5CEPA 2QOBA 4X6QC 1PKGA 4QMOA 4ENYA 5IQIA 2XJ0A 3NYNA 4G6OA 1KE8A 3E8DA 3HZTA 2IWIA 2ITUA 5DRDA 4RLLA 3VULA 4HGSA 3VQUA 2CKOA 1PHKA 1O9UA 5CT7A 2UW5A 4XG9A 4EK5A 4JAJA 5EDQA 4IWDA 4DH8A 4LGGA 5M4CA 2OF2A 5H3QA 4FSYA 3I60A 4ITHA 2W1CA 2ZV7A 4GIIA 4LOOA 3NW5A 3MI9A 4IZ7A 2JEDA 2HZIA 4GSBA 3TKIA 3I5ZA 4RX5A 2YZAA 3EQHA 4FV8A 2Y9QA 4XOYA 4FSWA 4EONA 4AW2A 3S00A 3L9MA 4EC8A 2BIYA 2CLXA 4AQCA 5HCXA 2RKUA 3PE1A 4PDOA 3NVMB 4HW7A 3VUHA 4GG7A 3WF5A 3PRIA 2XYUA 4X7QA 3BEGA 2VWXA 3PZEA 4DBNA 4NIFB 4NM3A 3RHKA 3Q6WA 2C6TA 3VS2A 4A9TA 5CLPA 4CCBA 4Q5EA 5KUPA 3C4FA 3PG3A 5CS6A 5EHOA 3FZRA 3ZO2A 3AC2A 1R78A 4D2SA 4ZY6A 4WHZA 4YSMA 2QURA 4FGRA 3FXWA 3O51A 2I6LA 2V22A 2W4JA 3UYTA 3Q5IA 1UWJA 4KSQA 4JLCA 1OL2A 2QONA 3FWQA 3I81A 1KWPA 4XBRA 3LZBA 4BIEA 5L2SA 1H8FA 3UJGA 2B1PA 3F3VA 3IQ7A 4BC6A 2CLQA 3DJ5A 4B8MA 3WIGA 2PK9A 3NUPA 5L6PA 1PMNA 2QOOA 1R0PA 3SG9A 4A07A 3VO3A 2WTIA 2GNFA 3DXQA 4O7TA 1XR1A 1YHSA 1NVRA 4E3CA 2XM8A 3HV7A 2GQRA 3CCNA 2E9OA 3DJ6A 2JBOA 4PMPA 2UZWE 2X2LA 4CMTA 3IW5A 3EN4A 3V04A 3NYOA 1ZZLA 2BRMA 2XF0A 3R28A 3QU0A 4IM0A 5DEYA 1ZWSA 4XG7A 3ZZEA 4F0GA 4QMQA 3FZ1A 3F7ZA 3QD4A 4HYHA 3O7LB 2G2HA 4GYGA 3RBWA 4F7SA 3R8LA 4KAOA 5DLSA 5CEMA 3EN7A 4AT4A 3KC3A 1J1BA 4WSQA 3HRFA 5FBNC 4ZIMA 4I1ZA 3RWQA 2G01A 4CT2A 5C01A 3QHWA 2QO9A 4IM3A 2QG7A 3C4XA 4FV5A 4FK6A 5T3QA 5D11A 5FP5A 4ACMA 4BCHA 4EHEA 3SW4A 3GCUA 4L44A 3PXKA 5EYMA 1PW2A 2WU7A 4FKPA 2BAQA 4IE9A 3QQKA 3R02A 4PTCA 4AW1A 4YO4A 5BVFA 5FDPA 4Q2AA 1GIIA 4L01A 5HNBA 2VTIA 3UVQA 4DG0E 2W1HA 3ITZA 2P2HA 5FBOA 3VRZA 5AAGA 2JFMA 4JR3A 4BGHA 3H4JA 2OH4A 3FMEA 1YOMA 3KVWA 3TWJA 3GFEA 3SXRA 4O1PA 1PXKA 5AMNA 5ETIA 1SMHA 5KX8A 1KV2A 1UU9A 5JQ8A 2PZ5A 4L3JA 4D55A 3D4QA 5IU2A 2ZB1A 4TYHB 4ASZA 4CZYB 4EH9A 5A14A 1IG1A 3A2CA 5I9VA 3F82A 3VN9A 4Y5HA 4EH3A 4J1RA 4YZMA 4WRSA 4YP8A 2XK4A 2YWVA 1H1QA 1M2QA 4DTAA 4AZWA 3TTJA 4AW5A 5HBHA 3DAJA 4YHTA 3N4UA 2R9SA 4FEVA 2B4SB 3VUMA 4BDEA 4Z9LA 4DLJA 3R0TA 1L8TA 4JIAA 5DN3A 2OJGA 5GIPE 3ZSIA 4GKHA 3CGOA 3E3PA 3FLWA 4M69B 2BTRA 4ZLZA 4ERKA 4DHFA 5CF6A 4O86A 3A7GA 4HVDA 1FPUA 2BAKA 3FI4A 4FEUA 2JFLA 3C0GA 3QTZA 3R9NA 5H8BA 4EOKA 3VS1A 3R01A 3T8OA 2XRUA 4I3ZA 4Y46A 3VUGA 3CPCA 1M2RA 3HUCA 4MQ2A 3SRVB 4USEA 4TWNA 2B54A 2JBPA 2X4ZA 2YM5A 4QYGA 3SD0A 4CGAA 3KXZA 1Z57A 3F7WA 3K5VA 4FC0A 5DRBA 3JS2A 5FXQA 4NTTA 3F2NA 5D9HA 2OG8A 5K4IA 4L52A 1M2PA 3A7JA 5AP2A 2DS1A 4FKOA 4CQGA 1KE9A 1OKZA 4O84A 3DQWA 3OF0A 5IQDA 3U51A 4DEGA 2OJIA 1M52A 2G2FA 3II5A 3RPOA 4FZDB 4CD0A 4OLIA 3RM6A 1LUFA 4PF4A 1CMKE 4D4VA 5J7HA 2C47A 2OO8X 3QAME 4I23A 4GUBA 2YM7A 1LPUA 1XKKA 4RFZA 4UWYA 1RJBA 4OBQA 4FG7A 3KCKA 1H0WA 5GZ9A 2PUNA 4I94A 2J4ZA 3RAHA 3WIKA 4KKGA 3TJCA 5AIKA 3B8QA 3TT0A 3EN9A 2H9VA 3HYHA 4CVAA 4EYMA 4DF3A 1ZYSA 3VUTA 3S4QA 1OPJA 3KRWA 3GB2A 3MJ2A 1LEZA 1DAWA 5EDPA 3UQGA 3PLAE 1IASA 2ITNA 3BZ3A 5JSMA 2CJMA 3G15A 3R1NA 1OZ1A 4Q5HA 3WILA 4JQ7A 4CMUA 5CQWA 4FV6A 4AX8A 5BUIA 5CT0A 3G51A 3E62A 3Q3BA 3QCYA 4C61A 5JKGA 3A99A 3KN6A 3AG9A 2XCHA 3POZA 1I44A 3NAXA 4KBKA 4RJ3A 5IISA 4I92A 4CQEA 1K3AA 4BYJA 3OFMA 4FVRA 5CU2A 4FYOA 5CSXA 4R3RA 2C3JA 2QQ7A 3LLTA 4MNEB 3LCTA 4CRLA 5IUHA 5L8KA 4PL3A 1YDSE 4FL3A 4XG2A 5HG9A 4OAVB 3BKBA 2W4KA 5IEYA 5K4JA 2PULA 4RQVA 4BWPA 2JGZA 3C4EA 1PMUA 3ZO3A 3TKUA 4Z7HA 5LMBA 2C1AA 1URWA 5CU0A 3AT3A 2CGXA 4KIQA 4HPUE 4DCEA 5EM6A 2Y4IC 3G33A 4IB0A 2QR8A 4ZZMA 5HX6A 2C5OA 2Y6MA 1T46A 3HGKA 1URCA 4GS6A 4IFGA 4ZTSA 1OIRA 3O8PA 4EQUA 3VS0A 1OKVA 2VO0A 3NUNA 3FXXA 5CAVA 2X2KA 5J9ZA 3DK3A 3KVXA 4XV9A 3L9PA 4HYUA 2WEIA 2CKPA 2EU9A 3E63A 4H3QA 5ANKA 4E4NA 2OSCA 2DYLA 2R3IA 2I0VA 4GCJA 4S34A 3ULZA 4B8LA 4ANNA 2UZVA 4EOOA 4EKLA 4YNOA 1TVOA 3W18A 5ICPA 5LMKA 4IFCA 5AUUA 1ND4A 4GVJA 4U42A 4WT6A 5HORA 3HV4A 3BHTA 1P5EA 3BLHA 1JPAA 5CI6A 1Y8GA 4NFNA 3KULB 4I4FA 5BVOA 3FMJA 1OI9A 2VO6A 5JGDA 2CSNA 4FNWA 1BI8A 2P4IA 3QQJA 3H3CA 2PYWA 4ZJVA 5BYZA 4XEYA 2XBAA 5E91A 3T3UA 5C26A 5J9LA 3MS9A 2W1GA 3G90X 1CTPE 3QRJA 4BBFA 5DBXA 3UIXA 4QMMA 1GZOA 3D14A 1ZARA 5CSVA 4ZSLA 3LFNA 3RCDA 3WF6A 4PL5A 3PWYA 1GNGA 3OG7A 2ZAZA 5EDRA 2QG5A 4GV1A 4WOVA 2Z7SA 3IGOA 4U41A 3GU4A 4BWXA 3LFFA 3A8WA 3TI1A 2X1NA 3H9OA 4U45A 4R7BA 3ZDIA 3R6XA 2YM4A 2CPKE 2VRXA 5ETCA 2X81A 2QLUA 4BICA 4USFA 2PVHA 4U3ZA 5HE1A 2R3JA 3AC8A 5KMOA 5LARA 5IQBA 1J3HA 3OT3A 4QMTA 4UXLA 3IK3A 2FUMA 3EKKA 4C02A 1B39A 4CG8A 3OXZA 1YXUA 4P90A 5BVWA 4I6HA 4YLJA 4BCKA 3GCPA 2DWBA 4FV9A 1Z9XA 3EFKA 4R6VA 4WG5A 2Z8CA 2Y0AA 1V0OA 3HMOA 4D2RA 3BRBA 3JVRA 2GU8A 2WMSA 3OXTA 3A60A 5E90A 3W2QA 4WO5A 2CN5A 3NNVA 4JBOA 4KABA 4YHJA 5EW9A 4RWKA 4F0IA 2UZEA 4IWPA 1M7NA 3CJFA 2GPHA 2CDZA 3ALOA 2OJJA 4I41A 2XK7A 3VNTA 3GOKA 4EORA 2VX3A 4OTRA 3DKCA 4FT5A 2HZNA 4O7YA 3HDMA 4GUEA 1YVJA 4X2FA 3MY5A 3TXOA 2CCIA 5HIEA 1PXJA 4ACDA 1Q41A 2QOQA 5EI8A 4FR4A 4NH1A 3R7IA 4NKAA 2O5KA 5IKWA 1Q8WA 4DG3E 3OWKA 1FGIA 1FOTA 4G9RA 4FVPA 4LOPA 4MQ1A 4R77A 3ZM9A 4QNAA 3UVPA 4EH4A 2R0UA 2X6DA 4IVDA 3HMPA 3OWPA 5DEWA 1GY3A 4KIKB 3Q96A 4FKJA 4YLLA 4AAAA 3ZO1A 2LGCA 3JUHA 3WYXA 3LLAA 4EL9A 4FT0A 5H8EA 2VGOA 2B55A 3I6WA 5HLPA 4D9TA 3EQGA 3AD5A 5C9CA 3ULIA 4K9YA 4TYJA 5EH0A 4FV1A 3AC1A 1QL6A 4J71A 5KKRB 3VS7A 4FT9A 4TTHB 3UGCA 1OBGA 5EYCA 3N51A 4QPAA 5AV4A 3CBLA 3R9DA 3HAMA 4RJ4A 5HHWA 3VBYA 2GFCA 2XK8A 4A9SA 2Q83A 3CJGA 4FEQA 2WXVA 4FNYA 2OXYA 3K54A 1UWHA 3BU5A 2C0IA 3GU8A 4LM5A 3O96A 3OOMA 4AE9A 3A8XA 5LVMA 2VNWA 1R39A 5DWRA 5FG8A 4FTCA 4ANBA 4KUJA 1GJOA 2C68A 2IVUA 4BCIA 4J53A 4FV4A 2V7OA 2V5QA 4S31A 4DLIA 2C0TA 3I0OA 3MB7A 4QMZA 5TE0A 4RC2A 5AP4A 2PUIA 5LMKC 2WPAA 5IPJA 4LRJA 3KXHA 2HXLA 3ORXA 2NRUA 4FTJA 2IVVA 4FUYA 1PMVA 5BPYA 5HBJA 3QKLA 4BZNA 4JG6A 3ZC5A 2XBJA 2HCKA 5L8LA 2J0LA 5TKDA 3ZS5A 1NT2A 4CSVA 2WTDA 1ZMWA 4DFBA 3WE8A 1W98A 3WI6A 3CR0A 4WRGA 3HKOA 4W9WA 4AACA 5IMEA 3OUKA 3Q2MA 4YBKA 4E26A 3LQ5A 1ZYJA 3BGZA 4RA4A 3CEKA 4FI1A 5IDPA 3F5XA 4DA5A 5I0BA 3PY3A 2BFXA 2J0MB 3DPKA 3OWJA 4JDKA 3ZHPC 2BZHB 5JGBA 1FVVA 5DMZA 2HK5A 4RZWA 3DT1A 4LI5A 2XKCA 1A48A 3ZTXA 4TWOA 2FO0A 2IZUA 3UE4A 4DC2A 1ZOGA 3PJ3A 2OFUA 4Q9ZA 4BVUA 4TYGA 4AFEA 4OUCA 3UQCA 2YFXA 5D7AA 3CS9A 2A19B 3LXLA 3ORTA 2YACA 4EH7A 3PSDA 4JT3A 2VTRA 4EWQA 5KMLA 3MN3A 1OUKA 4UMQA 5D12A 3FC1X 3ZBFA 3NW6A 3W8QA 4K33A 4AW0A 5CALA 5LVPA 1SVHA 2G1TA 4QMXA 3LXPA 5EI2A 5J5SA 2W96B 3UQFA 5IQFA 4C62A 3QTWA 1MUOA 2E9UA 2XNOA 4KIPA 3AGMA 4OTHA 4PP9A 4ZTNA 3BX5A 4P5ZA 4UEUA 4FGBA 1M14A 2ERKA 1P2AA 3BBWA 3VC4A 3CSVA 3FHRA 3DXNA 4EHVA 4KSPA 3PJ2A 4QPSA 5HVJA 3GU7A 3PYYA 1XH5A 4EJNA 3DA6A 1Q4LA 2VUWA 2I7QA 1MQ4A 1GOLA 1IA9A 1XO2B 4YJVA 4ASDA 3BELA 4D5KA 2YAAA 1TQIA 2B9IA 2P0CA 3G6HA 5ETAA 3NUSA 2QKRA 5HD4A 4M0ZA 5C8NA 3Q9ZA 1FMKA 3I79A 4RVKA 4TWCA 3GC8A 5IA3A 2YZLA 2IO6A 3P78A 5D41A 2BZKB 5BYYA 3R00A 2BRNA 3UYSA 5K5NA 4H1MA 3VHEA 1JVPP 3E8EA 4I0RA 3W55A 3BE9A 4G5PA 3KQ7A 4FK3A 2V0DA 4A06A 4OGRA 3RMFA 4Q9SA 4IMYA 4LGHA 2FYSA 4EK4A 4GMYA 3BYVA 3DAEA 2JDVA 5JH6A 1UU8A 4BIBA 1H27A 4AOIA 1LEWA 3N4TA 1SYKA 2F2UA 3OOGA 3VUIA 3SOAA 4D0XA 3DGKA 2VWWA 3BIZA 3HA8A 4HZSA 5DA3A 5AM6A 5HLWA 5AUXA 3UBDA 4BKJA 5CTPA 4PDSA 4D0WA 3L9NA 2GSFA 5CSHA 3G0FA 4A4LA 2X2MA 3ZXTA 3HMIA 4MAOA 4NJ3A 4GFMA 5FTQA 3DB8A 2P55A 4BDFA 4F1MA 2R3HA 5K9IA 5AUYA 2XP2A 5I9WA 4CFXA 4WNMA 2ITTA 3IW7A 3QGWA 2ZM4A 3OCSA 5B0XA 3FKLA 4EK6A 3FJQE 4TZRA 5F94A 3BWJA 3VS6A 3E3BX 2WTJA 1KSWA 4FOBA 4BHNA 5AM7A 1B6CB 3FMDA 3FKOA 2OZAA 4PNKA 3LXKA 3IO7A 2HIWA 4EZ5A 2YDIA 1HCLA 3F5UA 3KK8A 1IRKA 2X8IA 5F4NA 2PL0A 1R0EA 3KFAA 2WOUA 3LFEA 2BFYA 2R3KA 4LV5A 2PVNA 3U9NA 5J95A 3RZFA 2C6DA 3SKCA 5AA8A 4FKVA 4IAIA 3UZTA 3TG1A 4ZSEA 3EFWA 5CZHA 2JIIA 4IAKA 4GH2A 3UP2A 4GU9A 4HZRA 3TDVA 2C5XA 1JSTA 2GMXA 3GBZA 1B38A 3F69A 3FXZA 5HLNA 3BWFA 2GQSA 3IGGA 2YJSA 2UZTA 2W05A 2W06A 2W1EA 1RE8A 2EWAA 3NNWA 3OEFX 2X6EA 3VUDA 4CKIA 3MH2A 4M68A 4ZS0A 4AT5A 4IAZA 3ZLXA 1JWHA 2E9PA 3PJ1A 3SLSA 4QYYA 4APCA 5BVNA 4RVLA 5CEOA 5E92A 3V5PA 3NMUF 2IZRA 4QP2A 1YI4A 3CQEA 1QMZA 4WNPA 4PV0A 2R2PA 1UA2A 3P4KA 2FSTX 3VS5A 5BMMA 2YCSA 2JLDA 2H8HA 2ITYA 3FY0A 4UALA 4EK8A 2VWBA 2VWYA 2ZJWA 4HCUA 4FTNA 3F3ZA 3P7CA 3ZOSA 2NO3A 3AXWA 5IQGA 3EB0A 2WQMA 5IZFA 5E8ZA 5E8VA 1A9UA 3VF9A 4FKUA 4TWPA 3COKA 3F66A 2RFEA 2PMLX 1XH9A 5AWMA 2JDTA 2UZOA 3VS4A 3LJ2A 5J1WA 4N4SA 5E1EA 3TUCA 2OIDA 3KKVA 2NRYA 2KULA 4FKQA 4FX3A 2E2BA 4E5AX 4UN0C 5C8KA 4CFFA 2J6MA 5C1QB 1Q97A 3GCQA 4N6ZA 3O71A 2XRWA 1KUTA 2X0GA 4CG9A 4F9CA 4LQMA 4NM7A 4XUFA 3FI2A 2OFVA 4AGUA 5M4FA 2PWLA 3DNEA 1QPJA 3QD2B 4TYEA 4G3FA 3UIMA 4BBEA 3O2MA 5HO6A 2C6IA 3Q4UA 4MYGA 4PL4A 3WOWA 3UNJA 4Y85A 5AP6A 2GS6A 4R7IA 4BCNA 3RI1A 3A61A 3NS9A 2W1IA 3U54A 1LP4A 2OH0E 3PXFA 3D7TA 1ZMUA 3EKNA 3ERKA 5HO8A 2Y7JA 3EQDA 3ZLWA 4J97A 4K2RA 4ZTHA 4XMOA 4BKZA 5ANIA 4ACCA 1GAGA 3RAKA 4E73A 4EH2A 3ZH8A 5IDNA 1LR4A 1G3NA 2X4FA 3UMWA 3UNZA 2PMIA 2OLCA 1XH6A 4KRCA 1JBPE 2R3MA 2OWBA 3SV0A 3ZCLA 2BMCA 2F4JA 3FMKA 3FYKX 1ZYLA 3L1SA 4FODA 4IANA 3BU6A 5TO8A 1BL6A 2IW9A 4YJTA 2HW7A 3ZYAA 5AAEA 1DI8A 4G3GA 4IWOA 3GNIB 5HU3A 4G5JA 4X2NA 1QPDA 4CV8A 4YMJA 1HOWA 2VX0A 5ANOA 5GJDA 3MBLA 2WQBA 2RG5A 3PXRA 2G2IA 3CC6A 4DEHA 4YJPA 3ZUVA 4OTWA 4RBLA 4I4EA 4C3PA 3TACA 4LMNA 3E7VA 2WMVA 2YM8A 3NAYA 4JBVA 5K0KA 2WO6A 3KN5A 4ITJA 1UKIA 4F7JA 3BHHA 5K5XA 2C6KA 3OBGA 3PVWA 2OF4A 3C9WA 4ZLYA 2BZJA 4FEXA 2J51A 1K9AA 4V0GA 4ZK5A 4AN2A 4DEEA 4F7LA 1WBOA 1J7LA 5A9UA 3UIUA 3C4WA 4FBXA 2UW0A 4C58A 4FNXA 4QP7A 3P79A 3R21A 4JJRA 3BE2A 3UODA 4O1OA 4EHZA 3MJ1A 4ZLOA 2PMOX 2XEZA 4QP8A 2F9GA 2HAKA 2WU6A 4I0SA 3OT8A 3RZBA 4QYEA 5E7RA 5HE3A 4ZJIA 3GQLA 3O0GA 4O0TA 3R30A 4CTCA 2QVSE 1JLUE 5KMIA 3MIAA 2VWIA 3HDNA 4C0TA 3LOKA 5FWKK 5LVNA 4YSJA 2ZM1A 3UDBA 4XP0A 3GCVA 5JMSA 3KXMA 2O64A 1W82A 3LCKA 4U80A 4ANOA 2WMUA 1PKDA 4Z16A 1OITA 4U5JA 2UW4A 5KZIA 3FSFA 1SZMA 3QQHA 4PUZA 4PTGA 2OKRA 3MB6A 4RMZA 4RG0A 5EM8A 4F09A 3HLLA 2PE2A 1NW1A 3LFCA 2FSOX 3HP2A 4TW9A 4AG8A 3M1SA 4FE2A 3MTLA 3GU6A 2C5NA 4GFGA 4QMVA 4XV2A 2J9MA 4FTTA 2XMYA 4A4XA 3V3VA 2X9FA 3P7AA 4ANSA 3V51A 3HA6A 4KBAA 4IIRA 4FTUA 1Q8ZA 4APPA 4ASEA 4MWHA 4E4LA 4A4OA 4E5BA 1BLXA 4JX7A 5BVEA 3RAIA 4IDVA 5M09A 1OL7A 4F6SA 4CYJA 3NCZA 1WBWA 5DVRA 4CT1A 5CF8A 1F3MC 4YBJA 4ZXTA 5KMMA 2QOCA 3NZ0A 1AQ1A 2C6MA 4DT8A 3NDMA 4B4LA 3PXZA 4XG4A 1Q61A 4L00A 4QMPA 3E88A 3ORLA 4ZJJA 3ORMA 2IZSA 3A4OX 4Y72A 3ZRLA 5JK3A 3HV5A 1TKIA 4NIFA 4EEVA 3FL5A 1PJKA 3E8CA 4CFNA 4OBPA 2YDJA 3Q4ZA 4C35A 3OY3A 4YHFA 3I1AA 3PVGA 4W4VA 4HVHA 3A7FA 3U6IA 5IQCA 5LWMA 3T9IA 3NGAA 4C4IA 4DH5A 5HTIA 2UW3A 1FVTA 1ZRZA 5JZNA 2UW8A 3OW3A 3ZU7A 4MKCA 1SVGA 4EZ3A 4LOQA 1JOWB 1NY3A 1YXTA 2O63A 2I0YA 4JRNA 2YIRA 3V8SA 3HEGA 4UXQA 4AWIA 3T3VA 4X3JA 5CASA 3UOHA 4ARKA 2XB7A 4O0YA 4P7EA 2XNPA 4IDTA 3I5NA 5J87A 3UZPA 4J98A 4ZP5A 3VVHA 3HV3A 3Q9WA 4FSMA 4CKRA 1OPKA 4WG3A 3ZONA 5DGZA 1SNUA 4WBOA 4FA2A 3DS6A 2J0KA 3CPBA 3DK7A 4OTFA 4BL1A 2PZRA 3DQXA 4OBOA 3I7CA 4N0SA 2P3GX 4QOXA 4ZZNA 2GHMA 1U54A 4X6RA 5A4CA 5AA9A 1PXPA 3ETAA 3Q04A 2OK1A 2IG7A 1VR2A 4YURA 3LQ8A 4XP2A 1W0XC 4M84A 3C4CA 3H0ZA 4RIWB 4WKQA 2YLEA 4F08A 2QHMA 5HNGA 4D5HA 1R1WA 3TZ7A 3QCSA 3FC2A 4FF8A 2PVJA 5A46A 3EQCA 5E1SA 2YM6A 2ETKA 4F4PA 4IH8A 3CE3A 4G9CA 4JR7A 2PPQA 1V1KA 4G31A 2VTHA 5E9EA 1APME 2A4LA 4AA0A 2YIXA 3KK9A 4XP3A 5CY3A 3BYMA 5H9BA 2I0EA 1R3CA 4AA5A 3PIYA 3BYOA 5IH4A 3U87A 4RLKA 3QUDA 3GC0A 4FKGA 3EFJA 4PX6A 1V0BA 3BHVA 4UBAA 5HI2A 1OM1A 3QXOA 4FT3A 1ZY5A 5AP7A 5A6OA 5B2LA 3GVUA 3QKKA 4OR5A 4ALUA 5E8YA 2VTPA 3C50A 4ZTMA 4X3FB 3N9XA 4Z7GA 5BUEA 1JAMA 4LYNA 4AZEA 5L2WA 2VN9A 3D9VA 4YZ9A 3AMAA 3KRJA 5A54A 5F1ZA 3OY1A 5FRIA 1E1VA 4TYHA 1I09A 3ODZX 4W9XA 2ACXA 3GT8A 4QNYA 1O6YA 3RVGA 4DEDA 3GU5A 2UVYA 4GKIA 4Y8DA 1DM2A 3MA6A 3HRCA 4IC7A 2VAGA 2W1FA 4H36A 3T9TA 4BCJA 3DB6A 4DH3A 5FP6A 3NIZA 5M56A 4BWKA 3LFAA 3F3UA 4QTDA 3QTXA 1MQBA 3BYSA 5E8WA 4QP4A 5GZAA 1YXXA 2YEXA 2Z02A 4EBWA 2YISA 4V05A 3TTIA 5C4KA 3OCTA 4D1ZA 3D2IA 4M69A 2E9NA 5EHLA 2J0JA 1BI7A 1XBCA 4YZBA 4UMUA 3ROCA 2QHNA 3AMBA 2WQOA 3MA3A 4JL9A 1VYZA 5C4LA 4PQNA 3BHYA 2I0HA 5AAFA 3HMMA 4BHZA 4BTMA 3Q9YA 4C38A 5M57A 3PP1A 4FKTA 4BDCA 5JFXA 1OB3A 4OT5A 3MSSA 3V5QA 1SM2A 4MNFA 4IWQA 4AT3A 4XG6A 4F9YA 4RIOA 3DY7A 1YKRA 2R3LA 5HG8A 2BDWA 1YI6A 3DKFA 3HNGA 3LFDA 2AC3A 4XX9A 5EKNA 4NL0A 2R7IA 1H1WA 4GFOA 3BBTB 2C69A 4BBMA 1Q8YA 4AOTA 5EKOA 1RDQE 1MP8A 1O6LA 4PRJA 4CEGA 1WVYA 3DNDA 1SNXA 2XYNA 3OEZA 1PMEA 4M66A 3ANRA 2UZDA 5EM7A 2JDSA 4LMUA 4U97A 2C30A 4FEWA 1IAHA 5FM3A 3R2YA 4W4XA 3IW6A 4U81A 4CNHA 3CY2A 4UZDA 2C0OA 2VO7A 4GK4A 4XV3A 3W1FA 4L8MA 4Y83A 3CKWA 4YJUA 4LUDA 4AZSA 1Y8YA 2EB2A 1WZYA 5AV0A 4I6BA 3AGLA 4ONAA 4IBMA 3TDWA 3K3IA 5JEBA 3LCSA 4PPAA 3EYHA 2R3RA 2C6EA 3OROA 3PXQA 4PTEA 4D1SA 3C5IA 2HYYA 3BEAA 4GL9A 5L6WL 2PVMA 3FDNA 4HVGA 5M51A 5BMSA 3PXYA 4C8BA 2RFDA 3R73A 5ITAA 2YWPA 3MH0A 1GIHA 2JKMA 4BCQA 3GFWA 4GT4A 4XHKB 5CF4A 4FT7A 4A9RA 4EKKA 3EIDA 1REKA 4ZOGA 2OXXA 4M67A 3LCDA 1FQ1B 2XEYA 4ZSGA 3EYGA 1H0VA 4BI1A 3TZMA 4GYIA 1CM8A 5HG7A 4HCTA 3Q60A 2IVTA 3ZMMA 4MNEA 4ZTQA 4MXAA 3OWLA 4FTOA 3SQQA 3W2OA 2VWUA 2GTNA 4CFUA 5M06A 2UV2A 2B53A 2IJMA 2O65A 1YDTE 1OKYA 2PTKA 3PSCA 3UOLA 4C57A 3F5GA 5IH5A 2J5FA 3B2TA 3DKGA 3MWUA 3GI3A 2GHGA 1YHVA 3TV7A 4BF2A 1UV5A 5GINE 5JRQA 3R2BA 3TV4A 4R5YA 5M55A 1PRYA 3DV3A 4BDKA 2W0JA 4C2WA 4DGLC 2ITXA 1BX6A 2R5TA 2BKKA 2R0IA 2X9EA 4LRKA 4IC8A 4PDPA 2UW6A 2HW6A 3FQSA 4RIXA 3UO4A 3IS5A 4AE6A 5J79A 4HPTE 4JVGA 2XCKA 4EK3A 4RT7A 4QQCA 4E8AA 3COMA 4DFNA 4MHAA 5EOLA 3ATSA 5AR5A 3PJCA 2XK6A 4BCFA 4H3BA 4CCUA 3ORIA 4AS0A 1YOLA 4EYJA 1F5QA 1V0PA 2XNBA 3EHAA 4HNFA 3IDCA 4QMYA 3KULA 4O6EA 4WA9A 4XLIA 3U6HA 1H07A 3I6UA 5CEQA 3R71A 5AUWA 1VZOA 3RNYA 4D2WA 2OXDA 5JGAA 4MD9E 3LIJA 3ZM4A 5HESA 3Q4CA 4GU6A 4BCMA 2IVSA 3QC9A 4YO6A 5KCVA 5KMJA 3OUNB 2J0IA 2YA9A 4FZ7A 2PUUA 4MWIA 2J2IB 4Y5QA 5GZ8A 4XNEA 3BGPA 3V01A 1WMKA 1JQHA 2UZBA 1S9JA 4F1TA 3KXNA 3UG2A 2WMWA 4G3CA 5AP3A 5HKMA 5LCJA 2XIKA 4XRJA 4R3PA 4B99A 1PXNA 4AGCA 5IA2A 5CNNA 4TKSA 4G3EA 2RL5A 3QZGA 4ORKA 1XHAA 4YPDA 5HX8A 3EWHA 5HCYA 3DJ7A 4DITA 4EBVA 5FXRA 5LVOA 5A3XA 3IG7A 1E1XA 4IB5A 1JSVA 3F6XA 4IXPA 1YXVA 3R9HA 4OTPA 3ORNA 3WF8A 2XNGA 4YLKA 3PFQA 2WQNA 3CY3A 3PY0A 4FV7A 4NFMA 4F1OA 3C0HA 4LV8A 2WTKB 2Z7QA 1OGUA 1P14A 2ITWA 2WMTA 3PA3A 4USDA 5EG3A 4WG4A 5L8JA 1UNLA 3O8TA 4YZNA 2PU8A 1YW2A 2GNHA 4EH6A 3U55A 3K3JA 2PVRA 4CFMA 5HZNA 2G9XA 4O7SA 1XH7A 3S2PA 2YCFA 5TR6A 4BTJA 3ZFYA 4K0YA 4BY9E 3SG8A 3MFUA 3TNWA 1XBAA 2UVZA 3EOCA 4IADA 4O6LA 5AR3A 1TQPA 2WQEA 3I4BA 4QTAA 3RALA 4FTMA 4MXOA 3V6RA 5IUGA 3WF9A 4BCGA 3UOJA 5J8IA 4L45A 2A2AA 5CEIA 2ZMCA 2Z7LA 5AP0A 4YJQA 3UC3A 3MFSA 3RJCA 3DBEA 1ERKA 2ITVA 3DKOA 3KY2A 4ZSJA 4XS2A 2GNGA 4NW5A 5M53A 3PPJA 1Q62A 4QT1A 5LOHA 5AR8A 4DT9A 1Q24A 3TCPA 1WBNA 1IR3A 3PLSA 4RWLA 3LVPA 4AU8A 5HQ0A 5CX9A 3LM0A 2ZB0A 4GK2A 2XS0A 4ASXA 5KBQA 3SXSA 1OMWA 4AN9A 3R8PA 5EQYA 4QO9A 2JIVA 3KXGA 4PMSA 2ITZA 3IOKA 4J99A 5KE0A 3C51A 2BAJA 4U44A 1P4OA 1W84A 4KIKA 5HICA 3ROYA 2JD5A 4UWBA 4DEBA 4UMPA 4F70A 5JZJA 2E9VA 2REIA 4IAYA 4YTIA 4X21A 4BI2A 2FH9A 4E7WA 2EB3A 4BFMA 2W5BA 4ZZOA 4JRVA 1JSUA 2A27A 4K77A 4XH6A 3HECA 3K2LA 1ZMVA 3REPA 1WCCA 3R8UA 4CFVA 4F6UA 3NVKI 3O7LD 2Y4PA 4DE4A 3E7OA 4IX5A 4AP7A 5FEQA 4R3CA 5HU9A 2J5EA 4KS7A 5IEVA 2XNNA 4ALVA 5GIOE 2XZSA 4TXCA 2X7OA 4QQ5A 1NVSA 4R7HA 2QOKA 1UU7A 1CKJA 2BR1A 3QX4A 4N70A 4EUUA 3GGFA 4AZVA 3SVVA 3C13A 3OS3A 1MRVA 3POOA 4ZEGA 3QTIA 4ZS4A 1H08A 3TV6A 3QRKA 4YU2A 3TJDA 4KA3A 3HVCA 5CEKA 2DQ7X 3S3IA 3CIKA 5CU4A 2ZV9A 5FDXA 5AX9A 4ERWA 3GQIA 1WFCA 3ZDUA 5FD2A 2QOIA 3OMVA 4RVMA 1W83A 4TNDA 2Q0NA 3EN6A 4MXXA 4WUAA 1WVWA 4YZDA 3ACJA 5AIRA 5JT2A 4KNBA 1ZAOA 3GC7A 3HMNA 5IA4A 3U6JA 3QL8A 1BUHA 3NUUA 2O0UA 5EOBA 4PNIA 2BDJA 2HOGA 4RX9A 3NUXA 3R7VA 5E4HA 4RIYA 3P0MA 5FEEA 4M3QA 4C34A 3D5XA 2WIHA 3G9NA 4DEAA 4E4XA 4QYFA 4CFWA 3KGAA 1PXIA 3LHJA 4GIHA 4YUQA 5CAPA 5IH6A 4DCAA 2P33A 4JDIA 2WGJA 3ZEWA 5K3YA 5DFPA 2VTTA 5BVKA 4FIFA 2HWOA 3O50A 4ANQA 4O83A 4I20A 5BUJA 3GC9A 3WF7A 2NNWB 2UW9A 3BLRA 4YR8A 1H1RA 3E92A 4G1WA 3LMIA 4JAIA 4OTGA 3PPZA 4F9WA 3UTOA 4FSUA 3W16A 4I0TA 5B7VA 3KL8A 5FM2A 2VTJA 1PYXA 1W7HA 4AA4A 4P5QA 3IW8A 1P4FA 2CHLA 5A6NA 4BYIA 4IJ9A 1YQJA 3NR9A 3BQRA 2GTMA 4I5MA 4YJSA 5JRSA 3MVHA 3O8UA 3LMHA 4DBXA 4GJ3A 3QZIA 4AF3A 2Z2WA 3WYYA 5F95A 4U8ZA 4L7SA 2RGPA 4PY1A 4KKHA 1GZNA 4ZMEA 3AT2A 3RM7A 3VRYA 4BTKA 2ZV8A 5CAUA 1XH4A 3QHRA 4O21A 3DLZA 4JQ8A 3D7TB 3L8PA 4RX8A 3IONA 5GJGA 3M2WA 2WB8A 4FZAB 4A7CA 3UO5A 4MF1A 4NEUA 3CP9A 2CGWA 4QMSA 3R7UA 5FQDC 1ZLTA 2GCDA 5J5TA 1HCKA 3V5TA 4FSRA 4E6CA 2HENA 2VX1A 4E1ZA 4CZTA 5EYKA 2WEVA 3UG1A 4AFJA 3FV8A 2F7XE 4C36A 2QKWB 3HUBA 2ZOQA 1OIUA 3QUPA 4BDAA 3PIZA 5ANJA 5C03A 3G9LX 4IB1A 3R8ZA 1T45A 1Y91A 3R83A 2YM3A 3WE4A 2VO3A 2UZUE 4QMLA 3OD6X 5CI7A 5DI1A 1BMKA 1L3RE 3FBVA 3COIA 4NK9A 3NNXA 1RW8A 3R8VA 4EWHA 5KMNA 2HXQA 2OW3A 2FGIA 2BHHA 3ZC6A 4J52A 2RFSA 4LRMA 3NW7A 1JKSA 3P7BA 4IZAA 4M0YA 4HGLA 3W2SA 3MH3A 3OTVA 1S9IA 3QRIA 4TNBA 3BQCA 4DGOA 2FSMX 3QA0A 4OTIA 5IA1A 5BVDA 5KKRC 4O7RA 1M7QA 2BILB 4C2VA 4F7NA 3FLSA 5T6KA 3ORZA 5GJFA 2XK9A 3UPZA 3V5WA 4MVFA 4IVAA 4FTQA 2WOTA 4YNEA 4NKSA 3WBLA 4V0GB 4CRSA 2A1AB 3IDBA 3LE6A 4O7NA 4JG8A 4R1VA 4XV1A 4EOLA 4E20A 2JDRA 3C1XA 4EH8A 3KRRA 3CKXA 4O22A 5DR2A 3OC1A 4H1JA 4O2ZA 3ZUUA 3F3WA 2IPXA 2RF9A 4IAAA 4MH7A 4O0UA 4BDHA 4NYEA 3ACKA 4PPCA 2V7AA 3UMXA 3VBQA 2WAJA 3W2RA 2BDFA 2BIKB 3PUPA 3WARA 4PP7A 3PP0A 2YLFA 2W4OA 4MCVA 5M07A 2YABA 2YHVA 4O27B 3DBQA 2C3LA 4FSTA 1BKXA 2CKQA 4AN3A 2VV9A 4HJOA 4F9BA 2BALA 5M4UA 3E5AA 4RQKA 1UVRA 3RPSA 2H96A 3EN5A 3NIEA 5DT4A 4B7TA 4O7WA 2GFSA 2PZIA 3SDJA 2HZ0A 3KRLA 4LG4A 4H3PA 1KOAA 5HIDA 5M08A 2ETMA 1IEPA 1QCFA 3QQUA 4AZFA 5ANEA 3W10A 5LWNA 3IPHA 3GOPA 5F9EA 4UYNA 3ODYX 2W7XA 3EZVA 4EOIA 4UWCA 2VTAA 4OTDA 1H26A 4XJ0A 1FBNA 2Y4IB 4NJDA 2R3GA 4O0WA 3Q9XA 4E6QA 3S1HA 3AOXA 4O96A 1XH8A 1AD5A 3M42A 3W33A 5A4QA 3QQFA 5HG5A 2XKDA 5LCKA 1VJYA 4F64A 4Y73A 3LFBA 4GK3A 4EOPA 2BRHA 3VBVA 3CQWA 2VTOA 4D9UA 2QI8A 3SXFA 1O6KA 1YDRE 4BGGA 5HD7A 2WNTA 2PSQA 3D5VA 4HGEA 4NZWB 2X7FA 4RFMA 4F65A 1Z5MA 1KV1A 1OL6A 3QQGA 5EW8A 5KHWA 5C27A 4M15A 3DDQA 5I9YA 4EJ7A 3UNKA 2OZOA 4DINA 4HOKA 4NWMA 4XLVA 1KE7A 3GCSA 5I5ZA 1U5QA 4QMNA 3AC3A 2GDOA 4C4EA 5IMXA 3JY9A 1GIJA 1Q3DA 2QO7A 4DAWA 1IAJA 3PTGA 3R1SA 3VIDA 2X8DA 4I6FA 1CSNA 4S30A 4RWIA 4QD6A 4NCTA 1H1SA 2BROA 5G1XA 3TKHA 3QC4A 1H24A 4BDGA 4BCPA 4E6DA 4HNIA 3JPVA 2HWPA 2QR7A 3FLYA 4FMQA 4FICA 4NTSA 5L2IA 3TZ8A 1J1CA 2NP8A 4UB7A 5D7VA 5IQEA 4XRLA 2R7BA 2JITA 4NU1A 3RINA 2AUHA 4NM0A 4ACHA 1OVEA 2J7TA 4UYAA 1U54B 4I22A 2CMWA 4UZHA 4AOJA 4WIHA 1YWVA 3PA4A 4IX3A 3U8WA 4W8DA 3LPBA 3QD0A 3FPMA 2PY3A 5BX0A 2I1MA 4EOMA 3DLSA 2PMNX 3QLFA 3DBCA 3PE2A 4TY1A 4UV0A 5DOSA 5DT0A 3UPXA 3WZDA 4G16A 4CLJA 2PE1A 5M44A 2CN8A 2XIRA 2BKZA 2QNJA 4R8QA 3DTCA 5C8MA 1PXMA 2R3FA 4DN5A 2J90A 4L3PA 3FI3A 4PMTA 5E8UA 4GT3A 4D2VA 5ACBC 4DG2E 3BYUA 2RIOA 1JKLA 2HZ4A 3VUKA 3LQ3A 1OL5A 4C3RA 4QTBA 2XJ2A 5DE2A 2C5VA 3Q6UA 4DGMA 2B9FA 4OTQA 4W4YA 5KHXA 4ZSAA 2PZPA 2C3KA 3R7GA 3MYGA 2CGVA 3U4UA 3RCJA 4OAUC 5I3OA 4CMOA 3Q52A 1YWRA 2OIQA 5HVKA 3KA0A 3ET7A 4XG8A 2UUEA 3H10A 1JKTA 5A4TA 3HL7A 4ZTRA 1YHWA 3KXXA 3PG1A 3COHA 3DAKA 3F5PA 3RPYA 1EH4A 4NSTA 4DFLA 4JQEA 2AC5A 4TL0A 5DT3A 2A0CX 3TZ9A 2ZMDA 3MV5A 3R04A 4FV2A 4JDJA 5CVGA 5JFSA 1ZYDA 4YPSA 3TL8A 3UP7A 1JNKA 4KKEA 4EQMA 1K2PA 2O3PA 2W17A 4GT5A 4BDJA 5IQAA 3P23A 3EQBA 3NUYA 3SAYA 2FA2A 4N6YA 4F99A 2XH5A 3EZRA 4M8TA 3ZUTA 2B0QA 3CGFA 5T68A 2EVAA 3R7YA 2WMRA 4C4JA 5L6OA 3UZRA 4K18A 2PZYA 2R3QA 3QCQA 4FTAA 3ANQA 3F9NA 4IB3A 4IAFA 3NLBA 3NPCA 1H00A 3SGCA 3TNIA 4DTKA 2WMQA 5CSPA 1MRYA 5CNOA 3AQVA 2VWZA 3OZ6A 3FMHA 1UNHA 3C0IA 3D7ZA 3L8SA 3UO6A 5I4NA 3K5UA 5M4IA 1OBDA 5AUTA 4EUTA 2YDKA 5HVYA 1Y6AA 3OTUA 2XKFA 3BU3A 3FZOA 4KINA 5EQEA 4PWNA 5FTGA 3H0YA 1YOJA 3CXWA 4WD5A 4U6RA 2BZIB 3RP9A 4ZMFA 3R22A 3FLNC 3V6SA 5HE2A 2EXCX 3NYVA 2WTWA 3IKAA 3VWAA 3JR1A 3G0EA 3MDYA
chains in the Genus database with same CATH superfamily
3WZJA 2QC6A 2RG6A 2FSLX 3L8VA 3MPMA 5IF1A 4JXFA 2XAMA 3W32A 3NSZA 4C7TA 2GNLA 4N57A 4QRCA 3RGFA 2P2IA 4MF0A 5EHYA 3R7OA 4FYNA 3R63A 3OHTA 3A7HA 4FG8A 3QWJA 4I5CA 1H28A 1W8CA 4JS8A 5ANDA 5E8TA 3V5JA 3NNUA 3E87A 5I9XA 3FLZA 4O0RA 3P9JA 3KEXA 4CV9A 4BR3A 4UMTA 3EQFA 3NCGA 3DFAA 3MVJA 3QRTA 4K8AA 4D28A 4JIKA 5TF9A 5BYLA 1J91A 3QTSA 3B8RA 2CKEA 4FKIA 3ZEPA 3HRBA 5CAQA 2ZDTA 2GS7A 2QODA 2VTNA 4YTHA 2VU3A 4U43A 5FUTA 4MXYA 3FEGA 3DOGA 2WTCA 4O7VA 2B7AA 3P86A 4CZUA 3FHIA 4NCTC 4RX7A 2XK3A 4BDBA 3ZFMA 4C3FA 5JFWA 4U9AA 3KF4A 5AP5A 2Z60A 4CLIA 5KNJA 3D5UA 1FGKA 1M17A 3IDPA 5AR2A 3PVBA 3ZLYA 4ENXA 4M12A 2FB8A 5AX3A 2Z7RA 3ORPA 4DFZE 1H01A 2YITA 3P1AA 4YC6A 1U4DA 4FIEA 1STCE 3RKBA 2XVDA 3ZRKA 4IACA 4II5A 1PXLA 2QO2A 3WZUA 3H30A 3Q32A 2GNJA 3PWDA 2CNQA 3Q2JA 4L7FA 4RWJA 4MEDA 5CXHA 5EK7A 3EQPA 5HTCA 1GZ8A 3FYJX 4U40A 3U4WA 1FMOE 4DGNA 4Z3VA 5LJJA 2JDOA 3DFCB 4O0VA 3PDTA 1WAKA 2X0OA 4GJ2A 2C4GA 3GENA 4YC8A 2W1ZA 2OJFE 3Q53A 1AGWA 3TIZA 3W8LA 3KU2A 4TPTA 5D1JA 1NA7A 2JAVA 4K6ZA 4PMMA 5AR7A 5H2UA 3SRVA 2R4BA 3NYXA 3EQRA 3JXWA 4L43A 4O2PA 2WELA 4BGQA 2CNVA 4NW6A 4IQ6A 2XNEA 4RVTA 4PDYA 2VGPA 4MXZA 2Y8OA 4IEBA 4RIWA 3R8MA 1H4LA 1OKWA 4IVBA 3ZO4A 2CNUA 1TQMA 3D15A 3PVUA 4MTAA 3FMMA 4JG7A 5H8GA 1KOBA 4KBCA 2PHKA 3MGYA 3CD3A 3LMGA 4D4RA 4LGDA 3LKMA 4L9IA 5DH3A 4QEBA 1U59A 4TRLA 4RIXB 5L2TA 4E6AA 3HAVA 2QU6A 2OU7A 3MH1A 4R1YA 5CVFA 4HYIA 2XNMA 4FL1A 5BQ0A 3QBNA 2V62A 4KWPA 3VW8A 5A4EA 5CWZA 3GUBA 1YI3A 4RZVA 4C4FA 4DFUA 4EZ7A 1WBSA 3FPQA 3JY0A 3QTUA 3THBA 2GQGA 3ZZWA 4KB8A 3OBJA 3Q4TA 5CAOA 3QKMA 4L3LA 1PXOA 3PY1A 4AXEA 4HVSA 1RQQA 4FZ6A 4BB4A 4J95A 2EXEA 3CTJA 2R64A 3ZBXA 5FGKA 4O81A 3W2CA 4BI0A 1VYWA 1CKPA 4BZOA 4J8MA 4X3FA 4BCOA 4ZAUA 2F49A 4QQJA 5CU3A 4C37A 3FL4A 3V5LA 3MY1A 4AGWA 2SRCA 2XA4A 3S0OA 3LW0A 4CTBA 3QQLA 4KD1A 2ZM3A 1ZZ2A 3AT4A 4RJ7A 3FKNA 2AYPA 1QPCA 3ATTA 3ENHA 5EW3A 4AUAA 3G6GA 3TEIA 5HIBA 3FZPA 4EOQA 4EQCA 4YTFA 3QGYA 5AADA 4BIDA 2OBJA 2OIBA 2F57A 4I6LA 4L68A 2XUUA 3HX4A 2BCJA 4G6NA 5EM5A 2ZDUA 4DEIA 4I21A 3R9RA 2Q0BA 5A4LA 3N4VA 1WBTA 4FKWA 2R3NA 3MY0A 3A62A 5EFQA 3RAWA 3QF9A 5JFVA 2R3PA 4X2JA 3FLQA 4F78A 3PZHA 2X0QA 4QMUA 4J8NA 4S33A 1FVRA 4YGAA 2YIWA 2XALA 3FI8A 5K0XA 4I93A 4L53A 3NX8A 4HYSA 4LUEA 4TYIA 3WZKA 3LCOA 3QWKA 4XOZA 3CQUA 4FKSA 3OP5A 3NWWA 1OIYA 4S2ZA 2UVXA 2O8YA 2RSVA 4RC3A 3KMMA 1U46A 4L42A 4MBJA 4QMWA 4FV0A 2BHEA 5KZ0A 3PIXA 2IW8A 2W99B 3E8NA 4S32A 3SC1A 2UW7A 3QD3A 2YCRA 3ZSGA 3ENMA 4R5SA 4IZYA 3H9RA 3DU8A 4QPMA 4QQTA 4P4CA 5IA0A 3O17A 4FSZA 3VW6A 3PSBA 2YIQA 3KMWA 4JOAA 5FXSA 3SOCA 3OCGA 2W9FB 5G6VA 2IN6A 5J9YA 2WHBA 3BPRA 2KTYA 4E93A 3DBDA 3LJ0A 4U7ZA 4FIHA 5DHJA 2HY81 4ZTLA 4R78A 5ANGA 5DYJA 3CTQA 2XIXA 4HCVA 5EI6A 4IX6A 1JKKA 4G3DA 5CF5A 3RK7A 1XMMA 5IQHA 3OVVA 4FL2A 2CGUA 3KF7A 3DCVA 3MTFA 5CSWA 4C4HA 3MIYA 4TN6A 3D5WA 4O7ZA 2XKEA 4MD8E 2C3IB 4FTIA 4O0SA 3MESA 3MVMA 4J96A 2IW6A 1XBBA 1PYEA 5GNKA 4B6LA 4BZDA 2XIZA 3R9OA 1H25A 1Y6BA 2OICA 2X39A 3FAAA 2ONLA 3LFSA 4FIIA 3QTQA 4ZY5A 4RA5A 4EI4A 4CKJA 4NUSA 3LM5A 5I9ZA 1XJDA 3LAUA 5BV3A 3WZEA 3D83A 4H39A 3D2KA 4X2GA 5HEZA 4FTLA 3UOKA 4KRDA 5IA5A 4E5WA 5BNJA 3FE3A 3VONA 4BDIA 5AUVA 1YRPA 4C4GA 3FMLA 3VBWA 4MK0A 3ZLSA 4JBPA 3RWPA 1Q8UA 1J7IA 2X8EA 3QTRA 2W1DA 3BV3A 3FUPA 4RJ6A 4QP6A 5CXZA 3BGQA 4FG9A 4O82A 3QCXA 2QLQA 2WZJA 2CCHA 5B2MA 2W5HA 2QOLA 2QD9A 3RTPA 2YJRA 3MPAA 4XCUA 4A9YA 3EFLA 3B2WA 2VTMA 5DIAA 1PF8A 3VS3A 2X0PA 4FJVA 5F20A 2PVLA 1Q99A 4B9DA 1SVEA 3VF8A 3GXLA 5DNRA 2BRBA 3M11A 4RRVA 4GG5A 2YERA 3DZQA 1OECA 2GNIA 2W5AA 4PPBA 4RJ8A 5GHVA 4RJ5A 5KBRA 4G6LA 4ACGA 3W0MA 5DR9A 5KMKA 3V8WA 3ELJA 4FTKA 4FVQA 2ITQA 4X3FC 2I40A 3FSKA 5J1VA 3I7BA 3AD6A 3EJ1A 3H9FA 3HV6A 4C59A 3DDPA 3QZFA 5L4QA 2B52A 2DUVA 4RC4A 4M14A 4I5PA 2YCQA 5CU6A 1UNGA 4O38A 5CZIA 2X7GA 2H6DA 3MFRA 3SHEA 2UZLA 3AD4A 5J7BA 1WVXA 2XJ1A 1ATPE 3D94A 4RIYB 5DR6A 4OT6A 3VQHA 3E64A 4QTCA 2QOHA 3VAPA 1NVQA 4G17A 2PVKA 2WMBA 4FTRA 3W2PA 4D58A 2WFYA 2UZNA 2OZAB 4GW8A 4NM5A 4IM2A 3AMYA 4FZFB 3KMUA 3NRMA 1GZKA 3R1QA 3MVLA 4U0IA 2VD5A 3ORKA 4XYFA 3UVRA 1DS5A 4M7IA 5DPVA 3DBFA 3IECA 3NEWA 3U9CA 4F0FA 3TM0A 4WNKA 4RGJA 5TOZA 4H58A 3S95A 2YIYA 3AC4A 5FEDA 3ZFXA 4GEOA 2EUFB 3IOPA 4MBLA 4RSSA 5AV2A 4YTCA 2O2UA 2JKQA 3AKLA 2OI4X 4BTFA 3FY2A 1Q8TA 2BTSA 2LAVA 3CTHA 2VNYA 3FZSA 1UKHA 1G5SA 2ETRA 2IZTA 3F3TA 3KRXA 5E8SA 3DXPA 3C7QA 5HNIX 1BL7A 5ACKA 4F63A 2W9ZB 1VEBA 2B9JA 2Y6OA 4FNZA 4KS8A 2G15A 3C4ZA 4MBIA 5IEXA 4IJPA 2YAKA 3JVSA 1QPEA 3F2AA 4OW8A 1Y57A 4O7LA 3RHXA 2JC6A 5IUIA 4CXAA 1E9HA 4RPVA 3DTWA 3A4PA 4W4WA 4EH5A 4DTBA 4FIGA 2FVDA 4UY9A 5AV1A 1ZOEA 3L9LA 4TT7A 3VHKA 1ZYCA 3ALNA 3QRUA 4FOCA 4FKLA 3VJNA 5HE0A 3BHUA 5LMAA 3QXPA 3G5DA 4X0MA 3F2RA 4XG3A 5LVLA 3R1YA 3SX9A 2ZV2A 4GVAA 4JBQA 3ZXZA 4IZ5A 3GEQA 2R3OA 3QYWA 2JAMA 4L67A 5E8XA 3QA8A 4XBUA 5AR4A 5FTOA 4RFYA 4HGTA 3EL7A 2C1BA 3KB7A 3HP5A 4AXAA 4C33A 4DFYA 5CANA 2QOFA 3KCFA 3P5KA 1KE5A 1ZY4A 3GP0A 2NPQA 4BN1A 3CD8A 1KE6A 1CDKA 3EL8A 4U79A 4DH1A 5AEPA 3OCBA 3I0QA 4WUNA 4Y95A 5EYDA 3R7EA 3SW7A 3AC5A 2XM9A 3UC4A 5I9UA 1OPLA 2GS2A 4EOSA 3FQEA 3P08A 3PRFA 3VBXA 2ESMA 2WMXA 2WMAA 3FQHA 4YC3A 1PY5A 1X8BA 2B9HA 4LL0A 4W8EA 2ONLC 2PVFA 4D4SA 4G34A 4D2PA 1YXSA 2WIPA 4QYHA 1DAYA 1G8SA 3EQIA 4E4MA 3QUEA 4LL5A 2F7ZE 5FLFA 3EH9A 1UU3A 3NFGB 5L3AA 4DFXE 1ZXEA 4L6QA 5CQUA 2OGVA 1WBVA 2QCSA 2VTLA 3PA5A 4K11A 4DGGA 2PE0A 2ZYBA 3FMNA 5HO7A 1REJA 4MX9A 2HY0A 4BRXA 3Q5ZA 2H34A 4M97A 5LQFA 3L8XA 3BI6A 4V01A 2VZ6A 3RPRA 2BUJA 4BKYA 5AV3A 4UMRA 3TNQB 1IA8A 2PUPA 1CKIA 4WNOA 4GRBA 4ANMA 5EQPA 4YZCA 4IHPA 5HBEA 1WBPA 4FV3A 2BVAA 3IW4A 2OJ9A 2F7EE 5JN2A 2PVYA 2WKMA 5JQ5A 3MW1A 5CENA 2WTVA 4JI9A 4F9AA 4NT4A 3ID6C 5D10A 4KIOA 3QYZA 4MD7E 4A9UA 4ANLA 5AUZA 1F0QA 2GHLA 3LJ1A 5CYIA 4P2KA 4EHGA 4AAYA 3CLYA 3D0EA 4G2FA 4BDDA 3OW4A 3BLQA 4H05A 3A7IA 4CYIA 1MRUA 3RNIA 3BV2A 3F88A 4D2TA 3DK6A 4K1BA 4J7BA 2BRGA 2RFNA 3ZRMA 3V8TA 1XQZA 2VTSA 5HGIA 2HELA 3F61A 4AGDA 4QP1A 4YJRA 5L2QA 3LXNA 1BYGA 4O91A 2JKOA 3QX2A 1OL1A 2V55A 3QZHA 2VWVA 5DG5A 1J7UA 4U3YA 2JIUA 3O23A 4AZTA 2WD1A 5IG1A 4FIJA 3BCEA 2F2CB 1Q5KA 2ITPA 4ID7A 1OUYA 5KO1A 1DI9A 3RK5A 3TNHA 5LXMA 3EMGA 3KREA 3NUAA 4QP9A 5HOAA 4LFIA 4WBBB 2BPMA 3VJOA 2QU5A 4YJNA 3AKJA 5AFVA 3DZOA 2JKKA 5CVHA 5HCZA 5B2KA 4JX3A 4Z55A 3ZSHA 4F6WA 4B0GA 4DH7A 3PFYA 3VBTA 4ZY4A 4I24A 3UDSA 4JNWA 1Q3WA 3PPKA 4FSQA 4YJOA 3FZTA 4ALWA 2XIYA 2ZVAA 4ITIA 3LFQA 4L46A 4M13A 3TN8A 3QFVA 1U5RA 1YWNA 1OIQA 3OXIA 1FINA 4D4YA 5I3RA 5AJQA 4EOJA 3PJ8A 5ETFA 1NXKA 4I6QA 3RK9A 3C5UA 2ITOA 3QLGA 4FKRA 2C6LA 4O0XA 1ZOHA 3TUBA 3TIYA 5HTBA 4FSNA 3TNPC 4JDHA 3G2FA 4D1XA 4EC9A 1H1PA 3E93A 4IX4A 2WTKC 4DYMA 4I5HA 3UIBA 4V04A 1XWSA 2ERZE 2C6OA 3SA0A 3RPVA 2EXMA 4HVIA 5AP1A 4WSYA 1A06A 4IVCA 4QP3A 5TT7A 4QDEA 4QTEA 3QALE 1G8AA 2YN8A 4FUXA 4MXCA 3JYAA 3MFTA 2C5YA 4IW0A 2VTQA 4UX9A 3TUDA 2J50A 3MPTA 4X2KA 5CEPA 2QOBA 4X6QC 1PKGA 4QMOA 4ENYA 5IQIA 2XJ0A 3NYNA 4G6OA 1KE8A 3E8DA 3HZTA 2IWIA 2ITUA 5DRDA 4RLLA 3VULA 4HGSA 3VQUA 2CKOA 1PHKA 1O9UA 5CT7A 2UW5A 4XG9A 4EK5A 4JAJA 5EDQA 4IWDA 4DH8A 4LGGA 5M4CA 2OF2A 5H3QA 4FSYA 3I60A 4ITHA 2W1CA 2ZV7A 4GIIA 4LOOA 3NW5A 3MI9A 4IZ7A 2JEDA 2HZIA 4GSBA 3TKIA 3I5ZA 4RX5A 2YZAA 3EQHA 4FV8A 2Y9QA 4XOYA 4FSWA 2IEWA 4AW2A 4EONA 3S00A 3L9MA 4EC8A 2BIYA 2CLXA 4AQCA 3ML1A 5HCXA 2RKUA 3PE1A 4PDOA 3NVMB 4HW7A 3VUHA 4GG7A 3WF5A 3PRIA 2XYUA 4X7QA 3BEGA 2VWXA 3PZEA 4DBNA 4NIFB 4NM3A 3RHKA 3Q6WA 2C6TA 3VS2A 4A9TA 5CLPA 4CCBA 4Q5EA 5KUPA 3C4FA 3PG3A 5CS6A 5EHOA 4LDTA 3FZRA 3ZO2A 3AC2A 1R78A 4D2SA 4ZY6A 4WHZA 4YSMA 2QURA 4FGRA 3FXWA 3O51A 2I6LA 3BLAA 2V22A 2W4JA 3UYTA 3Q5IA 1UWJA 4KSQA 4JLCA 1OL2A 2QONA 1W2CA 3FWQA 1KWPA 3I81A 3LZBA 4XBRA 4BIEA 5L2SA 1H8FA 3UJGA 2B1PA 3F3VA 2AEGA 3IQ7A 4BC6A 2CLQA 3DJ5A 4B8MA 3WIGA 2PK9A 3BL9A 3NUPA 5L6PA 1PMNA 2QOOA 1R0PA 3SG9A 4A07A 3VO3A 2WTIA 2GNFA 3DXQA 4O7TA 1XR1A 1YHSA 1NVRA 4E3CA 2XM8A 3HV7A 2GQRA 3CCNA 2E9OA 3DJ6A 2JBOA 4PMPA 2UZWE 2X2LA 4CMTA 3IW5A 3EN4A 3V04A 3NYOA 1ZZLA 2BRMA 2XF0A 3R28A 3QU0A 4IM0A 5DEYA 1ZWSA 4XG7A 3ZZEA 4F0GA 4QMQA 3FZ1A 3F7ZA 3QD4A 4HYHA 3O7LB 2G2HA 4GYGA 3RBWA 4F7SA 3R8LA 4KAOA 5DLSA 5CEMA 3EN7A 4AT4A 3KC3A 1J1BA 4WSQA 3HRFA 5FBNC 4ZIMA 4I1ZA 3RWQA 2G01A 4CT2A 5C01A 3QHWA 2QO9A 4IM3A 2QG7A 3C4XA 4FV5A 4FK6A 5T3QA 5D11A 5FP5A 4ACMA 4BCHA 4EHEA 3SW4A 3GCUA 4L44A 3PXKA 5EYMA 1PW2A 2WU7A 4FKPA 2BAQA 4IE9A 3QQKA 3R02A 4PTCA 4AW1A 4YO4A 5BVFA 5FDPA 4Q2AA 1GIIA 4L01A 5HNBA 2VTIA 3UVQA 4DG0E 2W1HA 3ITZA 2P2HA 5FBOA 3VRZA 5AAGA 2JFMA 4JR3A 4BGHA 3H4JA 2OH4A 3FMEA 1YOMA 3KVWA 3TWJA 3GFEA 3SXRA 4O1PA 1PXKA 5AMNA 5ETIA 1SMHA 5KX8A 1KV2A 1UU9A 5JQ8A 2PZ5A 4L3JA 4D55A 3D4QA 5IU2A 2ZB1A 4TYHB 4ASZA 4CZYB 4EH9A 5A14A 1IG1A 3A2CA 5I9VA 3F82A 3VN9A 4Y5HA 4EH3A 4J1RA 4YZMA 4WRSA 4YP8A 2XK4A 2YWVA 1H1QA 1M2QA 4DTAA 4AZWA 3TTJA 4AW5A 5HBHA 3DAJA 4YHTA 3N4UA 2R9SA 4FEVA 2B4SB 3VUMA 4BDEA 4Z9LA 4DLJA 3R0TA 1L8TA 4JIAA 5DN3A 2OJGA 5GIPE 3ZSIA 4GKHA 3CGOA 3E3PA 3FLWA 4M69B 2BTRA 4ZLZA 4ERKA 4DHFA 5CF6A 4O86A 3A7GA 4HVDA 1FPUA 2BAKA 3FI4A 4FEUA 2JFLA 3C0GA 3QTZA 3R9NA 5H8BA 4EOKA 3VS1A 3R01A 3T8OA 2XRUA 4I3ZA 4Y46A 3VUGA 3UDTA 3CPCA 1M2RA 3HUCA 4MQ2A 3SRVB 4USEA 4TWNA 2B54A 2JBPA 2X4ZA 2YM5A 4QYGA 3SD0A 4CGAA 3KXZA 1Z57A 3F7WA 3K5VA 4FC0A 5DRBA 3JS2A 5FXQA 4NTTA 3F2NA 5D9HA 2OG8A 5K4IA 4L52A 1M2PA 3A7JA 5AP2A 2DS1A 4FKOA 4CQGA 1KE9A 1OKZA 4O84A 3DQWA 3OF0A 5IQDA 3U51A 4DEGA 2OJIA 1M52A 2G2FA 3II5A 3RPOA 4FZDB 4CD0A 4OLIA 3RM6A 1LUFA 4PF4A 1CMKE 4D4VA 5J7HA 2C47A 2OO8X 3QAME 4I23A 4GUBA 2YM7A 1LPUA 1XKKA 4RFZA 4UWYA 1RJBA 4OBQA 4FG7A 3KCKA 1H0WA 5GZ9A 2PUNA 4I94A 2J4ZA 3RAHA 3WIKA 4KKGA 3TJCA 5AIKA 3B8QA 3TT0A 3EN9A 2H9VA 3HYHA 4CVAA 4EYMA 4DF3A 1ZYSA 3VUTA 3S4QA 1OPJA 3KRWA 3GB2A 3MJ2A 1LEZA 1DAWA 5EDPA 3UQGA 3PLAE 1IASA 2ITNA 3BZ3A 5JSMA 2CJMA 3G15A 3R1NA 1OZ1A 4Q5HA 3WILA 4JQ7A 4CMUA 5CQWA 4FV6A 4AX8A 5BUIA 5CT0A 3G51A 3E62A 3Q3BA 3QCYA 4C61A 5JKGA 3A99A 3KN6A 3AG9A 2XCHA 3POZA 1I44A 3NAXA 4KBKA 4RJ3A 5IISA 4I92A 4CQEA 1K3AA 4BYJA 3OFMA 4FVRA 5CU2A 4FYOA 5CSXA 4R3RA 2C3JA 2QQ7A 3LLTA 4MNEB 3LCTA 4CRLA 5IUHA 5L8KA 4PL3A 1YDSE 4FL3A 4XG2A 5HG9A 4OAVB 3BKBA 2W4KA 5IEYA 5K4JA 2PULA 4RQVA 4BWPA 2JGZA 3C4EA 1PMUA 3ZO3A 3TKUA 4Z7HA 5LMBA 2C1AA 1URWA 5CU0A 3AT3A 2CGXA 4KIQA 4HPUE 4DCEA 5EM6A 2Y4IC 3G33A 4IB0A 2QR8A 4ZZMA 5HX6A 2C5OA 2Y6MA 1T46A 3HGKA 1URCA 4GS6A 4IFGA 4ZTSA 1OIRA 3O8PA 4EQUA 3VS0A 1OKVA 2VO0A 3NUNA 3FXXA 5CAVA 2X2KA 5J9ZA 3DK3A 3KVXA 4XV9A 3L9PA 4HYUA 2WEIA 2CKPA 2EU9A 3E63A 4H3QA 5ANKA 4E4NA 2OSCA 2DYLA 2R3IA 2I0VA 4GCJA 4S34A 3ULZA 4B8LA 4ANNA 2UZVA 4EOOA 4EKLA 4YNOA 1TVOA 3W18A 5ICPA 5LMKA 4IFCA 5AUUA 1ND4A 4GVJA 4U42A 4WT6A 5HORA 3HV4A 3BHTA 1P5EA 3BLHA 1JPAA 5CI6A 1Y8GA 4NFNA 3KULB 4I4FA 5BVOA 3FMJA 1OI9A 4AXCA 2VO6A 5JGDA 2CSNA 4FNWA 1BI8A 2P4IA 3QQJA 3H3CA 2PYWA 4ZJVA 5BYZA 4XEYA 2XBAA 5E91A 3T3UA 5C26A 5J9LA 3MS9A 2W1GA 3G90X 1CTPE 3QRJA 4BBFA 5DBXA 3UIXA 4QMMA 1GZOA 3D14A 1ZARA 5CSVA 4ZSLA 3LFNA 3RCDA 3WF6A 4PL5A 3PWYA 1GNGA 3OG7A 2ZAZA 5EDRA 2QG5A 4GV1A 4WOVA 2Z7SA 3IGOA 4U41A 3GU4A 4BWXA 3LFFA 3A8WA 3TI1A 2X1NA 3H9OA 4U45A 4R7BA 3ZDIA 3R6XA 2YM4A 2CPKE 2VRXA 5ETCA 2X81A 2QLUA 4BICA 4USFA 1OGYA 2PVHA 4U3ZA 5HE1A 2R3JA 3AC8A 5KMOA 5LARA 5IQBA 1J3HA 3OT3A 4QMTA 4UXLA 3IK3A 2FUMA 3EKKA 4C02A 1B39A 4CG8A 3OXZA 1YXUA 4P90A 5BVWA 4I6HA 4YLJA 4BCKA 3GCPA 2DWBA 4FV9A 1Z9XA 3EFKA 4R6VA 4WG5A 2Z8CA 2Y0AA 1V0OA 3HMOA 4D2RA 3BRBA 3JVRA 2GU8A 2WMSA 3OXTA 3A60A 5E90A 3W2QA 4WO5A 2CN5A 3NNVA 4JBOA 4KABA 4YHJA 5EW9A 4RWKA 4F0IA 2UZEA 4IWPA 1M7NA 3CJFA 2GPHA 2CDZA 3ALOA 2OJJA 4I41A 2XK7A 3VNTA 3GOKA 4EORA 2VX3A 4OTRA 3DKCA 4FT5A 2HZNA 4O7YA 3HDMA 4GUEA 1YVJA 4X2FA 3MY5A 3TXOA 2CCIA 5HIEA 1PXJA 4ACDA 1Q41A 2QOQA 5EI8A 4FR4A 4NH1A 3R7IA 4NKAA 2O5KA 5IKWA 1Q8WA 4DG3E 3OWKA 1FGIA 1FOTA 4G9RA 4FVPA 4LOPA 4MQ1A 4R77A 3ZM9A 4QNAA 3UVPA 4EH4A 2R0UA 2X6DA 4IVDA 3HMPA 3OWPA 5DEWA 1GY3A 4KIKB 3Q96A 4FKJA 4YLLA 4AAAA 3ZO1A 2LGCA 3JUHA 3WYXA 3LLAA 4EL9A 4FT0A 5H8EA 2VGOA 2B55A 3I6WA 5HLPA 4D9TA 3EQGA 3AD5A 5C9CA 3ULIA 4K9YA 4TYJA 5EH0A 4FV1A 3AC1A 1QL6A 4J71A 5KKRB 3VS7A 4FT9A 4TTHB 3UGCA 1OBGA 5EYCA 3N51A 4QPAA 5AV4A 3CBLA 3R9DA 3HAMA 4RJ4A 5HHWA 3VBYA 2GFCA 2XK8A 4A9SA 2Q83A 3CJGA 4FEQA 2WXVA 4FNYA 2OXYA 3K54A 1UWHA 3BU5A 2C0IA 3GU8A 4LM5A 3O96A 3OOMA 4AE9A 3A8XA 5LVMA 2VNWA 1R39A 5DWRA 5FG8A 4FTCA 4ANBA 4KUJA 1GJOA 2C68A 2IVUA 4BCIA 4J53A 4FV4A 2V7OA 2V5QA 4S31A 4DLIA 2C0TA 3I0OA 3MB7A 4QMZA 5TE0A 4RC2A 5AP4A 2PUIA 5LMKC 2WPAA 5IPJA 4LRJA 3KXHA 2HXLA 3ORXA 2NRUA 4FTJA 2IVVA 4FUYA 1PMVA 5BPYA 5HBJA 3QKLA 4BZNA 4JG6A 3ZC5A 1W2FA 2HCKA 2XBJA 2J0LA 5TKDA 3ZS5A 5L8LA 4CSVA 1NT2A 2WTDA 1ZMWA 4DFBA 3WE8A 1W98A 3WI6A 3CR0A 4WRGA 3HKOA 4W9WA 4AACA 5IMEA 3OUKA 3Q2MA 4BJJB 4YBKA 4E26A 3LQ5A 1ZYJA 3BGZA 4RA4A 3CEKA 4FI1A 5IDPA 3F5XA 4DA5A 5I0BA 3PY3A 2BFXA 2J0MB 3DPKA 3OWJA 4JDKA 3ZHPC 2BZHB 5JGBA 1FVVA 5DMZA 2HK5A 4RZWA 3DT1A 4LI5A 2XKCA 1A48A 3ZTXA 4TWOA 2FO0A 2IZUA 3UE4A 4DC2A 1ZOGA 3PJ3A 2OFUA 4Q9ZA 4BVUA 4TYGA 4AFEA 4OUCA 3UQCA 2YFXA 5D7AA 3CS9A 2A19B 3LXLA 3ORTA 2YACA 4EH7A 3PSDA 4JT3A 2VTRA 4EWQA 5KMLA 3MN3A 1OUKA 4UMQA 5D12A 3FC1X 3ZBFA 3NW6A 3W8QA 4K33A 4AW0A 5CALA 5LVPA 1SVHA 2G1TA 4QMXA 3LXPA 5EI2A 5J5SA 2W96B 3UQFA 5IQFA 4C62A 3QTWA 1MUOA 2E9UA 2XNOA 4KIPA 3AGMA 4OTHA 4PP9A 4ZTNA 3BX5A 4P5ZA 4UEUA 4FGBA 1M14A 2ERKA 1P2AA 3BBWA 3VC4A 3CSVA 3FHRA 3DXNA 4EHVA 4KSPA 3PJ2A 4QPSA 5HVJA 3GU7A 3PYYA 1XH5A 4EJNA 3DA6A 1Q4LA 2VUWA 2I7QA 1MQ4A 1GOLA 1IA9A 1XO2B 4YJVA 4ASDA 3BELA 4D5KA 2YAAA 1TQIA 2B9IA 2P0CA 3G6HA 5ETAA 3NUSA 2QKRA 5HD4A 4DDIA 4M0ZA 5C8NA 3Q9ZA 1FMKA 3I79A 4RVKA 4TWCA 3GC8A 5IA3A 2YZLA 2IO6A 3P78A 5D41A 2BZKB 5BYYA 3R00A 2BRNA 3UYSA 5K5NA 4H1MA 3W0PA 3VHEA 1JVPP 3E8EA 4I0RA 3W55A 3BE9A 4G5PA 3KQ7A 4FK3A 2V0DA 4A06A 4OGRA 3RMFA 4Q9SA 4IMYA 4LGHA 2FYSA 4EK4A 4GMYA 3BYVA 3DAEA 2JDVA