4A9RA

Crystal structure of human chk2 in complex with benzimidazole carboxamide inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
303
structure length
285
Chain Sequence
SVYPKALRDEYIMSKTLEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Benzimidazole Inhibitors of the Protein Kinase Chk2: Clarification of the Binding Mode by Flexible Side Chain Docking and Protein-Ligand Crystallography
pubmed doi rcsb
source organism Homo sapiens
total genus 89
structure length 285
sequence length 303
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4a9rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4a9rA01
4IX5A 5K0KA 2E9UA 3COIA 5A6NA 4A9YA 1BL7A 4Y95A 3W16A 3AMAA 3SKCA 4YJQA 4FEQA 2PULA 2J0MB 4PNIA 4EHEA 1YI4A 4IANA 5J1VA 2ITZA 4R5SA 4EOLA 5IG1A 5CU0A 4BWKA 4FTLA 1PJKA 1PMVA 4YO4A 5BUEA 3AD6A 2UZUE 3TDVA 2X81A 3VS5A 2HOGA 4CXAA 3B2TA 2BFYA 4I6HA 1ZYJA 4P4CA 3KU2A 4BI2A 1B6CB 1Q62A 2XNMA 2BTSA 5GIOE 2VZ6A 3G2FA 4MNEB 1Q61A 1M52A 3IO7A 2QHNA 1CTPE 4OTQA 3FI4A 1JKLA 3ZO4A 3POZA 3V8SA 2C0OA 4D2SA 4PUZA 5CZIA 3C0GA 3O8UA 3ROYA 3EQBA 4HZRA 4YU2A 5IEVA 5JN2A 3EN6A 2FGIA 5AADA 3QBNA 3IG7A 3FMLA 3C4XA 5KNJA 4LRJA 3GC9A 1GZ8A 5B0XA 3ORLA 1ZXEA 4IH8A 5IUHA 3AQVA 5A4CA 3PA5A 3WF9A 4RWJA 3RMFA 4ZSGA 5GNKA 3OHTA 4QTAA 2G2IA 3WARA 5CU3A 4R78A 2CPKE 3LQ3A 1PY5A 3L8XA 4XV1A 4C8BA 4DEIA 3TCPA 5D9HA 1M7NA 2ZM4A 3K54A 3UZPA 3VUTA 3LAUA 4BBMA 2ZV2A 4KBAA 4ZY6A 4RC4A 3BV3A 4NYEA 2YCSA 1NVSA 5I9ZA 1JWHA 3CS9A 3QAME 5C26A 2PMLX 3TZ7A 4J97A 3CTHA 2R3PA 3TV4A 2JDOA 2DYLA 3Q3BA 4G9CA 4XP3A 4L67A 4AUAA 3CXWA 5IDPA 2UZDA 2J0IA 5AFVA 3PJCA 4IM0A 3WYYA 4PTCA 4KKGA 3I5ZA 2Z2WA 1UKHA 4YJTA 4F7SA 2H96A 2BZKB 4UMRA 4N0SA 3DOGA 5J7BA 2BAQA 4ZTHA 4M84A 1BYGA 2HW7A 3FY0A 3EQHA 3FZPA 3PA4A 2C5NA 3NVMB 2KULA 3ORPA 3ORZA 3Q04A 3RVGA 1OUKA 1XO2B 2J9MA 3GCQA 4QQJA 3EB0A 3OC1A 3A8XA 3CY2A 4LI5A 4BKYA 3UVPA 5C03A 2X1NA 3AGMA 4FUXA 4YJUA 4O7SA 1OIRA 2BDJA 4ERKA 4HVHA 1Y6BA 2BMCA 3Q6WA 3UMXA 3WOWA 2XVDA 2W9FB 3JPVA 2OH0E 4AT4A 4O0VA 2YLEA 3CE3A 3QD0A 4HGLA 4FV9A 3FZTA 3OWPA 4FK6A 4OBPA 4X2FA 5M55A 3MVMA 5FG8A 5AIRA 4AOTA 3FYKX 2CNUA 4FV3A 1NVRA 4D9TA 4W4VA 2V7AA 3CEKA 4E3CA 3F5PA 3DLZA 3AC8A 3TDWA 4JS8A 4UWBA 5DHJA 2YLFA 1YHSA 4J53A 4IFGA 1DM2A 3MFTA 4KKEA 5BVKA 1HOWA 2BZIB 2ZYBA 4YC3A 2VTSA 3I7BA 5AV3A 2VTRA 3RZFA 3AD5A 5F9EA 3IDPA 4MTAA 4MXOA 5DI1A 5E8VA 4DH5A 2GHMA 3U51A 3V3VA 3MN3A 3MY5A 4JRVA 3TKUA 3KVWA 2NP8A 2CGXA 4F9BA 3D9VA 4E20A 4PF4A 4IVBA 4QTEA 2QG7A 3QX4A 3U6JA 4HYHA 3WF5A 4BI0A 2I0HA 3NYVA 3V6RA 1ZMVA 1K9AA 3PP0A 3GFEA 4PPBA 3NVKI 4NW6A 1NY3A 4FMQA 3WE4A 3KCFA 4BTKA 1RQQA 2GS6A 3I0OA 1R78A 3IGGA 4G31A 1M2QA 3I81A 3HMNA 5L2QA 2IVUA 2C6EA 1YKRA 3LCTA 2ZAZA 3UNZA 3UP2A 4UWYA 4C4FA 5F94A 3V01A 4Z7GA 3DJ7A 2IZTA 3RI1A 3TZMA 1UWJA 3VJNA 2OIQA 4XV3A 3VNTA 4DN5A 3NS9A 4E6AA 1M17A 4C33A 1YRPA 2YCFA 2B9HA 3BX5A 5FEDA 2ONLC 2VU3A 3EQCA 1BI7A 3TNIA 3D0EA 3N51A 1ATPE 4LG4A 2PVLA 5AP7A 3W1FA 4O7LA 1YWVA 3KRXA 2X7OA 4EZ7A 5JGDA 3NNXA 4GT3A 3EN7A 4JL9A 4D4RA 3LJ1A 4LV8A 3UQGA 5I9YA 1OM1A 5AV1A 1ZARA 3FUPA 4L7SA 4P2KA 2JGZA 4NFMA 2A19B 1ZAOA 4WSQA 2PVRA 1J7UA 2UV2A 3ZC5A 1QCFA 2XRWA 3QTXA 5GJDA 4JIAA 3L9LA 3SG9A 2W05A 2WOUA 3TEIA 5J87A 1PRYA 4G5PA 2XNPA 4BDIA 4H36A 3B8QA 4HNIA 2XNGA 3HUCA 4KAOA 4TWNA 3W55A 4ZJVA 4QP9A 3Q5ZA 3EH9A 2EXCX 5J1WA 3UIBA 4NW5A 4DITA 1H27A 3BV2A 2Q0BA 2X7GA 1WZYA 4YHFA 1YQJA 3BE2A 3BKBA 5C01A 4F0FA 5LVPA 4HOKA 3DXNA 2BDFA 2OIDA 3KB7A 4FTUA 2YM8A 5H8GA 4IM2A 5CXHA 2NRUA 5E92A 2H8HA 1JQHA 4TYIA 5HQ0A 3QQJA 5FLFA 3ZC6A 1BL6A 3AT3A 2OJIA 3F69A 4CQGA 4O7YA 1H28A 1L3RE 4DT9A 4FL1A 4FNXA 4FKPA 4WG4A 1WBPA 3EYGA 3SC1A 4E5BA 3PY0A 3UOKA 3HV5A 4JX3A 4RLKA 2J0LA 2WFYA 2WIPA 3GT8A 1UWHA 4HZSA 4EQMA 4OTFA 1P2AA 3MH3A 4GV1A 5C8MA 1M2PA 1WBSA 3P7BA 4USEA 2VO6A 2BRHA 3FLYA 1B39A 2ACXA 1PF8A 3S1HA 3ZEPA 4CZYB 3ATSA 2YZLA 1P5EA 1T45A 4L68A 4EH9A 2OF2A 3NUAA 5HO7A 3NIEA 3D15A 5EYKA 1UNHA 3Q9ZA 5FD2A 3DKCA 1DAWA 1KE7A 4LMNA 4ANSA 4QMPA 3KEXA 2O2UA 4U80A 4PNKA 2PZ5A 3FDNA 4FEXA 4K8AA 5FEEA 3QZFA 3AG9A 3GCVA 2PSQA 3LM5A 3C0IA 4K9YA 4DH3A 5IDNA 4K18A 5CZHA 5M44A 3F2NA 3GCUA 4I21A 4BYJA 4V01A 2X9EA 2VGPA 3QU0A 2UW4A 1QPCA 5HOAA 3WIGA 4JT3A 1Y91A 2WTWA 3U6HA 1FPUA 2GS2A 1W84A 2IVVA 5IQAA 4YLKA 5M4IA 1PXLA 3H0YA 2VTLA 4JDKA 1F5QA 1TQPA 3OZ6A 4UMQA 1L8TA 5JRQA 2CMWA 2HZIA 4ZS4A 4APCA 4GFGA 3MA6A 5BYYA 3M42A 5M07A 3LMGA 3RM7A 2C69A 5DRDA 4FKTA 4IVDA 5L6OA 4X6RA 3PJ8A 4YZMA 3E92A 3EOCA 4CFXA 4F7JA 4ANNA 1TKIA 3C51A 3KXGA 3K3JA 3KXZA 4YO6A 3VIDA 4FL2A 5JFWA 4ZMEA 5E90A 3K5UA 4BCJA 3KN5A 3MTLA 5G1XA 4FKLA 5HHWA 4GJ2A 2AC3A 2ZM3A 2E9VA 5IUGA 3TI1A 1MP8A 4LV5A 3VBQA 3E93A 3KFAA 2QOKA 3ODYX 4FVQA 2J7TA 4IDTA 4BGHA 4YZ9A 4O1OA 3SG8A 4FSTA 4RWIA 3C5IA 3M2WA 3QQKA 3E7OA 4QP4A 3GENA 5AUZA 3VUDA 3VN9A 5EW8A 4ANOA 4BDBA 4FKQA 2IJMA 3R2BA 4PTGA 3UVRA 3NUSA 2VWIA 3L1SA 5HO8A 2CKOA 4LRKA 2ONLA 4ZY4A 1XBCA 1WBNA 4U42A 1DS5A 2W4KA 4EK8A 2O3PA 5B2LA 3QRJA 5KKRB 3EQDA 2PK9A 4F9AA 2B9JA 2P0CA 2J2IB 4IZ5A 2F4JA 4G6OA 4BDCA 3CTQA 5HORA 1JVPP 3BEGA 3CC6A 3RWQA 2WQOA 4RWLA 4HGSA 3KXHA 5AX9A 2XUUA 5CSWA 3O51A 4JX7A 1PYEA 4KIOA 1OIYA 4RA5A 3GU4A 4GFMA 4PX6A 3VQUA 4C4JA 5KE0A 4E4NA 3PSDA 4FG8A 4OGRA 2VTQA 1J91A 2PTKA 3EN5A 3I60A 3DAKA 3TUCA 3RPOA 3FL4A 4XG3A 4C37A 4EOMA 2VWUA 4EOJA 4O7WA 3G6HA 3RK9A 5DOSA 5D7AA 3VULA 1V1KA 4I22A 4N6YA 4I6BA 2BZHB 5CLPA 5B2KA 4I5HA 2BROA 3PA3A 1O6LA 3DKFA 4I3ZA 1OBDA 3LMHA 4BVUA 3QQFA 2W5BA 4N6ZA 5AX3A 2BZJA 3O8TA 4NH1A 4AN3A 4C59A 2JEDA 3OXIA 2J50A 4IZAA 3TXOA 2GTNA 4FSZA 5BYLA 3FZSA 4FUYA 4USDA 5EW9A 4XBUA 4RX8A 1JLUE 4ORKA 5AR3A 3QRIA 1Q8YA 1YOJA 4FVPA 2RG6A 1OVEA 2G1TA 4E1ZA 1LEWA 4FL3A 3ANQA 3D14A 3QCXA 4LGGA 5KHXA 4PPAA 1XWSA 1G8SA 4FC0A 1OECA 5HX8A 3QWJA 4FYOA 1YOLA 3WF7A 5AAGA 4AFJA 4FV4A 4FV1A 4RIXA 2OJ9A 3DDPA 1ZMWA 5DMZA 5GJGA 4BCHA 2R2PA 4FG9A 4OT6A 4D4SA 5EHOA 4U3YA 2QO2A 2CN8A 4LGDA 3CKWA 4FR4A 2W06A 4FT7A 5HNBA 1ZOHA 2YDIA 4IB5A 2CN5A 3HAVA 4L42A 4FTJA 3O0GA 3ZXTA 4F1TA 5IA3A 5FP6A 2QVSE 2R3LA 4ZTLA 3LFSA 2VTPA 4QTDA 3OT8A 4ACMA 1E9HA 3OCBA 2C1AA 3UO4A 3V5PA 4F7NA 4CD0A 1LPUA 2HY0A 4G5JA 3DDQA 4FTIA 4O86A 2C1BA 5E9EA 2B9FA 4GG5A 3RPVA 2ITOA 4MQ2A 3ZDIA 5IF1A 2PWLA 3SW7A 3O2MA 4O2PA 4IAKA 4ZZOA 4B9DA 4S32A 2YM6A 5J95A 4EONA 4RFYA 3VUMA 4PRJA 3G9LX 4BWPA 2VTNA 2YIRA 1CKJA 4LOQA 3R2YA 4NTSA 4RGJA 2UW7A 3SA0A 4RJ8A 4O7ZA 4XOZA 3PDTA 3S0OA 1STCE 3CBLA 3Q32A 3HNGA 4FKSA 1F0QA 2R64A 5H8EA 3PZEA 3C4FA 3MPMA 2YWVA 5CEQA 5M53A 4JBPA 4H3QA 5CVHA 3QA8A 4D0WA 2YZAA 4KA3A 4PDPA 4X2NA 1XH8A 3T9TA 5L8KA 3BU5A 5ANOA 2QKWB 3F82A 3GVUA 2CLQA 3L9NA 4ZZMA 3QC9A 4GMYA 3FYJX 4GSBA 3QZHA 2IO6A 5CF5A 2QG5A 4GVAA 3OG7A 4JG7A 5EOLA 3QUEA 3DQXA 4D0XA 4X0MA 4M15A 5EYMA 1XH6A 3RHKA 1KE9A 2GNIA 5KMJA 1QPJA 2I6LA 5CAPA 2FSOX 3PVWA 2R3NA 2WQNA 2QONA 3BIZA 5BVEA 3TN8A 3ZM4A 2A0CX 1YHWA 4IFCA 3VS6A 4F0IA 3TNHA 3FC2A 4JAIA 4ZLYA 3PXFA 1YXVA 4XNEA 1APME 2C0IA 2CJMA 2IW9A 3IK3A 4RX9A 3A7FA 2W1GA 4XHKB 3R73A 2X9FA 2IG7A 3QQLA 5GHVA 3LQ5A 2AYPA 1ZYCA 2HXQA 4CEGA 2E9PA 4BZOA 4AN2A 1E1VA 2WKMA 2QC6A 4XV2A 2BUJA 3LFNA 3WZJA 2Z7QA 4ZJIA 1GAGA 2X2KA 3D94A 4L01A 3BRBA 3PVUA 4PMMA 4AZSA 3JY9A 1ZYSA 2JBPA 2P2HA 2XBJA 1OL1A 1JSUA 3LFEA 4I0SA 5KBQA 2QR8A 2XNBA 4LUEA 1O9UA 4QP8A 3FI8A 5DH3A 4FEWA 1BKXA 3W10A 2X8DA 5ACKA 4ACHA 1XHAA 3DGKA 3A7GA 4C62A 3SD0A 3F66A 3T3VA 5HCYA 3LCKA 1Q24A 1O6YA 2WQEA 3TIYA 3UC4A 4GT5A 2Z60A 4MX9A 4L00A 4DG3E 3R01A 4CZTA 3WYXA 3RPSA 2R3RA 3R8UA 4DEEA 3DQWA 1UA2A 4DH8A 2UZWE 5AP5A 3DNEA 3LFAA 4WG3A 3BU6A 3TNWA 4FT5A 3CGOA 2WD1A 3HV4A 4FOBA 4UMTA 4FSUA 2JC6A 4FNYA 4UB7A 2GSFA 2JDRA 1W0XC 3P9JA 4YP8A 5B7VA 5FTOA 3DXQA 4BDKA 4TYEA 1IA8A 4TTHB 5HG9A 3TL8A 3ZONA 3PRFA 1FMOE 1H0VA 1OKWA 4BHNA 5HVKA 4ASEA 2OXDA 4DEBA 3I79A 1CKIA 5ANJA 2F9GA 1MQBA 2FUMA 3EFJA 3G51A 1JSVA 2XKCA 4F7LA 5ANKA 4ZS0A 4RIXB 3I0QA 4O2ZA 4XEYA 4EBVA 4MKCA 5IH6A 3IW7A 1RJBA 1RE8A 2ETRA 3H30A 5IA1A 4CFWA 3ROCA 4JRNA 4C38A 2YCRA 1Y8GA 3ZO3A 4DGNA 4C02A 1CKPA 3S3IA 4U3ZA 4DINA 4DH1A 2IN6A 5TKDA 4KIPA 4XRLA 1P4OA 3WF6A 5M51A 4FTAA 4G3EA 4Q5HA 4Y73A 2F2CB 3NR9A 4NUSA 4II5A 5K5NA 3VHEA 4CKIA 3R9DA 3WZKA 2E9OA 2JITA 3HMIA 4ONAA 3CY3A 4EH6A 2XRUA 3HA8A 4DEGA 2YISA 5KUPA 3CD3A 4JJRA 5BPYA 3UNJA 4D55A 4BIEA 5AV0A 3CQWA 4K1BA 2YIWA 3FLSA 3NWWA 5L8JA 4AOIA 1OKVA 5AUWA 2HWPA 2PMOX 5IH5A 1J1BA 3R7IA 5ICPA 4AACA 4CQEA 5CEOA 3FZ1A 2UW0A 3MIAA 4KBKA 5CSVA 2PMNX 4MXAA 4J8MA 4MXXA 4OTHA 2RFNA 3ZTXA 4BCNA 3NW6A 4QMLA 4D2WA 2UZNA 1V0BA 4W8EA 2AC5A 4ZSLA 3UBDA 3UO6A 2UW9A 1GY3A 2C3JA 1UKIA 4L43A 4MHAA 5E8UA 4E4XA 3NCGA 3LLTA 2PZYA 5EFQA 3DFCB 4YLJA 4O21A 4RFMA 4QMOA 5AP2A 3UC3A 1PW2A 2OK1A 3FMNA 4IX6A 4GK4A 4PMTA 4AGWA 2YJSA 3OROA 3PXZA 4FG7A 3Q9WA 4GUEA 4S31A 4W8DA 3TJDA 4DLJA 5LOHA 4DFBA 3MYGA 4ALVA 1GIJA 3PG3A 4KS7A 4YZNA 5CT7A 5EDQA 3MJ1A 2JKKA 4CT2A 4Y8DA 3MGYA 4EQUA 5C8NA 2P2IA 3EQGA 4AFEA 3SW4A 3U87A 4BCIA 2XIRA 3MI9A 3O7LD 3NX8A 3RBWA 2I0EA 5DE2A 4EQCA 5J7HA 4MQ1A 1YWNA 3AT2A 3GC8A 3QLFA 5AUXA 4ASDA 1XH9A 3FHRA 3PY1A 3DV3A 5HBJA 3AD4A 2VTIA 4GEOA 1OMWA 4C58A 4KRDA 4CNHA 4D5HA 4LGHA 3QTWA 4O0WA 4R7HA 3A62A 4TT7A 4U8ZA 1OB3A 1UNGA 5G6VA 1I44A 4OAVB 4PV0A 3AXWA 5DG5A 3VAPA 4BTJA 3DK7A 3E8NA 3QTQA 2GNJA 4FSMA 4IACA 4NKSA 1NVQA 5LCKA 5A6OA 3LKMA 3GOKA 2WAJA 3TKHA 5BVDA 5HVYA 4K11A 4JQ8A 3JR1A 3FLNC 3ORMA 4Y72A 5EYDA 3P7CA 4A4LA 5KKRC 2B4SB 3IDCA 2QU6A 5I9UA 1QL6A 3VHKA 2QOOA 4JG8A 3THBA 4R3RA 1WCCA 5LVMA 4TWOA 4AN9A 3OBJA 4CT1A 4XX9A 4CRSA 4RIWA 4PMSA 1K2PA 3FXXA 5C1QB 1WVYA 3BHUA 4NJ3A 5EW3A 1UU8A 4C36A 3OT3A 3VBWA 5BQ0A 3EL7A 3RP9A 4QYHA 4F9YA 1PXJA 5AP6A 3PE2A 3LOKA 4BDEA 1Q4LA 5HE3A 5EQEA 4EYMA 5K5XA 2UW3A 3E7VA 3UQCA 3SVVA 2WOTA 4BCGA 4C3FA 4FV6A 3E64A 2PUUA 2OZOA 1SYKA 3UIMA 3A4PA 5KMKA 4ZSJA 3MDYA 4FV2A 4HVIA 4FNWA 5A4TA 3OW3A 3H4JA 1S9IA 3Q9XA 4QOXA 3R8LA 4WA9A 4WRSA 1JKSA 2WNTA 3P4KA 5CU4A 3W8QA 2VTMA 5I9VA 4DGGA 1OPLA 1WMKA 3EQIA 1OL5A 4L6QA 3LLAA 3ZEWA 2YN8A 2Y6OA 5KZ0A 2WMSA 4YZDA 3V5LA 2XA4A 2P55A 3N9XA 4V04A 3UZTA 1PHKA 2HIWA 2XNOA 4IAFA 2IWIA 2BILB 1FINA 2QD9A 4G34A 1R0EA 4L45A 4RG0A 2BHEA 3AT4A 3DKGA 3AC4A 4FTTA 5CSXA 3ELJA 4ACGA 3SAYA 4QMUA 4AW5A 2PMIA 1J1CA 3FC1X 4B8LA 2QO7A 4MBLA 3A8WA 3IKAA 1V0PA 2WEIA 4FSRA 4GJ3A 4MD9E 4RLLA 5T68A 2UZOA 3UG2A 4D2VA 2CNVA 3ZO2A 1WBWA 5AV4A 4GFOA 4L46A 4DTBA 2ITTA 2WXVA 4IQ6A 3DZOA 4LFIA 5K4IA 4BCMA 3QQHA 4PDSA 5HU3A 2PVNA 2PVFA 3VBXA 4Z16A 4C34A 4OAUC 1H24A 1H0WA 3MJ2A 4YMJA 3R0TA 3VF9A 3PJ1A 1H1RA 3KCKA 4WOVA 4BL1A 4EKLA 2R3QA 2X6EA 3R8VA 5AMNA 4R3CA 4R1VA 3RPYA 5LVOA 2I7QA 2P3GX 3F3UA 4IDVA 3O8PA 3QC4A 5CYIA 3LVPA 3TWJA 3VBVA 4D9UA 2G2HA 3EFLA 4UV0A 3PY3A 4ALWA 3QTZA 3CP9A 3MA3A 2PHKA 2IW8A 4CV9A 3RNYA 4YPDA 2HZ4A 3ENHA 3IQ7A 4JXFA 3RTPA 4A4OA 3QLGA 3VC4A 2QOFA 4CMOA 2VO3A 2QOIA 1IRKA 4L53A 1H1WA 1Q97A 5CQWA 3F3TA 1H4LA 3R8ZA 1ZY5A 1XQZA 2RFDA 3T8OA 5CSPA 3R7YA 2NRYA 3JVSA 4RJ7A 4M3QA 4ZZNA 4R8QA 2YIQA 2VX1A 4BBFA 4IAYA 3C4EA 3D83A 4B0GA 5CS6A 3E8DA 2BRGA 3CIKA 2VAGA 3LFFA 5DBXA 3OMVA 4W4XA 3VS7A 4UEUA 3SX9A 3LMIA 4J95A 4O6EA 5HE0A 4WO5A 1REKA 2W96B 3SGCA 5J79A 5ACBC 3U4UA 4C3RA 4CMUA 4R77A 3OEZA 3VS0A 1PKGA 3BEAA 3I4BA 2UZVA 2PVKA 2VD5A 3MS9A 4MWHA 1AQ1A 2OWBA 3VJOA 3DK6A 4FKIA 4NFNA 1KOAA 4ID7A 3JS2A 3MPTA 4Q5EA 4YJSA 3SV0A 3V04A 2G9XA 4EWHA 4QMSA 3CPBA 3ZH8A 4D28A 4FF8A 3GC0A 3D7TA 3TV7A 2BIYA 5HNIX 5DR9A 3F9NA 1U59A 3ZBFA 3F3VA 3EQPA 3FV8A 4Y5QA 4NKAA 4R6VA 3F7ZA 5KMMA 4FTRA 2PUIA 3HA6A 2WTVA 3LIJA 1ND4A 3PPZA 4F09A 5GZ8A 5CF8A 3F2AA 4M68A 1GZOA 5CEPA 3VRZA 2G2FA 3Q4TA 3R28A 3AC5A 4U7ZA 3BCEA 2R3OA 4UX9A 2J0KA 3SHEA 4FIEA 1YWRA 3HP2A 2ZB0A 3DT1A 4I1ZA 3ZYAA 1PXPA 2C6LA 4IB3A 3DJ5A 3OTUA 2IZSA 3GNIB 5LXMA 5LQFA 1E1XA 2W1ZA 3BWFA 4M13A 2OKRA 4QMXA 2GQSA 2RFSA 3TACA 2PE2A 4RIWB 5M09A 3DTWA 5DEYA 1EH4A 1PMUA 4FBXA 3O7LB 4QYYA 4MD7E 5CSHA 5I3OA 3CQEA 3FQSA 1SVHA 5CAVA 3NNUA 2F7XE 2UZBA 3CJFA 2GNGA 5FUTA 2OSCA 4YSMA 1FGKA 1Q3DA 3HVCA 3R9RA 5CEKA 1ZOGA 3P23A 4FX3A 4YSJA 3IW8A 3KQ7A 1OGUA 4LUDA 4I5MA 5FEQA 3UGCA 2YIYA 3W2OA 3UOJA 2CGUA 3BLQA 4EH4A 5KMOA 3S00A 3MVJA 4GS6A 4DGOA 3NUNA 2XF0A 3BU3A 3D5WA 4I92A 3PXYA 4TRLA 4C4HA 5GINE 3ORKA 3PE1A 4ZK5A 3A7JA 2HK5A 2SRCA 3R7GA 2WTDA 2XK4A 2ZVAA 4N4SA 4F6SA 3OOGA 3CD8A 2VWYA 2VO7A 2R4BA 3QXOA 1A48A 4WNPA 4QMYA 5EOBA 4MCVA 2WZJA 4QTBA 2E2BA 2BPMA 5FGKA 1JBPE 3TUBA 3HLLA 4YPSA 5JSMA 5HTIA 5IPJA 5L2IA 5AAEA 4ERWA 4JNWA 1XJDA 4WUAA 3K5VA 4ANBA 4F9CA 5E8XA 1GZNA 1SVGA 2YWPA 1FVTA 2PVMA 4NZWB 4YZBA 2FB8A 2VX0A 2XH5A 3OCGA 4QYFA 3KF4A 5E8SA 5TO8A 4DFZE 3KMWA 3FPMA 3MB7A 4D2RA 2CCHA 4QRCA 3G9NA 2R5TA 3DK3A 3DPKA 3E3PA 4PWNA 4QPAA 2W4JA 4X6QC 1BUHA 4A9SA 4CCUA 3ATTA 5AUYA 4F6WA 5CF4A 3EQFA 3Q5IA 5J9YA 4M8TA 1Q8TA 2W9ZB 3MVHA 4JDHA 3RAWA 4KS8A 4M0ZA 3WZDA 2O8YA 2GTMA 3I6WA 1HCKA 4TYHA 3BLHA 3KXNA 4IZ7A 3Q2MA 5KO1A 3ETAA 3DFAA 2GPHA 4CYIA 3CJGA 3F3ZA 4GYIA 5GZ9A 2QODA 5F95A 2QOBA 2NO3A 4ZSEA 5CANA 4H1MA 3HL7A 3IGOA 4OTGA 4PL3A 3ZUVA 5EI2A 3PLAE 3O71A 5HEZA 3SXFA 1VEBA 5HLWA 2YJRA 3LFDA 2C5VA 4YC8A 4RWKA 1QPEA 5BMMA 5IQCA 4IIRA 1FOTA 2BALA 4RX7A 4S34A 4PMPA 2QI8A 3E8EA 3VUHA 3GCSA 4X3FC 2YAKA 2YM7A 4ACDA 4I5PA 2PZIA 2YITA 5AUUA 2PVHA 4N70A 4UMPA 4CKJA 2XIZA 3MSSA 3G0EA 3EKNA 3NUXA 4FA2A 1OKYA 2G15A 4U5JA 5CASA 2B0QA 1WBOA 3U55A 4BC6A 4V0GA 5FTQA 4RJ5A 3T9IA 4XCUA 1TQIA 3FMEA 4E4MA 1ZOEA 3R1QA 4FTCA 5ANDA 1TVOA 5F1ZA 3ZZWA 2ESMA 1Q8UA 3KK9A 5IQBA 2JIIA 4BDGA 1YXSA 3QD4A 3HMOA 4I6FA 2PZRA 3OXTA 5FXSA 4HYIA 4M97A 4OTRA 4TN6A 3EL8A 3ZUTA 3ZDUA 4FTMA 4QT1A 4AA0A 3P79A 3WI6A 2Y6MA 4I24A 2QOQA 5HG7A 4ITJA 5CU2A 2F7EE 2YFXA 2UZTA 3FMMA 3QKLA 4H3BA 5IA2A 4F08A 1DI8A 4F70A 3NCZA 3ZHPC 2OFVA 5IEYA 3R71A 3QUDA 5IU2A 1V0OA 3D7TB 2YM4A 4GL9A 5EM7A 4AW0A 3PWYA 4K2RA 2W1IA 4O7NA 5C9CA 3F7WA 5AP4A 5I5ZA 1ZYLA 2YAAA 1XH7A 3EWHA 4ZTNA 3R00A 4BTMA 3PXKA 4XS2A 3MBLA 4NK9A 4UMUA 4NJDA 3O23A 4FV5A 1VZOA 5DPVA 3R9OA 2HENA 1YI6A 4OLIA 1BI8A 4L52A 3ZBXA 5KMLA 4MD8E 3NYXA 5EG3A 3V5WA 2A2AA 3VUIA 4S33A 3LM0A 3ITZA 5FRIA 1OITA 2CDZA 3UP7A 4CCBA 1OUYA 2J4ZA 3PZHA 4OW8A 3U8WA 1TQMA 4P7EA 4EUTA 2HAKA 3DJ6A 5CENA 2WHBA 4O81A 3UODA 4XJ0A 3WZUA 5HZNA 4AA4A 3E62A 3RK7A 3CKXA 2PY3A 4U44A 5DNRA 5E1EA 5DYJA 4YHTA 4PL5A 3D5UA 2ETKA 1Z57A 4O0YA 3NPCA 3FEGA 4Z9LA 2OO8X 2XK3A 3PYYA 4FTNA 4GRBA 4IWQA 4FT9A 2C0TA 2GFCA 2WQBA 2Z7SA 5D11A 3FKLA 3L9PA 5DN3A 2B9IA 5J8IA 4JR7A 4HJOA 4UZHA 3R7VA 5JEBA 3PFQA 3OFMA 3ENMA 4FGRA 4KUJA 2LGCA 3FSKA 3UPZA 3QD2B 5JGBA 4IZYA 4QMWA 4AXAA 4ASZA 3OUKA 1R39A 3R7EA 4FKVA 4ZTSA 1Y6AA 2R3KA 3T3UA 3DTCA 3AMBA 4QNAA 5I9XA 2FSMX 2W7XA 4QTCA 3KMUA 3KMMA 3C7QA 5K4JA 3FHIA 1G3NA 1J7IA 2B53A 4E4LA 4JBVA 3TTIA 5J9ZA 2OF4A 4KKHA 3NYOA 5DA3A 5BVWA 4C35A 4AOJA 1IEPA 4EKKA 2ZDUA 4CTCA 4AZEA 3ANRA 4NM7A 3JXWA 4IM3A 3MY0A 3HGKA 1OL2A 5FM3A 3BZ3A 4ITHA 4TY1A 5AAFA 3HMMA 3MFUA 4OTWA 3P78A 2UW8A 5E8WA 3F5GA 3GC7A 4BTFA 1OKZA 4XG4A 4E93A 3FY2A 3VS1A 3OXZA 3TNQB 4RC3A 3KXXA 3HRBA 5TOZA 2RFEA 2WELA 2BIKB 3ZO1A 1FVRA 3IONA 4WNKA 4A9UA 5CI7A 1U5RA 1Z9XA 2A4LA 2QQ7A 4K77A 4LL5A 4QMZA 5F20A 3TV6A 3DBEA 2X4FA 4MBIA 4RA4A 4AA5A 2VO0A 1Q8WA 4DA5A 5HD7A 4UN0C 3QCYA 3BELA 3HZTA 4NT4A 3UOHA 3KA0A 4F1OA 5BNJA 4JQ7A 3ERKA 4X3FA 1XBBA 2Z7RA 2B52A 4E5AX 4TYHB 3ULIA 3PSCA 5I0BA 2F2UA 1UU9A 5HBHA 5K3YA 3SQQA 4BR3A 4NM3A 4PP7A 2W1CA 4JIKA 4W9WA 2ERZE 4ANLA 4XOYA 1JKTA 3K3IA 4WBBB 3RCJA 3JY0A 3G0FA 5CEIA 3VBYA 4R5YA 3TT0A 3BWJA 1H1PA 3KGAA 4MWIA 3ZS5A 4AZVA 4X21A 4AX8A 1Y57A 2B54A 3FXWA 3D7ZA 3IW6A 4B99A 2CKPA 3HECA 1ZZ2A 2V7OA 3G15A 3ORNA 4QMNA 3S95A 3U6IA 4U9AA 4FE2A 3COMA 3DU8A 4A9TA 4BHZA 4BZNA 4NL0A 4ZLZA 4Q9SA 3C0HA 3S4QA 5JH6A 5IQGA 5M56A 4FIHA 5L4QA 5IQEA 1PXOA 2C6MA 4KIKA 2W5AA 5J5TA 2VTOA 3BBTB 4PP9A 4BY9E 3BHYA 3UYSA 5HCXA 3EZRA 3KKVA 4V0GB 3KN6A 3P5KA 5E8YA 3VW8A 4BDDA 1A06A 4P5QA 4RQVA 4HW7A 3FKNA 4O38A 4TW9A 5HKMA 3PUPA 2ETMA 3PSBA 5TF9A 4E6QA 3PIZA 1T46A 5D1JA 5BVFA 2ITNA 4D58A 3DBDA 4GG7A 2VWXA 4OTPA 3W2RA 1MUOA 4D1ZA 5EM6A 2B55A 3OP5A 4X7QA 1VYZA 4YBJA 3WZEA 3ZRMA 2R3MA 4DAWA 3KRJA 5JZJA 5LWMA 4XP2A 4TL0A 4FKGA 4BCOA 3M11A 4B4LA 2BVAA 4DBXA 3AC2A 3E5AA 5A4LA 3CQUA 4D4YA 2YACA 2CNQA 2O65A 4R3PA 4TYGA 5ETIA 4GYGA 3Q6UA 1UNLA 3FLWA 3Q4CA 3FLQA 4WUNA 3VQHA 3DXPA 1OL6A 1YW2A 5A46A 4E6DA 4AAAA 4P5ZA 5J5SA 3QRUA 4I41A 4RVKA 1YXTA 1UV5A 3ORXA 5IZFA 1Q3WA 3SRVA 3QCQA 3ZSHA 4BF2A 1R0PA 3WILA 4APPA 2R3GA 3DKOA 4U41A 3QF9A 3LFBA 4QMQA 5LWNA 2OH4A 3BI6A 3IOKA 4I23A 3ZFMA 1YI3A 3P1AA 3HYHA 2Y9QA 3GEQA 5T6KA 3MH1A 4OBOA 4JLCA 2C3KA 2VWWA 3OEFX 3Q4UA 4DFXE 4NCTA 4WNOA 4ZEGA 2WMVA 2W1DA 2WEVA 2R3FA 3D5XA 3BQRA 2AUHA 3ZFXA 4IX3A 4IAZA 4AW2A 2FSLX 2E9NA 5C4LA 4FNZA 2XK7A 4QQCA 3W2SA 3H9FA 4O6LA 2UVYA 3S2PA 3RPRA 1MRUA 4I4EA 1H26A 3C13A 4EI4A 2PE0A 2XEYA 4AGDA 4EUUA 5IMXA 4ZJJA 3WIKA 1JNKA 2R0IA 3EN9A 4DH7A 5DEWA 2Q0NA 1SNXA 4GUBA 1P14A 3CGFA 4FEUA 4RX5A 5AP1A 2QLUA 5BMSA 3KXMA 2RF9A 1KOBA 3IS5A 2W1HA 1Y8YA 5CNOA 2JDSA 4U81A 2EUFB 1Q5KA 5JGAA 4FOCA 3VF8A 4IEBA 4Y46A 3GFWA 4JDIA 2XMYA 3EHAA 5HIBA 2H6DA 2W5HA 3C1XA 1PXIA 4AE6A 1IAHA 3U9CA 3MVLA 4QNYA 4A4XA 3ZZEA 3QQGA 4V05A 4HGTA 4L3JA 5DR2A 2WMWA 3VS4A 1MRYA 5L2TA 3D5VA 2XJ1A 5DT0A 3O96A 4GCJA 1CDKA 2GS7A 4PQNA 5ETFA 4EOSA 5DT3A 2I0VA 1Q8ZA 2HY81 3ACJA 4XLIA 3NUUA 3QZIA 4CLJA 4HCUA 5AV2A 3NUYA 4A06A 2WMTA 3NIZA 2YM3A 2GNLA 3MB6A 5AP0A 3DBCA 5CWZA 2XS0A 4G6LA 4RZVA 3QTRA 4LOPA 3GOPA 4J7BA 5IQHA 2REIA 4UXQA 4O7TA 1RDQE 3PG1A 2QLQA 4O22A 3QWKA 4X3FB 1W7HA 4H58A 4EWQA 1FMKA 1A9UA 4MK0A 2X7FA 3NEWA 5EI6A 1JSTA 5I3RA 4JBOA 1LEZA 1J3HA 1U4DA 3SOAA 4BDJA 2BAJA 3JVRA 3I6UA 2I0YA 2ITPA 2P4IA 1KSWA 2XIXA 4ZIMA 2QOLA 2C5XA 3L8VA 3OTVA 2J5FA 2QO9A 4E26A 4ENXA 4E8AA 4NM5A 3LCDA 4XG8A 3U9NA 1YHVA 2J51A 1GNGA 3R1YA 3DZQA 3KC3A 1URCA 3OWLA 5IMEA 5JK3A 1O6KA 3CCNA 3QQUA 1MRVA 4RIOA 4FTQA 3MH0A 5EM5A 4BGGA 2RGPA 4MBJA 3KRWA 3NAXA 4LL0A 1K3AA 4I6QA 5L2WA 4M12A 4KIKB 4YLLA 4O84A 2EVAA 3EFWA 4EORA 4G2FA 4GU9A 4K0YA 2ZV7A 3CR0A 5A14A 4RMZA 4G3CA 4EHZA 1J7LA 3HAMA 4EYJA 4W9XA 3MV5A 4XLVA 4IB1A 5HVJA 1JAMA 4QQTA 3BE9A 4AZTA 4U0IA 5CY3A 5FP5A 2Z7LA 5FDPA 2J6MA 1LR4A 3PTGA 1ZYDA 2BRBA 2QOHA 2C30A 2CHLA 2QHMA 2XJ2A 4O7VA 5IEXA 3WF8A 1H07A 5ANEA 4ZTMA 1BMKA 2X8EA 4EH8A 3OUNB 4IW0A 4M14A 4EEVA 3NMUF 2VX3A 2YDKA 4IXPA 3MH2A 5HICA 4E73A 4I5CA 1GOLA 3DNDA 2Y4IB 3DLSA 2R9SA 3ZRLA 4DG0E 3NDMA 2VTAA 3DAEA 3R21A 3VO3A 4UALA 4EK5A 4NEUA 4FVRA 3LXPA 2B7AA 3B2WA 4QMVA 3V5QA 2XKFA 3NNVA 4RJ4A 3EZVA 4MXZA 4C2VA 2OBJA 3SRVB 2EB3A 4X2JA 3GU7A 5CNNA 5GZAA 4GK3A 4U45A 1LP4A 5L6WL 3SOCA 5AR8A 4CSVA 4ZSAA 4GIIA 2XK9A 5CQUA 3R7OA 1W8CA 2BTRA 1IG1A 3MWUA 3QYZA 2XM8A 4E6CA 3V8WA 4EOIA 4C4IA 2OZAB 3OWKA 5KBRA 4QMTA 5T3QA 2NNWB 5AR4A 2X39A 1PYXA 3V51A 3E88A 3FZRA 4IVCA 4U40A 3HRFA 3HRCA 3FJQE 4YJOA 3F3WA 2B1PA 2ZM1A 3LFQA 5I9WA 4HVSA 3Q53A 5CT0A 2CKEA 3P0MA 4FODA 2Y0AA 1SMHA 2X4ZA 3PJ2A 1UVRA 4MAOA 4NM0A 5LMAA 3W2QA 3W2PA 5FTGA 2WU6A 4IJ9A 4BZDA 1ERKA 3EIDA 2OICA 3HUBA 3RAKA 4BI1A 4YJPA 5AR5A 4FYNA 1CM8A 2IW6A 4HNFA 4BCQA 1JPAA 2YERA 4A7CA 2Z02A 2C3IB 4XG6A 5DGZA 1MQ4A 3R8PA 3KULA 2HZNA 4BGQA 4CFMA 5L3AA 3GU8A 2WMAA 3OS3A 2JAVA 3MFRA 4IX4A 1OPJA 3CPCA 3GUBA 3PXRA 3NYNA 4L7FA 4OBQA 4FKWA 3F5UA 4JBQA 5JRSA 3FBVA 4EK3A 3BYMA 4HCTA 3RAHA 4CFUA 2RG5A 2ZV8A 4MYGA 2GQGA 3UG1A 2FO0A 1XBAA 2OXXA 2VGOA 2ZDTA 2BAKA 4X3JA 1S9JA 5ETAA 3UOLA 2UW5A 4J98A 4AS0A 2ZMCA 4IB0A 3L8SA 4BDFA 2R3JA 3AGLA 5ANIA 5HCZA 4O7RA 4TWPA 4O0UA 4QP2A 3HEGA 2EXEA 3F5XA 4YBKA 4J71A 4L44A 4M7IA 3BGPA 3HX4A 4UYAA 2OJJA 2XBAA 2WQMA 1OPKA 3QKMA 2R7IA 4RRVA 4OT5A 2CSNA 3VS3A 5AA9A 4TNBA 3BYSA 5HE1A 5I4NA 3MESA 4DFUA 3I5NA 3LXKA 3PRIA 4MEDA 4YC6A 3GI3A 3ZU7A 3E87A 1WBVA 4QD6A 2R3IA 1KWPA 2JDTA 3Q4ZA 4QP1A 5AEPA 4S2ZA 2OJFE 3JUHA 5AUVA 5IQFA 4MF0A 2C47A 4M67A 5K0XA 3K2LA 1YDTE 4MNFA 4O82A 4XUFA 2PYWA 5HTBA 4RFZA 2Y7JA 5BVNA 1GIIA 2HELA 5TR6A 4YGAA 1W82A 3OW4A 2OU7A 5HIEA 4WD5A 3ORIA 3F6XA 4AZWA 3GQIA 5E1SA 1OI9A 5KZIA 1NXKA 5L8LA 5AR7A 3OY1A 4JOAA 3UYTA 4FSYA 4FV0A 1WBTA 3IOPA 4C0TA 2PUPA 4YZCA 5CF6A 2PZPA 3UDBA 1CMKE 3G90X 4GT4A 4EK4A 1B38A 2RSVA 4G6NA 4F1MA 5ITAA 4R7BA 5IQDA 3NW5A 4KIQA 4AF3A 3NGAA 2P33A 3V5TA 4YTIA 4OUCA 3NRMA 3QGWA 5EHLA 3QALE 4L3LA 5AM7A 2X0GA 5CAOA 1BLXA 4QMMA 2BKZA 2JD5A 3BGQA 4QQ5A 4TZRA 2WMXA 2BR1A 2QOCA 3ZLWA 2WB8A 3FQHA 4FI1A 2IVSA 4L9IA 4XV9A 5IKWA 5JFXA 5DLSA 5BUJA 4D2PA 4BKJA 4F0GA 4IWPA 4LQMA 2VRXA 2V0DA 4G9RA 4EH3A 2PE1A 4F4PA 3KRLA 1AD5A 2GHGA 3MTFA 2UVXA 2CGWA 4IADA 2PU8A 1OZ1A 1R3CA 2PPQA 3LFCA 3FLZA 4KB8A 4KSQA 4WBOA 3AOXA 3RZBA 4BICA 4BWXA 2ZOQA 5HIDA 3QRTA 3GB2A 3R9NA 4J96A 3WBLA 3V6SA 2BHHA 4JDJA 3FWQA 4PDOA 3G5DA 3SXSA 3E8CA 4IJPA 3MY1A 5E8TA 4CRLA 4TWCA 5EKOA 4CV8A 5DT4A 2PVJA 1YXXA 3Q52A 4H3PA 3ACKA 2W0JA 2JIUA 2XKDA 3ORTA 3SDJA 1GIHA 3FAAA 3EYHA 3GBZA 4ALUA 2C6OA 3PWDA 3SXRA 4ARKA 1KE6A 2WTKB 4RVMA 4X2KA 5M08A 4M69A 2C5YA 3GQLA 4I0RA 4I94A 5EDPA 3FXZA 3OWJA 5CEMA 4FKOA 5JMSA 5IQIA 4AW1A 1XH4A 3QL8A 5HLNA 3DAJA 5LMBA 4BDAA 2GMXA 4HVGA 5AA8A 5C27A 2BRMA 1U5QA 2Q83A 3MPAA 3GCPA 2FH9A 4G3FA 2XK6A 4PY1A 2CLXA 1DI9A 3D2KA 3LZBA 1WVWA 5KCVA 5KMIA 2W1EA 4FZDB 3ZMMA 2GQRA 4TKSA 4Y5HA 3W33A 2DS1A 2LAVA 4DTAA 3OF0A 3LJ0A 3KREA 4I4FA 5IUIA 2VNYA 2H34A 3ZSGA 5HG8A 4C57A 5JQ8A 2EB2A 2XCHA 3UO5A 4FZ6A 2FA2A 3PPKA 3VS2A 4Z55A 3VWAA 1M14A 4F6UA 4EHVA 1SNUA 4QP7A 3A61A 1Q41A 3II5A 3ZLXA 2G01A 3ZLYA 1BX6A 5CVFA 5JZNA 4E5WA 1FVVA 3EMGA 1U46A 2VTHA 4WHZA 4DEHA 4EJNA 4C4EA 5TT7A 2DQ7X 5DRBA 4DTKA 2X2LA 5HU9A 4JVGA 3KULB 5JKGA 2V5QA 2WMRA 3G33A 3KRRA 1ZWSA 4WT6A 4EOQA 3UTOA 4H05A 1DAYA 3R1SA 4NSTA 4KRCA 4UXLA 5IA4A 5IH4A 5J9LA 5FBNC 4U97A 4O0TA 4Y85A 5M57A 3BHHA 4YURA 2PL0A 4FIFA 4DYMA 1GJOA 4BIDA 3MFSA 4RIYA 3HMPA 1SVEA 4GH2A 4ZY5A 3N4VA 3FI2A 2GCDA 3Q2JA 2JFMA 1JOWB 4DBNA 5H8BA 4ZXTA 2IZUA 3NSZA 3QZGA 4FV8A 4M66A 2HZ0A 5BVOA 4EOPA 4CYJA 4EH2A 4EOKA 3FSFA 3ZM9A 5EDRA 5TE0A 3GGFA 4G17A 3IECA 2IZRA 4FT3A 5CALA 1SZMA 3PVBA 4RJ3A 2RIOA 3Q60A 3QRKA 3TG1A 2R0UA 3VBTA 2DUVA 3ZSIA 5A54A 5CXZA 1FBNA 3PLSA 1QPDA 2W1FA 4ZMFA 2X8IA 2YEXA 4S30A 2C4GA 3ULZA 3H9RA 3QA0A 3TJCA 4DCAA 4AE9A 2C6DA 4XP0A 2YHVA 3KK8A 3RWPA 3GXLA 3H10A 2JBOA 3NLBA 2C3LA 4XMOA 1R1WA 2FVDA 3VUKA 3BYUA 3C4CA 2XNEA 4TYJA 3R6XA 5ETCA 2XP2A 1REJA 3AC3A 4BCFA 1P4FA 3UNKA 3DBFA 4C4GA 5JFSA 4J99A 5L2SA 3LW0A 1FQ1B 2UZEA 2EWAA 4GIHA 3P08A 4JG6A 4HVDA 5EQPA 3Q96A 1VR2A 4K33A 3L9MA 5IISA 4GK2A 2VWVA 2WPAA 3NUPA 3ZRKA 5KMNA 3QKKA 4JR3A 1H08A 5B2MA 4HPTE 3A60A 4JAJA 5FM2A 2WO6A 4AG8A 1XH5A 1YOMA 5BX0A 5DIAA 4E7WA 1YDRE 4UY9A 2JLDA 1ZMUA 2XJ0A 3EJ1A 3PIYA 5HLPA 4RT7A 2O63A 3A99A 2ITWA 3QX2A 4IMYA 4W4YA 3AC1A 4A07A 4NIFA 4DG2E 3UVQA 4AWIA 2A1AB 3HKOA 3FI3A 3DA6A 4USFA 3ZUUA 4ZTRA 5A9UA 4FEVA 2C5OA 5AP3A 2XCKA 5A3XA 3CLYA 5M4UA 2CKQA 2ZB1A 3B8RA 5ANGA 1H1SA 1URWA 4H39A 4CFNA 4WG5A 5M4CA 2ZMDA 5FDXA 2ITUA 4Z7HA 5L6PA 4UBAA 2XZSA 4UWCA 4DGLC 4F64A 2XEZA 3ZLSA 2QU5A 3LQ8A 4EC9A 3BYVA 4F9WA 1M2RA 3F2RA 3I7CA 3DY7A 2I40A 5IA5A 4ENYA 4YTHA 3TTJA 5E7RA 5E91A 3I1AA 2GNHA 4LOOA 4O83A 4DC2A 4CFVA 4D4VA 2QNJA 4YTFA 4BIBA 4RC2A 1Z5MA 2Y4IC 1CSNA 4Q2AA 3VVHA 3COHA 1U54A 4FICA 4CMTA 4ACCA 2NPQA 2PUNA 3P7AA 3EQRA 3GU5A 3RKBA 4M0YA 5D10A 4D1SA 4R1YA 2QR7A 4ZOGA 4IC7A 4NTTA 4O27B 3RJCA 4IWOA 4M69B 5AM6A 2F49A 2ITVA 2WTJA 3OY3A 4AT3A 4JQEA 4DGMA 5A4EA 4AQCA 4CGAA 4WNMA 2IVTA 4F63A 1GZKA 2F57A 2OIBA 3R30A 4LYNA 4I93A 4AT5A 3P86A 3C9WA 1WFCA 3UIUA 3UIXA 3LHJA 2IPXA 4EL9A 4XG7A 3BLRA 2BCJA 3HV7A 3C4WA 2JDVA 4IWDA 3W32A 5HX6A 3OVVA 4FV7A 3PPJA 4OR5A 2HW6A 2J90A 2GFSA 2BDWA 4ZAUA 2HXLA 1IA9A 3BHVA 4IE9A 1PKDA 4HGEA 4NCTC 4CTBA 3C50A 2KTYA 2OFUA 3QGYA 5HG5A 3F61A 5JT2A 3VRYA 4JI9A 3CSVA 3PVGA 2ITXA 5E4HA 4IAAA 4EHGA 3DB6A 4G1WA 2VWZA 2ZJWA 5FXQA 3RINA 1ZZLA 3KVXA 3BGZA 4WRGA 4FZAB 3C5UA 3TIZA 3U4WA 5DWRA 5M4FA 4ITIA 4CG8A 2C68A 4G3GA 4TNDA 4YJRA 3HV6A 2WMUA 3MW1A 4YHJA 2C6IA 4EC8A 4FZFB 4DHFA 2W99B 5HTCA 4RQKA 5FXRA 3L8PA 3OCTA 3R63A 4AZFA 4MXCA 4HPUE 2VV9A 3ALOA 2Y4PA 4HYUA 4U6RA 4YNEA 1I09A 3OBGA 4KBCA 4FSQA 5HO6A 1VJYA 4RIYB 4Z3VA 2VTTA 4HYSA 5LMKC 1XKKA 4J1RA 4KSPA 4UZDA 5LJJA 2OGVA 1OIQA 4PL4A 1ZLTA 4C2WA 3RALA 3COKA 4FIGA 2J0JA 3DCVA 4K6ZA 3OCSA 3KY2A 4YJNA 4LMUA 4FTKA 3LE6A 4EOOA 1F3MC 3W8LA 4IVAA 4O0SA 5HGIA 3GP0A 2VNWA 4PTEA 2JKOA 3ZXZA 4IBMA 4YR8A 3N4UA 4BDHA 4L3PA 4FK3A 4GU6A 4OTIA 5KX8A 2OJGA 3A2CA 4O0RA 1UU7A 4C3PA 5C4KA 4F65A 3HP5A 2GDOA 3FZOA 1YXUA 2WMQA 5E8ZA 3VW6A 3NZ0A 4FIIA 4N57A 4GW8A 2YDJA 2W4OA 4FTOA 5DR6A 3OD6X 1W83A 4CZUA 4DF3A 4J8NA 3LXLA 1Q99A 4HCVA 3ZOSA 5DFPA 3H9OA 5H2UA 4QO9A 2I1MA 1YDSE 4I0TA 4LM5A 4BCPA 3R1NA 4RVLA 2W17A 1HCLA 3LCOA 4ASXA 3FMKA 4TXCA 4DE4A 4B7TA 2UVZA 3OOMA 3TZ8A 3A4OX 5KHWA 4C61A 3WE8A 3BHTA 5CTPA 1IR3A 3IPHA 5HESA 4EH5A 4G16A 5F4NA 3RNIA 5H9BA 2RKUA 2XNNA 5C8KA 3IDBA 4WSYA 3FMHA 1WAKA 5EYCA 3TKIA 3PP1A 4L8MA 5AIKA 5LARA 3UQFA 5AWMA 2DWBA 2ZV9A 4YUQA 3AMYA 4RZWA 5HD4A 2GHLA 4NIFB 4I20A 1XR1A 3FE3A 4EK6A 2X6DA 4XYFA 3REPA 4RBLA 2QKRA 4ZTQA 3IW5A 4D2TA 5LVLA 4WIHA 4EBWA 3CTJA 2YABA 4QP3A 4IC8A 5CI6A 1NA7A 1M7QA 4X2GA 4MF1A 4CKRA 3ID6C 4FGBA 4EZ5A 3PJ3A 4OTDA 3R8MA 4QYEA 2C6TA 3FMDA 4DLIA 3QHWA 1H1QA 1PXNA 3A7HA 4O1PA 3KL8A 3JYAA 3UPXA 3E3BX 3U54A 4FT0A 1FGIA 3E63A 4W4WA 2OLCA 2UUEA 5H3QA 2OW3A 4F99A 5EKNA 1H00A 4P90A 2OI4X 3LXNA 3ODZX 3R04A 4YJVA 4GKHA 3EN4A 5DVRA 4YTCA 3ZFYA 4AU8A 2QCSA 3EFKA 1U54B 2OZAA 4DEAA 3TM0A 2HYYA 2JIVA 4UYNA 1IAJA 5FBOA 4LRMA 4J52A 4BN1A 4QPSA 4DFYA 3UZRA 2YA9A 2O5KA 3NNWA 5AJQA 4KD1A 4XH6A 4MNEA 3RM6A 1OBGA 4U79A 1SM2A 2WTKC 4MVFA 1IASA 1PXMA 1YVJA 2O64A 3G6GA 3HDMA 3LJ2A 3HDNA 3QCSA 2R7BA 4ZP5A 4ZLOA 4CG9A 3BQCA 1QMZA 3DS6A 3TZ9A 3D4QA 3V8TA 3QFVA 1KE8A 3DBQA 2PVYA 4FZ7A 5EQYA 3UJGA 2JFLA 2V22A 2YM5A 4NWMA 2GNFA 3EKKA 3W2CA 3F88A 4KABA 3W18A 3HV3A 3BPRA 3RGFA 4CLIA 2BFXA 4C7TA 5M06A 4EZ3A 4NU1A 2JKQA 4BKZA 3O50A 5D41A 2Z8CA 2XIYA 5IA0A 5CX9A 4KWPA 3MIYA 3NAYA 3VUGA 3UE4A 1VYWA 2CCIA 5LVNA 1KE5A 4BRXA 1RW8A 5HI2A 5GIPE 4AGUA 2OXYA 3QYWA 1NT2A 2XB7A 4QP6A 3FMJA 2XYUA 5EK7A 4RJ6A 4DFLA 2WTCA 5LMKA 3SLSA 5K9IA 5BYZA 2VN9A 3C4ZA 3O17A 5LCJA 4CVAA 4XRJA 4FSWA 5D12A 5CU6A 3D2IA 4KINA 5D7VA 4A9RA 3KF7A 5JQ5A 3QTUA 4Q9ZA 2ITQA 4DCEA 3QD3A 3ET7A 3R83A 2VWBA 4BCKA 4RVTA 4B8MA 3N4TA 5EH0A 4B6LA 2WMBA 4TPTA 2EXMA 1G8AA 3H3CA 4O91A 1PMNA 4EH7A 4RSSA 5GJFA 5CAQA 4BFMA 3POOA 2X2MA 5AR2A 4XBRA 4PPCA 3QTSA 4GKIA 2F7ZE 2WTIA 5HBEA 4ANMA 5HNGA 4CFFA 3R22A 1AGWA 4O96A 4IAIA 1KV1A 2V55A 2YCQA 4FKUA 1OL7A 3ZCLA 1JKKA 4ANQA 3FL5A 4G3DA 4XG9A 5FQDC 4BB4A 2V62A 2VTJA 2OG8A 5BUIA 5HE2A 4BBEA 3IW4A 1PMEA 1X8BA 2XIKA 2EU9A 2JAMA 3FQEA 5A4QA 2WU7A 1ZRZA 4AP7A 4QYGA 2R3HA 4O0XA 3RAIA 2FSTX 4AGCA 4DT8A 4H1JA 1KV2A 3Q9YA 3BYOA 4KNBA 4FKRA 3DB8A 3M1SA 2QURA 4MXYA 2GU8A 3BBWA 3LPBA 2C6KA 3QUPA 2BRNA 5EM8A 2BKKA 5FWKK 4Y83A 5JFVA 2A27A 2Y8OA 3RHXA 3A7IA 1OIUA 2XM9A 3PXQA 2VUWA 3R9HA 3QXPA 3R02A 1PXKA 2XKEA 2RL5A 3H0ZA 2WIHA 4R7IA 3V5JA 4FSNA 3RK5A 4DEDA 3PIXA 2HCKA 3LCSA 2JKMA 2UZLA 3ALNA 5AUTA 2J5EA 4XG2A 4QPMA 2O0UA 3FPQA 4EJ7A 1H8FA 3QTIA 3UMWA 1H25A 3R7UA 1W98A 4D1XA 4RPVA 4PDYA 2ERKA 2HWOA 3NW7A 3QHRA 4BYIA 2WGJA 3GU6A 1NW1A 2UW6A 2YIXA 4FKJA 1LUFA 4MH7A 1KUTA 1UU3A 4IHPA 5CVGA 2XK8A 4D5KA 2FYSA 3FKOA 4DFNA 1WVXA 5EI8A 5EHYA 3RCDA 2H9VA 2XYNA 4FIJA 4YNOA 1ZY4A 2ITYA 1G5SA 2CGVA 4U43A 4WKQA 3TNPC 5CAUA 4GVJA 1H01A 3TUDA
chains in the Genus database with same CATH superfamily
4IX5A 5K0KA 2E9UA 3COIA 5A6NA 4A9YA 1BL7A 4Y95A 3W16A 3AMAA 3SKCA 4YJQA 4FEQA 2PULA 2J0MB 4PNIA 4EHEA 1YI4A 4IANA 5J1VA 2ITZA 4R5SA 4EOLA 5IG1A 5CU0A 4BWKA 4FTLA 1PJKA 1PMVA 4YO4A 5BUEA 3AD6A 2UZUE 3TDVA 2X81A 3VS5A 2HOGA 4CXAA 3B2TA 2BFYA 4I6HA 1ZYJA 4P4CA 3KU2A 4BI2A 1B6CB 1Q62A 2XNMA 2BTSA 5GIOE 2VZ6A 3G2FA 4MNEB 1Q61A 1M52A 3IO7A 2QHNA 1CTPE 4OTQA 3FI4A 1JKLA 3ZO4A 3POZA 3V8SA 2C0OA 4D2SA 4PUZA 5CZIA 3C0GA 3O8UA 3ROYA 3EQBA 4HZRA 4YU2A 5IEVA 5JN2A 3EN6A 2FGIA 5AADA 3QBNA 3IG7A 3FMLA 3C4XA 5KNJA 4LRJA 3GC9A 1GZ8A 5B0XA 3ORLA 1ZXEA 4IH8A 5IUHA 3AQVA 5A4CA 3PA5A 4FRFA 3WF9A 4RWJA 3RMFA 4ZSGA 5GNKA 3OHTA 4QTAA 2G2IA 3WARA 5CU3A 4R78A 2CPKE 3LQ3A 1PY5A 3L8XA 4XV1A 4C8BA 4DEIA 3TCPA 5D9HA 1M7NA 2ZM4A 3K54A 3UZPA 3VUTA 3LAUA 4BBMA 2ZV2A 4KBAA 4ZY6A 4RC4A 3BV3A 4NYEA 2YCSA 1NVSA 5I9ZA 1JWHA 3CS9A 3QAME 5C26A 4AXEA 2PMLX 3TZ7A 4J97A 3CTHA 2R3PA 3TV4A 2JDOA 2DYLA 3Q3BA 4G9CA 4XP3A 4L67A 4AUAA 3CXWA 5IDPA 2UZDA 2J0IA 5AFVA 3PJCA 4IM0A 3WYYA 4PTCA 4KKGA 3I5ZA 2Z2WA 1UKHA 4YJTA 4F7SA 2H96A 2BZKB 4UMRA 4N0SA 3DOGA 5J7BA 2BAQA 4ZTHA 4M84A 1BYGA 2HW7A 3FY0A 3EQHA 3FZPA 3PA4A 2C5NA 3NVMB 2KULA 3ORPA 3ORZA 3Q04A 3RVGA 1OUKA 1XO2B 2J9MA 3GCQA 4QQJA 3EB0A 3OC1A 3A8XA 3CY2A 4LI5A 4BKYA 3UVPA 5C03A 2X1NA 3AGMA 4FUXA 4YJUA 4O7SA 1OIRA 2BDJA 4ERKA 4HVHA 1Y6BA 2BMCA 3Q6WA 3UMXA 3WOWA 2XVDA 2W9FB 3JPVA 2OH0E 4AT4A 4O0VA 2YLEA 3CE3A 3QD0A 4HGLA 4FV9A 3FZTA 3OWPA 4FK6A 3AKLA 4OBPA 4X2FA 5M55A 3MVMA 5FG8A 5AIRA 4AOTA 3FYKX 2CNUA 4FV3A 1NVRA 4D9TA 4W4VA 2V7AA 3CEKA 4E3CA 3F5PA 3DLZA 3AC8A 3TDWA 4JS8A 4UWBA 5DHJA 2YLFA 1YHSA 4J53A 4IFGA 1DM2A 3MFTA 4KKEA 5BVKA 1HOWA 2BZIB 2ZYBA 4YC3A 2VTSA 3I7BA 5AV3A 2VTRA 3RZFA 3AD5A 5F9EA 3IDPA 4MTAA 4MXOA 5DI1A 5E8VA 4DH5A 2GHMA 3U51A 3V3VA 5BV3A 3MN3A 3MY5A 4JRVA 3TKUA 3KVWA 2NP8A 2CGXA 4F9BA 3D9VA 4E20A 4PF4A 3UDZA 4IVBA 4QTEA 2QG7A 3QX4A 3U6JA 4HYHA 3WF5A 4BI0A 2I0HA 3NYVA 3V6RA 1ZMVA 1K9AA 3PP0A 3GFEA 4PPBA 3NVKI 4NW6A 1NY3A 4FMQA 3WE4A 3KCFA 4BTKA 1RQQA 2GS6A 3I0OA 1R78A 3IGGA 4G31A 1M2QA 3I81A 3HMNA 5L2QA 2IVUA 2C6EA 1YKRA 3LCTA 2ZAZA 3UNZA 3UP2A 4UWYA 4C4FA 5F94A 3V01A 4Z7GA 3DJ7A 2IZTA 3RI1A 3TZMA 1UWJA 3VJNA 2OIQA 4XV3A 3VNTA 4DN5A 3NS9A 4E6AA 1M17A 4C33A 1YRPA 2YCFA 2B9HA 3BX5A 5FEDA 2ONLC 2VU3A 3EQCA 1BI7A 3TNIA 3D0EA 3N51A 1ATPE 4LG4A 2PVLA 5AP7A 3W1FA 4O7LA 1YWVA 3KRXA 2X7OA 4EZ7A 5JGDA 3NNXA 4GT3A 3EN7A 4JL9A 4D4RA 3LJ1A 4LV8A 3UQGA 5I9YA 1OM1A 5AV1A 4DDGA 1ZARA 3FUPA 4L7SA 4P2KA 2JGZA 4NFMA 2A19B 1ZAOA 4WSQA 2PVRA 1J7UA 2UV2A 3ZC5A 1QCFA 2XRWA 2X0OA 3QTXA 5GJDA 4JIAA 3L9LA 3SG9A 2W05A 2WOUA 3TEIA 5J87A 1PRYA 4G5PA 2XNPA 4BDIA 4H36A 3B8QA 4HNIA 2XNGA 3HUCA 4KAOA 4TWNA 3W55A 4ZJVA 4QP9A 3Q5ZA 3EH9A 2EXCX 5J1WA 3UIBA 4NW5A 4DITA 1H27A 3BV2A 2Q0BA 2X7GA 1WZYA 4YHFA 1YQJA 3BE2A 3BKBA 5C01A 4F0FA 5LVPA 4HOKA 3DXNA 2BDFA 2OIDA 3KB7A 4FTUA 2YM8A 5H8GA 4IM2A 5CXHA 2NRUA 5E92A 2X0QA 2H8HA 1JQHA 4TYIA 5HQ0A 3QQJA 5FLFA 3ZC6A 1BL6A 3AT3A 3VONA 2OJIA 3F69A 4CQGA 4O7YA 1H28A 1L3RE 4DT9A 4FL1A 4FNXA 4FKPA 4WG4A 1WBPA 3EYGA 3SC1A 4E5BA 3PY0A 3UOKA 3HV5A 4JX3A 4RLKA 2J0LA 2WFYA 2WIPA 3GT8A 1UWHA 4HZSA 4EQMA 4OTFA 1P2AA 3MH3A 4GV1A 5C8MA 1M2PA 1WBSA 3P7BA 4USEA 2VO6A 2BRHA 3FLYA 1B39A 2ACXA 1PF8A 3S1HA 3ZEPA 4CZYB 3ATSA 2YZLA 1P5EA 1T45A 4L68A 4EH9A 2OF2A 3NUAA 5HO7A 3NIEA 3D15A 5EYKA 1UNHA 3Q9ZA 5FD2A 3DKCA 1DAWA 1KE7A 4LMNA 4ANSA 4QMPA 3KEXA 2O2UA 4U80A 4PNKA 2PZ5A 3FDNA 4FEXA 4K8AA 5FEEA 3QZFA 3AG9A 3GCVA 2PSQA 3LM5A 3C0IA 4K9YA 4DH3A 5IDNA 4K18A 5CZHA 5M44A 3F2NA 3GCUA 4I21A 4BYJA 4V01A 2X9EA 3AKJA 2VGPA 3QU0A 2UW4A 1QPCA 5HOAA 3WIGA 4JT3A 1Y91A 2WTWA 3U6HA 1FPUA 2GS2A 1W84A 2IVVA 5IQAA 4YLKA 5M4IA 1PXLA 3H0YA 2VTLA 4JDKA 1F5QA 1TQPA 3OZ6A 4UMQA 1L8TA 5JRQA 2CMWA 2HZIA 4ZS4A 4APCA 4GFGA 3MA6A 5BYYA 3M42A 5M07A 3LMGA 3RM7A 2C69A 5DRDA 4FKTA 4IVDA 5L6OA 4X6RA 3PJ8A 4YZMA 3E92A 3EOCA 4CFXA 4F7JA 4ANNA 1TKIA 3C51A 3KXGA 4AXDA 3K3JA 3KXZA 4YO6A 3VIDA 4FL2A 5JFWA 4ZMEA 5E90A 3K5UA 4BCJA 3KN5A 3MTLA 5G1XA 4FKLA 5HHWA 4GJ2A 2AC3A 2ZM3A 2E9VA 5IUGA 3TI1A 1MP8A 4LV5A 3VBQA 3E93A 3KFAA 2QOKA 3ODYX 4FVQA 2J7TA 4IDTA 4BGHA 4YZ9A 4O1OA 3SG8A 4FSTA 4RWIA 3C5IA 3M2WA 3QQKA 3E7OA 4QP4A 3GENA 5AUZA 3VUDA 3VN9A 5EW8A 4ANOA 4BDBA 4FKQA 2IJMA 3R2BA 4PTGA 3UVRA 3NUSA 2VWIA 3L1SA 5HO8A 2CKOA 4LRKA 2ONLA 4ZY4A 1XBCA 1WBNA 4U42A 1DS5A 2W4KA 4EK8A 2O3PA 5B2LA 3QRJA 5KKRB 3EQDA 2PK9A 4F9AA 2B9JA 2P0CA 2J2IB 4IZ5A 2F4JA 4G6OA 4BDCA 3CTQA 5HORA 1JVPP 3BEGA 3CC6A 3RWQA 2WQOA 4RWLA 4HGSA 3KXHA 5AX9A 2XUUA 5CSWA 3O51A 4JX7A 1PYEA 4KIOA 1OIYA 4RA5A 3GU4A 4GFMA 4PX6A 3VQUA 4C4JA 5KE0A 4E4NA 3PSDA 4FG8A 4OGRA 2VTQA 1J91A 2PTKA 3EN5A 3I60A 3DAKA 3TUCA 3RPOA 3FL4A 4XG3A 4C37A 4EOMA 2VWUA 4EOJA 4O7WA 3G6HA 3RK9A 5DOSA 5D7AA 3VULA 1V1KA 4I22A 4N6YA 4I6BA 2BZHB 5CLPA 5B2KA 4I5HA 2BROA 3PA3A 1O6LA 3DKFA 4I3ZA 1OBDA 3LMHA 4BVUA 3QQFA 2W5BA 4N6ZA 5AX3A 2BZJA 3O8TA 4NH1A 4AN3A 4C59A 2JEDA 3OXIA 2J50A 4IZAA 3TXOA 2GTNA 4FSZA 5BYLA 3FZSA 4FUYA 4USDA 5EW9A 2AEGA 4XBUA 4RX8A 1JLUE 4ORKA 5AR3A 3QRIA 1Q8YA 1YOJA 4FVPA 2RG6A 1OVEA 2G1TA 4E1ZA 1LEWA 4FL3A 3ANQA 3W0OA 3D14A 3QCXA 4LGGA 5KHXA 4PPAA 1XWSA 1G8SA 4FC0A 1OECA 5HX8A 3QWJA 4FYOA 1YOLA 3WF7A 5AAGA 4AFJA 4FV4A 4FV1A 4RIXA 2OJ9A 3DDPA 1ZMWA 5DMZA 5GJGA 4BCHA 2R2PA 4FG9A 4OT6A 4D4SA 5EHOA 4U3YA 2QO2A 2CN8A 4LGDA 4LDTA 3CKWA 4FR4A 2W06A 4FT7A 5HNBA 1ZOHA 2YDIA 4IB5A 2CN5A 3HAVA 4L42A 4FTJA 3O0GA 3ZXTA 4F1TA 5IA3A 5FP6A 2QVSE 2R3LA 4ZTLA 3LFSA 2VTPA 4QTDA 3OT8A 4ACMA 1E9HA 3OCBA 2C1AA 3UO4A 3V5PA 4F7NA 4CD0A 1LPUA 2HY0A 4G5JA 3DDQA 4FTIA 4O86A 2C1BA 5E9EA 2B9FA 4GG5A 3RPVA 2ITOA 4MQ2A 3ZDIA 5IF1A 2PWLA 3SW7A 3O2MA 4O2PA 4IAKA 4ZZOA 4B9DA 4S32A 2YM6A 5J95A 4EONA 4RFYA 3VUMA 4PRJA 3G9LX 4BWPA 2VTNA 2YIRA 1CKJA 4LOQA 3R2YA 4NTSA 4RGJA 2UW7A 3SA0A 4RJ8A 4O7ZA 4XOZA 3PDTA 3S0OA 1STCE 3CBLA 3Q32A 3HNGA 4FKSA 1F0QA 2R64A 5H8EA 3PZEA 3C4FA 3MPMA 2YWVA 5CEQA 5M53A 4JBPA 4H3QA 5CVHA 3QA8A 4D0WA 2YZAA 4KA3A 4PDPA 4X2NA 1XH8A 3T9TA 5L8KA 3BU5A 5ANOA 2QKWB 3F82A 3GVUA 2CLQA 3L9NA 4ZZMA 3QC9A 4GMYA 3FYJX 4GSBA 3QZHA 2IO6A 5CF5A 2QG5A 4GVAA 3OG7A 4JG7A 5EOLA 3QUEA 3DQXA 4D0XA 4X0MA 4M15A 5EYMA 1XH6A 3RHKA 1KE9A 2GNIA 5KMJA 1QPJA 2I6LA 5CAPA 2FSOX 3PVWA 2R3NA 2WQNA 2QONA 3BIZA 5BVEA 3TN8A 3ZM4A 2A0CX 1YHWA 4IFCA 3VS6A 4F0IA 3TNHA 3FC2A 4JAIA 4ZLYA 3PXFA 1YXVA 4XNEA 1APME 2C0IA 2CJMA 2IW9A 3IK3A 4RX9A 3A7FA 2W1GA 4XHKB 3R73A 2X9FA 2IG7A 3QQLA 5GHVA 3LQ5A 2AYPA 1ZYCA 2HXQA 4CEGA 2E9PA 4BZOA 4AN2A 1E1VA 2WKMA 2QC6A 4XV2A 2BUJA 3LFNA 3WZJA 2Z7QA 4ZJIA 1GAGA 2X2KA 3D94A 4L01A 3BRBA 3PVUA 4PMMA 4AZSA 3JY9A 1ZYSA 2JBPA 2P2HA 2XBJA 1OL1A 1JSUA 3LFEA 4I0SA 5KBQA 2QR8A 2XNBA 4LUEA 1O9UA 4QP8A 3FI8A 5DH3A 4FEWA 1BKXA 3W10A 2X8DA 5ACKA 4ACHA 1XHAA 3DGKA 3A7GA 4C62A 3SD0A 3F66A 3T3VA 5HCYA 3LCKA 1Q24A 1O6YA 2WQEA 3TIYA 3UC4A 4GT5A 2Z60A 4MX9A 4L00A 4DG3E 3R01A 4CZTA 3WYXA 3RPSA 2R3RA 3R8UA 4DEEA 3DQWA 1UA2A 4DH8A 2UZWE 5AP5A 3DNEA 3LFAA 4WG3A 3BU6A 3TNWA 4FT5A 3CGOA 4FJVA 2WD1A 3HV4A 4FOBA 4UMTA 4FSUA 2JC6A 4FNYA 4UB7A 2GSFA 2JDRA 1W0XC 3P9JA 4YP8A 5B7VA 5FTOA 3DXQA 4BDKA 4TYEA 1IA8A 4TTHB 5HG9A 3TL8A 3NFGB 3ZONA 3PRFA 1FMOE 1H0VA 1OKWA 4BHNA 5HVKA 4ASEA 2OXDA 4DEBA 3I79A 1CKIA 4JMQA 5ANJA 2F9GA 1MQBA 2FUMA 3EFJA 3G51A 1JSVA 2XKCA 4F7LA 5ANKA 4ZS0A 4RIXB 3I0QA 4O2ZA 4XEYA 4EBVA 4MKCA 5IH6A 3IW7A 1RJBA 1RE8A 2ETRA 3H30A 5IA1A 4CFWA 3ROCA 4JRNA 4C38A 2YCRA 1Y8GA 3ZO3A 4DGNA 4C02A 1CKPA 3S3IA 4U3ZA 4DINA 4DH1A 2IN6A 5TKDA 4KIPA 4XRLA 1P4OA 3WF6A 5M51A 4FTAA 4G3EA 4Q5HA 4Y73A 2F2CB 3NR9A 4NUSA 4II5A 5K5NA 3VHEA 4CKIA 3R9DA 3WZKA 2E9OA 2JITA 3HMIA 4ONAA 3CY3A 4EH6A 2XRUA 3HA8A 4DEGA 2YISA 5KUPA 3CD3A 4JJRA 5BPYA 3UNJA 4D55A 4BIEA 5AV0A 3CQWA 4K1BA 2YIWA 3FLSA 3NWWA 5L8JA 4AOIA 1OKVA 5AUWA 2HWPA 2PMOX 5IH5A 1J1BA 3R7IA 5ICPA 4AACA 4CQEA 5CEOA 3FZ1A 2UW0A 3MIAA 4KBKA 5CSVA 2PMNX 4MXAA 4J8MA 4MXXA 4OTHA 2RFNA 3ZTXA 4BCNA 3NW6A 4QMLA 4D2WA 2UZNA 1V0BA 4W8EA 2AC5A 4ZSLA 3UBDA 3UO6A 2UW9A 1GY3A 3AKKA 2C3JA 1UKIA 4L43A 4MHAA 5E8UA 4E4XA 3NCGA 3LLTA 2PZYA 5EFQA 3DFCB 4YLJA 4O21A 4RFMA 4QMOA 5AP2A 3UC3A 1PW2A 2OK1A 3FMNA 4IX6A 4GK4A 4PMTA 4AGWA 2YJSA 3OROA 3PXZA 4FG7A 3Q9WA 4GUEA 4S31A 4W8DA 3TJDA 4DLJA 5LOHA 4DFBA 3MYGA 4ALVA 1GIJA 3PG3A 4KS7A 4YZNA 5CT7A 5EDQA 3MJ1A 2JKKA 4CT2A 4Y8DA 3MGYA 4EQUA 5C8NA 2P2IA 3EQGA 4AFEA 3SW4A 3U87A 4BCIA 1W2FA 2XIRA 2XAMA 3MI9A 3O7LD 3NX8A 3RBWA 2I0EA 5DE2A 4EQCA 5J7HA 4MQ1A 1YWNA 3AT2A 3GC8A 3QLFA 5AUXA 4ASDA 1XH9A 3FHRA 3PY1A 3DV3A 5HBJA 3AD4A 2VTIA 4GEOA 1OMWA 4C58A 4KRDA 4CNHA 4D5HA 4LGHA 3QTWA 4O0WA 4R7HA 3A62A 4TT7A 4U8ZA 1OB3A 1UNGA 5G6VA 1I44A 4OAVB 4PV0A 3AXWA 5DG5A 3VAPA 4BTJA 3DK7A 3E8NA 3QTQA 2GNJA 4FSMA 4IACA 4NKSA 1NVQA 5LCKA 5A6OA 3LKMA 3GOKA 2WAJA 3TKHA 5BVDA 5HVYA 4K11A 4JQ8A 3JR1A 3FLNC 3ORMA 4Y72A 5EYDA 3P7CA 4A4LA 5KKRC 2B4SB 3IDCA 2QU6A 5I9UA 1QL6A 3VHKA 2QOOA 4JG8A 3THBA 4R3RA 1WCCA 5LVMA 4TWOA 4AN9A 3OBJA 4CT1A 4XX9A 4CRSA 4RIWA 4PMSA 1K2PA 3FXXA 5C1QB 1WVYA 3BHUA 4NJ3A 5EW3A 1UU8A 4C36A 3OT3A 3VBWA 5BQ0A 3EL7A 3RP9A 4QYHA 4F9YA 1PXJA 5AP6A 3PE2A 3LOKA 4BDEA 1Q4LA 5HE3A 5EQEA 4EYMA 5K5XA 2UW3A 3PUFC 3E7VA 3UQCA 3SVVA 2WOTA 4BCGA 4C3FA 4FV6A 3E64A 2PUUA 2OZOA 1SYKA 3UIMA 3A4PA 5KMKA 4ZSJA 3MDYA 4FV2A 4HVIA 4FNWA 5A4TA 3OW3A 3H4JA 1S9IA 3Q9XA 4QOXA 3R8LA 4WA9A 4WRSA 1JKSA 2WNTA 3P4KA 5CU4A 3W8QA 2VTMA 5I9VA 4DGGA 1OPLA 1WMKA 3EQIA 1OL5A 4L6QA 3LLAA 3ZEWA 2YN8A 2Y6OA 5KZ0A 2WMSA 4YZDA 3V5LA 2XA4A 2P55A 3N9XA 3BL9A 4V04A 3UZTA 1PHKA 2HIWA 2XNOA 4IAFA 2IWIA 2BILB 1FINA 2QD9A 4G34A 1R0EA 4L45A 4RG0A 2BHEA 3AT4A 3DKGA 3AC4A 4FTTA 5CSXA 3ELJA 4ACGA 3KIOC 3SAYA 4QMUA 4AW5A 2PMIA 1J1CA 3FC1X 4B8LA 2QO7A 4MBLA 3A8WA 3IKAA 1V0PA 2WEIA 4FSRA 4GJ3A 4MD9E 4RLLA 5T68A 2UZOA 3UG2A 2XARA 4D2VA 2CNVA 3ZO2A 1WBWA 5AV4A 4GFOA 4L46A 4DTBA 2ITTA 2WXVA 4IQ6A 3DZOA 4LFIA 5K4IA 4BCMA 3QQHA 4PDSA 5HU3A 2PVNA 2PVFA 3VBXA 4Z16A 4C34A 4OAUC 1H24A 1H0WA 3MJ2A 4YMJA 3R0TA 3VF9A 3PJ1A 1H1RA 3KCKA 4WOVA 4BL1A 4EKLA 2R3QA 2X6EA 3R8VA 5AMNA 4R3CA 4R1VA 3RPYA 5LVOA 2I7QA 2P3GX 3F3UA 4IDVA 3O8PA 3QC4A 5CYIA 3LVPA 3TWJA 3VBVA 1W2DA 4D9UA 2G2HA 3EFLA 4UV0A 3PY3A 4ALWA 3QTZA 3CP9A 3MA3A 2PHKA 2IW8A 4CV9A 3RNYA 4YPDA 2HZ4A 3ENHA 3IQ7A 4JXFA 3RTPA 4A4OA 3QLGA 3VC4A 2QOFA 4CMOA 2VO3A 2QOIA 1IRKA 4L53A 1H1WA 1Q97A 5CQWA 3F3TA 1H4LA 3R8ZA 1ZY5A 1XQZA 2RFDA 3T8OA 5CSPA 3R7YA 2NRYA 3JVSA 4RJ7A 4M3QA 4ZZNA 4R8QA 2YIQA 2VX1A 4BBFA 4IAYA 3C4EA 3D83A 4B0GA 5CS6A 3E8DA 2BRGA 3CIKA 2VAGA 3LFFA 5DBXA 3OMVA 4W4XA 3VS7A 4UEUA 3SX9A 3LMIA 4J95A 4O6EA 5HE0A 4WO5A 1REKA 2W96B 3SGCA 5J79A 5ACBC 3U4UA 4C3RA 4CMUA 4R77A 3OEZA 3VS0A 1PKGA 3BEAA 3I4BA 2UZVA 2PVKA 2VD5A 3MS9A 4MWHA 1AQ1A 2OWBA 3VJOA 3DK6A 4FKIA 4NFNA 1KOAA 4ID7A 3JS2A 3MPTA 4Q5EA 4YJSA 3SV0A 3V04A 2G9XA 4EWHA 4QMSA 3CPBA 3ZH8A 4D28A 4FF8A 3GC0A 3D7TA 3TV7A 2BIYA 5HNIX 5DR9A 3F9NA 1U59A 3ZBFA 3F3VA 3EQPA 3FV8A 4Y5QA 4NKAA 4R6VA 3F7ZA 5KMMA 4FTRA 2PUIA 3HA6A 2WTVA 3LIJA 1ND4A 3PPZA 4F09A 5GZ8A 5CF8A 3F2AA 4M68A 1GZOA 5CEPA 3VRZA 2G2FA 3Q4TA 3R28A 3AC5A 4U7ZA 3BCEA 2R3OA 4UX9A 2J0KA 3SHEA 4FIEA 1YWRA 3HP2A 2ZB0A 3DT1A 4I1ZA 3ZYAA 1PXPA 2C6LA 4IB3A 3DJ5A 3OTUA 2IZSA 3GNIB 5LXMA 5LQFA 1E1XA 2W1ZA 3BWFA 4M13A 2OKRA 4QMXA 2GQSA 2RFSA 3TACA 2PE2A 4RIWB 5M09A 3DTWA 5DEYA 1EH4A 1PMUA 4FBXA 3O7LB 4QYYA 4MD7E 5CSHA 5I3OA 3CQEA 4DHIB 3FQSA 1SVHA 5CAVA 3NNUA 2F7XE 2UZBA 3CJFA 2GNGA 5FUTA 2OSCA 4YSMA 1FGKA 1Q3DA 3HVCA 3R9RA 5CEKA 1ZOGA 3P23A 4FX3A 4YSJA 3IW8A 3KQ7A 1OGUA 4LUDA 4I5MA 5FEQA 3UGCA 2YIYA 3W2OA 3UOJA 4AXFA 2CGUA 3BLQA 4EH4A 5KMOA 3S00A 3MVJA 3P5JC 4GS6A 4DGOA 3NUNA 2XF0A 3BU3A 3D5WA 4I92A 3PXYA 4TRLA 4C4HA 5GINE 3ORKA 3PE1A 4ZK5A 3A7JA 2HK5A 2SRCA 3R7GA 2WTDA 2XK4A 2ZVAA 4N4SA 4F6SA 3OOGA 3CD8A 2VWYA 2VO7A 2R4BA 3QXOA 1A48A 4WNPA 4QMYA 5EOBA 4MCVA 2WZJA 4QTBA 2E2BA 2BPMA 5FGKA 1JBPE 3TUBA 3HLLA 4YPSA 5JSMA 5HTIA 5IPJA 5L2IA 5AAEA 4ERWA 4JNWA 1XJDA 4WUAA 3K5VA 4ANBA 4F9CA 5E8XA 1GZNA 1SVGA 2YWPA 1FVTA 2PVMA 4NZWB 4YZBA 2FB8A 2VX0A 2XH5A 3OCGA 4QYFA 3KF4A 5E8SA 5TO8A 4DFZE 3KMWA 3FPMA 3MB7A 4D2RA 2CCHA 4QRCA 3G9NA 2R5TA 3DK3A 3DPKA 3E3PA 4PWNA 4QPAA 2W4JA 4X6QC 1BUHA 4A9SA 4CCUA 3ATTA 5AUYA 4F6WA 5CF4A 3EQFA 3Q5IA 5J9YA 4M8TA 1Q8TA 2W9ZB 3MVHA 4JDHA 3RAWA 4KS8A 4M0ZA 3WZDA 2O8YA 2GTMA 3I6WA 1HCKA 4TYHA 3BLHA 3KXNA 4IZ7A 3Q2MA 5KO1A 3ETAA 3DFAA 2GPHA 4CYIA 3CJGA 3F3ZA 4GYIA 5GZ9A 2QODA 5F95A 2QOBA 2NO3A 4ZSEA 5CANA 4H1MA 3HL7A 3IGOA 4OTGA 4PL3A 3ZUVA 5EI2A 3PLAE 3O71A 5HEZA 3SXFA 1VEBA 5HLWA 2YJRA 3LFDA 2C5VA 4YC8A 4RWKA 1QPEA 5BMMA 5IQCA 4IIRA 1FOTA 2BALA 4RX7A 4S34A 4PMPA 2QI8A 3E8EA 3VUHA 3GCSA 4X3FC 2YAKA 2YM7A 4ACDA 4I5PA 2PZIA 2YITA 5AUUA 2PVHA 4N70A 4UMPA 4CKJA 2XIZA 3MSSA 3G0EA 3EKNA 3NUXA 4FA2A 1OKYA 2G15A 4U5JA 5CASA 2B0QA 1WBOA 3U55A 4BC6A 4V0GA 5FTQA 4RJ5A 3T9IA 4XCUA 1TQIA 3FMEA 4E4MA 1ZOEA 3R1QA 4FTCA 5ANDA 1TVOA 5F1ZA 3ZZWA 2ESMA 1Q8UA 3KK9A 5IQBA 2JIIA 4BDGA 1YXSA 3QD4A 3HMOA 4I6FA 2PZRA 3OXTA 5FXSA 4HYIA 4M97A 4OTRA 4TN6A 3EL8A 3ZUTA 3ZDUA 4FTMA 4QT1A 4AA0A 3BL7A 3P79A 3WI6A 2Y6MA 4I24A 2QOQA 5HG7A 4ITJA 5CU2A 2F7EE 2YFXA 2UZTA 3FMMA 3QKLA 4H3BA 5IA2A 4F08A 1DI8A 4F70A 3NCZA 3ZHPC 2OFVA 5IEYA 3R71A 3QUDA 5IU2A 1V0OA 3D7TB 2YM4A 4GL9A 5EM7A 4AW0A 3PWYA 4K2RA 2W1IA 4O7NA 5C9CA 3F7WA 5AP4A 5I5ZA 1ZYLA 2YAAA 1XH7A 3EWHA 4ZTNA 3R00A 4BTMA 3PXKA 4XS2A 4AAYA 3MBLA 4NK9A 4UMUA 4NJDA 3O23A 4FV5A 1VZOA 5DPVA 3R9OA 2HENA 1YI6A 4OLIA 1BI8A 4L52A 3ZBXA 5KMLA 4MD8E 3NYXA 5EG3A 3V5WA 2A2AA 3VUIA 4S33A 3LM0A 3ITZA 5FRIA 1OITA 2CDZA 3UP7A 4CCBA 1OUYA 2J4ZA 3PZHA 4AXCA 4OW8A 3U8WA 1TQMA 4P7EA 4EUTA 2HAKA 3DJ6A 5CENA 2WHBA 4O81A 3UODA 4XJ0A 3WZUA 5HZNA 4AA4A 3E62A 3RK7A 3CKXA 2PY3A 4U44A 5DNRA 5E1EA 5DYJA 4YHTA 4PL5A 3D5UA 2ETKA 1Z57A 4O0YA 3NPCA 3FEGA 4Z9LA 2OO8X 2XK3A 3PYYA 4FTNA