4A9RA

Crystal structure of human chk2 in complex with benzimidazole carboxamide inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
303
structure length
285
Chain Sequence
SVYPKALRDEYIMSKTLEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
publication title Benzimidazole Inhibitors of the Protein Kinase Chk2: Clarification of the Binding Mode by Flexible Side Chain Docking and Protein-Ligand Crystallography
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 89
structure length 285
sequence length 303
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4a9rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4a9rA01
4AN9A 4D1ZA 3KXNA 4I4EA 2UW5A 3CD3A 3O96A 4AF3A 5A4TA 1H0WA 1OIRA 2CKEA 1QCFA 4W9WA 3QLFA 5EYDA 4BDGA 4JBQA 5D10A 4O38A 4WNPA 3L9MA 4BTMA 3GOPA 5M44A 2IPXA 3K2LA 4EBVA 4FA2A 4Q5EA 3CP9A 1Q8YA 1W82A 2W1FA 3UNKA 4BCKA 1E1VA 1PKDA 1DI8A 5FBOA 5FD2A 3NCGA 4FIHA 4GG5A 4BC6A 4ITHA 4CMOA 3DAEA 3QD0A 3DY7A 1YXVA 4L00A 3W10A 4BIBA 3LXKA 3IK3A 4TKSA 4DFZE 5L8KA 4I0SA 4YZNA 3R8UA 3E62A 4CEGA 4JI9A 4R1YA 4W9XA 4KABA 2JIVA 5ETAA 3E88A 3F3ZA 4GT3A 3DXNA 3UE4A 4IE9A 4XG6A 3P5KA 1O6LA 4OTGA 4UWBA 3U8WA 3HRCA 4RT7A 5EQPA 3R7VA 2C3JA 5L8JA 2PVYA 3CGFA 3W2OA 4QMYA 3CKWA 4UMQA 2WIPA 5HEZA 3BU5A 4RZVA 5E7RA 4YTIA 4MXAA 4AW0A 4KIKB 3R7YA 5M08A 4IVCA 5LMAA 1NVSA 1YXXA 2XIXA 2X6DA 5HO8A 5B0XA 4F1OA 5C4LA 3U6HA 1DI9A 5F1ZA 3VNTA 2B9HA 4TYIA 4U43A 4RWIA 4RX9A 3PP0A 1GIJA 4YO6A 5E91A 4FVRA 3ORLA 4U45A 4FTKA 4XRJA 2QU6A 4NIFB 2VTJA 4PPAA 4AZEA 4ANBA 3D7ZA 2ERZE 4NZWB 4YBKA 3R8LA 4FKPA 1RDQE 1H1QA 3RWQA 4DE4A 3EQHA 3RAHA 5L6PA 4MYGA 4OBOA 5HESA 3TJDA 2KTYA 4JX7A 5K0XA 4MX9A 4TYJA 3VULA 3BELA 4NH1A 3OXZA 2ESMA 5AR5A 2XZSA 1RQQA 1PJKA 1WVWA 5J79A 2HIWA 4ZTHA 3L9NA 5CAPA 5DLSA 3BHVA 3MVJA 3FZOA 3AC8A 4RJ7A 4FIIA 3I7CA 3R9DA 2B9IA 3BLQA 4ZIMA 2GFSA 4QP8A 3ZRLA 2P33A 4QPMA 5HG7A 4FC0A 1KE6A 1U46A 3MESA 4DFUA 2C5VA 2R2PA 5AP6A 1RE8A 3MTLA 3BLHA 4LOQA 1WMKA 4GV1A 4G5PA 4RWLA 5IA3A 4LMUA 3ZZEA 5DGZA 4BZDA 2J50A 1FOTA 4MAOA 3U51A 2VTMA 4LV8A 1S9IA 3EYHA 3GCUA 5EQEA 2O3PA 1BL6A 3E92A 3MVLA 2IZTA 4CLIA 2H6DA 4CRLA 2QOKA 5C9CA 2OXDA 3ROYA 3W1FA 2JKQA 2EUFB 4BCPA 4C4HA 5HG5A 2PVFA 4FV7A 4CT1A 3BBWA 5CSXA 4YLLA 4BDEA 4HVGA 4NW5A 3RAKA 4ASDA 3Q5IA 3DBCA 4CZUA 3SXFA 4V04A 5E4HA 3JPVA 1ZARA 4MNEA 3KK8A 3ZSIA 3VHKA 2UZTA 4XYFA 5KMJA 4LM5A 1Y6AA 2ZB1A 2HAKA 4RWKA 3COHA 5DG5A 5EI8A 4ZY5A 3DBEA 2QKWB 3D5VA 4ERKA 3HMPA 5CXZA 5DMZA 5HU9A 3PY0A 1KUTA 4EJNA 3UP2A 2A4LA 3FE3A 2RG5A 3D94A 3L1SA 3HVCA 3MW1A 4EQUA 3BQRA 3FJQE 2WXVA 4AG8A 3VUMA 3SX9A 1KSWA 4H3BA 4BYIA 2YABA 4D2PA 3RZBA 4EORA 5M53A 4IAKA 5HBEA 1H01A 5EKOA 1QPEA 4EOJA 5M56A 1UU7A 4FT0A 4RJ3A 3FI4A 5J7BA 5IEVA 4YZCA 4PRJA 3L8SA 5F94A 3A4PA 2YJRA 2PMNX 3FPMA 4BDCA 4EC8A 4O7WA 3DQXA 4DEBA 1G8SA 2CNQA 5D12A 2C0TA 2YLFA 4DFNA 3GU4A 4GYIA 4PL4A 4YNOA 4BIEA 2WFYA 2ITPA 4XOZA 5DEWA 4BI2A 4ORKA 3UMXA 4BBEA 4XEYA 4FX3A 4FK6A 3MH0A 4BYJA 3BV2A 1Q24A 3EN6A 4MXXA 3MYGA 1FINA 3BGPA 4ZOGA 5FWKK 4D1XA 5M4CA 4YJOA 2UZBA 4R5YA 4R3RA 3COMA 2JIIA 1R0PA 3UYTA 1H1PA 2GQGA 1TQMA 2PMOX 3IG7A 1ATPE 3IW5A 4UBAA 4FR4A 5CSHA 5B2KA 5M06A 1W83A 4MNEB 3V01A 3VBWA 4B7TA 3MY5A 2WIHA 2UV2A 2R4BA 3RPVA 1F0QA 4PY1A 1MRVA 3NUPA 3W8LA 3L9PA 3V6RA 4NM0A 4DINA 2G2FA 4RJ6A 2UW6A 4ZSAA 3SXRA 2J90A 4XV2A 2YHVA 5IISA 4QMWA 3QRTA 3GOKA 3FKLA 3PLSA 3O8UA 4N4SA 2HXQA 3I7BA 4DH3A 2C6MA 4QMMA 5GNKA 5D1JA 3G6HA 5AUXA 3TZ9A 1YI3A 4QQTA 5C26A 2NO3A 3FUPA 4XV9A 4DTAA 5CF6A 2W5AA 3S3IA 1M17A 4DEDA 5IH4A 4MD8E 1OZ1A 2OI4X 3RM6A 4O7ZA 2GSFA 2BFXA 4OGRA 3UMWA 4IWPA 4JOAA 5HNIX 5HTCA 4QP4A 5F95A 4HCUA 2YA9A 4HJOA 1VZOA 2PSQA 1WVYA 4KB8A 4ZK5A 3WF6A 3DJ5A 4JDKA 2YIXA 3CR0A 4ACHA 3I81A 5CVGA 3AG9A 4UB7A 3R8ZA 1O6KA 1PYEA 1EH4A 1FVVA 1OM1A 4O91A 4XP3A 5ANDA 3MPMA 3QBNA 3QTXA 4IVDA 4NFMA 5CI6A 3I6UA 4XG3A 3DLZA 4L3JA 4CZTA 4O0WA 3ET7A 4DGMA 2CSNA 4EZ5A 4CCBA 4HW7A 4NK9A 4EK8A 1PF8A 2B9JA 3ALNA 3R7OA 4EH8A 4KIQA 5AUYA 4BDBA 4EK6A 3FAAA 4Y83A 3WF8A 3EMGA 2BKKA 4P5QA 4KNBA 5IKWA 2QO9A 2C6OA 4S33A 1BLXA 1YRPA 1OMWA 4O0YA 4TZRA 5C01A 5GZAA 1H0VA 2ITOA 1KE7A 4IIRA 3NYXA 4DEIA 4YO4A 4RIXA 1SVGA 1FBNA 4NL0A 2X81A 4JXFA 3GUBA 4FTIA 3QKLA 3FEGA 4FOBA 4CFVA 2PZPA 4YTFA 5K5XA 5CVHA 5JFWA 4CVAA 4RJ8A 3DZOA 3RCDA 4JRNA 4ACMA 4F99A 5AFVA 5D9HA 4IWQA 2X4ZA 3K54A 4BIDA 4FKOA 2YISA 5LWNA 1Z57A 4HVIA 2R3LA 5HO7A 2C0IA 2ERKA 3PA5A 2JDVA 3RMFA 3PE1A 4XX9A 4I5PA 3ZM4A 3BGQA 4FKGA 3DB6A 1CKIA 3NX8A 4EHGA 2J5EA 4FG9A 4O1PA 3TCPA 3MFTA 3UZTA 3ODZX 4GVJA 4FE2A 3OY3A 2C30A 2E9NA 5AR7A 3FV8A 3A7FA 2J5FA 3CKXA 3LCKA 3EIDA 3PVGA 4L7SA 3C5UA 4E6AA 2XB7A 4RMZA 4QP2A 3DGKA 3GC0A 4UWCA 5AMNA 3VAPA 3W8QA 3ZLYA 5BQ0A 5KKRC 4BCNA 2CLXA 5FDPA 4AW1A 3WYYA 1IAJA 5KE0A 4C2VA 2XNNA 5F4NA 5CF4A 3EN7A 3A8WA 3W2CA 4FKWA 4EH2A 4WBOA 5HE1A 3TNHA 2QOQA 3BGZA 4CZYB 3RJCA 2B9FA 2GTMA 4FTUA 4HOKA 4YUQA 5JH6A 2BKZA 4QTBA 4Y95A 3BHTA 5G6VA 4JAJA 1PXOA 1YHVA 1IA9A 4KINA 2ITNA 4BY9E 4C57A 2BTRA 2VGOA 3C5IA 2I0HA 3OBJA 2GCDA 2VO7A 4LGGA 3VBXA 5HCXA 4M69A 4TYEA 3PXZA 3QCQA 1J1CA 5CT7A 5KNJA 3DTCA 1CKPA 4E6CA 3EKKA 3QZGA 4I5MA 5E8TA 3RHKA 3A62A 2PPQA 1OL6A 2Y8OA 5EG3A 1JAMA 4R3PA 4FKIA 4NWMA 1XR1A 3KKVA 2ITTA 4AOTA 4EKLA 4MXYA 5M57A 5ACBC 1LR4A 4F65A 3V6SA 2C3LA 4BGHA 4FKJA 4FTQA 3NEWA 3P23A 2C69A 2PVRA 4I0TA 3P86A 4L43A 4PX6A 3CQUA 4LRJA 3NW6A 2OW3A 3V8TA 2C68A 3HMIA 3VRZA 3VQHA 4DGNA 4Y8DA 3D2KA 1WBWA 3E3PA 4H3PA 4FSMA 4TNDA 3A61A 2B0QA 4IVAA 4F08A 4WHZA 4OAVB 4F7JA 5IQAA 5I9XA 2FVDA 5CSVA 2CLQA 2ZVAA 4A9YA 4NTTA 2JDSA 3KN6A 3QTZA 5J5SA 1U4DA 4J8NA 2GNJA 2YM5A 3PA4A 2PYWA 3MA3A 3RAWA 3ID6C 3N9XA 3KEXA 2Z7SA 4JJRA 3R01A 5J5TA 5IMXA 4AT5A 4LL5A 3AQVA 4DAWA 3AT4A 2JKOA 1NY3A 2R7BA 5EYMA 1BI7A 3VF8A 3DBDA 2XKEA 4KS8A 2YJSA 4ANLA 3QUDA 3GT8A 4M7IA 2JGZA 4UZHA 4K8AA 5BUJA 4FT7A 4Z7HA 4WRGA 3UTOA 5IZFA 2RFDA 4D5KA 1OL1A 1XQZA 4WG4A 4C8BA 2F2CB 4FTTA 4QOXA 1SZMA 3OOGA 3ZO1A 4CFNA 4IB0A 4MD9E 3VW6A 1OITA 4L3PA 3LMHA 3KULA 2BZKB 2Z02A 1UNGA 3ITZA 3MJ2A 4FUXA 4YJRA 1XH9A 5FTGA 3TJCA 3PP1A 4U0IA 3RNYA 3NNWA 2C4GA 5CWZA 1YW2A 4YHFA 2HW7A 5AP0A 3QZIA 4AX8A 5A4CA 4KSPA 5CAVA 4NTSA 3NR9A 1PW2A 3QGYA 2W5BA 4FV5A 4MVFA 3KREA 3EZVA 1OL5A 1IR3A 2V7AA 5HIBA 4GFMA 5BNJA 2QI8A 4X3FC 4O0RA 4OBQA 3KMUA 5JEBA 1WCCA 2C6KA 4ONAA 4O27B 1YDRE 5CF8A 2WHBA 3AD5A 4Z9LA 4F7LA 3EFKA 4I6FA 4J96A 4C36A 4A9UA 5FTQA 3M2WA 4C2WA 3NLBA 4EBWA 4RA4A 2RF9A 3RALA 3WBLA 5DPVA 1URCA 5M4IA 1OI9A 1YXTA 1GZ8A 3HV7A 5EM7A 5AA9A 5CF5A 1UKHA 4PNKA 3F3VA 1G8AA 2W1CA 3ZUUA 3P0MA 5HO6A 2ZOQA 2XIZA 4FV1A 4W4VA 3C7QA 3RZFA 3HNGA 1AGWA 3I1AA 4PWNA 3HRFA 2W06A 4ZEGA 2OZAA 4AOIA 4TPTA 3FSKA 3RTPA 4F63A 1A06A 5AP1A 4EQMA 5HQ0A 2QOCA 3O50A 2XS0A 4FTLA 4R8QA 3LQ3A 4M14A 4EWQA 3W2QA 1RJBA 4UALA 4MH7A 3DKFA 4CLJA 3TWJA 4B6LA 5HVKA 3OY1A 3C4ZA 2JD5A 2QOFA 3OWPA 4UYNA 3RPOA 3TNPC 5KHWA 4R5SA 5EH0A 5AWMA 5M4UA 5HLPA 1YOMA 4FYOA 4EOPA 2Q0BA 2XKCA 5I9ZA 5A4QA 4YJTA 2YAKA 4J98A 1H8FA 2OICA 4X0MA 1OPJA 4NKSA 2UZLA 3KCFA 3FHIA 4WO5A 4E26A 5T68A 4QMNA 4PDYA 2H8HA 2CGWA 4JVGA 4TNBA 3MFUA 3SOAA 2OK1A 4MF0A 2VU3A 2REIA 3WF9A 4C4FA 2UVZA 3KULB 3FZSA 5ANJA 5LMKA 4XG8A 2F4JA 2WMBA 3E8NA 4FTNA 4FZ7A 4WT6A 4QYFA 5GZ9A 5HGIA 3GU5A 1JNKA 3II5A 3EQBA 2WMTA 1XH7A 4PQNA 4E6DA 2VTRA 1B39A 1R1WA 1HCKA 3KF4A 2JKKA 3P7CA 4NM7A 1A9UA 1XH8A 5AR3A 5JKGA 3H0ZA 1BI8A 2O0UA 3Q96A 2VNYA 4L7FA 3G51A 2OIQA 2VUWA 5L6WL 4Z7GA 2QONA 3W55A 1GZOA 3QTSA 5K4JA 3PPZA 5KZIA 3QX2A 4BCJA 2ITYA 3W2PA 4B0GA 5IDPA 1H1SA 3ZM9A 1GNGA 1P5EA 3NYVA 3LOKA 3EFLA 4NEUA 3PE2A 3FMEA 4K6ZA 3MH1A 2VWZA 4U3YA 4MD7E 4Z3VA 5GINE 3HECA 3LLAA 5AV1A 3PJCA 4PNIA 3A8XA 4WG3A 4KRCA 4GS6A 4LUDA 3Q5ZA 2Z60A 1J3HA 4FV4A 3R2YA 2WTDA 4IAIA 2BROA 3MIYA 3JXWA 4TWCA 5E8VA 1H1RA 2XJ0A 2XNGA 4FKRA 3S2PA 3ZRKA 4I6HA 4XNEA 4FKLA 3MN3A 3PRFA 1IA8A 4QPSA 4EOKA 2ZDTA 2O63A 3E7VA 4YZMA 2P2HA 1CTPE 3OS3A 5BVOA 5HIEA 4TL0A 1VYWA 4HCTA 1AD5A 3IPHA 4A4XA 3DDQA 5GJFA 4AZWA 2ETKA 5HX8A 5CAOA 3HLLA 2C5NA 3TXOA 4YJVA 4EUUA 2XCHA 3AT3A 4IX6A 4QMSA 1JLUE 4GU9A 4QNYA 4JQ8A 3OC1A 1Y57A 4DGOA 3KVWA 1V0PA 2I0YA 4YU2A 1JOWB 4AW5A 3DFAA 2WO6A 4ALUA 4IZYA 3GP0A 4MXZA 5LVPA 3CXWA 3M42A 1V0OA 4K2RA 4MEDA 4F0GA 2QKRA 4L46A 2WAJA 3MWUA 5K9IA 4QMLA 4ZTMA 4FIFA 2GS6A 4RFZA 4FSTA 2V22A 3C0GA 1CSNA 3EN5A 3T9TA 4AAAA 4E20A 5AA8A 5LJJA 4GFGA 3R71A 3QC4A 2W1DA 3S00A 4NUSA 4TWPA 3PZHA 3UDBA 5CI7A 2WTKC 4RIOA 3C1XA 4GIHA 1FMOE 2G9XA 5HVJA 4EQCA 3ANRA 2AUHA 1YOLA 2WKMA 3PY1A 2X2KA 3QQUA 2V5QA 3QTQA 1YWNA 4NYEA 4PL5A 3D7TA 4DG3E 1H27A 1XH6A 4BDIA 4JIKA 3R7EA 3GQIA 3FLSA 4QMTA 4AN2A 4YPDA 3Q9WA 2OKRA 3CGOA 3LFEA 4EL9A 5DH3A 4FEXA 4I21A 4D2SA 5BYZA 4QD6A 3FI3A 3KCKA 4LOOA 4P2KA 3OT8A 4UZDA 5AUTA 3VW8A 3I60A 2GHGA 2F49A 3EZRA 3JY0A 3PIYA 4CT2A 3OW3A 3HMNA 4EZ3A 4ZLZA 1B38A 2GNFA 4JR7A 1XH5A 2JAVA 3EWHA 4YSMA 3HMOA 2UVXA 5ETFA 5LARA 4BI1A 3DJ6A 4M13A 3QUPA 1QPDA 4UMRA 3IDCA 4IBMA 2J0LA 4D4VA 2OF2A 1IASA 3H30A 2G01A 2P2IA 4I6QA 4MXOA 2XRUA 2VWVA 3C4EA 3C50A 4FG7A 4AT4A 5FDXA 3RHXA 3NUAA 4EHVA 3EN9A 1PMEA 3E93A 3BYMA 5IUGA 2W1ZA 2W17A 4JR3A 3U4WA 3RWPA 4GMYA 2C6EA 3R22A 2XK7A 3HZTA 1URWA 2R7IA 4FVQA 5E8WA 4BDFA 3MDYA 5AV3A 1GIIA 3HYHA 4ALWA 1YHWA 1NW1A 2WPAA 1R78A 1CKJA 1Z5MA 4RJ5A 3Q2MA 1G5SA 2PZYA 2WZJA 4IFCA 4M0YA 2B1PA 3DAJA 3VUIA 5FQDC 5LWMA 3BLRA 3PXFA 4EUTA 2C1BA 3CPBA 3UIBA 4D2TA 4FGBA 2XJ1A 4F9CA 1OUYA 3PXYA 3KC3A 2HZ0A 3FKOA 3FI8A 3BE2A 2JFLA 1ND4A 4TYHA 4BI0A 3BBTB 4JIAA 4YP8A 3ORKA 2C6LA 3SDJA 4GFOA 1JKKA 5AR2A 2X8DA 4ITJA 4Y73A 4S34A 4LQMA 1GOLA 2R3JA 5EDRA 3DQWA 4FL1A 3FBVA 2C5XA 1VEBA 2HY81 3O8TA 1XBCA 1OIYA 2IN6A 3GCPA 2Y9QA 4C37A 3FLNC 3QQGA 4RVLA 3PXKA 4UX9A 1H07A 3OMVA 4FIGA 5FP5A 3ZC5A 5IH5A 5DI1A 4R7IA 2GQSA 4AU8A 3H9RA 4FYNA 3D5WA 5DT4A 3VUDA 3NSZA 4GW8A 5HICA 4D4SA 3WILA 1I44A 2EXMA 3G90X 3I6WA 4IC8A 3PJ3A 1DS5A 4LRKA 3WZJA 3B2WA 4ANMA 3TTIA 3LHJA 4C3FA 3BU6A 3QX4A 2BAKA 3HAVA 4O7VA 1YWVA 5HX6A 3ZSHA 4YLJA 3IDPA 3BEGA 4FI1A 1A48A 3AC4A 3R28A 3HAMA 3UIMA 2Z2WA 2VX3A 4XG9A 2CNUA 1WBVA 4U5JA 4QYYA 2JBPA 2BRBA 5TKDA 3NUXA 4BCGA 2RL5A 4FZFB 2UW8A 4GUEA 4E5BA 5BVDA 4S2ZA 1Q8TA 1WBOA 2IWIA 5C03A 3I79A 4RVMA 2CKPA 4I1ZA 4HGLA 1OGUA 3D14A 4U7ZA 4I5HA 4Y5HA 3ZFXA 3TUDA 2OBJA 3TDWA 4F9YA 1Y91A 1Y8GA 2QLUA 3PVUA 2OFUA 4D5HA 4N6ZA 2PUNA 4E4NA 1ZWSA 2UW9A 3BHYA 5AP2A 1PXLA 3ORTA 4KAOA 4IJ9A 5E8YA 2WOUA 3SOCA 2YWPA 4DYMA 5TF9A 4EHZA 3DU8A 3R8VA 1HCLA 4CYIA 3A7IA 4TYHB 4C38A 2XYUA 3DNEA 2G1TA 3D15A 3MY0A 2HWPA 1U5RA 4MCVA 3F7ZA 3M1SA 3UG1A 3UOLA 3LFCA 3SLSA 1ERKA 3OROA 5EM6A 4JRVA 2ZJWA 3KU2A 3R83A 2C5OA 3PDTA 4KIPA 1WAKA 1ZY5A 3QTIA 4O7RA 3ORMA 4D58A 3EKNA 4K11A 1MRYA 4FIEA 2HELA 4WNKA 2FO0A 3VWAA 3E87A 5B2LA 4X2NA 3Q9XA 4MBJA 2IW8A 2IW6A 3MBLA 3FXXA 5BVFA 2QR7A 5HHWA 4EK3A 4BTKA 1ZYCA 4G2FA 1YI4A 2BMCA 5AEPA 4DBXA 2R3RA 1UKIA 3K3IA 4O7TA 3NNUA 4M15A 5HCZA 4LL0A 4PP7A 3POZA 3EJ1A 4FBXA 4H58A 5J9YA 4MBIA 2JITA 3SW7A 5HD7A 4U79A 4ACCA 2ZYBA 4NKAA 4U6RA 3QD3A 4LRMA 2PMIA 3ZO4A 4EZ7A 4CMUA 4GVAA 3F61A 4FTJA 4HPUE 5CENA 3IOPA 1R3CA 3GC9A 2XYNA 3QGWA 1TQPA 4WSQA 2RFEA 4V0GA 2JIUA 2GS2A 3COIA 1MQBA 4R7HA 5LVNA 5EQYA 2OJGA 3B8QA 2XIYA 2XNEA 3EQGA 3F7WA 1SVEA 5A6NA 2GNIA 4RIWA 5E8ZA 5AV2A 4OUCA 4PDOA 5K0KA 3F5UA 4M0ZA 4ASEA 2DWBA 3ODYX 1JVPP 4OTHA 1OPKA 3ZZWA 4DH5A 4RX5A 5DVRA 2X9FA 2I6LA 4ZP5A 5BUIA 3SRVA 5FEDA 2J6MA 2OXXA 4FVPA 3F3UA 2YIWA 2X7GA 3ACKA 3MI9A 4RQKA 2W9FB 3CY2A 2C3IB 5J9ZA 3AT2A 4L53A 2XM8A 3G9LX 4L01A 2FSLX 4AWIA 3A4OX 4GH2A 4HVSA 3QXPA 1NVQA 3RVGA 1VYZA 1PXJA 3L9LA 4FNWA 4ZY6A 4BCIA 2WELA 3HKOA 2YACA 2ETMA 3UOJA 2BZIB 3GFEA 4GJ2A 3V5LA 2PHKA 3FZPA 3LMGA 2Y0AA 3F69A 3OXTA 4XV1A 3UO4A 5DA3A 5L6OA 2PUIA 4OT5A 4X2JA 2FSMX 5L8LA 2PUUA 4IX3A 1J91A 5L2TA 3ELJA 2GNHA 3QYWA 4PTGA 2C1AA 4ZTNA 4V05A 3LFQA 1BX6A 2ITUA 3CBLA 2PY3A 1IAHA 2C6TA 3ZLXA 3NWWA 3TV4A 4O7LA 2YIQA 4CD0A 5IA2A 4IZAA 4RIYA 4L52A 5CX9A 3DCVA 4H3QA 2RGPA 4DEHA 3VBYA 2CPKE 2VNWA 5I5ZA 4EOMA 3AC2A 2B4SB 4DH8A 4FZDB 5IPJA 3POOA 4C3RA 2PMLX 2IVTA 3RGFA 2JBOA 2R3NA 5AM6A 4UMPA 1X8BA 5A3XA 2W4KA 3BRBA 3Q52A 3OG7A 4ITIA 2C6DA 2QVSE 5FLFA 1ZYJA 3FL5A 3TDVA 3NAYA 3WZKA 5FXRA 4M68A 4JAIA 4BRXA 4ZJIA 5EW8A 4RIWB 2B53A 3QU0A 4BVUA 5DR6A 5JK3A 5EM5A 3ANQA 1OB3A 4YPSA 5IEXA 3TL8A 4ZZOA 3DFCB 4YHTA 2E9UA 2DS1A 4WKQA 3UZRA 3C9WA 3QL8A 5BVNA 1IEPA 2OU7A 5HNGA 3OFMA 5EYCA 4GG7A 5KHXA 2VTIA 2HXLA 2HK5A 2VN9A 3MSSA 3TUCA 2PL0A 4HNIA 5CU3A 3OWKA 4QMUA 3WOWA 3CE3A 5TR6A 3C51A 4GT4A 3G6GA 4RLLA 5M55A 3R7IA 3SHEA 5A9UA 1KV1A 2JEDA 3ZC6A 3NVKI 5T3QA 3FMHA 4AN3A 4JNWA 4RFMA 2A1AB 2CGVA 1UVRA 1PXMA 3LCSA 4IADA 4QYEA 2OIDA 4RFYA 5H2UA 4XCUA 2IW9A 4HGTA 2NPQA 5B7VA 2I0VA 2P0CA 3HMMA 3TACA 4FIJA 4EOIA 2R0IA 4A9SA 2W4JA 4IMYA 3C13A 4JQEA 4WRSA 3RAIA 2W1IA 3UQGA 4AXAA 4BBFA 3ZYAA 3E8DA 5DYJA 3WF5A 3FLZA 1XH4A 4I3ZA 5IA4A 2VWIA 3CQWA 1TQIA 4RRVA 5KUPA 2IVSA 3F6XA 3I4BA 3WE8A 2YEXA 3A7HA 5H8GA 4ANNA 3V3VA 5HLNA 3LMIA 2ZB0A 1KE9A 4O1OA 4BWKA 1QMZA 4X3FA 1ZYSA 5H3QA 5DNRA 5DFPA 2VO3A 3QCXA 1WVXA 5IU2A 3KY2A 3V5PA 5HI2A 4EWHA 2R5TA 2YIYA 3KA0A 4FT5A 3D0EA 4YHJA 4BKJA 5CAQA 5JFSA 2YAAA 1ZOGA 2EWAA 4JDIA 5HNBA 3G2FA 4B4LA 3QALE 1VJYA 2BDFA 3QA8A 4FUYA 4AS0A 4XJ0A 3GVUA 4TYGA 5DHJA 3GU8A 4IC7A 3NDMA 1Q5KA 4ANSA 2O2UA 3IDBA 4YLKA 5FBNC 3OD6X 4XG7A 4M8TA 1J7LA 1RW8A 1CDKA 2VRXA 5BVEA 2OXYA 1DM2A 4AA5A 2QC6A 3FL4A 1K9AA 2R3IA 4RC3A 4UWYA 4IAFA 5A4EA 5JQ8A 2CMWA 4JQ7A 4HCVA 3V5JA 4D4YA 5J9LA 3BHUA 4I20A 3DKOA 2Z7QA 3VUGA 4BWPA 3P4KA 4U9AA 4I41A 2JC6A 2OJIA 5EK7A 5EM8A 2XH5A 3TZ8A 4C4JA 5JFVA 3I5NA 4JBPA 5IQEA 4BGQA 4FODA 5L2SA 3BX5A 1OKVA 3QQKA 5AUUA 2PVMA 5BMMA 3ENMA 4IB5A 1JBPE 2R3KA 3P7BA 5J95A 4DG2E 5AAGA 2XRWA 5JGAA 2BRGA 2E2BA 3PG3A 3HV4A 5AP5A 4MXCA 4FNXA 5J1VA 5IDNA 4ZAUA 5KZ0A 3RI1A 4GK3A 5KCVA 2R3HA 2OSCA 4KKGA 4PV0A 2VWXA 4W8DA 3OCSA 4P7EA 4WIHA 5E1EA 3T3VA 2QOIA 5FM2A 1M7NA 4LV5A 4XUFA 5TE0A 2EU9A 2Q0NA 3NPCA 2UZVA 4QMZA 1Y6BA 4YNEA 4G6LA 5DRDA 4MNFA 3OUKA 3RK5A 4FKTA 2OZOA 4FL3A 4GK4A 2W1EA 2PU8A 5AR8A 4X3FB 4XV3A 1W0XC 3DNDA 4QP7A 4LG4A 3EYGA 2RKUA 4RIXB 5CT0A 1O9UA 2VO0A 3ERKA 4CG9A 4X6QC 2QOLA 4XBUA 3D83A 3O7LD 5BMSA 5D7AA 1XJDA 2GHLA 2UZOA 4ANOA 4Y85A 4L42A 4OT6A 4FSYA 4WG5A 3HGKA 2O65A 2X7OA 2CJMA 3PSBA 3KRRA 4DG0E 2OLCA 4HNFA 2OFVA 3AC5A 3ZDIA 5EHYA 3UVPA 2C47A 4YJUA 3M11A 1XHAA 4RVTA 3E8EA 1JSTA 2C6IA 3PVBA 4ZSGA 3U54A 3IW4A 3K5VA 3PRIA 4F6UA 4JG7A 5AAFA 1DAYA 2XK8A 4H39A 3DV3A 3SG8A 3FC2A 2YN8A 2HENA 3NNVA 5E90A 4FSNA 3IQ7A 4G34A 2UW7A 4EC9A 3BU3A 1STCE 4DT9A 3ENHA 4FF8A 3EQDA 4PPCA 4QT1A 1YXSA 3IW7A 4II5A 3LZBA 4YJQA 2YCQA 4EYJA 3D4QA 4RA5A 3KRLA 3R0TA 2YM7A 4FTRA 3LM0A 4KS7A 3U9CA 3UIXA 2WOTA 3I5ZA 1IRKA 4E4MA 4I22A 4GSBA 2VAGA 4R6VA 5EW3A 3WARA 3IW6A 3DT1A 3U4UA 2YZLA 4QP6A 4Z16A 3EQIA 3NAXA 5IQFA 3PPJA 3GC7A 4FZ6A 4F7SA 1JKTA 3Q9YA 3QYZA 4S32A 4FNZA 4IDVA 4ERWA 5HORA 3SG9A 4U40A 4W4YA 3IGOA 4K9YA 5AR4A 3RPRA 4WUNA 3U87A 3CY3A 3V5QA 4D4RA 4RBLA 3ZFYA 4Z55A 2HZ4A 4BKZA 4E3CA 3FC1X 3NYNA 5HIDA 2VTNA 3KVXA 4FK3A 5HKMA 5AUZA 2PE1A 1Q99A 4O0SA 2NRUA 2JKMA 3GC8A 5CEIA 4M69B 3SC1A 3TNQB 4J95A 4XMOA 4IZ5A 3IGGA 5ICPA 3HP2A 4G3EA 1APME 3E7OA 4X2GA 5IA5A 4E93A 4CQEA 1UWJA 1PXIA 1ZOEA 4USEA 5AP7A 4R77A 4DFBA 1O6YA 1MQ4A 3RM7A 1LPUA 2WMUA 2HWOA 4BKYA 2OH0E 1OKZA 3KL8A 3TTJA 3HV3A 4M66A 2EXEA 3FMKA 1YXUA 4GK2A 2OH4A 4BGGA 3BZ3A 3KRXA 3EH9A 3PXRA 4PL3A 4IX5A 4F6WA 3W33A 4D2WA 2XIRA 5EDPA 5AJQA 3QCYA 4P5ZA 4BF2A 4E4XA 1P2AA 1XO2B 5J87A 4FICA 5BUEA 4JBVA 4IAAA 4ALVA 1H4LA 1V0BA 3JY9A 2X1NA 3ZSGA 3LQ8A 1TKIA 4E6QA 3MVMA 4FEQA 3EQRA 4G3FA 5DR9A 3WYXA 4ZTLA 2ONLC 4FV6A 3ATSA 1GJOA 4GKHA 4XLVA 5L2WA 3BYUA 4IVBA 3B8RA 4F1TA 2AC3A 2RG6A 3ULIA 4X21A 4F1MA 3Q4ZA 1KOAA 5J8IA 4JDHA 1H00A 1ZXEA 1M7QA 2X7FA 4NSTA 2VD5A 3C0IA 4ZTSA 3N51A 1KOBA 3OTUA 4AZFA 3FI2A 3GU6A 3U55A 3JS2A 3AGMA 4UN0C 2J0KA 1MRUA 3FZRA 2X8EA 4L44A 5CEMA 2VTTA 2W9ZB 5E8SA 3OOMA 1ZRZA 3F2AA 3FSFA 1W8CA 3ZH8A 4DLJA 2OIBA 4Q5HA 3P1AA 3ZBXA 3TUBA 3DKCA 4FSRA 4CKRA 4CGAA 3PSDA 3KXXA 4M84A 5E8UA 2BDJA 1PRYA 2EXCX 4F9BA 3QZFA 2HZNA 2QOOA 3R8MA 1Z9XA 4IJPA 5GIPE 4YBJA 1QL6A 2J51A 3HDMA 4E1ZA 2B7AA 2XMYA 5CEKA 4PMTA 5JT2A 4W4WA 3RKBA 3RK9A 4D1SA 4C34A 3L8VA 4G3DA 3ZS5A 3R73A 3WIKA 5C27A 1BKXA 3BQCA 5FEEA 5IQBA 5AV4A 3DXPA 3TNIA 2QQ7A 3R02A 4O83A 4AFEA 4M3QA 3GCVA 2YCRA 4XRLA 5FM3A 4AZSA 3QTWA 4O0TA 5HTBA 1T45A 2LGCA 4LGHA 4RX8A 2YWVA 4R78A 4ANQA 3NUSA 4YMJA 4GUBA 1Y8YA 4LI5A 5K3YA 4GJ3A 3O17A 2R3MA 5CTPA 5AUVA 3TNWA 3HX4A 1G3NA 5GHVA 2GMXA 2BUJA 2C3KA 3ORNA 4TTHB 2GNLA 3F66A 5ANEA 3MVHA 3NMUF 4XBRA 3LXPA 3ATTA 3CEKA 2PZIA 4M67A 1JKLA 4OBPA 1E9HA 5I9YA 5LOHA 2OGVA 2QG7A 1F5QA 4ZSEA 2OZAB 1UU3A 2XBAA 4O0XA 2WMQA 3OEFX 3SKCA 2EVAA 5HE3A 2X0GA 4BCQA 3KN5A 3V8SA 3RBWA 3GEQA 4L8MA 4ASZA 4TRLA 4U80A 3AMAA 5CU6A 4MHAA 3G33A 4IH8A 4H1JA 4ZJJA 5EHOA 2WNTA 4O7NA 2A27A 3KMMA 4NW6A 4XLIA 2DUVA 4EKKA 5IQGA 3QZHA 4Y46A 3QHWA 5CXHA 2YDJA 3UNZA 4F4PA 3FQEA 3BI6A 4G3GA 2Y7JA 4IB3A 3ZEWA 5LQFA 1P4FA 2B54A 4ID7A 2Y6MA 2VTLA 1MP8A 1YDSE 4BTFA 2BDWA 5EI2A 4AW2A 5EYKA 5HG9A 4O21A 3R9HA 1JQHA 5IUHA 4DH7A 2Y4IB 3K3JA 3S0OA 2ZV7A 5L2IA 2B55A 2V7OA 5JRSA 5IA0A 3C4XA 4BCMA 4OAUC 2CHLA 3F5GA 3CTJA 2ZDUA 1PMNA 4O96A 2KULA 4AGCA 4AQCA 4ZSLA 2R3GA 1OIQA 3NZ0A 3TIZA 3BE9A 4J99A 3TG1A 4TY1A 2PVNA 2F7ZE 3MB7A 2R9SA 3P79A 3CJFA 4NJ3A 1PXNA 3NCZA 4XG2A 3EFWA 2QNJA 3CD8A 2QLQA 3KFAA 3E5AA 3S1HA 3AMBA 3LFAA 4EH3A 3FMJA 4KBCA 3AC3A 2JFMA 3IECA 3L8PA 2I7QA 2BRHA 2UW0A 1B6CB 4BN1A 4DTBA 1ZY4A 2R64A 2VTPA 4RQVA 3KF7A 3NNXA 4CRSA 3NS9A 3FXWA 4K0YA 4WNMA 5FEQA 3H10A 3ORZA 3C4WA 3R9RA 4FTCA 3WZEA 3FQSA 3DZQA 5CVFA 2X9EA 4EH9A 3OTVA 4PF4A 4GT5A 2WTIA 4OTDA 4G6NA 3EN4A 4PTEA 2PE0A 4U44A 4C58A 4ZJVA 5FUTA 5DN3A 1PYXA 4OTPA 5IQHA 4M12A 4HVHA 5CEQA 2HY0A 3QTUA 2GFCA 4GEOA 4IZ7A 1S9JA 4QTCA 2YM3A 5JN2A 1OKWA 2W05A 2JLDA 4C4EA 1KE5A 4OTIA 5LCJA 3OW4A 3QKMA 3GQLA 4FV8A 5KMKA 1H26A 4E5WA 4ZS4A 1XBAA 1J7IA 4IDTA 3VVHA 3T9IA 3Q6UA 4H36A 4KBKA 1JSUA 3RPSA 1YDTE 4B8LA 2IZRA 2YIRA 2J0JA 4E4LA 2Z7RA 3R9OA 3Q9ZA 4AT3A 4IWDA 5HVYA 3OWJA 5A54A 3EQPA 3EQFA 2RIOA 4O2PA 3EB0A 5TOZA 4O81A 3CS9A 4X2KA 3HRBA 3SQQA 4FGRA 1HOWA 2NP8A 2A2AA 2YLEA 3GB2A 5CSPA 3ACJA 2ZMCA 4YC8A 1YQJA 3DA6A 3R7GA 3IS5A 4GRBA 4YR8A 1L3RE 1UNHA 1PY5A 3QRUA 5I9UA 3ALOA 4J53A 4FV9A 2G2IA 4DCAA 1SMHA 4QMXA 4KIKA 5ETIA 3LE6A 4PMSA 3PPKA 2GS7A 4AA4A 3KXGA 4AP7A 4BR3A 2QG5A 2F9GA 4FEVA 2ETRA 3NIEA 3D7TB 4I6BA 3PUPA 3QC9A 4GL9A 1OECA 4IW0A 5HOAA 4G9CA 4OTQA 3LM5A 4J52A 4IXPA 2VX0A 3PJ8A 1PXPA 4I5CA 1VR2A 4P90A 3UPXA 4DEAA 1JWHA 2VGPA 3R8PA 2UVYA 1ZMVA 2XNBA 3E64A 3U9NA 2ZM4A 5JGDA 5ANOA 4G17A 1PXKA 1U54A 1KWPA 4KKEA 4KIOA 5IQDA 3WI6A 4ZZNA 3SAYA 2VWBA 5D11A 3UGCA 4EI4A 2JDRA 2XP2A 5KMNA 1F3MC 3T3UA 4KKHA 3O8PA 3HP5A 5CZHA 1PMVA 1TVOA 2FSOX 4QP9A 2WMSA 2QO2A 3FYKX 5EDQA 4I94A 4D55A 4WBBB 4BDDA 3Q04A 4ZTQA 1GY3A 2UZWE 2P4IA 1Q8WA 4LFIA 3T8OA 3TIYA 3LXNA 5KMLA 4FKVA 4GCJA 4YJSA 3ORXA 4FTOA 2XK6A 5I9VA 2X6EA 4QMOA 2BCJA 3LCOA 3LFSA 5DT0A 3S4QA 3BKBA 5AAEA 2P55A 1NT2A 2W1HA 5CNOA 4QO9A 3ZU7A 3RP9A 3VN9A 4L6QA 3B2TA 3FWQA 4Y5QA 3QWJA 3VRYA 3W2SA 3Q32A 4RC4A 4D28A 4QQ5A 5AX9A 2W4OA 2CCIA 3NGAA 2UZNA 1XWSA 4ACGA 3SV0A 1Q97A 3KMWA 3A7JA 3JVSA 3PY3A 4K1BA 2J0MB 4F9AA 1T46A 4J1RA 2F7XE 3E3BX 5HE2A 4CQGA 3Q2JA 4BDHA 1WFCA 2WU6A 2W5HA 2XM9A 3R04A 3TEIA 5AM7A 2E9OA 2E9VA 4MWIA 4W4XA 2PUPA 4MBLA 4YURA 3P7AA 2WQOA 1U5QA 5CU2A 3DTWA 1WZYA 2WTJA 3D5XA 3VS2A 2PVLA 4DEGA 5DE2A 4QMVA 3I0OA 4TWNA 5CLPA 4OTWA 3FY0A 3ZMMA 1Q4LA 1H25A 4MQ1A 3DK7A 1U54B 3UVRA 2FH9A 4Q2AA 3VHEA 3HEGA 5KMIA 2VO6A 3BHHA 4DGLC 3PIXA 5D7VA 4A06A 5HU3A 5M51A 1LEWA 2QODA 4NCTC 4X2FA 2WB8A 1UA2A 3FMLA 3JR1A 4O84A 4PMPA 2QU5A 3ZOSA 5BYLA 4FKUA 2YCFA 4XS2A 3MY1A 5BPYA 4J7BA 3MJ1A 3ZLSA 4UY9A 3PWDA 4DF3A 4PTCA 1Q3DA 2IZUA 3CJGA 2ZM1A 4QTDA 4ENXA 5CALA 2BAQA 4PMMA 3QWKA 2AYPA 5HLWA 4H1MA 1PHKA 3F88A 4G16A 3PLAE 5EW9A 5G1XA 2LAVA 3VS5A 3BCEA 1YWRA 3F2NA 3QQFA 4K77A 2XK4A 3OHTA 5CU0A 3C4FA 2R3OA 2YZAA 2DYLA 4G31A 3UQCA 5K4IA 4F64A 4U8ZA 2AC5A 3ZEPA 4NU1A 1FGKA 4KA3A 5C8KA 5HTIA 3OT3A 2WQBA 1OUKA 3EHAA 2O5KA 2O8YA 3CPCA 3LAUA 4BDAA 1Q8UA 2BHEA 5CYIA 3UNJA 4IAZA 3N4VA 2VZ6A 3HA8A 3QKKA 2A19B 5EI6A 5TO8A 4BB4A 4G6OA 4DFLA 4J8MA 5L4QA 5GJGA 3VUTA 2ITXA 2VTHA 3UC3A 1XKKA 4Q9SA 1V1KA 4JL9A 2IVUA 3PXQA 3DBFA 2XNOA 4JG6A 5FP6A 2QCSA 5GZ8A 4CV8A 5CU4A 2O64A 4ZZMA 4HYUA 1AQ1A 4EOQA 1H24A 4E73A 4WOVA 1UWHA 4AUAA 2VV9A 5ANGA 4F7NA 5IG1A 3VF9A 4XHKB 5ANIA 4ARKA 3ZXTA 2XK9A 4I24A 1LEZA 2ZV2A 3OZ6A 2C0OA 4USDA 5TT7A 3ZUVA 2V55A 2J0IA 1UU8A 3QAME 3SA0A 3AOXA 3UP7A 3WE4A 5EFQA 3W32A 3VS7A 5H8EA 1KE8A 4DCEA 4IAYA 4RPVA 4ZY4A 2GTNA 3HV6A 5DOSA 3UG2A 4FEWA 3OVVA 2XKDA 2VTAA 4IHPA 5HZNA 2ITQA 3MB6A 1UNLA 3LJ2A 3QFVA 3DK6A 1XBBA 4G3CA 3L8XA 3THBA 3TKIA 3ZLWA 1OBDA 1SNUA 4V0GB 3FKNA 4QPAA 3F3TA 2XIKA 3NYOA 3TKHA 4F09A 4DTKA 2XEZA 4TXCA 3VJNA 5FRIA 4CYJA 3OF0A 3KRJA 3PVWA 2CKQA 3R00A 4NT4A 4MF1A 3UO6A 3P08A 4KD1A 3DKGA 2XEYA 3KK9A 4A4OA 3R1YA 4G5JA 3NUUA 4QMPA 4YC3A 4O6LA 1JPAA 1H28A 4MWHA 5B2MA 5C1QB 2ZV9A 2QD9A 2PVJA 3G5DA 4WNOA 2Y6OA 4FV0A 3SRVB 2WMAA 2W1GA 2HYYA 3IW8A 2WGJA 3PG1A 1J7UA 1FMKA 5IF1A 3GGFA 1OL7A 1BYGA 4OW8A 4U97A 2CKOA 4N57A 2YM8A 4EEVA 3BEAA 4OTFA 4CV9A 4D9UA 2FSTX 3R30A 3IONA 4PUZA 3SGCA 2WD1A 3UBDA 3W18A 3LCDA 5KBRA 1JSVA 3GI3A 3H3CA 5BVKA 5KKRB 3LPBA 5AV0A 4FKSA 1QPCA 4AFJA 3ZBFA 1OPLA 4CTBA 4FT3A 4IQ6A 4CKIA 3LJ0A 2WTVA 3NUYA 3MTFA 4FSWA 4HYIA 5IMEA 1M2RA 2OJ9A 4CFUA 2WEIA 4I0RA 2F57A 3BPRA 3LVPA 4P4CA 2BALA 3A7GA 4AACA 4ASXA 4O7YA 1K2PA 4ZLYA 2HCKA 3VC4A 5LCKA 3A2CA 4DH1A 4AOJA 1ZOHA 2WMVA 3LXLA 1Q62A 4S30A 3V5WA 1GZKA 4G1WA 3ZO2A 1Q61A 2XKFA 5E92A 3R1NA 3P78A 3A60A 4RIYB 4U81A 4GKIA 4I93A 5CZIA 3GBZA 4XG4A 2R3FA 3RPYA 3IO7A 3O0GA 4DA5A 3W2RA 4GYGA 1YVJA 2WTWA 4FOCA 3VS1A 3ZTXA 4C4IA 4RLKA 5HE0A 4UYAA 4IEBA 2C5YA 2ZM3A 4LMNA 4YZDA 2H34A 3VUHA 3MS9A 3MH3A 3Q4TA 3JVRA 2A0CX 4FSQA 2EB3A 2V0DA 4UMUA 3GENA 2WU7A 5DT3A 2HW6A 3UZPA 3LIJA 3VUKA 2Z7LA 5I3OA 3JYAA 1OIUA 2PZRA 2VTOA 3ETAA 3TV6A 1PMUA 4DC2A 3N4UA 1P14A 3ORIA 2WEVA 5LVLA 4BCHA 5BYYA 2WQEA 3BYSA 4IX4A 5L2QA 4IFGA 4JG8A 5FG8A 2I40A 3ZDUA 1SYKA 3ZHPC 3VO3A 3AD4A 4XP2A 4OLIA 4RVKA 4A9RA 5M07A 3R7UA 3SVVA 3UOHA 4RZWA 2F7EE 4HGSA 4JT3A 4EK5A 5D41A 2BRNA 2ONLA 3FY2A 4C7TA 4C4GA 3EL8A 5IEYA 4FKQA 4GIIA 4C02A 4EK4A 3QRIA 4CFWA 5IH6A 4UXLA 4R3CA 2W99B 1GAGA 3Q4CA 2FA2A 1WBTA 1IG1A 3VBVA 3LFNA 1M2PA 4TWOA 1OBGA 4RWJA 2HZIA 1OL2A 1J1BA 2BHHA 2W96B 4O82A 4YTCA 4FL2A 3WZUA 1FQ1B 2UUEA 1H1WA 4BDJA 3PSCA 5KBQA 2GNGA 4HYSA 3QF9A 1E1XA 1ZZ2A 4YGAA 1MUOA 4AE9A 4ZLOA 3O71A 2CDZA 3KXZA 2EB2A 4AZVA 3DPKA 4FEUA 3FLYA 3VS6A 4ZXTA 3D2IA 3D9VA 4BCOA 3QQHA 4E5AX 5C8NA 3FYJX 1M14A 4JS8A 4H05A 4LYNA 2YITA 4QYHA 3P9JA 4BHNA 3UOKA 5H9BA 4ZMEA 1LUFA 4MTAA 4AGDA 1ZLTA 3ORPA 1JKSA 3IOKA 3R2BA 3R1QA 2WMRA 4EH5A 3JUHA 4UXQA 5M4FA 5BX0A 3MH2A 3GU7A 1NVRA 4EH4A 1LP4A 3F5PA 5HD4A 4DITA 2VWUA 4C33A 5AADA 5L3AA 4BHZA 4G9RA 3VS4A 2YDIA 3KQ7A 3KGAA 2BZHB 3VBTA 2X2LA 3UVQA 4YZ9A 2BRMA 4EOLA 4N70A 5A14A 3DXQA 3FQHA 5H8BA 1CM8A 4NM3A 5LMBA 4KWPA 2UZEA 4IANA 4AE6A 4DFXE 4RC2A 3NUNA 5FTOA 4AGWA 2F2UA 5KO1A 3OUNB 5AX3A 5IUIA 1FVTA 1UU9A 3Q53A 3SD0A 4GU6A 4N6YA 2IVVA 1ZMUA 2W0JA 2XF0A 3QA0A 2PE2A 4JBOA 3FPQA 3TI1A 5JSMA 3TZMA 4YZBA 1SM2A 4BBMA 4D9TA 3MA6A 2XK3A 5C8MA 3F3WA 5HCYA 2PK9A 3LFDA 4QNAA 4DEEA 2ITVA 3O2MA 5FXSA 3NW5A 3BWFA 1PKGA 4BZOA 3QCSA 5IQIA 3UODA 2IJMA 3DK3A 3AMYA 3QD2B 1UV5A 5CASA 5I3RA 3QRKA 4TN6A 2GHMA 4OTRA 4U41A 5LXMA 4E7WA 3NIZA 1U59A 5CQWA 5EHLA 3ZONA 3TKUA 4YSJA 4DBNA 3G9NA 4FT9A 1I09A 3G15A 1ZAOA 3DS6A 3CQEA 4AZTA 4F70A 2BAJA 3O7LB 4HPTE 4S31A 5LVOA 5EOBA 4C3PA 3K5UA 4C59A 4WD5A 4BICA 2HOGA 1W98A 4IM2A 2UW3A 5E1SA 2QO7A 4B9DA 1YKRA 2X2MA 3H0YA 3HA6A 3CTHA 4V01A 3RCJA 5IQCA 4ZTRA 2BIYA 2PZ5A 5E8XA 2ZV8A 5CAUA 2FYSA 3NW7A 3KXHA 2GDOA 1Q8ZA 4ZSJA 4K18A 3MFRA 4RG0A 3HDNA 4IACA 3ZO3A 4L67A 3DLSA 3PJ1A 3REPA 3UYSA 1P4OA 2ITWA 3DBQA 3HUCA 2H9VA 3PYYA 3R63A 4O86A 2JAMA 4NM5A 1K3AA 5CSWA 2YDKA 1GZNA 5LVMA 3OXIA 3OCTA 5ETCA 5A6OA 3UQFA 3MPTA 2WTCA 4EOSA 3SW4A 2QR8A 3G0FA 5AIKA 4BDKA 4CXAA 5CS6A 3GCQA 2BVAA 2YFXA 3F9NA 5I0BA 3AXWA 5ACKA 4ENYA 3DDPA 3CLYA 4N0SA 2FB8A 3CC6A 4HZSA 4CFFA 2G2HA 4DN5A 4F0IA 2BFYA 2BILB 3DOGA 3R21A 4BL1A 3LQ5A 3MIAA 3DJ7A 1REKA 3RINA 4O2ZA 2E9PA 4OR5A 3QTRA 5F20A 2CCHA 3TT0A 5CANA 3CCNA 2PVKA 5J7HA 2YCSA 4PDPA 3N4TA 2R3QA 2GPHA 3AD6A 5JRQA 5J1WA 3AGLA 4WA9A 1R39A 5IA1A 3TV7A 5I9WA 3BYOA 2XNPA 1FPUA 4KRDA 1WBNA 3GNIB 3VIDA 1YI6A 2J2IB 3UJGA 3HUBA 3KRWA 3EL7A 4LGDA 4QQCA 3QHRA 1NA7A 5JZNA 2OF4A 1Q3WA 3IKAA 3Q4UA 1ZYDA 4L45A 4JDJA 3Q3BA 4YTHA 3V04A 5JFXA 4FG8A 4QQJA 4A7CA 4XOYA 5CEPA 5JZJA 4CMTA 5E9EA 3Q6WA 2X8IA 3NRMA 2RFNA 4UV0A 2I1MA 2CGXA 4L3LA 2CNVA 2X39A 4KUJA 3OEZA 1W7HA 4A9TA 4Q9ZA 2VTQA 3FXZA 4K33A 2R3PA 4A4LA 2SRCA 5DBXA 2XVDA 4UMTA 4C61A 5F9EA 2UW4A 2QHMA 3E8CA 4J97A 2JDTA 4RJ4A 3MPAA 3BV3A 5DIAA 3ZFMA 3OCBA 4LOPA 4BCFA 1GIHA 2CN5A 4TW9A 2WTKB 4EHEA 5A46A 4QTAA 1SNXA 4YC6A 1WBPA 2QOHA 3ULZA 5ITAA 3QLGA 5AIRA 4FSZA 5GIOE 5CY3A 1NXKA 4IB1A 5KMOA 5JGBA 2PULA 4I92A 2UZDA 1KV2A 3HV5A 1REJA 4RX7A 4Y72A 3V5TA 3LLTA 2BZJA 3F5XA 5AP3A 3BYVA 4PDSA 4MK0A 3TN8A 3FZ1A 1OKYA 2J7TA 3FMMA 1R0EA 4DLIA 3LJ1A 4QMQA 4HZRA 4EH6A 5CQUA 5A4LA 2OWBA 4O0VA 1FGIA 5KX8A 4CFXA 2ITZA 2B52A 2FGIA 4MKCA 4W8EA 2XCKA 2Z8CA 3VJOA 3R6XA 3E63A 4HVDA 3BWJA 1ZZLA 2G15A 4TT7A 3VS0A 1WBSA 3D5UA 3A99A 3Q60A 2H96A 5FXQA 4QYGA 2XBJA 5BVWA 3O51A 4BZNA 2I0EA 4DHFA 2BTSA 5I4NA 2WQNA 4I4FA 3C0HA 4ACDA 4C0TA 3F82A 3PZEA 1SVHA 2VWWA 3EFJA 4U42A 3ROCA 2CGUA 2BR1A 3U6JA 2YERA 3EOCA 4EYMA 2OO8X 3UC4A 1ZYLA 3MGYA 4F0FA 3C4CA 5C4KA 4D2RA 1BMKA 1QPJA 3DAKA 5GJDA 2NNWB 3U6IA 3GFWA 4APPA 2WMXA 2FUMA 3ZRMA 2BIKB 2BPMA 3TM0A 5ANKA 4CKJA 4WUAA 3RK7A 4F9WA 3H4JA 1M52A 3HL7A 4D0XA 1CMKE 2W7XA 3COKA 3V51A 4QP3A 4QRCA 3WZDA 4APCA 2DQ7X 5AP4A 5FGKA 4AA0A 3SXSA 4FMQA 3LFFA 3UIUA 4EOOA 1ZMWA 1H08A 3W16A 3FZTA 2ZMDA 2J9MA 4FV2A 2VWYA 2YM4A 4E8AA 1W84A 3ZCLA 2PTKA 1YOJA 3PWYA 2QURA 4IWOA 2WMWA 1BUHA 3F2RA 2RSVA 2XA4A 4PP9A 4BTJA 3QD4A 3VQUA 4NFNA 4CNHA 4MQ2A 3FHRA 5CEOA 3VS3A 2IZSA 4O22A 4EJ7A 5DWRA 4EH7A 3CTQA 2J4ZA 3H9FA 3BIZA 4U3ZA 2UZUE 3R1SA 4KSQA 4B8MA 4JLCA 4CSVA 4YJPA 4HYHA 5HBJA 2Q83A 3OCGA 4CG8A 3QRJA 4R1VA 4D0WA 2WQMA 4FNYA 3ZXZA 4FTAA 4J71A 4PPBA 3TZ7A 5KMMA 5EKNA 3OBGA 4BWXA 4ZS0A 4X7QA 4D2VA 3PTGA 4KBAA 2ACXA 1FVRA 4WSYA 3FLWA 3OP5A 4IM3A 3MV5A 4RGJA 2QHNA 3PIZA 3PA3A 2IO6A 5AUWA 5JMSA 2YM6A 3MFSA 5CNNA 3WF7A 4NCTA 3LKMA 3CSVA 3VBQA 4BFMA 5T6KA 4FV3A 4I23A 5JQ5A 4CTCA 3UO5A 2VX1A 2VTSA 3PFQA 2NRYA 3UPZA 5M09A 3I0QA 3GXLA 3LFBA 2CN8A 4FZAB 4XH6A 3RNIA 2V62A 3H9OA 3NVMB 2PWLA 1DAWA 5HBHA 5EOLA 3KXMA 4L68A 4FTMA 3QQJA 4QP1A 4NJDA 3PJ2A 4C35A 4QTEA 2OJJA 2QOBA 2Y4PA 3QUEA 4X3JA 3S95A 4XP0A 4M97A 2RFSA 2X4FA 4RSSA 2PVHA 1BL7A 2OJFE 3QQLA 4C62A 3KB7A 1YHSA 4L9IA 3O23A 4YJNA 1L8TA 2OG8A 4DT8A 2XJ2A 4B99A 5DEYA 1M2QA 3G0EA 1Q41A 3FDNA 4IM0A 4DGGA 1OVEA 4ZMFA 3AC1A 4F6SA 4FSUA 2ZAZA 4DFYA 4USFA 4HGEA 2JDOA 3QXOA 5HG8A 4CCUA 3FMNA 4X6RA 4CFMA 2IG7A 5DRBA 4LUEA 2P3GX 2GU8A 2XUUA 3FMDA 3LW0A 3R9NA 4JX3A 4A07A 5LMKC 3DB8A 3EQCA 4R7BA 4EONA 4AGUA 3GCSA 3FLQA 3OWLA 4NIFA 2Y4IC 3V8WA 3LCTA 5K5NA 4UEUA 5DR2A 4O0UA 2GQRA 3ZUTA 4O6EA 4O7SA 3CIKA 3WIGA 2XNMA 2R0UA
chains in the Genus database with same CATH superfamily
4AN9A 4D1ZA 3KXNA 4I4EA 2UW5A 3CD3A 3O96A 4AF3A 5A4TA 1H0WA 1OIRA 2CKEA 1QCFA 4W9WA 3QLFA 5EYDA 4BDGA 4JBQA 5D10A 4O38A 4WNPA 3L9MA 4BTMA 3GOPA 5M44A 2IPXA 3K2LA 4EBVA 4FA2A 4Q5EA 3CP9A 1Q8YA 1W82A 2W1FA 3UNKA 4BCKA 1E1VA 1PKDA 1DI8A 5FBOA 5FD2A 3NCGA 4FIHA 4GG5A 4BC6A 4ITHA 1TZDA 4CMOA 3DAEA 3QD0A 3DY7A 1YXVA 4L00A 3W10A 4BIBA 3LXKA 3IK3A 4TKSA 4DFZE 5L8KA 4I0SA 4YZNA 3R8UA 3E62A 4CEGA 4JI9A 4R1YA 4W9XA 4KABA 2JIVA 5ETAA 3E88A 3F3ZA 4GT3A 3DXNA 3UE4A 4IE9A 4XG6A 3P5KA 1O6LA 4OTGA 4UWBA 3U8WA 3HRCA 4RT7A 5EQPA 3R7VA 2C3JA 5L8JA 2PVYA 3CGFA 3W2OA 4QMYA 3CKWA 4UMQA 2WIPA 5HEZA 3BU5A 4RZVA 5E7RA 4YTIA 4MXAA 4AW0A 4KIKB 3R7YA 5M08A 4IVCA 5LMAA 1NVSA 1YXXA 2XIXA 2X6DA 5HO8A 5B0XA 4F1OA 5C4LA 3U6HA 1DI9A 5F1ZA 3VNTA 2B9HA 4TYIA 4U43A 4RWIA 4RX9A 3PP0A 1GIJA 4YO6A 5E91A 4FVRA 3ORLA 4U45A 4FTKA 4XRJA 2QU6A 2X0PA 2VTJA 4NIFB 4PPAA 4ANBA 4AZEA 3D7ZA 1XMMA 2ERZE 4NZWB 4YBKA 3R8LA 4FKPA 1RDQE 1H1QA 3RWQA 4DE4A 3EQHA 3RAHA 5L6PA 4MYGA 4OBOA 5HESA 3TJDA 2KTYA 4JX7A 5K0XA 4MX9A 4TYJA 3VULA 3BELA 4NH1A 3NFGB 2A98A 3OXZA 2ESMA 5AR5A 2XZSA 1RQQA 1PJKA 1WVWA 5J79A 2HIWA 4ZTHA 3L9NA 5CAPA 5DLSA 3BHVA 3MVJA 3FZOA 3AC8A 4RJ7A 4FIIA 3I7CA 3R9DA 2B9IA 3BLQA 4ZIMA 2GFSA 4QP8A 3ZRLA 2P33A 4QPMA 5HG7A 4FC0A 1KE6A 1U46A 3MESA 4DFUA 2C5VA 2R2PA 5AP6A 1RE8A 3MTLA 3BLHA 4LOQA 1WMKA 4GV1A 4G5PA 4RWLA 5IA3A 4LMUA 3ZZEA 5DGZA 2AQXA 4BZDA 2J50A 1FOTA 4MAOA 3U51A 1XMLA 2VTMA 4LV8A 1S9IA 3EYHA 3GCUA 5EQEA 2O3PA 1BL6A 3E92A 3MVLA 2IZTA 4CLIA 2H6DA 4CRLA 2QOKA 5C9CA 2OXDA 3ROYA 3W1FA 2JKQA 2EUFB 4BCPA 4C4HA 5HG5A 2PVFA 4FV7A 4CT1A 3BBWA 5CSXA 4YLLA 4BDEA 4HVGA 4NW5A 3RAKA 4ASDA 3Q5IA 3DBCA 4CZUA 3SXFA 4V04A 5E4HA 3JPVA 1ZARA 4MNEA 3KK8A 3ZSIA 3VHKA 2UZTA 4XYFA 5KMJA 4LM5A 1Y6AA 2ZB1A 2HAKA 4RWKA 3COHA 5DG5A 5EI8A 4ZY5A 3DBEA 2QKWB 3D5VA 4ERKA 3HMPA 5CXZA 5DMZA 5HU9A 3PY0A 1KUTA 3UDZA 4EJNA 3UP2A 2A4LA 3FE3A 2RG5A 3D94A 3L1SA 3HVCA 3MW1A 4EQUA 3BQRA 3FJQE 2WXVA 4AG8A 3PUFC 3VUMA 3SX9A 1KSWA 4H3BA 4BYIA 2YABA 4D2PA 3RZBA 4EORA 5M53A 4IAKA 5HBEA 1H01A 5EKOA 1QPEA 4EOJA 5M56A 1UU7A 4FT0A 4RJ3A 3FI4A 5J7BA 5IEVA 4YZCA 4PRJA 3L8SA 5F94A 3A4PA 2YJRA 2PMNX 3FPMA 4BDCA 4EC8A 4O7WA 3DQXA 4DEBA 1G8SA 2CNQA 5D12A 2C0TA 2YLFA 4DFNA 3GU4A 4GYIA 4PL4A 4YNOA 4BIEA 2WFYA 2ITPA 3PFYA 4XOZA 5DEWA 4BI2A 4ORKA 3UMXA 4BBEA 4XEYA 1ST0A 4FX3A 4FK6A 3MH0A 4BYJA 3BV2A 1Q24A 3EN6A 4MXXA 3MYGA 1FINA 3BGPA 4ZOGA 5FWKK 4D1XA 5M4CA 4YJOA 2UZBA 4R5YA 4R3RA 3COMA 2JIIA 1R0PA 3UYTA 1H1PA 2GQGA 1TQMA 2PMOX 3IG7A 1ATPE 3IW5A 4UBAA 2X0QA 4FR4A 5CSHA 5B2KA 5M06A 1W83A 4MNEB 3V01A 3VBWA 4B7TA 3MY5A 2WIHA 2UV2A 2R4BA 3RPVA 1F0QA 4PY1A 1MRVA 3NUPA 3W8LA 3L9PA 3V6RA 4NM0A 4DINA 2G2FA 4RJ6A 2UW6A 4ZSAA 3SXRA 2J90A 4XV2A 2YHVA 5IISA 4QMWA 3QRTA 3GOKA 3FKLA 3PLSA 3O8UA 4N4SA 2HXQA 3I7BA 4DH3A 2C6MA 4QMMA 3AKJA 5GNKA 5D1JA 3G6HA 5AUXA 2ZFYA 3TZ9A 1YI3A 4QQTA 5C26A 2NO3A 3FUPA 4XV9A 4DTAA 5CF6A 2W5AA 3S3IA 1M17A 4DEDA 5IH4A 4MD8E 1OZ1A 2OI4X 3RM6A 4O7ZA 2GSFA 2BFXA 4OGRA 3UMWA 4IWPA 4JOAA 5HNIX 5HTCA 4QP4A 5F95A 4HCUA 2YA9A 4HJOA 1VZOA 2PSQA 1WVYA 4KB8A 4ZK5A 3WF6A 3DJ5A 4JDKA 2YIXA 3CR0A 4ACHA 3I81A 5CVGA 3AG9A 4UB7A 3R8ZA 1O6KA 1PYEA 1EH4A 1FVVA 1OM1A 4O91A 4XP3A 5ANDA 3MPMA 3QBNA 3QTXA 4IVDA 4NFMA 5CI6A 3I6UA 4XG3A 3DLZA 4L3JA 4CZTA 4O0WA 3ET7A 4DGMA 2CSNA 4EZ5A 4CCBA 4HW7A 4NK9A 4EK8A 1PF8A 2B9JA 3ALNA 3R7OA 4EH8A 4KIQA 5AUYA 4BDBA 4EK6A 3FAAA 4Y83A 3WF8A 3EMGA 2BKKA 4P5QA 4KNBA 5IKWA 2QO9A 2C6OA 4S33A 1BLXA 1YRPA 1OMWA 4O0YA 4TZRA 5C01A 5GZAA 1H0VA 2ITOA 1KE7A 4IIRA 3NYXA 4DEIA 4YO4A 4RIXA 1SVGA 1FBNA 4NL0A 2X81A 4JXFA 3GUBA 4FTIA 3QKLA 3FEGA 4FOBA 4CFVA 2PZPA 4YTFA 5K5XA 5CVHA 5JFWA 4CVAA 4RJ8A 3DZOA 3RCDA 4JRNA 4ACMA 4F99A 5AFVA 5D9HA 4IWQA 2X4ZA 3K54A 4BIDA 4FKOA 2YISA 5LWNA 1Z57A 4HVIA 2R3LA 5HO7A 2C0IA 2ERKA 3PA5A 2JDVA 3RMFA 3PE1A 4XX9A 4I5PA 3ZM4A 3BGQA 4FKGA 3DB6A 1CKIA 3NX8A 4EHGA 2J5EA 4FG9A 4O1PA 3TCPA 3MFTA 3UZTA 3ODZX 4GVJA 4FE2A 3OY3A 2C30A 2E9NA 5AR7A 3FV8A 3A7FA 2J5FA 3CKXA 3LCKA 3EIDA 3PVGA 4L7SA 3C5UA 4E6AA 2XB7A 4RMZA 4QP2A 3DGKA 3GC0A 4UWCA 5AMNA 3VAPA 3W8QA 3ZLYA 5BQ0A 5KKRC 4BCNA 2CLXA 5FDPA 4AW1A 3WYYA 1IAJA 5KE0A 4C2VA 2XNNA 5F4NA 5CF4A 3EN7A 3A8WA 3W2CA 4FKWA 4EH2A 4WBOA 5HE1A 3TNHA 2QOQA 3BGZA 4CZYB 3RJCA 2B9FA 2GTMA 4FTUA 4HOKA 4YUQA 5JH6A 2BKZA 4QTBA 4Y95A 3BHTA 5G6VA 4JAJA 1PXOA 1YHVA 1IA9A 4KINA 2ITNA 4BY9E 4C57A 2BTRA 2VGOA 3C5IA 2I0HA 3OBJA 2GCDA 2VO7A 4LGGA 3VBXA 5HCXA 4M69A 4TYEA 3PXZA 3QCQA 1J1CA 5CT7A 5KNJA 3DTCA 1CKPA 4E6CA 3EKKA 3QZGA 4I5MA 5E8TA 3RHKA 3A62A 2PPQA 1OL6A 2Y8OA 5EG3A 1JAMA 4R3PA 4FKIA 4NWMA 1XR1A 3KKVA 2ITTA 4AOTA 4EKLA 4MXYA 5M57A 5ACBC 1LR4A 4F65A 3V6SA 2C3LA 4BGHA 4FKJA 4FTQA 3NEWA 4AXFA 3P23A 2C69A 2PVRA 4I0TA 3P86A 4L43A 4O4BB 3CQUA 4PX6A 4LRJA 3NW6A 2OW3A 3V8TA 2C68A 3HMIA 3VRZA 3VQHA 4DGNA 4Y8DA 3D2KA 1WBWA 3E3PA 4H3PA 4FSMA 4TNDA 3A61A 2B0QA 4IVAA 4F08A 4WHZA 4OAVB 4F7JA 4QDVA 5IQAA 5I9XA 2FVDA 5CSVA 2CLQA 2ZVAA 4A9YA 4NTTA 2JDSA 3KN6A 3QTZA 5J5SA 1U4DA 4J8NA 2GNJA 2YM5A 3PA4A 2PYWA 3MA3A 3RAWA 3ID6C 3N9XA 3KEXA 2Z7SA 3W0SA 4JJRA 3R01A 5J5TA 5IMXA 4AT5A 4LL5A 3AQVA 4DAWA 3AT4A 2JKOA 1NY3A 2R7BA 5EYMA 1BI7A 3VF8A 3DBDA 2XKEA 4KS8A 2YJSA 4ANLA 3QUDA 3GT8A 4M7IA 2JGZA 4UZHA 4K8AA 5BUJA 4FT7A 4Z7HA 4WRGA 3UTOA 5IZFA 2RFDA 4D5KA 1OL1A 1XQZA 4WG4A 4C8BA 2F2CB 4FTTA 4QOXA 1SZMA 3OOGA 3ZO1A 4CFNA 4IB0A 4MD9E 3VW6A 1OITA 4L3PA 3LMHA 3KULA 2BZKB 2Z02A 1UNGA 3ITZA 3MJ2A 4FUXA 4YJRA 1XH9A 5FTGA 3TJCA 3PP1A 4U0IA 3RNYA 3NNWA 2C4GA 5CWZA 1YW2A 2X0OA 2HW7A 4YHFA 3QZIA 5AP0A 4AX8A 5A4CA 4KSPA 5CAVA 4NTSA 3NR9A 1PW2A 3QGYA 2W5BA 4FV5A 4MVFA 3KREA 3EZVA 1OL5A 1IR3A 2V7AA 5HIBA 4GFMA 5BNJA 2QI8A 4X3FC 4O0RA 4OBQA 3KMUA 5JEBA 1WCCA 2C6KA 4ONAA 4O27B 1YDRE 5CF8A 2WHBA 3AD5A 4Z9LA 4F7LA 3EFKA 4I6FA 4J96A 4C36A 4A9UA 5FTQA 3M2WA 4C2WA 3NLBA 4EBWA 4RA4A 2RF9A 3RALA 3WBLA 5DPVA 1URCA 5M4IA 1OI9A 1YXTA 1GZ8A 3HV7A 5EM7A 5AA9A 5CF5A 1UKHA 4PNKA 3F3VA 1G8AA 2W1CA 3ZUUA 3AKLA 3P0MA 5HO6A 2ZOQA 2XIZA 4FV1A 4W4VA 3C7QA 3RZFA 3HNGA 1AGWA 3I1AA 4PWNA 3HRFA 2W06A 4ZEGA 1G8JA 2OZAA 4O4FA 4TPTA 4AOIA 3FSKA 3RTPA 4F63A 1A06A 5AP1A 4EQMA 5HQ0A 2QOCA 3O50A 2XS0A 4FTLA 4R8QA 3LQ3A 4M14A 4EWQA 3W2QA 1RJBA 4UALA 4MH7A 3O5AA 3DKFA 4CLJA 3TWJA 4B6LA 5HVKA 3OY1A 3C4ZA 2JD5A 2QOFA 3OWPA 4UYNA 3RPOA 3TNPC 5KHWA 4R5SA 5EH0A 5AWMA 5M4UA 5HLPA 1YOMA 4FYOA 4EOPA 2Q0BA 2XKCA 5I9ZA 5A4QA 4YJTA 2YAKA 4J98A 1H8FA 2OICA 4X0MA 1OPJA 4NKSA 2UZLA 3KCFA 3FHIA 4WO5A 4E26A 5T68A 4QMNA 4PDYA 2H8HA 2CGWA 4JVGA 4TNBA 3MFUA 3SOAA 2OK1A 4MF0A 2VU3A 2REIA 3WF9A 4C4FA 2UVZA 3KULB 3FZSA 5ANJA 5LMKA 4XG8A 2F4JA 2WMBA 3E8NA 4FTNA 4FZ7A 4WT6A 4QYFA 5GZ9A 5HGIA 3GU5A 1JNKA 3II5A 3EQBA 2WMTA 1XH7A 4PQNA 4E6DA 2VTRA 1B39A 1R1WA 1HCKA 3KF4A 2JKKA 3P7CA 4NM7A 1A9UA 1XH8A 5AR3A 5JKGA 3H0ZA 1BI8A 2O0UA 3Q96A 2VNYA 4L7FA 3G51A 2OIQA 2VUWA 5L6WL 4Z7GA 2QONA 3W55A 1GZOA 3QTSA 5K4JA 3PPZA 5KZIA 3QX2A 4BCJA 2ITYA 3W2PA 4B0GA 5IDPA 1H1SA 4MUQA 3ZM9A 1GNGA 1P5EA 3NYVA 3LOKA 3EFLA 4NEUA 3PE2A 3FMEA 4K6ZA 3MH1A 2VWZA 4U3YA 4MD7E 4Z3VA 5GINE 3HECA 3LLAA 5AV1A 3PJCA 4PNIA 3A8XA 4WG3A 4KRCA 4GS6A 4LUDA 3Q5ZA 2Z60A 1J3HA 4FV4A 3R2YA 2WTDA 4IAIA 2BROA 3MIYA 3JXWA 4TWCA 5E8VA 1H1RA 2XJ0A 2XNGA 4FKRA 3S2PA 3ZRKA 4I6HA 4XNEA 4FKLA 3MN3A 3PRFA 1IA8A 4QPSA 4EOKA 2ZDTA 2O63A 3E7VA 4YZMA 2P2HA 1CTPE 3OS3A 5BVOA 5HIEA 4TL0A 1VYWA 4HCTA 1AD5A 3IPHA 4A4XA 3DDQA 5GJFA 4AZWA 2ETKA 5HX8A 5CAOA 3HLLA 2C5NA 4AAYA 3TXOA 4YJVA 4EUUA 2XCHA 3AT3A 4IX6A 4QMSA 1JLUE 4GU9A 4QNYA 4JQ8A 3OC1A 1Y57A 4DGOA 3KVWA 1V0PA 2I0YA 4YU2A 1JOWB 4AW5A 3DFAA 2WO6A 4ALUA 4IZYA 3GP0A 4MXZA 5LVPA 3CXWA 3M42A 1V0OA 4K2RA 4MEDA 4F0GA 2QKRA 4L46A 2WAJA 3MWUA 5K9IA 4QMLA 4ZTMA 4FIFA 2GS6A 4RFZA 4FSTA 2V22A 3C0GA 1CSNA 3EN5A 3T9TA 4AAAA 4E20A 5AA8A 5LJJA 4GFGA 3R71A 3QC4A 2W1DA 3S00A 4NUSA 4TWPA 3PZHA 3UDBA 5CI7A 2WTKC 4RIOA 3C1XA 4GIHA 1FMOE 2G9XA 5HVJA 4EQCA 3ANRA 2AUHA 1YOLA 2WKMA 3PY1A 2X2KA 3QQUA 2V5QA 3QTQA 1YWNA 4NYEA 4PL5A 3D7TA 4DG3E 1H27A 1XH6A 4QDEA 4BDIA 4JIKA 3R7EA 3GQIA 3FLSA 4QMTA 4AN2A 4YPDA 3Q9WA 2OKRA 3CGOA 3LFEA 4EL9A 5DH3A 4FEXA 4I21A 4D2SA 5BYZA 4QD6A 3FI3A 3KCKA 4LOOA 4P2KA 3OT8A 4UZDA 5AUTA 3VW8A 3I60A 2GHGA 2F49A 3EZRA 3JY0A 3PIYA 4CT2A 3OW3A 3HMNA 4EZ3A 4ZLZA 1B38A 2GNFA 4JR7A 1XH5A 2JAVA 3EWHA 4YSMA 3HMOA 2UVXA 5ETFA 5LARA 4BI1A 3DJ6A 4M13A 3QUPA 1QPDA 4UMRA 3IDCA 4IBMA 2J0LA 4D4VA 2OF2A 1IASA 2IF8A 3H30A 2G01A 2P2IA 4I6QA 4MXOA 2XRUA 2VWVA 3C4EA 3C50A 4FG7A 4AT4A 5FDXA 3RHXA 3NUAA 4EHVA 3EN9A 1PMEA 3E93A 3BYMA 5IUGA 2W1ZA 2W17A 4JR3A 3U4WA 3RWPA 4GMYA 2C6EA 3R22A 2XK7A 3HZTA 1URWA 2R7IA 4FVQA 5E8WA 4BDFA 3MDYA 5AV3A 1GIIA 3HYHA 4ALWA 1YHWA 1NW1A 2WPAA 1R78A 1CKJA 1Z5MA 4RJ5A 3Q2MA 1G5SA 2PZYA 2WZJA 4IFCA 4M0YA 2B1PA 3DAJA 3VUIA 5FQDC 5LWMA 3BLRA 3PXFA 4EUTA 2C1BA 3CPBA 3UIBA 4D2TA 4FGBA 2XJ1A 4F9CA 1OUYA 3PXYA 3KC3A 2HZ0A 3FKOA 3FI8A 3BE2A 2JFLA 1ND4A 4TYHA 4BI0A 3BBTB 4JIAA 4YP8A 3ORKA 2C6LA 3SDJA 4GFOA 1JKKA 5AR2A 2X8DA 4ITJA 4Y73A 4S34A 4LQMA 1GOLA 2R3JA 5EDRA 3DQWA 4FL1A 3FBVA 2C5XA 1VEBA 2HY81 3O8TA 1XBCA 1OIYA 2IN6A 3GCPA 2Y9QA 4C37A 3FLNC 3QQGA 4RVLA 3PXKA 4UX9A 1H07A 3OMVA 4FIGA 5FP5A 3ZC5A 5IH5A 5DI1A 4R7IA 2GQSA 4AU8A 3H9RA 4FYNA 3D5WA 5DT4A 3VUDA 1ST4A 3NSZA 4GW8A 5HICA 4D4SA 3WILA 1I44A 2EXMA 3G90X 3I6WA 4IC8A 3PJ3A 1DS5A 4LRKA 3WZJA 3B2WA 4ANMA 3TTIA 3LHJA 4C3FA 3BU6A 3QX4A 2BAKA 3HAVA 4O7VA 1YWVA 5HX6A 3ZSHA 4YLJA 3IDPA 3BEGA 4FI1A 1A48A 3AC4A 3R28A 3HAMA 3UIMA 2Z2WA 2VX3A 4XG9A 2CNUA 1WBVA 4U5JA 4QYYA 2JBPA 2BRBA 5TKDA 3NUXA 4BCGA 2RL5A 4FZFB 2UW8A 4GUEA 4E5BA 5BVDA 4BJJB 4S2ZA 1Q8TA 1WBOA 2IWIA 5C03A 3I79A 4RVMA 2CKPA 4I1ZA 4HGLA 1OGUA 3D14A 4U7ZA 4I5HA 4Y5HA 3ZFXA 3TUDA 2OBJA 3TDWA 4F9YA 1Y91A 1Y8GA 2QLUA 3PVUA 2OFUA 4D5HA 4N6ZA 2PUNA 4E4NA 1ZWSA 2UW9A 3BHYA 5AP2A 1PXLA 3ORTA 4KAOA 4IJ9A 5E8YA 4LDTA 1G8KA 2WOUA 3SOCA 2YWPA 4DYMA 5TF9A 4EHZA 3DU8A 3R8VA 1HCLA 4CYIA 3A7IA 4TYHB 4C38A 2XYUA 3DNEA 2G1TA 3D15A 3MY0A 2HWPA 1U5RA 4MCVA 3F7ZA 3M1SA 3UG1A 3UOLA 3LFCA 3SLSA 1ERKA 3OROA 5EM6A 4JRVA 2ZJWA 3KU2A 3R83A 2C5OA 3PDTA 4KIPA 1WAKA 1ZY5A 3QTIA 4O7RA 3ORMA 4D58A 3EKNA 4K11A 1MRYA 4FIEA 2HELA 4WNKA 2FO0A 3VWAA 3E87A 5B2LA 4X2NA 3Q9XA 4MBJA 2IW8A 2IW6A 3MBLA 3FXXA 5BVFA 2QR7A 5HHWA 4EK3A 4BTKA 1ZYCA 4G2FA 1YI4A 2BMCA 5AEPA 4DBXA 2R3RA 1UKIA 3K3IA 4O7TA 3NNUA 4M15A 5HCZA 4LL0A 4PP7A 3POZA 3EJ1A 4FBXA 4H58A 5J9YA 4MBIA 2JITA 3SW7A 5HD7A 4U79A 4ACCA 2ZYBA 4NKAA 4U6RA 3QD3A 4LRMA 2PMIA 3ZO4A 4EZ7A 4CMUA 4GVAA 3F61A 4FTJA 3UDSA 4HPUE 5CENA 3IOPA 1R3CA 3GC9A 2XYNA 3QGWA 1TQPA 4WSQA 2RFEA 4V0GA 2JIUA 2GS2A 3COIA 1MQBA 4R7HA 5LVNA 5EQYA 2OJGA 3B8QA 2XIYA 2XNEA 3EQGA 3F7WA 1SVEA 5A6NA 2GNIA 4RIWA 5E8ZA 5AV2A 4OUCA 4PDOA 5K0KA 3F5UA 4M0ZA 4ASEA 2DWBA 3ODYX 1JVPP 4OTHA 1OPKA 4O4DA 3ZZWA 4DH5A 4RX5A 5DVRA 2X9FA 2I6LA 4ZP5A 5BUIA 3SRVA 5FEDA 2J6MA 2OXXA 4FVPA 3F3UA 2YIWA 2X7GA 3ACKA 3MI9A 4RQKA 2W9FB 3CY2A 2C3IB 5J9ZA 3AT2A 4L53A 2XM8A 3G9LX 4L01A 2FSLX 4AWIA 3A4OX 4GH2A 4HVSA 3QXPA 1VLRA 1NVQA 3RVGA 1VYZA 1PXJA 3L9LA 4FNWA 4ZY6A 4BCIA 2WELA 3HKOA 2YACA 2ETMA 3UOJA 2BZIB 3GFEA 4GJ2A 3V5LA 2PHKA 3FZPA 3LMGA 2Y0AA 3F69A 3OXTA 4XV1A 3UO4A 5DA3A 5L6OA 2PUIA 4OT5A 4X2JA 2FSMX 5L8LA 2PUUA 4IX3A 1J91A 5L2TA 4AXCA 3ELJA 2GNHA 3QYWA 4PTGA 2C1AA 4ZTNA 4V05A 3LFQA 1BX6A 2ITUA 3CBLA 2PY3A 1IAHA 2C6TA 3ZLXA 3NWWA 3TV4A 4O7LA 2YIQA 4CD0A 5IA2A 4IZAA 4RIYA 4L52A 5CX9A 3DCVA 4H3QA 3W0RA 2RGPA 4DEHA 3VBYA 2CPKE 2VNWA 5I5ZA 4EOMA 3AC2A 2B4SB 4DH8A 4FZDB 5IPJA 3POOA 4C3RA 2PMLX 2IVTA 3RGFA 2JBOA 2R3NA 5AM6A 4UMPA 1X8BA 5A3XA 2W4KA 3BRBA 3Q52A 3OG7A 4ITIA 2C6DA 2QVSE 5FLFA 1ZYJA 3FL5A 3TDVA 3NAYA 3WZKA 5FXRA 4M68A 4JAIA 4BRXA 4ZJIA 5EW8A 4RIWB 2B53A 3QU0A 4BVUA 5DR6A 5JK3A 5EM5A 3ANQA 1OB3A 4YPSA 5IEXA 3TL8A 4ZZOA 3DFCB 4YHTA 2E9UA 2DS1A 4WKQA 3UZRA 3C9WA 3QL8A 5BVNA 1IEPA 2OU7A 5HNGA 3OFMA 5EYCA 4GG7A 5KHXA 2VTIA 2HXLA 2HK5A 2VN9A 3MSSA 3TUCA 2PL0A 4HNIA 5CU3A 3OWKA 4QMUA 3WOWA 3CE3A 5TR6A 3C51A 4GT4A 3G6GA 4RLLA 5M55A 3R7IA 3SHEA 5A9UA 1KV1A 2JEDA 3ZC6A 3NVKI 5T3QA 3FMHA 4AN3A 4JNWA 4RFMA 2A1AB 2CGVA 1UVRA 1PXMA 3LCSA 4IADA 4QYEA 2OIDA 4RFYA 5H2UA 4XCUA 2IW9A 4HGTA 2NPQA 5B7VA 2I0VA 2P0CA 3HMMA 3TACA 4FIJA 4EOIA 2R0IA 4A9SA 2W4JA 4IMYA 3C13A 4JQEA 4WRSA 3RAIA 2W1IA 3UQGA 4AXAA 4BBFA 3ZYAA 3E8DA 5DYJA 3WF5A 3FLZA 1XH4A 4I3ZA 5IA4A 2VWIA 3CQWA 1TQIA 4RRVA 5KUPA 2IVSA 3F6XA 3I4BA 3WE8A 2YEXA 3A7HA 5H8GA 4ANNA 3V3VA 5HLNA 3LMIA 2ZB0A 1KE9A 4O1OA 4BWKA 1QMZA 2AEGA 4X3FA 1ZYSA 5H3QA 5DNRA 5DFPA 2VO3A 3QCXA 1WVXA 5IU2A 3KY2A 3V5PA 5HI2A 4EWHA 2R5TA 2YIYA 3KA0A 4FT5A 3D0EA 4YHJA 4BKJA 5CAQA 5JFSA 2YAAA 1ZOGA 2EWAA 4O4EA 4JDIA 5HNBA 3G2FA 4B4LA 3QALE 1VJYA 2BDFA 3QA8A 4FUYA 4AS0A 4XJ0A 3GVUA 4TYGA 5DHJA 3GU8A 4IC7A 3NDMA 1Q5KA 4ANSA 2O2UA 3IDBA 4YLKA 5FBNC 3OD6X 4XG7A 4M8TA 4DDGA 1J7LA 1RW8A 1CDKA 2VRXA 5BVEA 2OXYA 1DM2A 4AA5A 2QC6A 3FL4A 1K9AA 4I6LA 2R3IA 4RC3A 4UWYA 4IAFA 5A4EA 5JQ8A 3KIOC 2CMWA 4JQ7A 4HCVA 3V5JA 4D4YA 5J9LA 3BHUA 4I20A 3DKOA 2Z7QA 3VUGA 4BWPA 3P4KA 4U9AA 4I41A 2JC6A 2OJIA 5EK7A 5EM8A 2XH5A 3TZ8A 4C4JA 5JFVA 3I5NA 4JBPA 5IQEA 4BGQA 4FODA 5L2SA 3BX5A 1OKVA 3QQKA 5AUUA 2PVMA 5BMMA 3ENMA 4IB5A 1JBPE 2R3KA 3P7BA 5J95A 4DG2E 5AAGA 2XRWA 5JGAA 4AXEA 2BRGA 2E2BA 3PG3A 4DHJA 3HV4A 5AP5A 4MXCA 4FNXA 5J1VA 4LV7A 5IDNA 4ZAUA 5KZ0A 3RI1A 4GK3A 5KCVA 2R3HA 2OSCA 4KKGA 4PV0A 2VWXA 4W8DA 3OCSA 4P7EA 4WIHA 5E1EA 3T3VA 2QOIA 5FM2A 1M7NA 4LV5A 4XUFA 5TE0A 2EU9A 2Q0NA 3NPCA 2UZVA 4QMZA 1Y6BA 4YNEA 4G6LA 5DRDA 4MNFA 3OUKA 3RK5A 4FKTA 2OZOA 4FL3A 4GK4A 2W1EA 2PU8A 5AR8A 4X3FB 4XV3A 1W0XC 3DNDA 4QP7A 4LG4A 3EYGA 2RKUA 4RIXB 5CT0A 1O9UA 2VO0A 3ERKA 4CG9A 4X6QC 2QOLA 4XBUA 3D83A 3O7LD 5BMSA 5D7AA 1XJDA 2GHLA 2UZOA 4ANOA 4Y85A 4L42A 4OT6A 4FSYA 4WG5A 3HGKA 2O65A 2X7OA