4A9RA

Crystal structure of human chk2 in complex with benzimidazole carboxamide inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
303
structure length
285
Chain Sequence
SVYPKALRDEYIMSKTLEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Benzimidazole Inhibitors of the Protein Kinase Chk2: Clarification of the Binding Mode by Flexible Side Chain Docking and Protein-Ligand Crystallography
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
total genus 89
structure length 285
sequence length 303
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4a9rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4a9rA01
2B55A 1Y91A 3IW4A 2Y6OA 4O2PA 3GFEA 4WRGA 4FKTA 3V6RA 2ZB0A 5HIBA 4GH2A 1GNGA 3BQRA 3RALA 4AZWA 5AWMA 3AMAA 4P90A 5KMNA 3FKLA 3UIMA 3NW6A 5HGIA 3NUAA 4CEGA 1K3AA 2ONLC 3TM0A 3R6XA 3SG9A 5HZNA 4O2ZA 1JKLA 3L9MA 1ZY5A 2JDRA 3LMIA 4CKJA 4ZTRA 4E3CA 2GHLA 3LQ5A 1PF8A 4AXAA 4DEEA 4BZDA 2WZJA 5D10A 4GV1A 4J52A 3VBTA 2ONLA 1PXKA 5BYYA 4EHGA 2EB3A 5C1QB 4FVPA 2UZDA 3QL8A 1XH4A 4FKJA 4IFGA 4I41A 5IMXA 3CTHA 4AN9A 4OLIA 5FP5A 2QR7A 2VTQA 4YTIA 3A4PA 3V8TA 4L45A 5H8GA 4K18A 2B9HA 5A14A 3BBWA 2W1IA 1UU3A 4LUDA 4X6RA 3VBQA 1AQ1A 3PA4A 5C4KA 2XIZA 3IW7A 2UW5A 2BZHB 5EKOA 2V22A 4QYYA 5HG9A 5I9ZA 2C4GA 4PPAA 4QPAA 2IW8A 3R9DA 4EL9A 3BHVA 4BBFA 5FDPA 4QMXA 4D1ZA 4G16A 2BALA 4FSRA 3FMLA 4D2VA 3O8UA 1E1XA 1Q24A 2R3IA 5FG8A 2XK3A 4ENXA 3DKCA 2GSFA 2J4ZA 4K8AA 1G3NA 4KRCA 3TG1A 5HEZA 2HZNA 3QX4A 5C9CA 1G5SA 3QC9A 5AJQA 4YLKA 4GU9A 2OJFE 3UQGA 1WZYA 3H4JA 3C0GA 3R8UA 2PVLA 4CQGA 5ANJA 3LHJA 2B7AA 2C0OA 2VX0A 3MA6A 4YZCA 5EDPA 1P2AA 3UVPA 1UKHA 4LOQA 4LV5A 4ZY5A 4HNIA 2CLXA 1OITA 1XHAA 5D9HA 3AQVA 5E8ZA 3FXZA 3AC5A 4AW2A 3OHTA 1YXUA 3E63A 3PY1A 4DEDA 4IAYA 1KSWA 3LFDA 4PTCA 4DFNA 4DFXE 2VTPA 3DV3A 3ZO2A 1WBWA 2W1CA 3Q52A 4PX6A 4CGAA 4YGAA 4CMUA 5JK3A 3IKAA 1ND4A 4FTUA 5BYLA 1GJOA 2UZWE 3UIXA 4IX3A 2OF4A 2VWYA 3GXLA 3ZLWA 2HZ0A 2YM4A 5E8XA 4YUQA 1ZOGA 2H9VA 1MP8A 2FA2A 2ZDUA 3LJ1A 3D2KA 3LPBA 4KS8A 4O0UA 3UP2A 2VTRA 4L67A 3WF6A 4DH8A 3CGFA 5HE2A 3MESA 4NL0A 1W82A 3AT4A 2Z7SA 1GIJA 1H8FA 3SOAA 4C4GA 2BRNA 4OT5A 2B54A 1Z5MA 4BWKA 1XBBA 4FK6A 3NNVA 5HE0A 4BY9E 4KIOA 2YABA 4Q2AA 3K2LA 4ZP5A 4I20A 4FL2A 1BUHA 2CSNA 2BCJA 3FLYA 5DIAA 3LFSA 4ZEGA 5HBJA 3FPMA 2WIPA 4WNMA 2VZ6A 4NKAA 4PTEA 2H34A 3KXNA 3QU0A 2F57A 3C7QA 2IW6A 3JUHA 4FG9A 5DR2A 4ZLYA 4FNWA 4ZZMA 5M4FA 3MH2A 3L9LA 2VTTA 2I0YA 3WYXA 2HY81 3GC9A 5BX0A 5KUPA 4PP7A 4QYHA 4LOOA 4MD7E 1FMOE 3TZ7A 4XNEA 2QOCA 3OROA 3QTWA 3ZSGA 3R1QA 2HYYA 3R2YA 3W33A 3MTLA 2BFXA 2WOUA 4L7FA 4Y5HA 3LFNA 1KV1A 5CF4A 4DTAA 4CSVA 4ZJVA 4HZSA 2OJIA 4BIEA 4FK3A 2YCSA 3EB0A 3LJ2A 4J7BA 1REJA 2W99B 4LG4A 2Z7RA 3GOKA 4FSMA 5E8WA 5ETFA 4TL0A 3UNZA 2OIDA 3UOHA 5J79A 5ACBC 2VO7A 2XBAA 4Y85A 1OL6A 2IWIA 2QURA 3VO3A 3BV2A 3NYOA 4GL9A 3PPJA 4FUYA 2R3RA 4FOBA 4FIEA 3KRLA 4DH3A 2ITOA 4WG5A 3TJCA 4C58A 4IAZA 4GT4A 3LFEA 4JR7A 5JFVA 1W7HA 3GOPA 4GG7A 1ZXEA 4W9XA 4ZMEA 2CPKE 4KNBA 4BCKA 5A3XA 1XBCA 3D4QA 5DEWA 1BYGA 4IX5A 3RCDA 3V5TA 5LVNA 3CGOA 5LCKA 4L3LA 4BKZA 3ZDIA 2C0TA 2J7TA 2YDIA 3RVGA 5I9VA 2JC6A 3TV6A 4Z55A 3FZSA 3AGMA 4M3QA 2BZJA 4D0WA 3F5XA 3L8VA 3MFTA 4ZJIA 4CVAA 3E5AA 4A9TA 3OCBA 3DKFA 1UU8A 3ZEWA 3DXPA 4O0RA 2QOLA 5CNOA 2YISA 1TQPA 1WBNA 3CXWA 4IIRA 3CIKA 4FSTA 4XRLA 4EOIA 4L3PA 2GNIA 2LAVA 4F7SA 3L9NA 3VUKA 3C51A 2I7QA 4G3FA 4OW8A 4KUJA 3TNWA 3UE4A 3Q53A 4MTAA 4YBKA 4ORKA 3SRVB 3C5IA 3RHXA 5CSPA 4ZSAA 3RHKA 2XBJA 3KK9A 4FTMA 5BYZA 3BGPA 3HYHA 4NM3A 4OGRA 3TNIA 4TYEA 2PY3A 5KKRC 4JBOA 3NZ0A 5AUXA 3ZLSA 2W1HA 1NT2A 1SVEA 2GTNA 4FT9A 3HV7A 4NJDA 4XG6A 1WBTA 3U9NA 3TV4A 3OY3A 3HLLA 5HTIA 1ZAOA 2NPQA 2VNWA 1NA7A 3IW6A 3UNKA 2O2UA 2GS6A 3CBLA 4U40A 2ZM1A 5DOSA 1IA8A 2WMVA 3NNWA 3FY2A 5HX6A 5F95A 2R3HA 4YLLA 5M53A 2HY0A 5FM2A 3QTRA 4DFZE 4B8MA 2I0EA 2WHBA 4F0IA 2O5KA 2RFNA 3PXYA 2YJRA 3DXQA 1ZYDA 3K3JA 1OL2A 3OW3A 4BDAA 1JKSA 3AG9A 2PHKA 3FQEA 3MWUA 4FC0A 4R3RA 2C5VA 3LCKA 5CY3A 1WAKA 2IVSA 4LMNA 1O6KA 2XIKA 3ZC6A 5LARA 4CMTA 4ALVA 4U81A 3H3CA 1YHWA 1U5RA 2V7AA 1MRYA 3UPZA 3KXGA 4TN6A 4XG2A 4JIKA 1M2RA 1OI9A 5HNBA 1OL1A 3RINA 1QPEA 5TT7A 2VWUA 5BVKA 2REIA 3IK3A 3ZO3A 3D5VA 4EK4A 5DYJA 2VD5A 3KCKA 4I0TA 4M14A 4AT3A 5L2SA 4FKRA 3WIKA 3OG7A 5GZ9A 3HP5A 3COKA 1QPJA 2BDWA 2GS2A 3AC1A 5CWZA 5E91A 3NW5A 5AAFA 5M06A 1TKIA 4ZTMA 3LW0A 3R30A 1SNUA 1FINA 2YLEA 3P1AA 4ZS0A 4FTCA 2CKPA 3KF4A 2RFSA 4RWKA 5BNJA 5DA3A 5CEOA 4PL3A 2X0GA 3DY7A 2BTRA 3ORIA 4J97A 3TXOA 2ZOQA 4PDYA 2WO6A 4USFA 2O3PA 4YJTA 4A07A 3KCFA 3THBA 4A9UA 5LOHA 3LKMA 3C5UA 4QP4A 3RBWA 3ULZA 4O7LA 2QG5A 4I24A 4LI5A 4A7CA 2Y7JA 2XCHA 4RX7A 2IZTA 3C4WA 2UV2A 2QOBA 3DBEA 4RFYA 3WIGA 3BLRA 4C4HA 2XZSA 5FBNC 5ACKA 3FMMA 2J0LA 1J1CA 2W1EA 4ALWA 4AW5A 3GQLA 2QCSA 5BVOA 2X8DA 3DLZA 4ASDA 4XV3A 2GPHA 3PY3A 3O0GA 3DAKA 3V6SA 4DC2A 2CNQA 2I0HA 2V0DA 4RIWB 4XBRA 4RGJA 3RAKA 2WGJA 1WCCA 3VRZA 4ANOA 2HZ4A 1IEPA 4YJOA 5G1XA 3R1NA 1YVJA 3VF9A 2WMXA 3HV5A 4TWCA 5C27A 3C13A 4WBOA 4CTCA 2R3OA 4P7EA 4C35A 1PXJA 5K4JA 3FLWA 3W32A 4FV0A 2OZAA 3NNUA 4AT5A 3TNQB 3Q9ZA 1J3HA 1JOWB 2Y0AA 3QWJA 4AOJA 3G2FA 3VNTA 3CKWA 3OZ6A 3F5GA 5IQAA 1QCFA 4TKSA 4HGLA 4C2VA 4HVIA 5I3RA 1A48A 4BDJA 5KE0A 4EOOA 3EN5A 4RMZA 2PL0A 4MAOA 2ZV2A 4ENYA 4F99A 3QZIA 2VWWA 4FIJA 4AFJA 3VF8A 3KKVA 4WNPA 3QLFA 3KN6A 1OKVA 2PMLX 4UBAA 3MJ1A 3OBJA 3QF9A 4LOPA 3ORTA 4C4FA 4B8LA 2WD1A 4ZTNA 3ZFYA 1OPJA 2CJMA 3LFFA 3ANQA 4E6QA 3TDWA 4BI2A 2HXLA 4CNHA 5IA2A 2Q0NA 2P33A 5FTGA 2CKQA 4PDSA 4PL4A 4RA4A 5EFQA 3BU3A 3PJCA 3GP0A 4G2FA 2BIYA 4GRBA 3GT8A 4QRCA 4X2GA 5IEVA 4OAUC 3MFUA 2CGUA 4Q5EA 4AF3A 3L9PA 4MNFA 4E6AA 4P5QA 3UDBA 3VS1A 4LRJA 3SXFA 4EWQA 1Y8GA 2PVHA 2E2BA 4JQ8A 3FLQA 5J9ZA 4E4LA 2CN5A 5L6WL 5HQ0A 1NVQA 3OT8A 1Q61A 4K77A 4QP7A 4A4LA 3HMIA 2V55A 2W5BA 4K0YA 4ITJA 3GU5A 4TPTA 3V04A 3PWDA 4CG8A 5H8EA 3VUGA 5IA1A 4FKLA 2UZVA 3NUSA 3I6WA 3KRXA 4O0YA 5ETIA 2UW0A 4AOTA 4R7BA 3H9FA 4DEHA 5HCZA 3QAME 4NH1A 5F4NA 1B6CB 3NX8A 4YR8A 1Q99A 3VHEA 4QP3A 5EW9A 4FTJA 5AAGA 3R7UA 4KKEA 3P7BA 4O7ZA 1BL7A 1Y8YA 3EN9A 1QMZA 2CNVA 3EN4A 2C5NA 3BWJA 5KMOA 4X2JA 4XMOA 4ACGA 4XJ0A 1YWRA 3CTJA 3WBLA 3ZXTA 4FEWA 1DI9A 4NJ3A 5DI1A 4AP7A 3HL7A 3W8QA 3D14A 1K9AA 4HCVA 1OIYA 3C9WA 4NZWB 1KOAA 3DDPA 3R1SA 4XOZA 4GJ2A 3KULB 3ZRKA 1CDKA 4FV8A 3F3ZA 4QP8A 3MW1A 4RA5A 1TVOA 4FTNA 3PSCA 5KKRB 3RMFA 3ORNA 2B1PA 3T3VA 1PYXA 3P0MA 3G15A 4BC6A 4C34A 2HXQA 3U9CA 4R78A 2WOTA 5M55A 4DTKA 4W4YA 4BCOA 3CSVA 3EQPA 3OBGA 4CG9A 5EM6A 2YITA 4UN0C 2GQGA 3BCEA 2C6LA 5DNRA 4PDPA 1P4OA 3R0TA 3H0YA 4WT6A 3MBLA 4U43A 4XRJA 4EQMA 4EBWA 2J5FA 3Q9XA 4QTBA 4QYFA 3L8SA 4EK8A 2R7BA 4R77A 3GB2A 3S0OA 5DLSA 2XK7A 4R3CA 3FI3A 1I09A 1XQZA 4RIYB 4D4YA 4AGUA 3NIZA 4DLJA 3OEFX 4XP3A 5CALA 2R3PA 4D4RA 3GUBA 5DRDA 2UW9A 2G2FA 1YHSA 2R7IA 2YCFA 3ODZX 3PJ1A 4ACDA 4USEA 5CQWA 3UC4A 2A1AB 4CRSA 3LXKA 4HPUE 3DZOA 4JBVA 2ZV7A 3DK6A 2QKRA 3HRCA 4JR3A 3RNIA 3ZUVA 3CY3A 4JRVA 4RFMA 3OTUA 3IW8A 5CZIA 5IA5A 4PL5A 1OBDA 4IVDA 3ZOSA 3OT3A 4WUNA 5AR5A 3V8SA 2WXVA 5TO8A 3TUDA 2JITA 4Y95A 5EM5A 3VS3A 3W55A 1JAMA 3RAWA 5EHOA 4BCGA 3LFCA 3F6XA 4AAAA 4EOPA 2FSOX 4EJ7A 4YZMA 1H1RA 5BUIA 3R8VA 4FZ6A 4XV1A 4E4MA 2YAKA 1J1BA 4FI1A 2BPMA 5TR6A 1PKDA 2FUMA 4O1OA 4QYGA 3MH3A 4RC3A 4YP8A 4H3PA 2JFMA 4MF1A 4FIIA 2R3MA 4TYHA 4LV8A 3PZHA 2Y4PA 2PWLA 3OUNB 3HUBA 5JGBA 2JKKA 1W84A 3NCGA 2ZJWA 4RJ4A 4ZLOA 2CGWA 5HIDA 1Q5KA 2Z60A 3SLSA 2IVVA 1CKPA 2YM3A 4EH6A 4KINA 5C8MA 1J91A 3VVHA 4LL0A 5C26A 5E1SA 3EQGA 2UZEA 4L68A 4YJUA 3UZPA 4EI4A 4EH9A 3MFRA 1CMKE 2R3NA 4MQ1A 5DHJA 4QTEA 2WAJA 4FV3A 4KD1A 4WRSA 3I81A 3T8OA 3COHA 4C36A 1PMEA 1SVGA 2W17A 4ASZA 3TTJA 1OGUA 3PA3A 2PTKA 4FKPA 4RX8A 4HGEA 3HNGA 2OJJA 4DT9A 4ZSLA 4KIKB 1RJBA 3RAHA 4F08A 1QPCA 4UWCA 2B9FA 1XWSA 4X3FA 4ALUA 5DH3A 3NUXA 4F1OA 4UMQA 2Z7LA 3OCTA 3VUIA 3QXPA 4DHFA 3WZUA 2CMWA 5HU3A 4UEUA 2ZAZA 4IFCA 4KIKA 3S1HA 1URWA 3GCVA 4X3FC 2R5TA 2IVUA 2VO0A 3A60A 4DGMA 2PE2A 4NFNA 2PU8A 4GG5A 4U45A 2WIHA 2X4FA 1M7QA 2R3JA 3T3UA 1JSUA 3H30A 4GMYA 3QKLA 3R9NA 3VS7A 4AN2A 5JT2A 2IVTA 2WQOA 2XNNA 3O23A 3ZSIA 3ZHPC 5CANA 3DTCA 5CEIA 5J7BA 3M42A 3RK9A 3QQFA 4CTBA 2F7ZE 2YEXA 3PRFA 2YZLA 3BX5A 1UV5A 5FUTA 3FMNA 4TYIA 3ORKA 5AP3A 3PXZA 5CYIA 4GIIA 4F9AA 2YWVA 5DPVA 2YWPA 1PXPA 4Q9ZA 3R8ZA 5I9UA 2E9OA 3ORMA 1LR4A 2B53A 4ITIA 1PKGA 3DPKA 4GJ3A 3D5UA 3HRFA 5AP4A 3G0FA 1TQIA 1OKZA 4PNIA 1A9UA 4FKVA 4EEVA 4GK3A 5CT7A 2HIWA 2VWIA 4FSWA 4U41A 1ZY4A 2W5AA 3FZTA 4O82A 3FLSA 4MKCA 2VX1A 3ENHA 1ATPE 4ZSGA 3SXSA 2AUHA 4IJ9A 3U8WA 4CT1A 3EQIA 1OBGA 1BX6A 1T46A 3DQWA 2ZVAA 1JPAA 4C02A 2XNMA 1B39A 4YURA 1GZNA 3PG3A 5EDRA 5D41A 4ZAUA 1TQMA 3MYGA 3LAUA 3NRMA 1MQBA 3D7TB 3GBZA 4N0SA 4F64A 4DTBA 5GIPE 1Z57A 2UW7A 3BYOA 3MI9A 3R28A 4L42A 4ZTHA 4WSYA 1QPDA 4AT4A 3LLTA 2JDOA 4I22A 1PYEA 1H01A 4E4NA 5HIEA 5BVEA 3QTXA 5F20A 4GYIA 5DMZA 1SNXA 2F2CB 5GZ8A 5LVOA 4DGNA 4IM3A 5KX8A 4FTLA 4L8MA 3SV0A 3G90X 5A54A 2PPQA 3NYVA 4PY1A 5F9EA 3KA0A 4EYJA 3F2AA 4TT7A 4RIOA 3MVMA 3FLNC 2UZOA 3I60A 3RPSA 4BIBA 5HTCA 5L8LA 5IQFA 2CKOA 1Q62A 2P2IA 4ASXA 3RZBA 3RPOA 4S30A 2AC3A 4BCHA 4DEBA 2R0UA 3Q3BA 3DK7A 3ULIA 4IAFA 3ORXA 4OTFA 2X1NA 3BEAA 3VBWA 2ZMDA 2ITTA 2WTCA 4OR5A 1SYKA 2NP8A 3OP5A 1F3MC 2PE1A 5A6OA 4XP0A 4XLVA 4IANA 1R78A 3AOXA 3NLBA 5IUIA 3ZUTA 4LYNA 3O71A 3KXMA 3IGOA 3FPQA 3LCTA 3GENA 4L6QA 4PDOA 5CAUA 3EWHA 4UMTA 3EQRA 4DA5A 3OCSA 3NUNA 3EFJA 2QQ7A 4WHZA 3ZLYA 5JZJA 3JVSA 2PZ5A 2WMWA 3KEXA 3FC2A 4M15A 3IPHA 5AM6A 2IO6A 3E87A 1SZMA 2XYUA 5EOBA 3HDNA 4G9CA 3E88A 3JYAA 3UOJA 4XBUA 3QC4A 3T9IA 1S9IA 2J0KA 2Q83A 4QQCA 5CF5A 1YKRA 2JGZA 3KRRA 4L00A 4O84A 5BMMA 4L44A 4NKSA 3ALNA 4E5WA 3P7AA 2O64A 3RCJA 3V5WA 2C30A 1FGIA 1SVHA 4EOSA 4E6CA 3PY0A 1UNHA 2H96A 3IDCA 4D1XA 4EKLA 3BV3A 3LVPA 4Y46A 4Z9LA 4AZFA 4BCNA 4IWQA 3GEQA 3MA3A 3NAYA 4L7SA 4I0SA 1YDTE 3HRBA 2NRYA 4WA9A 3TN8A 3RPYA 2ERZE 4JT3A 3BU5A 2BRMA 4KWPA 3KREA 4O81A 2R0IA 4AW1A 3CS9A 1U4DA 4RLLA 4RJ7A 4RVKA 3PPZA 2FO0A 5FEDA 4EC9A 4F7JA 5IQGA 2F49A 2OIQA 4I0RA 3AGLA 4H1JA 3R63A 3WARA 4BBEA 3D15A 2SRCA 4WNOA 4BICA 4R5SA 5E8VA 2DQ7X 4S2ZA 2CLQA 1ZMWA 3JS2A 4FL3A 2IW9A 2PUPA 4XCUA 4S32A 4TRLA 5CSVA 3NVKI 3EMGA 1BKXA 3I5ZA 1JKTA 2G1TA 2QI8A 2UZBA 3K54A 4MXZA 1M2PA 2C3LA 1Q8WA 4CFVA 1ZYCA 2GFCA 4BRXA 2BHEA 1Q8UA 5AIRA 4NIFB 5HKMA 2NRUA 4OTIA 4P2KA 3CPBA 5HBHA 3V8WA 4PNKA 4XP2A 2J6MA 4PUZA 2JD5A 3Q60A 4JDIA 3RWQA 2IZSA 3BGZA 3A7HA 3FI4A 1AD5A 2BFYA 1OZ1A 4E26A 3TNPC 1ZOHA 2BKKA 3P4KA 4GKIA 5CNNA 4XG3A 5C4LA 3OW4A 5AMNA 5IA3A 5HVJA 3MJ2A 4U8ZA 3QHWA 3AD5A 1WBVA 1O6LA 3VN9A 4IEBA 4F63A 5EKNA 2A0CX 2KULA 4BCPA 2PULA 4QD6A 4I3ZA 2BMCA 3R9HA 3PZEA 2A4LA 4UALA 1HCLA 4YC6A 5KZIA 3QALE 5FBOA 4ASEA 1ZMUA 2QVSE 5IDPA 3QQJA 3LQ3A 1H0VA 3TZMA 2BDJA 1PXIA 3AC8A 3FKNA 4AE9A 1W0XC 4Z16A 4W4WA 3BYVA 4FKQA 4EH8A 1WBSA 4F09A 4S31A 4AA5A 3LOKA 3EQCA 3MY1A 2Y6MA 5AV0A 5AUZA 4WNKA 4NM0A 5T3QA 3DK3A 3MY5A 2ZV9A 4PMTA 4RQVA 4OTDA 3OXIA 4O96A 2W96B 3F88A 4BDIA 4RWJA 2KTYA 4D9TA 4F0GA 4HZRA 3I5NA 2OO8X 4G5PA 2WTVA 3IS5A 3BPRA 3EZRA 3M11A 2PVYA 3NIEA 2OI4X 2OFVA 3JPVA 5EOLA 1ZYLA 3O7LD 3OMVA 4BTKA 4BI0A 3OF0A 3VAPA 5IG1A 4MWIA 4ZS4A 3O2MA 5JGDA 1PJKA 4AX8A 2BHHA 3A7JA 3C1XA 3DNDA 3OD6X 3KL8A 4D4SA 4TNDA 2OW3A 3HMMA 4I21A 4FZFB 3PVWA 2HZIA 4BFMA 3K5VA 3DBCA 4FSQA 3ZU7A 3DFAA 1KWPA 2IZRA 4JS8A 3EIDA 4WUAA 5EM7A 3B8QA 3HMOA 3KVXA 2GCDA 3FJQE 4X0MA 4E6DA 4EZ3A 3SGCA 3V3VA 4F0FA 3IDPA 4C3RA 4FTAA 2WTJA 3VW8A 4FKIA 3DKOA 3R8PA 4DGOA 3R7YA 4MNEB 5A4LA 3KGAA 4FVRA 3TI1A 1SMHA 4F9CA 1U46A 2VTLA 4IAIA 3Q4TA 2UZLA 1XBAA 4W4VA 4BDDA 4TWOA 3ACKA 3QQHA 1HOWA 4O91A 4U80A 4CKRA 2PSQA 4N4SA 2W0JA 4LGDA 4EK3A 3MS9A 4QPMA 4OBPA 4E1ZA 2IG7A 2QOKA 3PWYA 4BZOA 3CR0A 4EWHA 1V0BA 4ITHA 3CQUA 2XJ2A 1GZKA 5DT0A 1Q4LA 3BU6A 5FEQA 3RZFA 4O7YA 4DGGA 2BUJA 1UWJA 3OTVA 4JG7A 1Q3DA 3PP0A 4UB7A 1M2QA 4U44A 4YJQA 3RPRA 3COMA 4FG8A 4M0YA 5HG8A 4R5YA 2HW6A 3NUUA 3KRWA 4X3JA 3I4BA 2B9JA 4FKGA 4M0ZA 3PSBA 5EG3A 5T6KA 5KNJA 4BCMA 1PXNA 2JAVA 3EQHA 3VUDA 3UBDA 3R2BA 3UO5A 3PTGA 4ZSJA 1T45A 3LXNA 3MIAA 4OTPA 5IMEA 4CFUA 4ACMA 4EZ7A 4FEUA 1ZOEA 2XCKA 3IW5A 4FNXA 4IZ7A 5JRSA 1NVSA 3QZHA 4C4IA 1OPKA 2PMNX 4FODA 4JVGA 5IUGA 3FV8A 1FVRA 2VTOA 1WMKA 5TF9A 5L6PA 2R3QA 2DWBA 1YI3A 5D7VA 2UUEA 4XS2A 5L6OA 1YI6A 4IZ5A 5LCJA 4J98A 4U42A 2BTSA 3O17A 3QA0A 5GNKA 1F5QA 3RJCA 2VWZA 3NPCA 4F9WA 4IVAA 4JXFA 4NWMA 5CSHA 4BCJA 1H4LA 4MHAA 3CQWA 3POOA 3R9RA 4ZOGA 4D0XA 4NT4A 3V5QA 4DG2E 3NUPA 4OTRA 5IH4A 1L3RE 3PRIA 3IECA 4I4FA 2WQEA 1JKKA 2ZB1A 4GK4A 4BDBA 3AMBA 2R3FA 3ZCLA 5IA4A 1ZZ2A 3TKUA 5LXMA 4QP6A 3WF7A 3C4FA 4FUXA 2ZV8A 4ZXTA 4FV6A 4IACA 3VWAA 4BIDA 3IGGA 3OUKA 5EDQA 3PA5A 1LPUA 5ANKA 2HAKA 4I23A 4IB3A 3U87A 3K3IA 3WF8A 2RGPA 4I92A 2FSTX 3DB6A 2OK1A 4H39A 5AX9A 4WOVA 4APCA 2YCQA 3Q96A 3OEZA 4H05A 2AC5A 1QL6A 1XO2B 3ACJA 3MIYA 3IO7A 3QHRA 4S34A 4YZBA 4MXYA 4RG0A 4V05A 5K4IA 4OTGA 3VS5A 3IG7A 2Q0BA 4RBLA 4J96A 3BLHA 4F6SA 4R1VA 3SDJA 2YAAA 2CKEA 2VO3A 2VUWA 4D2TA 2BILB 4F1TA 2VAGA 3DGKA 2WEVA 4YZNA 4QMSA 2WFYA 5JFSA 3QUEA 2F4JA 5CU2A 1V0PA 2VTIA 4DFYA 4W8EA 4JL9A 1M52A 1PHKA 1YWVA 4CV8A 1M7NA 3ID6C 1OVEA 3ZLXA 1VJYA 1VEBA 2A19B 4DH1A 1CTPE 1UKIA 1YDSE 4PP9A 2H8HA 1Q41A 2QO9A 5E92A 2JKMA 4BN1A 1WBPA 4W8DA 2ITVA 2BR1A 2QODA 1PMNA 2F7EE 2PE0A 4NSTA 3ZFXA 5M4CA 5B0XA 1OL7A 2PVRA 4UXLA 5E8YA 3HV6A 4U5JA 5JFXA 2OG8A 2JIIA 4A9YA 3BHUA 1PXLA 4DCAA 4JIAA 4E4XA 3C0IA 5L4QA 3NMUF 4BHNA 3HMPA 5I0BA 4RVTA 5ANIA 1ZMVA 2OICA 3N4VA 1DAYA 4J8MA 5E8TA 5CENA 2EU9A 4KBCA 4MWHA 2HW7A 3N9XA 3R1YA 3WF5A 2VTMA 1PMUA 4XYFA 3MVHA 5D11A 3WE4A 2J0IA 2GNGA 1JVPP 2RFEA 4IC7A 4O1PA 1PW2A 1OIUA 2EXCX 4I5PA 4RC4A 4K6ZA 5HVYA 1RW8A 4JOAA 2FYSA 1DAWA 5L2IA 1UWHA 1H00A 4AACA 4EH5A 2OXDA 3W18A 5CAOA 5AR4A 4ZY4A 5GJGA 4UZHA 4YMJA 3U6HA 3BHTA 2XYNA 4EQCA 4DEAA 4IB5A 4FT5A 3E7VA 1FOTA 2Z7QA 4PMMA 4G6NA 4MX9A 5KMLA 2ZYBA 2X9FA 5AADA 4UY9A 2XJ1A 3VS0A 4DGLC 3I7BA 3CC6A 2WTKC 2ETRA 2OH4A 4JRNA 4BDFA 4CKIA 2XK4A 1YOMA 3HECA 4CLJA 3LMGA 2OBJA 1H08A 1Y6AA 3EH9A 4FX3A 4BWPA 5M07A 5A4QA 3D5XA 4FKSA 4AA4A 3QRUA 1XR1A 5DR9A 5KBRA 4WSQA 3CD8A 4M7IA 3LLAA 3F82A 4EK6A 2YIXA 2R3LA 3CTQA 4LFIA 4O7SA 3ZM9A 2HELA 3BYSA 2PVNA 2W1ZA 3II5A 3F2RA 1ZYJA 2VX3A 4BKJA 5T68A 2OXYA 3TDVA 4FKWA 1UU7A 3FC1X 3JVRA 4L01A 1H1SA 3ZMMA 3SKCA 3OWJA 3MPMA 5EQYA 1VR2A 3OS3A 5HNIX 3UJGA 3ZYAA 2VO6A 4E73A 4MBIA 3ANRA 4IX4A 1O6YA 4TNBA 4JG6A 3UYTA 3E62A 3EN6A 4M12A 1Y57A 2WMTA 5L3AA 4IADA 4BL1A 2WQBA 2V62A 5A4EA 2C6KA 4O22A 3QRTA 3F9NA 2P55A 4Q5HA 2XKCA 2XNEA 1UNLA 5AP2A 5HLPA 4E7WA 2E9UA 3U6IA 3SG8A 2FSMX 5K5NA 3UQCA 3K5UA 5KHWA 2OJGA 3FE3A 2EWAA 4E5BA 5KHXA 1MQ4A 3ZZWA 4IJPA 4IDTA 2WMAA 3U51A 5IQCA 3QD4A 2HOGA 5GZAA 2W9FB 4FKUA 4LRMA 3QQLA 4F9BA 4BI1A 3HV3A 5HE3A 4NK9A 2OXXA 4RWIA 3SW7A 2C0IA 4Y83A 3KU2A 1VYWA 2I0VA 2YFXA 4IZAA 4MBLA 3R83A 3ROYA 2RKUA 4AQCA 4HW7A 5EYCA 4AZTA 2W05A 2WKMA 3HX4A 4O21A 4XH6A 3REPA 3NNXA 3WZDA 5AUVA 1MRVA 3BI6A 1KE7A 2FB8A 2QHNA 2B4SB 2R2PA 2BIKB 5D12A 3R7IA 3VQHA 1WVYA 2XNBA 1OECA 4GUBA 4QNAA 4EUUA 3TUCA 4FTRA 5HICA 4HYSA 5AR2A 2X2LA 5FLFA 4J1RA 5JQ8A 2YDJA 1NXKA 3UZTA 3O96A 4IH8A 1PXOA 1OPLA 4GCJA 4Y8DA 1W83A 3PE2A 3PXKA 4ANLA 4B6LA 3E64A 1LP4A 4DFBA 2WPAA 2CDZA 2Z2WA 2X6DA 4M69B 4O0VA 2C5YA 2XH5A 4IC8A 4DFUA 2WTWA 2DUVA 2YA9A 4V01A 2A2AA 2O65A 4BHZA 3HUCA 4YZ9A 4L9IA 2EVAA 4BKYA 2X9EA 2P4IA 4NW6A 5HBEA 5TKDA 2JDTA 4EC8A 3KULA 1J7UA 3TT0A 4O7TA 5GINE 2HWOA 1LEWA 4OAVB 2JEDA 4O38A 2X2KA 4HYIA 4LGGA 4IAAA 5LVPA 4GKHA 2WNTA 4NEUA 4U9AA 4GU6A 4PTGA 1ZYSA 5B2LA 2C3IB 3SHEA 3I1AA 2WQNA 5HO6A 4TTHB 5KCVA 4K9YA 4I5HA 2XM9A 5KBQA 4QQ5A 2HK5A 1ZZLA 4OTHA 5IA0A 5AM7A 1ZWSA 3TUBA 4YC3A 1STCE 3VUTA 1P4FA 5A9UA 4U97A 3E7OA 5CU4A 2G2IA 2IPXA 2XIYA 2C6OA 4DN5A 5BUEA 5FTQA 4IZYA 1S9JA 3GCSA 3QTSA 4XG4A 3HMNA 3GU4A 1ERKA 3C4XA 4UV0A 5CI6A 1R0EA 3D9VA 2JKQA 2QLQA 3PXQA 3TWJA 4UYAA 5BVDA 4ANQA 2WTKB 3F66A 3ODYX 3VUMA 1UU9A 3WE8A 3O7LB 5I5ZA 4TWNA 3B2WA 4XG7A 3W16A 5LWNA 4DBXA 4M13A 4TYJA 5CVFA 2GNJA 4HVGA 3Q4UA 3A61A 4II5A 2B52A 3POZA 5IQEA 4FV9A 3DS6A 5EQPA 5HNGA 3ZBXA 4IB1A 3ATSA 3ZTXA 4DINA 4FOCA 2VTSA 3GCPA 3QLGA 4HJOA 4UMPA 3ZO4A 4D2SA 2ITYA 2HENA 5CVGA 3SQQA 5B7VA 4DEIA 1YHVA 4KA3A 2OZOA 4M8TA 3U54A 3HP2A 4RFZA 1R0PA 2G15A 2C69A 4OT6A 3QKKA 3S00A 1Q3WA 3HVCA 5DT3A 5EW8A 3HAMA 3W2PA 4O6EA 4CYJA 4MNEA 4DH7A 2HWPA 4FE2A 2CGVA 3KY2A 3C4ZA 3PUPA 2WMRA 2IJMA 2YIRA 3KRJA 4XUFA 5I3OA 3TTIA 5CXZA 2ITXA 3ROCA 3A7GA 5IEXA 2WELA 4YPSA 2JBOA 4KABA 1PMVA 4JDJA 2YM7A 4YTHA 4JI9A 4BDCA 4FA2A 2J50A 3QD2B 5A6NA 4HVHA 3MFSA 4B4LA 5HE1A 4EUTA 1GIHA 4AGWA 3GCQA 2JDVA 4Y72A 3WF9A 3FQSA 4FKOA 3AT2A 5CI7A 4GUEA 1KE8A 3DT1A 2OZAB 4FTTA 3ZM4A 4QQJA 5GIOE 4USDA 5J8IA 4O6LA 2BRBA 3P86A 3V5LA 5HOAA 5FXRA 2J0MB 3QA8A 5AR3A 4BWXA 5JKGA 4R7IA 3BYUA 3GQIA 2R64A 2YHVA 3DJ7A 4C61A 5AR7A 4N57A 4FEVA 3GVUA 1H26A 1X8BA 4GEOA 4E20A 4AZVA 2C6TA 3MB6A 3RM7A 4MK0A 5H3QA 5IQDA 5ANGA 4C0TA 3KXZA 4ZJJA 1LEZA 5I4NA 2ETMA 2X8IA 3DJ6A 5CSWA 2UW6A 3P5KA 3OOGA 3A2CA 3ZONA 4MD9E 3CEKA 4YJRA 5G6VA 1REKA 5BVWA 4IQ6A 2RSVA 4CRLA 3V01A 4QMWA 3VULA 4O7NA 2H6DA 2PVJA 4K1BA 1XH8A 5IQHA 2J51A 3LQ8A 4BVUA 4QMNA 4XOYA 3FZPA 1U54B 4ACCA 1O9UA 1XJDA 3Q6WA 3UTOA 3WYYA 1ZLTA 2AYPA 4FTQA 2QD9A 3SX9A 3KMUA 5AUUA 4MD8E 2XEZA 2NO3A 3QFVA 3QCQA 2EUFB 5DR6A 4LMUA 1NW1A 1WVXA 4BDKA 1BL6A 2GQRA 3N4TA 4ACHA 4KB8A 5JFWA 2RG5A 4A4OA 2Y4IB 5LVLA 4TWPA 4UMUA 4R8QA 3TNHA 1H27A 1Y6BA 5CT0A 3DB8A 4Y73A 4D4VA 4HPTE 3GC0A 3GU6A 5LQFA 4PF4A 3NDMA 1H1WA 3HZTA 3AC2A 4C7TA 5DWRA 4ID7A 3SAYA 4QMPA 3BHHA 1G8AA 4C4EA 3S95A 4ERWA 3EQFA 4X2FA 4YJSA 5K3YA 4B7TA 1OUKA 4ANSA 4BCFA 4CFMA 1V1KA 1YQJA 3DNEA 3BIZA 3I7CA 4G3DA 3UPXA 3E92A 2OJ9A 3QYZA 4EJNA 2CN8A 1BMKA 3N4UA 1H07A 3B8RA 4J8NA 3SC1A 3D5WA 1LUFA 5ETCA 5GHVA 2UZNA 4BGGA 2ZM4A 4IBMA 3TKIA 2X39A 2QHMA 4M68A 5A46A 1CKJA 3VC4A 5GJFA 3QXOA 4AW0A 3QQKA 4F7NA 1AGWA 5DBXA 5H9BA 2GHMA 2FGIA 2VGOA 2X7GA 2W4OA 3CKXA 3MH0A 3OCGA 4FZ7A 4RX5A 3QZFA 3FMKA 2XA4A 3GC7A 4FYOA 5BQ0A 4QP1A 4U7ZA 3SD0A 4GT5A 4TY1A 2X81A 2OIBA 4J99A 2ITQA 3LJ0A 5HG7A 3QRIA 4CFFA 5E8UA 4QQTA 3CY2A 5C8KA 2YCRA 4D58A 5M4IA 3EHAA 2UW4A 2VGPA 1FQ1B 1BLXA 2C3JA 3P9JA 5EI6A 4YSJA 4FT7A 2YM5A 3FZOA 4FBXA 3COIA 4BBMA 4EHVA 3RK5A 2W1DA 5FDXA 4C3FA 4QMTA 5JSMA 3UQFA 3HA6A 4CLIA 2B0QA 2QO2A 5CQUA 1JLUE 2I1MA 4G6LA 3BQCA 2GDOA 3E93A 3FY0A 4U0IA 4DH5A 3F3UA 4FV5A 1W8CA 5DN3A 4CFXA 4GS6A 3NUYA 4RPVA 3HKOA 2YM6A 3NSZA 2ZDTA 2OKRA 4W9WA 3MH1A 3M1SA 3CE3A 5IISA 3UOLA 2XUUA 4CZTA 4D2PA 3TEIA 2QU6A 4F70A 3D0EA 1IA9A 3A4OX 1KOBA 1MUOA 4GK2A 2XK6A 5HORA 3RM6A 1OL5A 4CD0A 3A8WA 3SRVA 1KV2A 3VQUA 2WMUA 4ARKA 3W2OA 1M17A 3NCZA 4CFNA 4G3GA 2X7OA 3LXLA 4EOLA 5BVNA 4QMOA 2CCIA 4AA0A 2NNWB 3LCSA 3O8TA 4J95A 4A06A 2OWBA 4E8AA 5M09A 5DRBA 5CEMA 4XHKB 2UZTA 2QG7A 5AV1A 3PVBA 2CCHA 2CHLA 2J0JA 3PLSA 4X2NA 2R3KA 2YM8A 4QP9A 3SW4A 4D2RA 1KE5A 4FT3A 3SXRA 4IM0A 3WILA 5M44A 5IEYA 5LVMA 5D7AA 2OLCA 2XVDA 5KMKA 3FMEA 3F7ZA 4QT1A 3JXWA 4BR3A 3EN7A 4QYEA 5J9LA 3E3BX 4KIQA 4L53A 3VBYA 4M66A 1DS5A 2QOHA 3RTPA 3EL7A 3W2QA 3ZFMA 4FF8A 4CXAA 3GI3A 1YOJA 4X7QA 3R7GA 3ZSHA 3FUPA 4JX3A 5CVHA 4AE6A 3E3PA 4F1MA 3D7TA 2YACA 1DI8A 2RL5A 5F1ZA 4U79A 3EKNA 5ITAA 2GU8A 4GVJA 5FP6A 2BAQA 4EOQA 4M67A 4KKGA 4QOXA 3FAAA 3EYHA 5IH6A 1Q97A 2PVFA 3UMWA 4RJ6A 4BTFA 4XV9A 3Q4CA 3Q32A 5J1WA 5I9WA 3IONA 4RJ3A 5CEQA 3UOKA 3PJ2A 3ZBFA 3BZ3A 3R8LA 5CAPA 5IH5A 3W1FA 4ZSEA 1GOLA 4G31A 4E93A 2FVDA 2Y8OA 2YZAA 3QZGA 1H28A 4V0GA 4EH2A 5KO1A 1OB3A 4FMQA 4LL5A 5HG5A 2OFUA 4S33A 5AUWA 3DLSA 3TIZA 2XP2A 5H8BA 4AU8A 5BPYA 3ITZA 2VV9A 5JQ5A 4AWIA 4MBJA 5K0XA 5DVRA 2PVKA 4RX9A 1XH5A 4MXCA 2C1AA 2VWXA 3O51A 3ORLA 2C6DA 4EQUA 3NYXA 3KK8A 5M57A 4FEXA 4B9DA 4MQ2A 5L8KA 3GU8A 2BRGA 2GFSA 2X8EA 3DTWA 5EHYA 3BRBA 3GCUA 3DBFA 3DBQA 3LFQA 4N70A 3FYJX 4QMVA 4UZDA 4UX9A 4ZLZA 4FTIA 3CJGA 4YO4A 3DAEA 5FWKK 3A7FA 4K11A 5HO7A 2WU7A 3WOWA 5K0KA 3KMMA 4JNWA 5CASA 2GNFA 4KS7A 1U59A 2EB2A 2X4ZA 3Q5IA 4ZTSA 4ERKA 3F69A 4HCTA 2CGXA 3UZRA 1IRKA 5FXQA 5DT4A 4O83A 4ZZOA 3ZXZA 2XM8A 2XJ0A 2FH9A 4M84A 1YXXA 4D9UA 1IASA 4D5KA 3EKKA 2XS0A 2X2MA 3FL4A 1YXSA 3LIJA 2EXMA 3RWPA 4O0WA 3MGYA 5HLNA 1Q8YA 2Z02A 1H0WA 2ITWA 5AV2A 5DEYA 1FVVA 1VZOA 5AFVA 4GFOA 3V5JA 2UW8A 4JBQA 3ENMA 5FD2A 5M08A 4AGCA 2VTHA 2UW3A 3P7CA 4YBJA 4LGHA 1IAHA 4R6VA 5IUHA 5HCXA 4UMRA 4JG8A 3VIDA 3U4WA 4D2WA 3GGFA 3VBVA 1Q8ZA 4KBAA 2O0UA 5E1EA 4CFWA 5D1JA 3QQGA 4UYNA 3A8XA 5EK7A 5ICPA 4EH4A 5K9IA 4XG8A 4V04A 2BZIB 1RDQE 4L46A 2I6LA 4FIHA 4NTTA 1FVTA 4G3EA 2C5XA 2ETKA 1PXMA 3FWQA 5CF8A 4I6FA 4KKHA 5CXHA 2LGCA 3G51A 4I6BA 4TYHB 3ZC5A 4BDHA 4RT7A 4W4XA 4EZ5A 1J7IA 3R04A 5AP6A 4ONAA 4XV2A 1H24A 4YHTA 4YTCA 5I9YA 3P08A 2IZUA 4O0TA 1GIIA 3ETAA 3NYNA 4JDHA 3UIUA 3EFLA 2QOIA 3MVLA 5EYDA 5EI2A 1OM1A 3AC3A 3G9LX 4PWNA 3NVMB 4ANBA 2PYWA 3OWPA 3QRKA 1RQQA 2X6EA 5EW3A 2PZIA 3I0QA 3HGKA 4UWYA 4X6QC 4C4JA 3LXPA 3QGWA 3NS9A 1GZ8A 1NY3A 3HV4A 3UO6A 1FPUA 3AT3A 3DFCB 3CPCA 4YO6A 2QKWB 3NW7A 3D2IA 3CCNA 4IE9A 4PPCA 4F9YA 3GNIB 5AA9A 3IDBA 5CU6A 5J9YA 2QLUA 2UVZA 2C68A 1CSNA 5IDNA 1YWNA 3QTIA 4QP2A 2Y4IC 1ZRZA 4IXPA 4FTKA 2BAJA 5B2MA 4FT0A 4WG4A 1U5QA 4FNZA 4YC8A 3HAVA 2E9NA 4FNYA 4DG3E 2JIVA 3OXTA 1W98A 2PZYA 1RE8A 3ZDUA 2JBPA 3LFAA 4H3BA 5J5SA 2FSLX 3TL8A 5CEKA 4RIXB 2C6MA 5LMAA 4AN3A 2PUUA 5IU2A 5HHWA 2GQSA 4BCIA 3PIYA 3WZKA 3CD3A 4O27B 4J53A 4YSMA 4QMQA 3ET7A 4EOJA 3G6HA 3VUHA 2C1BA 1VYZA 4Y5QA 4FIFA 1YDRE 4U3ZA 4X2KA 4LUEA 4FV1A 3IOPA 5L2TA 4NYEA 5AV3A 2VRXA 4RIXA 1J7LA 4QTDA 1BI8A 1FGKA 4H3QA 3RNYA 3Q9WA 4I6HA 3QD0A 4APPA 2V7OA 3BKBA 3DU8A 2ZMCA 5J87A 4MXXA 3S4QA 3QYWA 5M4UA 3ERKA 1FMKA 3DOGA 4QTCA 3LZBA 1OUYA 5BUJA 1JSVA 2QNJA 3MVJA 4EOKA 3PSDA 4G9RA 4RJ8A 2YIQA 4A9RA 4DG0E 4BZNA 4NTSA 4PPBA 4OTWA 5EHLA 5B2KA 3G0EA 4FV2A 4D28A 4EOMA 3QKMA 4QMMA 5ETAA 4G34A 3A62A 3S2PA 3VJOA 3PDTA 1K2PA 3BE9A 1YOLA 4YTFA 5ANEA 4I5CA 3UG2A 4F6WA 4B0GA 4EBVA 1E1VA 3L8PA 5AP5A 4DT8A 2YN8A 3UODA 4YHJA 3L8XA 3F5UA 3P79A 5DG5A 2VU3A 4C59A 1CM8A 3PXFA 2PZRA 2I40A 4JLCA 3PIXA 3UG1A 4BCQA 3DCVA 3AD4A 5L2QA 1YXTA 1Z9XA 5AP1A 2VNYA 3UIBA 4UWBA 3SA0A 4HNFA 1WFCA 5H2UA 4XLIA 4EK5A 2W7XA 5AIKA 5CX9A 3G5DA 3JY0A 4C8BA 5ANDA 4I93A 2QU5A 3TIYA 4YLJA 4IHPA 4FSUA 3EFKA 4O86A 2XKEA 2X7FA 3PIZA 3TZ8A 4AG8A 2GHGA 4R1YA 3G33A 4JBPA 2W9ZB 4FYNA 2GMXA 4HOKA 3S3IA 4G3CA 2IN6A 2ITZA 1XH9A 4C33A 4DYMA 3MY0A 3VHKA 1H1PA 3WI6A 3Q2JA 3ZS5A 1GZOA 3LM5A 4RQKA 2PMIA 4MCVA 3I6UA 3FSFA 4QTAA 5GJDA 2ITNA 4G6OA 3RK7A 5IKWA 2PK9A 5FGKA 2BRHA 5IF1A 4I1ZA 4PMPA 3EJ1A 3Q04A 3E8DA 3FLZA 3P23A 2W5HA 5J1VA 4RJ5A 3AD6A 3FZ1A 2J90A 3PG1A 5IPJA 3DZQA 3HEGA 4YPDA 1A06A 4N6YA 5C8NA 3QWKA 2XKDA 2VWVA 4CQEA 2XNPA 4ZZNA 3GU7A 4BGHA 3CLYA 3EQBA 4R3PA 5CAVA 2O8YA 3Q5ZA 3MN3A 2OF2A 4MXOA 1OIRA 3F3WA 3FMDA 3HA8A 3KC3A 4RLKA 3TACA 3VS6A 5HLWA 4EORA 3ZUUA 3ZH8A 5JN2A 5L2WA 4WD5A 1U54A 4FSZA 1PY5A 3QD3A 4FSNA 2XB7A 4J71A 2G2HA 3OWLA 4HGSA 1UA2A 3QUDA 3FBVA 5EYMA 2XRUA 4OTQA 5E8SA 3EZVA 4F4PA 3CQEA 4ANMA 1MRUA 2WEIA 4C37A 1UVRA 3ELJA 2ZM3A 3VRYA 4KIPA 4RIWA 4V0GB 3SOCA 4GYGA 5TE0A 4DCEA 3FZRA 4EKKA 5HU9A 3MV5A 4JX7A 1R3CA 2YJSA 4YHFA 2B9IA 2WB8A 4CZYB 3F5PA 4RZVA 3A7IA 3E8NA 2C47A 3H10A 2YDKA 3MDYA 4PQNA 2JDSA 3AC4A 3QRJA 4WO5A 4MVFA 3W2CA 4CYIA 3GFWA 2RIOA 2W06A 1SM2A 3PJ3A 3R00A 5A4CA 3NAXA 1DM2A 2GNHA 3HDMA 3QX2A 4YNOA 5AR8A 3O8PA 2WMQA 5C03A 5KMIA 4IB0A 5LMKA 1KUTA 1WBOA 3FL5A 3MPAA 3ZRLA 2C3KA 3VBXA 4C2WA 2JFLA 4ZTLA 3Q9YA 3BHYA 3KF7A 4FGBA 3JR1A 3M2WA 4GFGA 3QBNA 4YU2A 2JKOA 4QMLA 2C5OA 4RC2A 3TV7A 4JDKA 4NW5A 4UXQA 5CF6A 2ITPA 5LMKC 4IVCA 5CU3A 4GT3A 4HGTA 3OXZA 3F2NA 3PVUA 3OFMA 4FR4A 3TJDA 3Q2MA 3C4CA 2BDFA 3PVGA 2A27A 3MSSA 4NIFA 4XEYA 4RIYA 5ANOA 5J5TA 3LE6A 5F94A 3IQ7A 4Q9SA 2RFDA 3NR9A 2JAMA 3BEGA 4BF2A 3W10A 4BTMA 3IOKA 3DA6A 4GFMA 4O7VA 2J9MA 4FZAB 5EYKA 5FRIA 3UVQA 4FG7A 5A4TA 3EL8A 5LWMA 4MEDA 4Z3VA 3FXWA 4L43A 5DFPA 3QTQA 3JY9A 3SVVA 5FQDC 3MB7A 4BGQA 2PVMA 4NU1A 4CCUA 2F7XE 1JSTA 3F3VA 4YJNA 2EXEA 3QGYA 4IM2A 3TKHA 4AFEA 1JWHA 5IQIA 1KE9A 5HD4A 4KSQA 2XK9A 3VJNA 4DAWA 1OIQA 2P0CA 2YIWA 4I94A 1GAGA 3BGQA 3FSKA 2BKZA 3WZEA 4YJPA 4AZEA 4FV7A 4KSPA 4QO9A 2R3GA 4BB4A 4C3PA 3FKOA 3KB7A 3DBDA 5HTBA 5KMJA 4ZMFA 2XRWA 3PPKA 3UNJA 5EH0A 3KVWA 3KXXA 4RWLA 2WTDA 5AEPA 2WMBA 3RAIA 5CU0A 5KMMA 4TW9A 1XH6A 2PZPA 2VTAA 3R7EA 2OU7A 1OKYA 4U6RA 4NM7A 3W8LA 4QMYA 1OKWA 4JAJA 3T9TA 3Q4ZA 4JJRA 3RPVA 1FBNA 3PLAE 2W1GA 1P5EA 2ITUA 1IAJA 3NGAA 2YERA 1I44A 2Y9QA 5AUYA 2G9XA 5JGAA 3FQHA 1JBPE 3D83A 4L3JA 3GC8A 4TYGA 3KN5A 4JAIA 3DAJA 4HYHA 2E9PA 4ZK5A 3UO4A 3UP7A 1G8SA 4DE4A 2XNOA 2VTNA 2UVXA 4KRDA 4N6ZA 5HI2A 3R01A 5L8JA 5E4HA 2XMYA 5J95A 4OBOA 5FTOA 3R21A 4ZY6A 3VW6A 2F9GA 3N51A 3EYGA 2XNGA 3ALOA 5BMSA 3CP9A 4H1MA 2BROA 3DJ5A 2UVYA 3P78A 3RKBA 3ZO1A 4CZUA 1CKIA 3MTFA 4C62A 5FXSA 3BBTB 1YRPA 4TZRA 4DITA 3DQXA 3UMXA 3H9RA 1M14A 5JH6A 4NCTA 4GSBA 4EONA 3BELA 4LRKA 3PE1A 1IR3A 5M56A 5E7RA 5AX3A 3OC1A 4I6QA 2F2UA 2V5QA 2G01A 4JQEA 4M97A 3NEWA 4PRJA 1XH7A 4WBBB 2OGVA 3PYYA 3R02A 4NFMA 4NCTC 4HVSA 2OH0E 4BDGA 4LQMA 3F61A 3LCDA 5K5XA 2BVAA 3RP9A 3RGFA 2VN9A 2DS1A 3DKGA 3FMHA 2ACXA 3UYSA 1BI7A 2E9VA 3QCXA 4ANNA 2CNUA 4BDEA 5E9EA 1YI4A 4EH3A 3EQDA 4K33A 5HX8A 4G17A 4PMSA 4NM5A 2P2HA 3RI1A 4IW0A 3G9NA 3OWKA 3Q6UA 3V5PA 4E5AX 4GVAA 1R39A 1PRYA 1F0QA 5EM8A 4I5MA 3R8MA 4FEQA 3WZJA 2QO7A 3PP1A 4MYGA 4R7HA 2RG6A 4CV9A 3L1SA 4Z7HA 3R22A 4HYUA 5JRQA 4FV4A 4OUCA 3UVRA 1OMWA 4DF3A 3BWFA 2R9SA 3R9OA 3FDNA 1WVWA 3UC3A 5FEEA 3W2SA 5JMSA 1JQHA 5CTPA 4L52A 2YLFA 2GTMA 3QTZA 5HCYA 4CT2A 4ZTQA 3OVVA 3EFWA 4TXCA 5AV4A 3LMHA 4O7WA 2XIXA 2UZUE 1UNGA 3R7OA 2BAKA 3VS4A 1YW2A 4G5JA 4EYMA 4PV0A 1HCKA 3FEGA 3VS2A 4FICA 3LM0A 3QUPA 2XF0A 3FYKX 5HESA 2QOFA 3MPTA 2C6IA 4AUAA 4IX6A 2GS7A 3AXWA 3QCYA 1IG1A 4IDVA 3FHIA 1KE6A 4MF0A 2OSCA 4QNYA 5CS6A 5E90A 3TZ9A 3ZEPA 4O7RA 4RZWA 4DFLA 4IWPA 3ZRMA 1P14A 2P3GX 2R4BA 4C38A 4IWOA 5I9XA 2VWBA 4AS0A 3E8CA 2WU6A 4A4XA 3G6GA 5AP0A 4FSYA 2XKFA 4O0XA 1EH4A 3FI2A 3PJ8A 5DGZA 2WTIA 4P4CA 5KZ0A 3R71A 3I0OA 4KAOA 2JIUA 4RRVA 4AGDA 5AAEA 2ERKA 3H9OA 5CSXA 4XX9A 3ATTA 4DLIA 3BLQA 2JLDA 5CZHA 2XEYA 3D7ZA 3QCSA 2PUNA 4XG9A 4O0SA 3EOCA 5HO8A 2HCKA 2O63A 4C57A 4F6UA 1R1WA 1Q8TA 4X3FB 4YJVA 3U55A 1APME 4I4EA 4EHZA 4JQ7A 3B2TA 4BTJA 4IAKA 4WKQA 3D94A 4MH7A 3FXXA 4K2RA 2W4KA 4ZIMA 3PXRA 3E8EA 5AA8A 2BZKB 5AUTA 2XIRA 3U4UA 2GNLA 1NVRA 4Z7GA 1V0OA 3QQUA 4GIHA 4OBQA 5HD7A 2W4JA 4LM5A 4U3YA 3I79A 4IVBA 4WG3A 4AZSA 3UGCA 3DXNA 3C4EA 1E9HA 4FTOA 5C01A 4QPSA 5M51A 1ZARA 5TOZA 4D1SA 4WIHA 4D5HA 2QR8A 4YZDA 5FM3A 2YIYA 2XK8A 4RVMA 2DYLA 4F7LA 3C0HA 4HVDA 3C50A 5CEPA 3DDQA 2W1FA 5HVKA 3LFBA 3KMWA 4RVLA 5LJJA 4IMYA 3AMYA 3QTUA 4CMOA 4P5ZA 3KFAA 3PFQA 5JEBA 2QONA 4CCBA 4F65A 5CLPA 5BVFA 1H1QA 4BYIA 3V51A 2ESMA 1GY3A 4X21A 1H25A 4MXAA 3F3TA 3NWWA 5CAQA 2QC6A 3KXHA 4FL1A 4A9SA 3KQ7A 3FI8A 5IZFA 1URCA 4EH7A 3R7VA 5IQBA 3CJFA 3H0ZA 3F7WA 2PUIA 3BYMA 4H58A 3TCPA 2VTJA 3ORZA 2RF9A 5J7HA 4AOIA 4EHEA 5EQEA 5DE2A 3ORPA 4H36A 3FMJA 4YNEA 5EI8A 1B38A 2PMOX 4KBKA 5JZNA 1XKKA 3A99A 4FVQA 1L8TA 2J2IB 4FIGA 5AP7A 3FHRA 4D55A 4G1WA 5LMBA 2WQMA 3OY1A 4RSSA 3OOMA 4FGRA 4B99A 2C6EA 4FZDB 4NUSA 4QMUA 2Z8CA 3W2RA 2J5EA 4GW8A 3R73A 4BYJA 4DBNA 3LCOA 2QOOA 2QOQA 1JNKA 3O50A 3U6JA 4IWDA 2WMSA 4HCUA 3BE2A 4DEGA 1YXVA 4QMZA 4M69A 3ZZEA
chains in the Genus database with same CATH superfamily
2B55A 1Y91A 3IW4A 2Y6OA 4O2PA 3GFEA 4WRGA 4FKTA 3V6RA 2ZB0A 5HIBA 4GH2A 1GNGA 3BQRA 3RALA 4AZWA 5AWMA 3AMAA 4P90A 5KMNA 3FKLA 3UIMA 3NW6A 5HGIA 3NUAA 4CEGA 1K3AA 1VLRA 2ONLC 3TM0A 3R6XA 3SG9A 5HZNA 4O2ZA 1JKLA 3L9MA 1ZY5A 2JDRA 3LMIA 4CKJA 4ZTRA 4E3CA 2GHLA 3LQ5A 1PF8A 4AXAA 4DEEA 4BZDA 2WZJA 5D10A 4GV1A 4J52A 3VBTA 2ONLA 1PXKA 5BYYA 4EHGA 2EB3A 5C1QB 4FVPA 2UZDA 3QL8A 1XH4A 4FKJA 4IFGA 4I41A 5IMXA 3CTHA 4AN9A 4OLIA 5FP5A 2QR7A 2VTQA 4YTIA 3A4PA 3V8TA 4L45A 5H8GA 4K18A 2B9HA 5A14A 3BBWA 2W1IA 1UU3A 4LUDA 4X6RA 3VBQA 1AQ1A 3PA4A 5C4KA 2XIZA 3IW7A 2UW5A 2BZHB 5EKOA 2V22A 4QYYA 5HG9A 5I9ZA 2C4GA 4PPAA 4QPAA 2IW8A 3R9DA 4EL9A 3BHVA 4BBFA 5FDPA 4QMXA 4D1ZA 4G16A 2BALA 4FSRA 3FMLA 4D2VA 3O8UA 1E1XA 1Q24A 2R3IA 5FG8A 2XK3A 4ENXA 3DKCA 2GSFA 2J4ZA 4K8AA 1G3NA 4KRCA 3TG1A 5HEZA 2HZNA 3QX4A 5C9CA 1G5SA 3QC9A 5AJQA 4YLKA 4GU9A 2OJFE 3UQGA 1WZYA 3H4JA 3C0GA 3R8UA 2PVLA 4CQGA 5ANJA 3LHJA 2B7AA 2C0OA 2VX0A 3MA6A 4YZCA 5EDPA 1P2AA 3UVPA 1UKHA 4LOQA 4LV5A 4ZY5A 4HNIA 2CLXA 1OITA 1XHAA 5D9HA 3AQVA 5E8ZA 3FXZA 3AC5A 4AW2A 3OHTA 1YXUA 3E63A 3PY1A 4DEDA 4IAYA 1KSWA 3LFDA 4PTCA 4DFNA 4DFXE 2VTPA 2AEGA 3DV3A 3ZO2A 1WBWA 2W1CA 3Q52A 4PX6A 4CGAA 4YGAA 4CMUA 5JK3A 3IKAA 1ND4A 4FTUA 5BYLA 1GJOA 2UZWE 3UIXA 4IX3A 2OF4A 2VWYA 3GXLA 3ZLWA 2HZ0A 2YM4A 5E8XA 4YUQA 1ZOGA 2H9VA 1MP8A 2FA2A 2ZDUA 3LJ1A 3D2KA 3LPBA 4KS8A 4O0UA 3UP2A 2VTRA 4L67A 3WF6A 4DH8A 3CGFA 5HE2A 3MESA 4NL0A 1W82A 3AT4A 2Z7SA 1GIJA 1H8FA 3SOAA 4C4GA 2BRNA 4OT5A 2B54A 1Z5MA 4BWKA 1XBBA 4FK6A 3NNVA 5HE0A 4BY9E 4KIOA 2YABA 4Q2AA 3K2LA 4ZP5A 4I20A 4FL2A 1BUHA 2CSNA 2BCJA 3FLYA 5DIAA 3LFSA 4ZEGA 5HBJA 3FPMA 2WIPA 4WNMA 2VZ6A 4JMQA 4NKAA 4PTEA 2H34A 3KXNA 3QU0A 2F57A 3C7QA 2IW6A 3JUHA 4FG9A 5DR2A 4ZLYA 4FNWA 4ZZMA 5M4FA 3MH2A 3L9LA 2VTTA 2A98A 2I0YA 2HY81 3GC9A 3WYXA 5BX0A 4PP7A 4QYHA 5KUPA 4LOOA 4MD7E 1FMOE 3TZ7A 4XNEA 2QOCA 3OROA 3QTWA 3ZSGA 3R1QA 2HYYA 3R2YA 3W33A 3MTLA 2BFXA 2WOUA 4L7FA 4Y5HA 3LFNA 1KV1A 5CF4A 4DTAA 4CSVA 4ZJVA 4HZSA 2OJIA 4BIEA 4FK3A 2YCSA 3EB0A 3LJ2A 4J7BA 1REJA 2W99B 4LG4A 2Z7RA 3GOKA 4FSMA 5E8WA 5ETFA 4TL0A 3UNZA 2OIDA 3UOHA 5J79A 5ACBC 2VO7A 2XBAA 4Y85A 1OL6A 2IWIA 2QURA 3VO3A 3BV2A 3NYOA 4GL9A 3PPJA 4FUYA 2R3RA 4FOBA 4FIEA 3KRLA 4DH3A 2ITOA 4WG5A 3TJCA 4C58A 4IAZA 4GT4A 3LFEA 4JR7A 5JFVA 1W7HA 3GOPA 4GG7A 1ZXEA 4W9XA 4ZMEA 2CPKE 4KNBA 4BCKA 5A3XA 3PUFC 1XBCA 3D4QA 5DEWA 1BYGA 4IX5A 3RCDA 3V5TA 5LVNA 3CGOA 5LCKA 4L3LA 4BKZA 3ZDIA 2C0TA 2J7TA 2YDIA 3RVGA 5I9VA 2JC6A 3TV6A 4Z55A 3FZSA 3AGMA 4M3QA 2BZJA 4D0WA 3F5XA 4AXEA 3L8VA 3MFTA 4ZJIA 4CVAA 3E5AA 4A9TA 3OCBA 3DKFA 1UU8A 3ZEWA 3DXPA 4O0RA 2QOLA 5CNOA 2YISA 1TQPA 1WBNA 3CXWA 4IIRA 3CIKA 4FSTA 4XRLA 4EOIA 4L3PA 2GNIA 2LAVA 4F7SA 3L9NA 3VUKA 3C51A 2I7QA 4G3FA 4OW8A 4KUJA 3TNWA 3UE4A 3Q53A 4MTAA 4YBKA 1G8KA 4ORKA 3SRVB 3C5IA 4O4DA 2X0PA 3RHXA 4ZSAA 5CSPA 3RHKA 2XBJA 3KK9A 4FTMA 5BYZA 3BGPA 3HYHA 4NM3A 4OGRA 3TNIA 4TYEA 2PY3A 5KKRC 4JBOA 3NZ0A 5AUXA 3ZLSA 2W1HA 1NT2A 1SVEA 2GTNA 4FT9A 3HV7A 4NJDA 4XG6A 1WBTA 3U9NA 3TV4A 3OY3A 3HLLA 5HTIA 1ZAOA 2NPQA 2VNWA 1NA7A 3IW6A 3UNKA 2O2UA 2GS6A 3CBLA 4U40A 2ZM1A 5DOSA 1IA8A 2WMVA 3NNWA 3FY2A 5HX6A 5F95A 2R3HA 4YLLA 5M53A 2HY0A 5FM2A 3QTRA 4DFZE 4B8MA 2I0EA 2WHBA 4F0IA 2O5KA 2RFNA 3PXYA 2YJRA 3DXQA 1ZYDA 3K3JA 1OL2A 3OW3A 4BDAA 1JKSA 3AG9A 2PHKA 5BV3A 3FQEA 3MWUA 4DHZA 4FC0A 4R3RA 2C5VA 3LCKA 5CY3A 1WAKA 2IVSA 4LMNA 1O6KA 2XIKA 3ZC6A 5LARA 4CMTA 4ALVA 4U81A 3H3CA 4DDGA 1YHWA 1U5RA 2V7AA 1MRYA 3UPZA 3KXGA 4TN6A 4XG2A 4JIKA 1M2RA 1OI9A 5HNBA 1OL1A 4O4FA 3RINA 1QPEA 5TT7A 2VWUA 5BVKA 2REIA 3IK3A 3ZO3A 3D5VA 4EK4A 5DYJA 2VD5A 3KCKA 4I0TA 4M14A 4AT3A 5L2SA 4FKRA 3WIKA 3OG7A 5GZ9A 3HP5A 3COKA 1QPJA 2BDWA 2GS2A 3AC1A 5CWZA 5E91A 3NW5A 5AAFA 5M06A 1TKIA 4ZTMA 4AAYA 3LW0A 3R30A 1SNUA 1FINA 2YLEA 3P1AA 4ZS0A 4FTCA 2CKPA 3KF4A 2RFSA 4RWKA 5BNJA 5DA3A 5CEOA 4PL3A 2X0GA 3DY7A 2BTRA 3ORIA 4J97A 3TXOA 2ZOQA 4PDYA 2WO6A 4USFA 2O3PA 4YJTA 4A07A 3KCFA 3THBA 4A9UA 5LOHA 3LKMA 3C5UA 4QP4A 3RBWA 3ULZA 4O7LA 2QG5A 4I24A 4LI5A 4A7CA 2Y7JA 2XCHA 4RX7A 2IZTA 3C4WA 2UV2A 2QOBA 3DBEA 4RFYA 3WIGA 3BLRA 4C4HA 2XZSA 1ST4A 5FBNC 5ACKA 3FMMA 2J0LA 1J1CA 2W1EA 4ALWA 4AW5A 3GQLA 1G8JA 2QCSA 5BVOA 2X8DA 3DLZA 4ASDA 4XV3A 2GPHA 3PY3A 3O0GA 3DAKA 3V6SA 4DC2A 2CNQA 2I0HA 2V0DA 4RIWB 4XBRA 4RGJA 3RAKA 2WGJA 1WCCA 3VRZA 4ANOA 2HZ4A 1IEPA 4YJOA 5G1XA 3R1NA 1YVJA 3VF9A 2WMXA 3HV5A 4TWCA 5C27A 3C13A 4WBOA 4CTCA 2R3OA 4P7EA 4C35A 1PXJA 5K4JA 3FLWA 3W32A 4FV0A 2OZAA 3NNUA 4AT5A 3TNQB 3Q9ZA 1J3HA 1JOWB 2Y0AA 3QWJA 4AOJA 3G2FA 3VNTA 3CKWA 3OZ6A 3F5GA 5IQAA 1QCFA 4TKSA 4HGLA 4C2VA 4HVIA 5I3RA 1A48A 4BDJA 5KE0A 4EOOA 3EN5A 4RMZA 2PL0A 4MAOA 2ZV2A 4ENYA 4F99A 3QZIA 2VWWA 4FIJA 4AFJA 3VF8A 3KKVA 4WNPA 3QLFA 3KN6A 1OKVA 2PMLX 4UBAA 3MJ1A 3OBJA 3QF9A 4LOPA 3ORTA 4C4FA 4B8LA 2WD1A 4ZTNA 3ZFYA 1OPJA 2CJMA 3LFFA 3ANQA 4E6QA 3TDWA 4BI2A 2HXLA 4CNHA 5IA2A 2Q0NA 2P33A 5FTGA 2CKQA 4PDSA 4PL4A 4RA4A 5EFQA 3BU3A 3PJCA 3GP0A 4G2FA 2BIYA 4GRBA 3NFGB 3GT8A 4QRCA 4X2GA 5IEVA 4OAUC 3MFUA 2CGUA 4Q5EA 4AF3A 3L9PA 4MNFA 4E6AA 4P5QA 3UDBA 3VS1A 1W2FA 4LRJA 3SXFA 4EWQA 1Y8GA 3P5JC 2PVHA 2E2BA 4JQ8A 3FLQA 5J9ZA 4E4LA 2CN5A 5L6WL 5HQ0A 1NVQA 3OT8A 1Q61A 4K77A 4QP7A 4A4LA 3HMIA 2V55A 2W5BA 4K0YA 4ITJA 3GU5A 4TPTA 3V04A 3PWDA 4CG8A 5H8EA 3VUGA 5IA1A 4FKLA 2UZVA 3NUSA 3I6WA 3KRXA 4O0YA 5ETIA 2UW0A 4AOTA 4R7BA 3H9FA 4DEHA 5HCZA 3QAME 4NH1A 5F4NA 1B6CB 3NX8A 4YR8A 1Q99A 3VHEA 4QP3A 5EW9A 4FTJA 5AAGA 3R7UA 4KKEA 3P7BA 4O7ZA 1BL7A 1Y8YA 3EN9A 1QMZA 2CNVA 3EN4A 2C5NA 3BWJA 5KMOA 4X2JA 4XMOA 4ACGA 4XJ0A 1YWRA 3CTJA 3WBLA 3ZXTA 4FEWA 1DI9A 4NJ3A 5DI1A 4AP7A 3HL7A 3W8QA 3D14A 1K9AA 4HCVA 1OIYA 3C9WA 4NZWB 1KOAA 3DDPA 3R1SA 4XOZA 4GJ2A 3KULB 3ZRKA 1CDKA 4FV8A 3F3ZA 4QP8A 3MW1A 4RA5A 1TVOA 4FTNA 3PSCA 5KKRB 3RMFA 3ORNA 2B1PA 3T3VA 1PYXA 3P0MA 3G15A 4BC6A 4C34A 2HXQA 3U9CA 4R78A 2WOTA 5M55A 4DTKA 4W4YA 4BCOA 3CSVA 3EQPA 3OBGA 4CG9A 5EM6A 2YITA 4UN0C 2GQGA 3BCEA 2C6LA 5DNRA 4PDPA 1P4OA 3R0TA 3H0YA 4WT6A 3MBLA 4U43A 4XRJA 4EQMA 4EBWA 2J5FA 3Q9XA 4QTBA 4QYFA 3L8SA 4EK8A 2R7BA 4R77A 3GB2A 3S0OA 5DLSA 2XK7A 4R3CA 3FI3A 1I09A 1XQZA 4RIYB 4D4YA 4AGUA 3NIZA 4DLJA 3OEFX 4XP3A 5CALA 2R3PA 4D4RA 3BLAA 3GUBA 5DRDA 2UW9A 2G2FA 1YHSA 2R7IA 2YCFA 3ODZX 3PJ1A 4ACDA 4USEA 5CQWA 3UC4A 2A1AB 4CRSA 3LXKA 4O4CA 4HPUE 3DZOA 4JBVA 2ZV7A 3DK6A 2QKRA 3HRCA 4JR3A 4O4BB 3RNIA 3ZUVA 3CY3A 4JRVA 4RFMA 3OTUA 3IW8A 5CZIA 5IA5A 4PL5A 1OBDA 4AXFA 4IVDA 3ZOSA 3OT3A 4WUNA 5AR5A 3V8SA 2WXVA 5TO8A 3TUDA 2JITA 4Y95A 5EM5A 3VS3A 3W55A 1JAMA 3RAWA 5EHOA 4BCGA 3LFCA 3F6XA 4AAAA 4EOPA 2FSOX 4EJ7A 4YZMA 1H1RA 5BUIA 3R8VA 4FZ6A 4XV1A 4E4MA 2YAKA 1J1BA 4FI1A 2BPMA 5TR6A 1PKDA 2FUMA 4O1OA 4QYGA 3MH3A 4RC3A 4YP8A 4H3PA 2JFMA 4MF1A 4FIIA 2R3MA 4TYHA 4LV8A 3PZHA 2Y4PA 2PWLA 3OUNB 3HUBA 4BJJA 5JGBA 2JKKA 1W84A 3NCGA 2ZJWA 4RJ4A 4ZLOA 2CGWA 5HIDA 1Q5KA 2Z60A 3SLSA 2IVVA 1CKPA 2YM3A 4EH6A 4KINA 5C8MA 1J91A 3VVHA 4LL0A 5C26A 5E1SA 3EQGA 2UZEA 4L68A 4YJUA 3UZPA 4EI4A 4EH9A 3MFRA 1CMKE 2R3NA 4MQ1A 5DHJA 4QTEA 2WAJA 4FV3A 4KD1A 4WRSA 3I81A 3T8OA 3COHA 4C36A 1PMEA 1SVGA 2W17A 4ASZA 3TTJA 1OGUA 3PA3A 2PTKA 4FKPA 4O4EA 4RX8A 4HGEA 3HNGA 2OJJA 4DT9A 4ZSLA 4KIKB 1RJBA 3RAHA 4F08A 1QPCA 4UWCA 2B9FA 1XWSA 4X3FA 4ALUA 5DH3A 3NUXA 4F1OA 4UMQA 2Z7LA 3OCTA 3VUIA 3QXPA 4DHFA 3WZUA 2CMWA 5HU3A 4UEUA 2ZAZA 4IFCA 4KIKA 3S1HA 1URWA 3GCVA 4X3FC 2R5TA 2IVUA 2VO0A 3A60A 4DGMA 2PE2A 4NFNA 2PU8A 1OGYA 4GG5A 4U45A 2WIHA 2X4FA 1M7QA 2R3JA 3T3UA 1JSUA 3H30A 4GMYA 3QKLA 3R9NA 3VS7A 4AN2A 5JT2A 2IVTA 2WQOA 2XNNA 3O23A 3ZSIA 3ZHPC 5CANA 3DTCA 5CEIA 5J7BA 3M42A 3RK9A 3QQFA 4CTBA 2F7ZE 2YEXA 3PRFA 2YZLA 3BX5A 1ST0A 1UV5A 2XALA 5FUTA 3FMNA 4TYIA 3ORKA 5AP3A 3PXZA 5CYIA 4GIIA 4F9AA 2YWVA 5DPVA 2YWPA 1PXPA 3PFYA 4Q9ZA 3R8ZA 5I9UA 2E9OA 3ORMA 1LR4A 2B53A 4ITIA 1PKGA 3DPKA 4GJ3A 3D5UA 3HRFA 5AP4A 3G0FA 1TQIA 1OKZA 4PNIA 1A9UA 4FKVA 4EEVA 4GK3A 5CT7A 2HIWA 2VWIA 4FSWA 4U41A 1ZY4A 2W5AA 3FZTA 4O82A 3FLSA 4MKCA 2VX1A 3ENHA 1ATPE 4ZSGA 3SXSA 2AUHA 4IJ9A 3U8WA 4CT1A 3EQIA 1OBGA 1BX6A 1T46A 3DQWA 2ZVAA 1JPAA 4C02A 2XNMA 1B39A 4YURA 1GZNA 3PG3A 5EDRA 5D41A 4ZAUA 1TQMA 3MYGA 3LAUA 3NRMA 1MQBA 3D7TB 3GBZA 4N0SA 4F64A 4DTBA 5GIPE 1Z57A 2UW7A 3BYOA 3MI9A 3R28A 4L42A 4ZTHA 4FJVA 4WSYA 1QPDA 4AT4A 3LLTA 1W2CA 2JDOA 4I22A 1PYEA 1H01A 4E4NA 5HIEA 5BVEA 3QTXA 5F20A 4GYIA 5DMZA 1SNXA 2F2CB 5GZ8A 5LVOA 4DGNA 4IM3A 5KX8A 4FTLA 4L8MA 3SV0A 3G90X 5A54A 2PPQA 3NYVA 4PY1A 5F9EA 3KA0A 4EYJA 3F2AA 4TT7A 4RIOA 3MVMA 3FLNC 2UZOA 3I60A 3RPSA 4BIBA 5HTCA 5L8LA 5IQFA 2CKOA 1Q62A 2P2IA 4ASXA 3RZBA 3RPOA 4S30A 2AC3A 4BCHA 4DEBA 2R0UA 3Q3BA 3DK7A 3ULIA 4IAFA 3ORXA 4OTFA 2X1NA 3BEAA 3VBWA 2ZMDA 2ITTA 2WTCA 4OR5A 1SYKA 2NP8A 3OP5A 1F3MC 2PE1A 5A6OA 4XP0A 4XLVA 4IANA 1R78A 3AOXA 3NLBA 5IUIA 3ZUTA 4LYNA 3O71A 3KXMA 3IGOA 3FPQA 3LCTA 3GENA 4L6QA 4PDOA 5CAUA 3EWHA 4UMTA 3EQRA 3W0QA 3OCSA 4DA5A 3NUNA 3EFJA 2QQ7A 4WHZA 3ZLYA 5JZJA 3JVSA 2PZ5A 2WMWA 3KEXA 3FC2A 4M15A 3IPHA 5AM6A 2IO6A 3E87A 1SZMA 2XYUA 5EOBA 3HDNA 4G9CA 3E88A 3JYAA 3UOJA 4XBUA 3QC4A 3T9IA 1S9IA 2J0KA 2Q83A 4QQCA 5CF5A 1YKRA 2JGZA 3KRRA 4L00A 4O84A 5BMMA 4L44A 4NKSA 3ALNA 4E5WA 3P7AA 2O64A 3RCJA 3V5WA 2C30A 1FGIA 1SVHA 4EOSA 4E6CA 3PY0A 1UNHA 2H96A 3IDCA 4D1XA 4EKLA 3BV3A 3LVPA 4Y46A 4Z9LA 4AZFA 4BCNA 4IWQA 3GEQA 3MA3A 3NAYA 4L7SA 4I0SA 1YDTE 3HRBA 2NRYA 4WA9A 3TN8A 3RPYA 2ERZE 4JT3A 3BU5A 2BRMA 4KWPA 3KREA 4O81A 2R0IA 4AW1A 3CS9A 1U4DA 4RLLA 4RJ7A 4RVKA 3PPZA 2FO0A 5FEDA 4EC9A 4F7JA 5IQGA 3UDSA 2F49A 2OIQA 4I0RA 3AGLA 4H1JA 3R63A 3WARA 4BBEA 3D15A 2SRCA 4WNOA 4BICA 4R5SA 5E8VA 2DQ7X 4S2ZA 2CLQA 1ZMWA 3JS2A 4FL3A 2IW9A 2PUPA 4XCUA 4S32A 4TRLA 5CSVA 3NVKI 3EMGA 1BKXA 3I5ZA 1JKTA 2G1TA 2QI8A 2UZBA 3K54A 4MXZA 1M2PA 2C3LA 1Q8WA 4CFVA 1ZYCA 2GFCA 4BRXA 2BHEA 1Q8UA 5AIRA 4NIFB 5HKMA 2NRUA 4OTIA 4P2KA 3CPBA 5HBHA 3V8WA 4PNKA 4XP2A 2J6MA 4PUZA 2JD5A 3Q60A 4JDIA 3RWQA 2IZSA 3BGZA 3A7HA 3FI4A 1AD5A 2BFYA 1OZ1A 4E26A 3TNPC 1ZOHA 2BKKA 3P4KA 4GKIA 5CNNA 4XG3A 5C4LA 3OW4A 5AMNA 5IA3A 5HVJA 3MJ2A 4U8ZA 3QHWA 3AD5A 1WBVA 1O6LA 3VN9A 4IEBA 4F63A 5EKNA 2A0CX 2KULA 4BCPA 2PULA 4QD6A 4I3ZA 2BMCA 3R9HA 3PZEA 2A4LA 4UALA 1HCLA 4YC6A 5KZIA 3QALE 5FBOA 4ASEA 1ZMUA 2QVSE 5IDPA 3QQJA 3LQ3A 1H0VA 3TZMA 2BDJA 1PXIA 3AC8A 3FKNA 4AE9A 1W0XC 4Z16A 4W4WA 3BYVA 4FKQA 4EH8A 1WBSA 4F09A 4S31A 4AA5A 3LOKA 3EQCA 3MY1A 2Y6MA 5AV0A 5AUZA 4WNKA 4NM0A 5T3QA 3DK3A 3MY5A 2ZV9A 4PMTA 4RQVA 4OTDA 3OXIA 4O96A 2W96B 3F88A 4BDIA 4RWJA 2KTYA 4D9TA 4F0GA 4HZRA 3I5NA 2OO8X 4G5PA 2WTVA 3IS5A 3BPRA 3EZRA 3M11A 2PVYA 3NIEA 2OI4X 2OFVA 3JPVA 5EOLA 1ZYLA 3O7LD 3OMVA 4BTKA 4BI0A 3OF0A 3VAPA 5IG1A 4MWIA 4ZS4A 3O2MA 5JGDA 1PJKA 4AX8A 2BHHA 3A7JA 3C1XA 3DNDA 3OD6X 3KL8A 4D4SA 4TNDA 2OW3A 3HMMA 4I21A 4FZFB 3PVWA 2HZIA 4BFMA 3K5VA 3DBCA 4FSQA 3ZU7A 3W0PA 3DFAA 1KWPA 2IZRA 4JS8A 3EIDA 4WUAA 5EM7A 3B8QA 3HMOA 3KVXA 2GCDA 3FJQE 4X0MA 4E6DA 4EZ3A 3SGCA 3V3VA 4F0FA 3IDPA 4C3RA 4FTAA 2WTJA 3VW8A 4FKIA 3DKOA 3R8PA 4DGOA 3R7YA 4MNEB 5A4LA 3KGAA 4FVRA 3TI1A 1SMHA 4F9CA 1U46A 2VTLA 4IAIA 3Q4TA 2UZLA 1XBAA 4W4VA 4BDDA 4TWOA 3ACKA 3QQHA 1HOWA 4O91A 4U80A 4CKRA 2PSQA 4N4SA 2W0JA 4LGDA 4EK3A 3MS9A 4QPMA 4OBPA 4E1ZA 2IG7A 2QOKA 3PWYA 4BZOA 3CR0A 4EWHA 1V0BA 4ITHA 3CQUA 2XJ2A 1GZKA 5DT0A 1Q4LA 3BU6A 5FEQA 3RZFA 4O7YA 4DGGA 2BUJA 1UWJA 3OTVA 4JG7A 1Q3DA 3PP0A 4UB7A 1M2QA 4U44A 4YJQA 3RPRA 3COMA 4FG8A 4M0YA 5HG8A 4R5YA 2HW6A 3NUUA 3KRWA 4X3JA 3I4BA 2B9JA 4FKGA 4M0ZA 3PSBA 5EG3A 5T6KA 5KNJA 4BCMA 1PXNA 2JAVA 3EQHA 3VUDA 3UBDA 3R2BA 3UO5A 3PTGA 3AKKA 4ZSJA 1T45A 3LXNA 3MIAA 4OTPA 5IMEA 4CFUA 4ACMA 4EZ7A 4FEUA 1ZOEA 2XCKA 3IW5A 4FNXA 4IZ7A 5JRSA 1NVSA 3QZHA 4C4IA 1OPKA 2PMNX 4FODA 4JVGA 5IUGA 3FV8A 1FVRA 2VTOA 1WMKA 5TF9A 5L6PA 2R3QA 2DWBA 1YI3A 5D7VA 2UUEA 4XS2A 5L6OA 1YI6A 4IZ5A 5LCJA 4J98A 4U42A 2BTSA 3O17A 3QA0A 5GNKA 1F5QA 3RJCA 2VWZA 3NPCA 4F9WA 4IVAA 4JXFA 4NWMA 5CSHA 4BCJA 1H4LA 4MHAA 3CQWA 3POOA 3R9RA 4ZOGA 4D0XA 4NT4A 3V5QA 4DG2E 3NUPA 4OTRA 5IH4A 1L3RE 3PRIA 3IECA 4I4FA 3UDTA 2WQEA 1JKKA 2ZB1A 4GK4A 4BDBA 3AMBA 2R3FA 3ZCLA 5IA4A 1ZZ2A 3TKUA 5LXMA 4QP6A 3WF7A 3C4FA 4FUXA 2ZV8A 4ZXTA 4FV6A 4IACA 3W0SA 3VWAA 4BIDA 3IGGA 3OUKA 5EDQA 3PA5A 1LPUA 5ANKA 2HAKA 4I23A 4IB3A 3U87A 3K3IA 3WF8A 2RGPA 4I92A 2FSTX 3DB6A 2OK1A 4H39A 5AX9A 4WOVA 4APCA 2YCQA 3Q96A 3OEZA 4H05A 2AC5A 1QL6A 1XO2B 3ACJA 3MIYA 3IO7A 3QHRA 4S34A 4YZBA 4MXYA 4RG0A 4V05A 5K4IA 4OTGA 3VS5A 3IG7A 2Q0BA 4RBLA 4J96A 3BLHA 4F6SA 4R1VA 3SDJA 2YAAA 2CKEA 2VO3A 2VUWA 4D2TA 2BILB 4F1TA 2IF8A 2VAGA 3DGKA 2WEVA 4YZNA 4QMSA 2WFYA 5JFSA 3QUEA 2F4JA 5CU2A 1V0PA 2VTIA 4DFYA 4W8EA 4JL9A 1M52A 1PHKA 1YWVA 4CV8A 1M7NA 3ID6C 1OVEA 3ZLXA 1VJYA 1VEBA 2A19B 4DH1A 1CTPE 1UKIA 1YDSE 4PP9A 2H8HA 1Q41A 2QO9A 5E92A 2JKMA 4BN1A 1WBPA 4W8DA 2ITVA 2BR1A 2QODA 1PMNA 2F7EE 2PE0A 4NSTA 3ZFXA 5M4CA 5B0XA 1OL7A 2PVRA 4UXLA 5E8YA 3HV6A 4U5JA 5JFXA 2OG8A 2JIIA 4A9YA 3BHUA 1PXLA 4DCAA 4JIAA 4E4XA 3C0IA 5L4QA 3NMUF 3AKJA 4BHNA 3HMPA 5I0BA 4RVTA 5ANIA 1ZMVA 2OICA 3N4VA 3UDZA 1DAYA 4J8MA 5E8TA 5CENA 2EU9A 4KBCA 4MWHA 2HW7A 3N9XA 3R1YA 3WF5A 2VTMA 1PMUA 4XYFA 3MVHA 5D11A 3WE4A 2J0IA 2GNGA 1JVPP 2RFEA 4IC7A 4O1PA 1PW2A 1OIUA 2EXCX 4I5PA 4RC4A 4K6ZA 1XMMA 5HVYA 1RW8A 4JOAA 2FYSA 1DAWA 5L2IA 1UWHA 1H00A 4AACA 4EH5A 2OXDA 3W18A 5CAOA 5AR4A 4ZY4A 5GJGA 4UZHA 4YMJA 3U6HA 3BHTA 2XYNA 4EQCA 4DEAA 4IB5A 4FT5A 3E7VA 1FOTA 2Z7QA 4PMMA 4G6NA 4MX9A 5KMLA 2ZYBA 2X9FA 5AADA 4UY9A 2XJ1A 3VS0A 4DGLC 3I7BA 3CC6A 2WTKC 2ETRA 2OH4A 4JRNA 4BDFA 4CKIA 2XK4A 1YOMA 3HECA 4CLJA 3LMGA 2OBJA 1H08A 1Y6AA 3EH9A 4FX3A 4BWPA 5M07A 5A4QA 3D5XA 4FKSA 4AA4A 3QRUA 1XR1A 5DR9A 5KBRA 4WSQA 3CD8A 4M7IA 3LLAA 3F82A 4EK6A 2YIXA 2R3LA 3CTQA 4LFIA 4O7SA 3ZM9A 2HELA 3BYSA 2PVNA 2W1ZA 3II5A 3F2RA 1ZYJA 2VX3A