4A9RA

Crystal structure of human chk2 in complex with benzimidazole carboxamide inhibitor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
303
structure length
285
Chain Sequence
SVYPKALRDEYIMSKTLEVKLAFERKTCKKVAIKIISKPALNVETEIEILKKLNHPCIIKIKNFFDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQEEDCLIKITDFGHSKILGETSLMRTLCGTPTYLAPEVLVSVGTAGYNRAVDCWSLGVILFICLSGYPPFSEHRTQVSLKDQITSGKYNFIPEVWAEVSEKALDLVKKLLVVDPKARFTTEEALRHPWLQDEDMKRKFQDLLSEENESTALPQVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Benzimidazole Inhibitors of the Protein Kinase Chk2: Clarification of the Binding Mode by Flexible Side Chain Docking and Protein-Ligand Crystallography
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE CHK2
total genus 89
structure length 285
sequence length 303
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2011-11-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4a9rA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4a9rA01
5J79A 4TPTA 2BDFA 3Q96A 1H07A 3FDNA 2Z02A 3CCNA 5AV0A 2J0IA 2W9FB 1Q8ZA 4DBNA 3CE3A 3SOCA 3QAME 3VRYA 3RI1A 5IQEA 1OKYA 4BCPA 4YU2A 3PXYA 3E5AA 3VUIA 4O86A 3PY0A 3K2LA 4AGCA 1VJYA 1FGKA 2BIYA 3PP0A 4ZJVA 3U55A 5KZIA 3PRFA 4GMYA 4CKIA 4V04A 2XKEA 3ELJA 4U81A 3CP9A 3JXWA 3PY1A 4XEYA 3UO4A 3DLZA 5KKRB 2CNUA 2WQBA 5ETFA 4ZSEA 3DK6A 4FF8A 1B39A 4P5QA 5C8KA 2UZDA 1SYKA 1JKLA 2O64A 2RFEA 1MUOA 3L9PA 2PVHA 2Z7QA 5HX6A 5FEEA 3C13A 3KRLA 4O7LA 4CD0A 1XH9A 4GIIA 3UIMA 2F2UA 1DI8A 1PXNA 3DNEA 4TYGA 4BKYA 2V5QA 3ATTA 5BNJA 2R3FA 4D55A 5KE0A 3ZXTA 3SRVB 4BDEA 1XHAA 3PTGA 4NU1A 1BL6A 1J91A 2OW3A 5D1JA 1O6KA 4F64A 3DJ6A 2JBOA 3FLZA 5IQBA 1M14A 4LRKA 4X3JA 1NA7A 5FDXA 1F0QA 3EFJA 2QNJA 2IZUA 5EQYA 3QU0A 3P86A 4R3RA 5HBJA 1M2QA 4WG5A 4PX6A 4D1SA 2PK9A 5KMMA 3I7CA 4D2WA 4C38A 5GJDA 3ZLWA 5F4NA 3HV4A 3WF8A 3OWKA 1Q41A 4H58A 5J7BA 2Y8OA 3QUEA 2VTIA 4D9UA 1UNHA 1YXSA 3ROYA 3QQLA 4TZRA 4FOCA 5DIAA 4GFOA 5KZ0A 5M55A 2O65A 3MIAA 3UPZA 3AG9A 3KA0A 5LWMA 2BRBA 2WXVA 1AD5A 4HVGA 2W5BA 4FNZA 1GIIA 3MVJA 4RJ3A 1FPUA 3ZC5A 2W1DA 5BVDA 4C4JA 3V5QA 1WVYA 2YIRA 2BFXA 4IWPA 2X2KA 3EQRA 3OEZA 4MNFA 4NKSA 2B9FA 4AOIA 5HNBA 1FGIA 2YIQA 5JGAA 2V7OA 3PXKA 4G3EA 4AT4A 4EONA 1ZXEA 3RK9A 2PMNX 2ITQA 1KOAA 4FOBA 2EUFB 5EW9A 2YITA 3I7BA 1SVHA 4EYJA 4X0MA 3LXPA 1Q8TA 5B0XA 5IA4A 4OLIA 2YIWA 4PF4A 2YAAA 4GSBA 2OSCA 5FWKK 4OBPA 4WNOA 2CGVA 1J1BA 2JDSA 1OL2A 1X8BA 4M0ZA 4EBWA 3EQDA 1ZARA 4S31A 3RGFA 3ZRKA 4F7JA 4O7SA 4F0IA 2BAKA 2QU5A 2X4FA 3ZS5A 1IA9A 3IW7A 2RIOA 2F9GA 4KNBA 2P55A 4E8AA 1URWA 2JGZA 1UA2A 5IQIA 3I6WA 3WARA 5IKWA 3TXOA 3ORXA 3OBGA 1XQZA 3G33A 5JZNA 3MY0A 3UTOA 4AW5A 4NH1A 1ZYJA 2YACA 4DFUA 5H8BA 4GH2A 1Q4LA 1I44A 3MYGA 3FI8A 3K3IA 1DS5A 4PMPA 4WD5A 4Q2AA 1XH4A 3NRMA 3CSVA 4AE9A 3FMJA 5M07A 3DS6A 2QHNA 3S1HA 2VNWA 1U5RA 3HECA 3U9CA 4FEVA 3A7GA 3RJCA 1W84A 3KXNA 3Q5IA 5HCYA 1PMVA 2QQ7A 1ZYCA 3MPMA 3G6GA 4IC7A 4AA5A 3A99A 3R7IA 3TNPC 2XKFA 4BCGA 1M52A 3ORZA 3C1XA 2WMBA 3HMNA 4YZDA 2OICA 3FZRA 4I20A 4AW2A 4AAAA 2OJJA 1WAKA 2C47A 2WQNA 3MN3A 5AP6A 4MXYA 4M8TA 4FG9A 1U54B 3AGMA 3F88A 2KULA 3GCSA 4FSTA 4RIYB 1MP8A 4KS8A 4NKAA 3OEFX 5KMJA 3DZOA 3OP5A 3DK3A 3BKBA 4YJVA 3BV2A 2IVUA 5GNKA 4I0RA 4XV3A 4L6QA 4TL0A 3MH1A 2BAJA 5HICA 3D14A 4CFXA 3ZDUA 3L8PA 5HLPA 5CU3A 3N4UA 5JFWA 3LFCA 2VRXA 3CXWA 4JDIA 4HJOA 3WYYA 3BYVA 2UV2A 1S9IA 5JFVA 1XO2B 2WMXA 2ZV8A 2XS0A 1G3NA 5FQDC 3GC7A 3UNJA 3WZUA 1ZMUA 4X3FC 2YIYA 1HCLA 1CSNA 1NVSA 3OCBA 4MH7A 5CEIA 2C68A 2BZHB 3AOXA 5DI1A 3QYWA 4JRVA 4CMOA 3OVVA 1S9JA 4P7EA 2HZNA 4I5CA 4DLJA 2WMWA 2XJ1A 2BDWA 3GC0A 3QCYA 1Y91A 4GVJA 5C03A 4BF2A 4BTMA 4F70A 3IKAA 4L44A 4OTIA 2VTJA 5LMKC 3NW7A 3LJ1A 3R1NA 4FZ7A 4DLIA 3ORNA 4ZSJA 3U6IA 2B9HA 2CGWA 1K3AA 5D11A 5DVRA 3UOKA 3MTLA 2VTOA 2PVFA 2ZM3A 4FZFB 5CF6A 5DBXA 2R3PA 3DBQA 4IJPA 1OM1A 3MGYA 4AE6A 5ETAA 3GU4A 4BTFA 4Z16A 5IUGA 4A9YA 2Y7JA 2NP8A 4E26A 4FNXA 3VS7A 3TUBA 4YTCA 5AV2A 4HPTE 3EQHA 4FL2A 4A06A 3FPMA 5G1XA 1PYXA 2QOOA 3QRTA 4A9UA 1KV1A 3KF4A 4HGTA 4IB1A 5AUXA 4D4SA 5DOSA 4C33A 4ZY5A 4G17A 3T8OA 2ZOQA 5ACBC 1XBCA 5M51A 3LMIA 2YFXA 4DCAA 2FSMX 3PJ8A 4HVIA 2R3GA 2RFNA 4BDFA 4EK5A 5A4QA 3V04A 3ID6C 3IONA 1JNKA 3ZSHA 3CPBA 5F9EA 1LEZA 3BBWA 5FTGA 2IJMA 3KF7A 1OL7A 3MFUA 2R3RA 4FV1A 4GCJA 4I6QA 4IZ7A 5CSXA 5DNRA 3VULA 4AP7A 1OUKA 2QOLA 1YWVA 4QP3A 2NPQA 4QYEA 5H9BA 4JDKA 1ATPE 3WI6A 4D5HA 5DWRA 4HGEA 2XNPA 3RHKA 3QA8A 5LCJA 2I0HA 4ZS4A 3Q60A 3W8LA 4YO6A 4RQVA 5BUIA 4FTRA 4RA4A 3QX2A 3WF5A 4AW1A 3IECA 3QRJA 3KK9A 4AZSA 4BZOA 3SXRA 3ZMMA 5B2LA 5I5ZA 3C7QA 1CDKA 3OXTA 4PNKA 2YM6A 1L3RE 5F20A 5BYZA 4Q5EA 3NSZA 5EQEA 2I0YA 3IK3A 2XM8A 2UW8A 4QMLA 3AXWA 4U80A 2OLCA 1SMHA 3JVSA 2UW9A 5M4FA 4S33A 4EBVA 2XH5A 3MW1A 2B55A 3KXZA 4I22A 2QG7A 2C6DA 5H2UA 2EU9A 2UW5A 5AP0A 5AV1A 3RALA 4RJ6A 5EI8A 3UYTA 4XLIA 5LXMA 3FI2A 1ZOGA 3KK8A 3LFQA 4W9WA 5LOHA 1YKRA 3C4EA 4I4FA 5IEYA 2XJ0A 3WILA 4MXZA 3I0OA 3UOLA 2WEIA 4ALVA 3IPHA 4R6VA 4BIDA 3F7ZA 4BWPA 4FIFA 3WZKA 4HCVA 2E9OA 4IAFA 4EH3A 4OAUC 3F5PA 4YNEA 3NNVA 4PDPA 4X3FA 4FKPA 5J87A 2YABA 1BL7A 1LPUA 4BB4A 4C61A 2ETMA 5IH4A 2KTYA 1OPKA 4EK3A 4K8AA 3QD4A 4CFWA 4CMUA 2RFDA 2YM4A 4JX3A 4G6NA 3MJ2A 4ANBA 2X0GA 4DCEA 2ERKA 3PRIA 5I9XA 4I41A 4O0SA 4IAAA 4KBCA 2ZDTA 5AEPA 2IN6A 3PA4A 4XBRA 3Q52A 3QD2B 3QKMA 4TWOA 3GUBA 5E4HA 4UN0C 2VTQA 4ZS0A 1PMEA 5HLWA 4H36A 1ZZLA 3GFWA 5M4UA 4NCTA 3BHTA 2PY3A 5AP7A 3AT4A 5A4TA 3NYNA 1OKZA 5A9UA 1WVXA 3G0FA 2GDOA 3DV3A 4BDCA 1O6YA 2WTWA 4JI9A 4O96A 1H25A 4ERKA 5IZFA 3CBLA 2YDKA 3D2IA 5CT0A 4EWQA 3HEGA 3QQUA 5HIBA 4O7ZA 4FV5A 2Y9QA 2ITVA 4Z9LA 2VWUA 4DEGA 5L8JA 2Y4IC 3A60A 3BEAA 1GAGA 4J71A 3DB6A 4PNIA 5JMSA 4GKIA 4FSYA 2X8DA 3G15A 1JVPP 2VTSA 3FZPA 4YPSA 3OY1A 3SX9A 3ULIA 1JKTA 1REJA 3ZO2A 4U9AA 3Q4UA 2JKKA 3A4OX 2B9IA 2FVDA 3MA6A 4FMQA 4YC6A 4IVDA 3PLAE 4H3BA 5CAUA 1H28A 4IM0A 5JT2A 4A07A 2JBPA 3UVQA 4EH9A 4EOJA 3M1SA 4HCUA 5J9LA 3FHIA 3ZO4A 2R3KA 3BGZA 3FKLA 3GBZA 1KE5A 4PPCA 4G2FA 1WBVA 4QYGA 5CANA 1J7LA 3VUTA 3QHRA 3ZFXA 4M12A 1LUFA 3GOPA 4CCUA 3ZEWA 4RSSA 4JX7A 3TNHA 4A4XA 4L46A 4XMOA 4DA5A 4UXQA 2UVZA 2AC5A 3C0GA 2OJ9A 3BQRA 4ANSA 3RAKA 4HVDA 1XH7A 2FB8A 4OTRA 1PYEA 3DA6A 3QWJA 3V6SA 1ZAOA 3EN6A 3QCQA 4II5A 3TWJA 4EOLA 3FZSA 2XNBA 3SW4A 4EKLA 3DAKA 1PW2A 3I5ZA 4NUSA 5C4LA 2YCQA 2EB3A 3AC4A 3QCXA 3LW0A 3O17A 4I1ZA 4KKGA 4DTKA 2PMIA 3Q04A 3SDJA 4AACA 1KV2A 4FNYA 5KMNA 1H4LA 3EL7A 4EQCA 4YC8A 5ANGA 2QOKA 3A62A 3CY2A 1OIQA 2WPAA 4RJ7A 5TF9A 4CGAA 2PZRA 2QOIA 4P2KA 3RINA 4W4WA 3ERKA 4GT4A 3VBVA 4JQ7A 2EVAA 4RC4A 1ZMWA 2Z2WA 3DT1A 3ZUUA 2BTRA 2ITWA 2WTVA 5JQ8A 4MXOA 3O96A 3DGKA 5M08A 1U54A 2BHEA 2PZIA 3W2QA 4XG6A 1L8TA 3V5PA 4JBQA 4Y46A 3UMWA 4DGLC 2IPXA 1H00A 1J1CA 5E8YA 3BZ3A 4B0GA 5AR7A 3GCUA 4A4LA 1GJOA 2Y4PA 2RFSA 4FV0A 3RVGA 4KINA 4XG4A 5FEDA 4AN3A 4ANOA 3U4WA 4DF3A 4KIOA 3HA6A 3NAYA 4FV4A 4XV1A 5DN3A 5FLFA 4D9TA 1VR2A 4EUTA 3SLSA 1UU7A 3GU6A 2O2UA 2J0MB 4L7SA 4XUFA 3ETAA 2GNFA 3C9WA 3EL8A 4JDJA 4M14A 2G9XA 4V05A 1UNLA 3BHHA 5E1SA 4C59A 4XJ0A 4O0YA 3KFAA 4BCHA 4KUJA 3FXZA 1H1RA 3BE9A 2WGJA 3HKOA 4O0UA 5AR8A 2NNWB 3OROA 1IG1A 5T6KA 3BLRA 4C36A 4AFJA 1V1KA 3LCDA 5J5SA 3UO5A 4FSRA 2OXXA 5IH6A 3BWFA 4I5HA 2WU7A 4QMWA 2XIXA 3NGAA 4DEIA 3EWHA 3FBVA 3BHVA 3LM5A 5AR2A 4AOTA 5JH6A 5M53A 5FGKA 2WEVA 4BCKA 5IA0A 3LCSA 1EH4A 2YLFA 2I1MA 1JSVA 4FYNA 2CGUA 3P4KA 4GJ2A 4QTAA 1OIUA 3ALNA 2PE0A 1ZY5A 3E64A 3ZC6A 4NL0A 2UZEA 5CZHA 5CEOA 1H1SA 4GW8A 4CT2A 5KNJA 5DT4A 4AZVA 4DFXE 5HG7A 5E90A 3UP2A 4F09A 4X21A 3COKA 5HLNA 4FSUA 4BBMA 2EXEA 1UKHA 4FL1A 4QP2A 4IVCA 3Q3BA 3UQCA 3FSKA 1ZMVA 2BFYA 3FAAA 2QG5A 3A61A 3MTFA 3OY3A 4N0SA 2QVSE 4WHZA 4ZP5A 5L2QA 1XJDA 4RWIA 2HXLA 5EG3A 2CHLA 4NM7A 4FIIA 1LR4A 1R1WA 4U3ZA 5FM2A 3CD3A 4B99A 4MQ2A 4I0SA 2GNGA 2PVKA 1OECA 4A9RA 4EH4A 4RLKA 3R8PA 5J9YA 3RM7A 3UIBA 4RRVA 2X6DA 3F9NA 4YURA 5HTCA 2WAJA 5DLSA 1QPEA 3E3BX 5J95A 2XYUA 3QTXA 3COIA 3LXLA 3P79A 4KKEA 2X9FA 5T3QA 4MBLA 3ZRLA 1OPLA 4MBJA 5CAOA 3F2AA 4XRJA 5EOBA 4FEWA 3EJ1A 4KAOA 2DYLA 1RDQE 3PG1A 3UIUA 2PZ5A 5HEZA 3AC1A 4KSPA 4IB5A 4U44A 3HDNA 4XG8A 3RHXA 2JAVA 2P3GX 4YJTA 3MESA 3Q5ZA 2W1EA 4E4XA 4NM3A 1YVJA 5EK7A 4RX9A 4UYNA 4MWHA 4WKQA 3R00A 4D4RA 3CY3A 3P5KA 4GG5A 4MAOA 2XIRA 2A4LA 3UJGA 2OI4X 3ANRA 4ZTLA 4ITJA 3F3WA 4ZZMA 3E3PA 5K5NA 5CYIA 4B4LA 1M2RA 4BDKA 4FTMA 3DLSA 4D0WA 3MFTA 3Q6UA 5HBHA 4QOXA 3BYOA 3WIKA 4FE2A 4O7RA 2UW0A 4LMUA 1KE9A 2PZPA 5E7RA 2FGIA 3OXIA 4K11A 4RVTA 3V3VA 4AT3A 4APPA 5K9IA 4GK2A 3LOKA 4IAYA 3DXNA 5JGDA 3BCEA 3LFAA 3FQEA 4RG0A 1TQIA 1WCCA 4FG7A 4MX9A 4RFYA 2XIZA 4BGHA 4BWXA 5HX8A 3ACKA 3CEKA 4R1VA 5D10A 4ZK5A 3KY2A 2PWLA 3HVCA 4D1ZA 3A4PA 2PHKA 4IZYA 4ZZOA 4ID7A 2ZDUA 4RGJA 2UZUE 4DINA 3N9XA 3NNXA 3RPOA 4W8DA 4RIWB 3EB0A 4IX5A 3DNDA 2WZJA 5AUZA 3RNIA 4QMUA 2LGCA 4IZ5A 4MVFA 2BROA 5JZJA 3BLHA 4MXAA 3MB7A 3VAPA 5GZ9A 2W06A 5IEVA 2CJMA 1U4DA 3EH9A 4H3QA 1OI9A 3NZ0A 1Y57A 4FYOA 2C6OA 2OF4A 4YJRA 4O0VA 3Q4TA 3KVXA 4JG7A 4MKCA 3O51A 2X81A 3F5GA 3O7LB 3BGPA 4FT5A 4K77A 3FWQA 3KRRA 4D2PA 5KX8A 2IW9A 5IQFA 2XNMA 5BQ0A 4MD7E 2X4ZA 4HW7A 1K9AA 3FY0A 1JQHA 2JKQA 3ZSIA 2BRHA 5FUTA 2RL5A 1QCFA 1WBPA 2UW7A 2V0DA 2XB7A 3D0EA 3DKFA 4WNPA 3CTHA 4FIJA 4GT5A 4A9SA 4KS7A 3VBXA 1RE8A 3OBJA 5A4CA 2W4OA 5A4LA 4HOKA 5L4QA 4J95A 2WB8A 4IQ6A 2F7EE 4EZ3A 3PDTA 4C2VA 2ITTA 4F6WA 4O7NA 4Z7HA 4WSQA 2YDJA 1JOWB 2V55A 4JL9A 3D7ZA 1QL6A 2X2MA 4MD9E 4O1OA 3TN8A 4AZWA 3KC3A 3VW6A 1RW8A 3O8UA 4IDVA 2XK6A 2YHVA 2YM3A 4MYGA 4M66A 5F94A 2J0JA 3PPZA 2IW8A 4RFZA 2YDIA 5DEWA 4O0XA 2PMOX 3LMHA 3JYAA 2BIKB 4FC0A 4FV2A 1IASA 4K1BA 4O7VA 5AADA 4I4EA 5F1ZA 3CS9A 3BU3A 1J7IA 1B38A 4FSMA 4XG3A 3JUHA 2GSFA 2HXQA 2E9UA 3E92A 3W18A 5CALA 2B54A 3NUAA 4C3RA 3DBCA 4FX3A 5IPJA 2GTMA 3FMEA 3PSBA 4LUEA 5A14A 4NIFA 4O21A 1IAHA 2Y6MA 2Q83A 3UZRA 4XV9A 2YERA 4PY1A 4C2WA 4CQEA 2W7XA 5BMMA 3ZO1A 2PUNA 3Q32A 2GQSA 4LGHA 5I4NA 4N57A 3LPBA 3GC8A 3LJ2A 4R3PA 3F82A 3ODZX 4Y85A 5DR6A 2C5YA 4DH8A 4O1PA 2GMXA 3E87A 3LFSA 3R2BA 1UU3A 5CQUA 2OJFE 1IAJA 4F1OA 5K0KA 4M15A 5K0XA 5I9WA 3QRUA 4KIKA 5L3AA 3CLYA 4EHGA 2DWBA 2GHGA 4G31A 4JG8A 4FBXA 4IFCA 2HENA 3QCSA 4FODA 3BPRA 3DPKA 1M17A 2JEDA 1BYGA 4BCMA 4IAZA 4IZAA 4ZJIA 5H8GA 3GQLA 1OL5A 4R1YA 3UVPA 4EWHA 2UZTA 3VC4A 1BUHA 3BV3A 3TNWA 3ZZWA 1A48A 3CQWA 5AM7A 4AZEA 4FTTA 4LG4A 5H8EA 1GIHA 2ZM1A 3CQUA 3R8LA 5CF8A 3L9NA 4UBAA 3CKXA 3LM0A 1HCKA 4FTJA 4QYFA 3H4JA 5TE0A 4DEDA 5KHXA 3NIZA 3ZLSA 4IAKA 3PE2A 2ITUA 3BI6A 5CF4A 2CNQA 1F5QA 3THBA 2VV9A 4UYAA 5EYDA 2YWVA 4C4EA 4NIFB 3PIYA 2VN9A 4AA0A 3TV7A 1OGUA 3NUPA 3W8QA 4Y95A 4EOMA 1W83A 3DFCB 3NEWA 3NUYA 2ITZA 5AUYA 4BCIA 2GHLA 4GT3A 2GQGA 4FKVA 2YISA 4I3ZA 4XP0A 5AP5A 3HRBA 5KMIA 4H05A 2X6EA 3QTWA 4E6AA 4G34A 5CEMA 4UZHA 5GIOE 3HX4A 5CLPA 4YC3A 3CC6A 3OWPA 2C1BA 2Q0NA 3VS4A 3PJ1A 3OUKA 5J1VA 1Q3WA 3U8WA 2PTKA 4WUAA 2WKMA 1O6LA 3GEQA 4UZDA 5IUIA 4N6YA 2UUEA 5ANJA 2QOFA 5EYCA 3VIDA 3I0QA 3RAWA 3HMIA 4I0TA 1YHVA 2O3PA 3IGGA 3R02A 3BHUA 3FJQE 3NYOA 3ZSGA 2W1ZA 2PVRA 4LRMA 4LFIA 4ORKA 4LOQA 4S32A 4XG2A 4YZ9A 3RCDA 4H39A 5A6NA 4EH8A 4M69A 4TTHB 3WF9A 1PXJA 2J51A 2W1CA 5KUPA 4E20A 3O23A 5K3YA 4WG4A 4JQEA 3HMPA 3T9TA 3U51A 5AUUA 4DG2E 3H0YA 2B4SB 4MBIA 5EI6A 3ORMA 3B8RA 3E8EA 1R39A 3UGCA 5HG5A 2HAKA 3WBLA 2VGOA 2OH4A 1XKKA 3DBFA 1GOLA 3T9IA 3TG1A 3PG3A 4K0YA 4QP7A 2R3HA 1WBSA 5IG1A 3EN4A 3PY3A 4QMYA 4DN5A 5M57A 4YTFA 4JNWA 1B6CB 4GYIA 4JS8A 4M68A 4ZTRA 4BCOA 4QP8A 3QX4A 5LQFA 5M4IA 5I0BA 1XBAA 2VTPA 4Q9ZA 3FY2A 5CSVA 3QF9A 5HI2A 3OWJA 3F5XA 1ERKA 4J8NA 5GZAA 4FNWA 4W9XA 3ZO3A 5LMBA 4K6ZA 3UZTA 3K54A 4ZMFA 4RVMA 1LP4A 4BCQA 4C35A 2WMAA 3HV6A 4LOOA 3VF9A 3IW8A 4USFA 4KABA 3DKCA 5L2IA 2JIIA 2UZWE 1ND4A 4O84A 4BRXA 3HV7A 1Q97A 1WVWA 4EUUA 4GRBA 3VWAA 1Q24A 2HYYA 4XG9A 2XEZA 2QOCA 4BN1A 4XLVA 3NVKI 5M06A 4BFMA 5AAFA 2HZ4A 4OTWA 5AUWA 2WMQA 2O0UA 3REPA 3EHAA 5A3XA 4BDBA 5KMLA 3PVBA 3C0HA 3S00A 2SRCA 4L00A 1JKSA 1YI3A 5CU0A 3QWKA 3TKIA 4DBXA 1PKDA 1GY3A 3D4QA 4O6LA 3VF8A 4DTAA 1R0EA 3AMYA 3OTVA 1TVOA 3R83A 1IA8A 3MV5A 2PYWA 3O50A 3OMVA 2XNNA 1Q61A 3POZA 4MNEA 4YBKA 4E5WA 3SG9A 4DT9A 4GG7A 4KIKB 3Q4CA 4RIXB 4AXAA 2I6LA 4AGDA 3PJCA 4Q9SA 3KN5A 3PVGA 4XOZA 3B2TA 4IEBA 4XP2A 5CNOA 3DCVA 5DR9A 4FZ6A 2J5EA 4IC8A 3QZFA 3FC2A 4RWJA 4B9DA 1R78A 4L68A 2VAGA 3V5JA 3QZHA 3ZBFA 4BWKA 2QR7A 4X2JA 5B2KA 4DAWA 4FTCA 2VWWA 4MTAA 1CKJA 4IX3A 4J96A 5AP4A 5A46A 1GNGA 2C6KA 1JBPE 5DRDA 5IDNA 2YEXA 3HYHA 4YP8A 5I9VA 4FR4A 4F9AA 4DFBA 5FBOA 5EM8A 1OL1A 2VTNA 1KOBA 2CNVA 3QQFA 4G9RA 3WIGA 3MFRA 4DFZE 2C0TA 3E8DA 4OAVB 3LKMA 1ZZ2A 3BU5A 3KEXA 1V0OA 4D1XA 4IACA 3V5TA 3FXWA 3FMLA 4CTBA 3RMFA 3DBDA 4FV6A 1FVRA 2WIHA 3LLTA 3TIYA 5I9ZA 2R64A 2C3LA 3D15A 1MRVA 3QQKA 2HWPA 3LXKA 4AWIA 2CDZA 4G1WA 4IB0A 3TZ7A 3H0ZA 4PDOA 3UOHA 4EH2A 3KQ7A 4Y8DA 3GP0A 4RA5A 4G5JA 3LE6A 3PIZA 2OXDA 4I92A 4OTHA 3FXXA 3MH0A 4CYIA 3KB7A 3VS3A 3LXNA 4EOKA 3KULB 4ZTNA 4DHFA 3IO7A 2YA9A 4BTKA 5JRSA 3I60A 4APCA 3U9NA 2PPQA 1PF8A 4AGWA 5DYJA 2ZMCA 4O7YA 4K2RA 4JBVA 3HGKA 4KKHA 4XP3A 4ZY6A 2BHHA 3FC1X 4CXAA 3A7IA 3NVMB 2R3IA 3KRXA 4C7TA 3TUDA 3P7CA 4FKWA 4U79A 2QR8A 2G15A 2G2HA 4ANLA 2VWVA 3M11A 4ZXTA 2P4IA 4EK4A 4QP9A 2GPHA 4F9CA 3ALOA 4W4VA 5IA3A 2IZTA 2PZYA 5FM3A 2ZVAA 2CKEA 4QMXA 4EZ7A 1UNGA 1WMKA 2V62A 2VTRA 2BALA 4DFNA 4FVQA 4R78A 3FLSA 2C5XA 4FKRA 3DTWA 3OD6X 4D2SA 5HG8A 4YJNA 3FLNC 2UZLA 3CR0A 2OJGA 3R9NA 2VO3A 2ZV9A 4E4NA 4UEUA 3VW8A 2B52A 4ZEGA 4GU6A 4EH6A 2C3JA 5ICPA 3R1SA 4UXLA 4F65A 2XBJA 3C50A 3R7GA 1SNXA 3OG7A 5IMEA 1SNUA 2X7OA 4RWLA 3UO6A 1H1PA 3D94A 3QUPA 4GK4A 3UZPA 1Z9XA 3RTPA 4U0IA 3U6HA 1MRUA 3JPVA 1H08A 1W8CA 2BCJA 1V0BA 2J4ZA 3L9LA 3OCSA 4JR3A 2PMLX 3A8WA 3NUUA 1H0VA 1ZY4A 3PE1A 2J5FA 4YHTA 3ORTA 4XHKB 5FDPA 1Y8YA 2UZOA 3CJFA 3GGFA 3ORIA 4W4XA 4UMPA 4C57A 4ZZNA 2NRYA 5C9CA 2A0CX 1FVTA 3FZOA 3QA0A 3SD0A 3CPCA 4IB3A 3TV6A 3ZU7A 2PUPA 3R8MA 5IU2A 1OKVA 1YQJA 3LJ0A 1P4FA 2CLQA 2JDOA 4PP9A 5CU4A 3ZLXA 3M2WA 4BDJA 4JQ8A 5G6VA 4FTOA 3ZTXA 4EOQA 3HL7A 3HUBA 3GT8A 4YO4A 4QQ5A 1HOWA 3QGYA 3U6JA 2R7BA 3MPTA 4QO9A 4E7WA 4KBAA 5AP2A 5K4IA 4FV9A 2C0OA 3HZTA 5EHLA 3DZQA 4CLJA 3DQXA 3VUDA 3V6RA 2W5AA 3V5LA 4DYMA 2CCIA 4P5ZA 4RFMA 1T46A 3AT3A 4WIHA 5JRQA 1LEWA 4O0RA 2CCHA 3E8CA 5GHVA 4DE4A 2OZOA 4Z7GA 2J2IB 3AD5A 5AAGA 4CFUA 5ANIA 2W05A 2XK8A 2G01A 4IM3A 2BZKB 5BVWA 3KCFA 5IA1A 5FP6A 3JVRA 1Q8YA 1PXIA 3A7JA 2F7XE 3DTCA 4R7BA 3DJ7A 4FTIA 4X2GA 5BYLA 3BX5A 1TQMA 4OBQA 3BHYA 4FT0A 4IANA 4CFFA 1ZOHA 3MJ1A 2DUVA 1G8AA 4JXFA 3S95A 3BGQA 1PXPA 3POOA 3MIYA 2FYSA 2Y0AA 4L67A 3KREA 1QPJA 4QMTA 3T3UA 4E4MA 1M7NA 1FVVA 4V0GB 1GZOA 2C6EA 2Q0BA 4S2ZA 3FLWA 3BYSA 3LFBA 3OW4A 4EHEA 3D5VA 2OZAB 5JFSA 5BYYA 4PDSA 1P5EA 3OC1A 4I94A 3KXHA 4LI5A 4AU8A 3RBWA 2CKQA 4NWMA 2C6IA 2YZLA 4P90A 3ZUVA 1YWNA 4L3JA 3LFFA 4TT7A 3H9RA 3VO3A 4BBEA 4RIWA 5FG8A 5JN2A 4UMRA 1J3HA 4YZBA 4ZLZA 2YCSA 3KMUA 5CS6A 1YXVA 2NRUA 3AMAA 3EIDA 3F3UA 1KWPA 2QU6A 3P78A 2QLQA 4RC2A 4NW5A 3Q9WA 5CU6A 3U4UA 2C5NA 4X7QA 2C3KA 3SXFA 5L2SA 3Q9ZA 3R9DA 2F57A 4IDTA 2HIWA 4NTSA 3QTSA 3QQJA 4P4CA 1E9HA 2EXMA 5CI6A 3FHRA 5KHWA 2JD5A 5HZNA 2H96A 1YXXA 2F7ZE 5HESA 4NYEA 5GZ8A 3CTQA 3PP1A 1NXKA 4YLLA 3R7OA 5CSHA 3ZH8A 4NTTA 4FK6A 2CPKE 2W1GA 2WTKB 2HY81 4FV8A 5BVOA 4O2PA 3VS2A 2V22A 4E3CA 4JBPA 5EDQA 1XBBA 5HIDA 3ATSA 4TXCA 5EH0A 1MRYA 4I6BA 3UMXA 3FI4A 4WBOA 3DY7A 3PVUA 1Q8UA 4AF3A 4ANQA 5CX9A 2NO3A 2WMUA 4D5KA 4C3PA 4DH7A 1H0WA 3ENHA 2XNGA 2A2AA 3QTRA 4LOPA 4WG3A 3R8UA 3Q2MA 2R9SA 3UPXA 2P0CA 4FKGA 3D83A 1WZYA 3R9HA 3UQGA 4XS2A 4R5YA 4WA9A 4H1JA 5EM5A 4F1MA 3TDVA 4EH7A 4QQJA 2ZM4A 4XYFA 2J90A 5E9EA 2R3MA 4IE9A 4XV2A 2AC3A 3AD6A 3WZEA 3FSFA 3ZDIA 1YI4A 4QYHA 3AGLA 4R8QA 1YOJA 2E9VA 3RK5A 3VBYA 3ODYX 2FSOX 5IISA 4FV3A 4M3QA 5LVMA 2F4JA 4O7TA 1CM8A 3S3IA 3RNYA 3KMMA 4FTNA 2XMYA 4D2VA 3CTJA 4GVAA 4C3FA 4F9WA 3FMHA 2PE1A 5TR6A 4BICA 5KMOA 3VS1A 3N4TA 4E4LA 4UMUA 4RX8A 2ITOA 2J0KA 4BGQA 4AFEA 2HOGA 4LGDA 4QTDA 4BDAA 2R3OA 2VO6A 4R77A 3I1AA 2C0IA 3AT2A 4TYIA 3DJ5A 3L8XA 3UVRA 4EKKA 3D5UA 4IWDA 5EI2A 5HIEA 3EMGA 4WO5A 5AR4A 1OMWA 3RCJA 3FMDA 2R3JA 3DKGA 4EHZA 4ENYA 2EWAA 1XH8A 2OIBA 4A9TA 2YJRA 3IDBA 1WBTA 1YHSA 2OU7A 2RG6A 2FSTX 3ET7A 5CEPA 2R0IA 2J6MA 4PTEA 4O38A 3NLBA 3QD3A 3N51A 4JLCA 2WMRA 4KBKA 3R22A 3VS0A 4KB8A 1IR3A 1Z5MA 2HELA 2R3QA 4IH8A 1JWHA 3LQ8A 4ITIA 4UWYA 3HV5A 3II5A 3PPJA 3ACJA 4BY9E 4ZTQA 1KSWA 2EXCX 4NSTA 3D5WA 4DTBA 4PMSA 3R8ZA 4DEBA 4O83A 3MY5A 5HORA 1AQ1A 2VWYA 3GCPA 3I4BA 4RIXA 4KIPA 4CT1A 4C02A 4E5AX 5JKGA 3TIZA 4E6DA 2VWZA 3WE4A 4KIQA 4S34A 4CV8A 4FSZA 5HO6A 4AN2A 3NCGA 2VTTA 4S30A 4QMNA 3EN9A 3LAUA 2OG8A 3SG8A 4OTFA 5BVFA 5JEBA 2X9EA 5L6WL 2B53A 3PFQA 1QPDA 1U46A 5CVGA 1ZYDA 4D0XA 4I24A 3FEGA 1W98A 4U43A 1CKPA 3QQGA 4IWQA 3TT0A 4D58A 2R5TA 2C69A 4QMSA 2GS7A 5IDPA 4L9IA 5CXZA 4TWPA 4AUAA 3NW5A 3V5WA 2IZRA 4ANNA 3PLSA 3OOGA 4PL4A 5ANDA 5J8IA 2GNJA 2R3NA 1PY5A 3BE2A 2RF9A 5CWZA 1PXMA 3HUCA 5CASA 3RP9A 2XP2A 1YWRA 3ZEPA 4F6UA 3UODA 2AUHA 2W1IA 2W17A 3OS3A 5AAEA 3CGOA 5EM7A 3C4FA 4CFMA 4F63A 3GXLA 4TYHB 4CYJA 4FA2A 2JDRA 4KRCA 2XRWA 3UDBA 2PULA 4AX8A 5FP5A 2OZAA 4CFNA 1O9UA 3PIXA 5LARA 5AUVA 5L6OA 4IX6A 5FXRA 4EOOA 5M4CA 3OWLA 4QMMA 5LWNA 3TM0A 3OZ6A 4MCVA 2QCSA 3O8TA 1E1VA 2FO0A 3HV3A 2FUMA 3I6UA 3W2CA 2BRNA 4U8ZA 3MA3A 3CKWA 5JSMA 3R21A 5HVJA 4O91A 2PUUA 3VS5A 3A7HA 1YXTA 4R5SA 2J9MA 3FMNA 1NW1A 3F3ZA 3EN5A 1F3MC 2VO7A 3RPYA 3TACA 5EQPA 4R3CA 3SV0A 3VNTA 2WTIA 3DDPA 4DG0E 4GYGA 2C3IB 4CV9A 2WMSA 5H3QA 3K5UA 5IQCA 3ORPA 1KE6A 4IXPA 1ZYLA 4MWIA 2O5KA 4U7ZA 3P7AA 1CTPE 2R0UA 5DRBA 1FMOE 4TN6A 3CGFA 5EM6A 4L01A 3SHEA 2YJSA 4TYEA 3B2WA 3W16A 4F1TA 2GS6A 3PYYA 3QQHA 3RWPA 1A9UA 1PMUA 4QMVA 5TKDA 3VHKA 4CKRA 5IH5A 4J1RA 4MXXA 2ERZE 3LFNA 4OTQA 4ZOGA 4BYIA 3COHA 4YZCA 5BVEA 1FOTA 2I40A 4RIYA 4DEHA 3KXXA 3GCVA 3VUHA 3U87A 4C4IA 4ZLOA 1Q3DA 3F66A 4RX7A 1UWHA 4ENXA 2OFUA 3G5DA 2B0QA 4HPUE 5J5TA 3AMBA 5HO8A 4BVUA 4EOIA 2YLEA 5CF5A 4TRLA 5TOZA 2WOTA 4ZJJA 1YOLA 2BRMA 3QHWA 1YOMA 4RVLA 3OUNB 4YHJA 5A4EA 3R1QA 3WOWA 5IQDA 5DT0A 3W10A 3ORLA 5BUJA 3UP7A 2FH9A 4CEGA 5C26A 2XKDA 3EQPA 3QKKA 1SVEA 3H10A 5DPVA 3C0IA 3QL8A 4M69B 2X2LA 4FUYA 2GTNA 3TZ8A 2YIXA 4N6ZA 5ANOA 5GINE 4XX9A 4O22A 3D2KA 3PSDA 4L52A 5IF1A 5DG5A 5IEXA 2BKKA 3FI3A 3OF0A 2JC6A 3DDQA 2G2FA 3DU8A 4BCNA 5HU3A 4TW9A 4QMOA 3D5XA 4U5JA 4I21A 5C01A 3VRZA 5FTOA 5CAVA 2ZYBA 3EQBA 4NCTC 3OFMA 1JLUE 5CEKA 4QP6A 5K5XA 4DT8A 4YBJA 1NY3A 1W82A 5EW3A 4J7BA 4HVSA 5GJGA 3KU2A 5C27A 4BHNA 2QOBA 3UG2A 4O0WA 5AFVA 3WYXA 3QLGA 3MPAA 5LMKA 3HRCA 2JDTA 3OCGA 3OCTA 3ENMA 4M97A 5ETIA 4YSMA 2VU3A 5HE0A 1BI7A 1PJKA 2G2IA 3R6XA 4FSNA 4QTBA 3NYVA 3W2SA 3ZCLA 3OW3A 2HW7A 2F2CB 3E7VA 4C37A 5AIKA 3GFEA 3WE8A 1CMKE 4YJOA 3MB6A 2I0EA 5EKOA 4DH5A 3VQUA 2A19B 4ZMEA 3PUPA 5IA2A 4JG6A 5EDPA 1G5SA 4BCFA 1DAWA 3M42A 4O0TA 4JOAA 2BZJA 2WTDA 3R7UA 4I23A 4PMTA 3EQIA 4QMQA 2XK4A 3HP2A 3QXPA 4ASEA 2Z7SA 3KULA 3DBEA 2H34A 2GFSA 4J97A 3E62A 4RQKA 3HAMA 3UIXA 5J9ZA 2QHMA 2W99B 3MWUA 5L8LA 1PHKA 2CMWA 2ZV2A 4RMZA 2VWBA 5F95A 5HTBA 5HE2A 2VNYA 3SRVA 1VYZA 5L2TA 3P08A 4FKSA 2A1AB 4BI0A 4BI2A 4CVAA 3TDWA 2C4GA 4WBBB 3E88A 5DE2A 2QO9A 3EYGA 4PTGA 5HD7A 2WIPA 5D41A 3W2PA 3KRWA 4OGRA 4TNDA 3NUNA 3R9RA 4FEXA 3ZRMA 3RPRA 3AD4A 3VS6A 2C6LA 3D7TA 3PPKA 3QALE 3EFWA 1YXUA 4JVGA 4OTGA 4FT7A 2HZIA 5IQAA 2XRUA 4EK6A 1Z57A 5EDRA 3VVHA 2YM7A 2UW3A 1P14A 1Q62A 4EC8A 3DXPA 2UZNA 3I5NA 5HGIA 4OT5A 3IG7A 3UYSA 4ACGA 1OVEA 4OTDA 3KXMA 3Q9XA 3AC2A 2W9ZB 3R7YA 4CZYB 1RJBA 3EKKA 3NS9A 4FVRA 3TUCA 2RG5A 4BTJA 2HK5A 4NFNA 2CN5A 4RZWA 3UC4A 1J7UA 2QONA 2YN8A 3EQFA 3NCZA 3ZBXA 2P2IA 5CVHA 4IIRA 3TJCA 2F49A 3GCQA 4TWCA 4DH1A 3L8SA 3VN9A 2ZJWA 3DB8A 3S0OA 3QD0A 2FSLX 5CQWA 3NAXA 5IQGA 3LVPA 3PJ3A 4PDYA 2VX1A 3HA8A 4U41A 4L8MA 5E91A 3GVUA 4E93A 2JKOA 3UE4A 2RGPA 4JDHA 5C1QB 1VEBA 2R3LA 3EKNA 4M7IA 4MQ1A 2PVYA 5EFQA 3QTZA 5LMAA 4NK9A 3LCKA 3EQCA 4O6EA 4BGGA 2QD9A 5JFXA 2WNTA 1SM2A 2XK9A 4MD8E 3V8SA 5M56A 3E93A 5I9YA 3ZM9A 4FKJA 1JKKA 5I3OA 2OFVA 2P2HA 4RLLA 4OW8A 4DFLA 5C8MA 1Y6BA 4K18A 3BYMA 4WRGA 3RK7A 3DKOA 1OITA 2IW6A 4B8LA 2QKWB 2X7FA 5CTPA 3FKNA 5D12A 1E1XA 3R30A 4CCBA 1UU8A 1ZLTA 3DXQA 4ACHA 3CQEA 3FL5A 4FZDB 3TKUA 4GKHA 5HOAA 2JAMA 3ZFMA 5L8KA 3G9LX 3QBNA 4L3LA 1BKXA 3LHJA 4RIOA 1YRPA 2PVLA 2DQ7X 3IS5A 5HCXA 1PMNA 3RM6A 4UB7A 1BI8A 4MF1A 4AW0A 4DGNA 5J1WA 2GQRA 3C4XA 2ZMDA 2B1PA 4HNFA 3NUSA 3I79A 4JIAA 3JY0A 4EJ7A 1R3CA 3P23A 2JIUA 1WBWA 4LMNA 5CVFA 2VX0A 4KSQA 4Y5HA 4G3DA 5HNIX 3GU8A 5FD2A 4E1ZA 5HO7A 2VD5A 4YHFA 1XH5A 2C30A 4ZTMA 4JAIA 3VJNA 3ZM4A 2VTLA 3FYJX 4Y83A 2YZAA 4AQCA 3V01A 3VUGA 3R0TA 4E6QA 5BX0A 4R7HA 4WUNA 3QZGA 4GFMA 1PRYA 1BMKA 5ITAA 5AV3A 5KO1A 3FMMA 5AR5A 2JFMA 3CJGA 3NNWA 3LCTA 4GL9A 3HAVA 4ZAUA 5KMKA 4RVKA 4NT4A 4ACDA 1PXOA 2WTCA 3BWJA 3FYKX 3GQIA 4GIHA 1URCA 2JDVA 2QC6A 3HRFA 3GNIB 3F3VA 4M67A 4TNBA 3SVVA 5ANEA 3LMGA 1IEPA 4LRJA 4I5PA 4UWBA 5AR3A 3PXFA 2ZB1A 2GNHA 3MVLA 5AUTA 1FINA 2IG7A 5D7VA 5DGZA 1BLXA 5AMNA 4QT1A 4LV8A 4D2TA 3TJDA 1FBNA 1OUYA 3LZBA 3QLFA 4MEDA 4FEUA 4L43A 4CSVA 5KBQA 3LQ5A 4PRJA 3FKOA 4IVBA 3BIZA 3E8NA 3MH2A 2WQOA 3MBLA 4JRNA 4CG8A 4GUEA 3ZOSA 2W96B 4HZRA 4FKUA 4BR3A 4DH3A 4ALUA 4FVPA 5T68A 3GOKA 3IW5A 4TYJA 4A7CA 5CT7A 1XH6A 5HVKA 4BDHA 3C4ZA 3L8VA 3WZJA 4D4YA 4PWNA 5D9HA 1MQBA 4XBUA 3S4QA 1H8FA 5I9UA 4DGMA 4G3CA 1DAYA 2E9PA 2G1TA 2H8HA 3C51A 5A6OA 5L2WA 3SGCA 2X8IA 3SC1A 4YPDA 3KKVA 5HE3A 4EI4A 4G3FA 3R7EA 3MVHA 4JBOA 4IFGA 4A4OA 1CKIA 3QRKA 4L45A 4PP7A 5ANKA 3Q2JA 4U97A 2ACXA 2VO0A 3MS9A 5CSPA 4N70A 5HNGA 3F5UA 4Y5QA 4YMJA 1VZOA 2X8EA 3AC5A 4FEQA 1NVRA 2XZSA 3RPSA 3RAHA 4K9YA 3TTJA 4AS0A 4C0TA 2BTSA 3V51A 1WBOA 4MNEB 4RC3A 2LAVA 4GV1A 1UU9A 2GU8A 4QNYA 5E8SA 3R1YA 3R9OA 4HGLA 4X6RA 3KVWA 5BUEA 1U59A 5L6PA 2OJIA 4LUDA 3KXGA 4NJ3A 4WNMA 2YWPA 5AA9A 3BLQA 2RSVA 3WF7A 4RX5A 2VX3A 3FZ1A 4LV5A 4NEUA 4NM0A 3COMA 3K3JA 3PZEA 4BKJA 5CEQA 2ONLC 3P0MA 2J0LA 4HYSA 3FZTA 3KL8A 5AP3A 3IOPA 5JK3A 4FIHA 1QMZA 4OTPA 5ETCA 2E2BA 2XK3A 4BZNA 4FIGA 3ZLYA 3ANQA 3PVWA 4M0YA 1OZ1A 2FA2A 3VHEA 4CZTA 4WT6A 5AIRA 1OIYA 4U6RA 3FLYA 1OIRA 5J7HA 2R4BA 5HHWA 3OXZA 1PXKA 1Y6AA 1DM2A 2HWOA 4Q5HA 4F4PA 1M7QA 5HG9A 5E8ZA 3IDPA 3EZVA 3WF6A 4F0GA 4FKIA 3W2RA 4RJ5A 4Z55A 3H9FA 3FQSA 5AA8A 2QLUA 1GZ8A 1Q8WA 2VZ6A 1GZKA 4NW6A 4FGRA 3VQHA 3A2CA 2ETRA 2PVJA 4UALA 4ZSAA 4RT7A 3SAYA 5LCKA 2XA4A 1OL6A 3NPCA 4FKQA 2ITNA 4QRCA 4USEA 4U45A 4EORA 4G5PA 4YNOA 1FQ1B 2UW6A 3PA5A 4O82A 3GI3A 3DFAA 3F2RA 3NX8A 3ROCA 4CRLA 4BDGA 2HW6A 1H1QA 1UVRA 4AA4A 4F0FA 4CKJA 4MF0A 5CAQA 4L3PA 2OH0E 1Q5KA 3LFEA 5FTQA 3V8TA 4E5BA 3VBTA 3N4VA 5C8NA 3PA3A 3C5IA 2YM8A 3W55A 1SVGA 2HZ0A 4FKLA 3UNZA 4QTEA 3HLLA 2Y4IB 1BX6A 4XRLA 4CNHA 1APME 5CZIA 3IW6A 3FE3A 2W4KA 1JSUA 2UVXA 3FUPA 4RBLA 2XVDA 2IZSA 1H26A 2XNEA 2A27A 3NDMA 5AJQA 5FBNC 4H3PA 4IX4A 4E73A 4ITHA 4EL9A 3R2YA 2VUWA 2EB2A 3PWYA 3IDCA 4YJUA 3T3VA 4B6LA 1OB3A 2JITA 2C6MA 4YJPA 4C4FA 5DHJA 2QURA 2AYPA 5DT3A 2GNIA 4QP1A 4TY1A 4BI1A 2W1FA 3SA0A 4RJ4A 4KRDA 1YDTE 4C4GA 5DA3A 3R01A 3QC4A 4KWPA 4XOYA 2BAQA 2XIKA 4BL1A 1OKWA 3SW7A 3NR9A 2GS2A 5E8WA 2JFLA 4UMTA 2REIA 2X1NA 2WMTA 4YLKA 3VJOA 2HCKA 4AOJA 5E8XA 2IVVA 2ZAZA 2CKOA 4WSYA 2OF2A 3P7BA 4OUCA 3G90X 3TI1A 4ONAA 4QPSA 4CG9A 4BIBA 2I0VA 3A8XA 4FI1A 1H1WA 1M2PA 4L42A 4FTUA 4MHAA 1XR1A 4PQNA 2WTJA 4USDA 4ERWA 4F7SA 4UX9A 2C5VA 4R7IA 2V7AA 3KRJA 4FTKA 2ETKA 3PZHA 3R63A 3LCOA 4B7TA 2WU6A 1SZMA 4JR7A 2C6TA 4WRSA 4IVAA 4CZUA 1QPCA 4QD6A 5CSWA 2W4JA 1OBDA 3ZHPC 1TQPA 4MXCA 3OT3A 3FV8A 3EOCA 3JY9A 4NFMA 5BVNA 4GEOA 4BC6A 4IADA 4F99A 3IGOA 2PVNA 3PXRA 3R71A 3PJ2A 3RPVA 2XUUA 3UNKA 4OBOA 1JPAA 1RQQA 3UC3A 2BDJA 4J8MA 4OR5A 4O2ZA 3BQCA 2OKRA 2XJ2A 5LJJA 5CAPA 3D9VA 3OHTA 2OBJA 3LIJA 3OT8A 5CXHA 4F7LA 3HP5A 1H01A 2P33A 2OWBA 3QYZA 4EOPA 3IQ7A 4QP4A 3RZBA 5HU9A 2ITXA 3R7VA 5EOLA 3SOAA 2VTMA 4CRSA 3AC3A 2VWIA 2B9JA 4FSQA 4JAJA 4PTCA 1DI9A 3UOJA 4D4VA 4DEAA 4YZMA 3C5UA 3EZRA 4IM2A 2WELA 4IHPA 5BVKA 4U40A 3GB2A 3HMMA 2QO2A 3OTUA 4C4HA 3Q4ZA 3PXZA 1NVQA 4U42A 2IVTA 1GIJA 4HNIA 3EN7A 4PMMA 2WOUA 4RZVA 3F69A 4LQMA 4BDDA 4EHVA 4I6FA 4EZ5A 3RZFA 1G8SA 2VTAA 3QGWA 4LM5A 2OIDA 5AP1A 4ZSLA 5TT7A 3MVMA 4F9YA 1U5QA 2XEYA 4Z3VA 1YDSE 5IA5A 2E9NA 3LQ3A 2O63A 2GCDA 1OBGA 1WBNA 3G0EA 3QRIA 4DGGA 5DH3A 4DEEA 3KGAA 5LVLA 2IVSA 5CY3A 4BCJA 5HQ0A 4C34A 4ACCA 3F2NA 3OOMA 4OT6A 4EK8A 4Y72A 3ZONA 4GS6A 3ZYAA 4GUBA 5E8UA 2H9VA 3C4CA 3G6HA 3MI9A 3QFVA 4QPMA 5DR2A 5EW8A 4ASZA 5HD4A 5M44A 3JR1A 4PPBA 5LVOA 3QKLA 2BUJA 2WTKC 3U54A 5E92A 2B7AA 4KA3A 2R2PA 4X2KA 5K4JA 5AX9A 3L9MA 4BYJA 5IQHA 2PE2A 3QTUA 4ALWA 4I93A 2ONLA 1K2PA 3O7LD 4FTQA 4G6LA 4O7WA 4ZY4A 4J53A 4K33A 3ORKA 5DFPA 4PV0A 4MK0A 3GENA 1OPJA 4GFGA 4QNAA 3W33A 1W0XC 3F61A 4UY9A 2Z8CA 4LGGA 5DEYA 4HVHA 3P9JA 4F7NA 2CKPA 4IWOA 2QKRA 1V0PA 3BBTB 4ZLYA 2XBAA 3K5VA 2CGXA 4LL5A 4PL3A 2J7TA 1YI6A 2R7IA 4TYHA 4B8MA 4G3GA 3KMWA 1ZOEA 4F9BA 2IO6A 3GU7A 3ZZEA 4EQUA 1ZWSA 3BELA 4XCUA 3VUKA 4BZDA 4ZIMA 4RJ8A 2WFYA 4QQCA 3ITZA 3P1AA 4RPVA 4O27B 4J98A 3MFSA 5LVPA 3ULZA 2JLDA 2DS1A 4W4YA 5E8TA 1IRKA 2OO8X 4Y73A 3E63A 2BVAA 2UVYA 2IWIA 3FQHA 4FV7A 4EOSA 4F6SA 3F3TA 1T45A 2BMCA 3QTIA 5HVYA 3MH3A 2WO6A 2QO7A 3SKCA 3EYHA 4G16A 3PXQA 3HNGA 4J52A 3D7TB 5HKMA 4WOVA 4JJRA 2W0JA 5JQ5A 4L7FA 3SQQA 5B2MA 3FL4A 1MQ4A 4FT9A 3QC9A 5B7VA 4FIEA 4AZTA 3GU5A 3F7WA 5ACKA 3EFKA 3MDYA 4FKTA 5D7AA 1XWSA 1W7HA 3R04A 4HCTA 3QTQA 2BRGA 1Q99A 4FSWA 2HY0A 4HGSA 4PUZA 4YGAA 4C58A 5FRIA 4KD1A 2OXYA 5TO8A 3VBWA 3W1FA 4IAIA 3NYXA 4CTCA 4BKZA 2ITYA 3Q9YA 4HYUA 1YDRE 4DFYA 5AM6A 4BHZA 2GFCA 1UV5A 3G9NA 3L1SA 4HZSA 4YR8A 3DOGA 3DAJA 4HYIA 4TKSA 4V0GA 5FXQA 1I09A 5E8VA 4HYHA 3AC8A 3CIKA 1R0PA 4JIKA 3NW6A 4D28A 3WZDA 3NUXA 3QUDA 4H1MA 5BMSA 4AN9A 3C4WA 5CU2A 4FTAA 1FMKA 2ESMA 3O0GA 4ZTSA 5FXSA 2WQMA 3JS2A 2PSQA 4UV0A 4ACMA 4ASDA 4I6HA 4GK3A 2PVMA 4QYYA 4CMTA 2Z60A 4BIEA 4EQMA 3A7FA 4I5MA 3FPQA 1P4OA 3BEGA 3TZ9A 5BPYA 4EJNA 2ZV7A 4XNEA 2YM5A 4IMYA 5C4KA 2W5HA 4CQGA 4CLIA 4LYNA 2GHMA 1P2AA 3AQVA 4YTIA 3O8PA 2WMVA 4E6CA 3V8WA 3W2OA 4NJDA 4EH5A 2XKCA 2XYNA 3KN6A 5CENA 4V01A 4FUXA 1NT2A 4IJ9A 2XK7A 5EYMA 5LVNA 4YLJA 4PPAA 2XIYA 3UQFA 4NZWB 3ZFYA 5FEQA 1JSTA 3TEIA 4AGUA 3H9OA 2O8YA 5DMZA 3VBQA 5EKNA 5GJFA 5GIPE 2PUIA 4FKOA 4GJ3A 1AGWA 4QMZA 3UBDA 4BBFA 5IUHA 2J50A 4FG8A 2XM9A 4FZAB 3TTIA 3FLQA 4QTCA 3R73A 4X2NA 2QOHA 2YAKA 4YJQA 1WFCA 2BILB 2OGVA 3ZUTA 1YW2A 2OK1A 2C5OA 4YTHA 2QODA 5HCZA 4YSJA 5AX3A 2RKUA 3UG1A 4O81A 3FMKA 2OIQA 4UMQA 4QQTA 3G51A 1TKIA 3DK7A 3TNQB 4C8BA 3NWWA 1PXLA 4W8EA 4FT3A 4AZFA 2JIVA 4AG8A 3O71A 1ZYSA 2ZB0A 4C62A 1H24A 1UKIA 3DQWA 2VGPA 3ZXZA 3W32A 3G2FA 1ZRZA 3QZIA 5M09A 3MY1A 2BZIB 3KCKA 3NMUF 4ZTHA 5EYKA 2CLXA 3H30A 4M13A 4X6QC 5IMXA 5EHOA 4CFVA 5CI7A 2UW4A 2VWXA 3RKBA 3VUMA 4PL5A 3Q6WA 2GNLA 4IBMA 4X2FA 2XCKA 4QPAA 4AT5A 4EC9A 4DITA 3LLAA 4L53A 2YCFA 4F08A 1STCE 5KCVA 2Z7RA 2CN8A 4NM5A 3RWQA 4QMPA 5E1EA 2X39A 2QI8A 4ASXA 3IW4A 4RWKA 4D2RA 4M84A 1VYWA 4FK3A 4WNKA 2UZVA 3GC9A 5HBEA 2X7GA 3I81A 5JGBA 4LL0A 3R28A 4EYMA 3TCPA 3O2MA 1KE7A 5KKRC 2VTHA 3HDMA 4GU9A 3IOKA 4FTLA 2XF0A 3HMOA 3R8VA 4ANMA 2I7QA 2Y6OA 2H6DA 3F6XA 4BDIA 1UWJA 2BKZA 3MSSA 4J99A 5AV4A 4ARKA 3E7OA 3NNUA 4FGBA 4FICA 4IW0A 3RAIA 4XH6A 4YJSA 5A54A 3EQGA 2XNOA 4JT3A 2C1AA 1Y8GA 4UWCA 2CSNA 2Z7LA 3TZMA 1H27A 1A06A 4G6OA 2UZBA 5HTIA 1KE8A 2WQEA 4TWNA 5HE1A 2WHBA 3CD8A 4EEVA 3QXOA 3SXSA 3EFLA 5EHYA 2BR1A 2WD1A 5CNNA 3S2PA 4YUQA 3TV4A 3H3CA 3DAEA 3TKHA 5KBRA 2W1HA 2QOQA 4YZNA 4N4SA 2PL0A 4XG7A 3TNIA 3B8QA 5I3RA 1PKGA 4DG3E 1REKA 1GZNA 2BPMA 4DC2A 4DGOA 1YHWA 1KUTA 4FL3A 4U3YA 2ITPA 3BRBA 1JAMA 2XCHA 2YCRA 4ZSGA 3PWDA 3BU6A 3TL8A 5AWMA 3Q53A 3NIEA 4X3FB 3BYUA 2JKMA 3LFDA 2PU8A 4G9CA 3PSCA
chains in the Genus database with same CATH superfamily
5J79A 4TPTA 2BDFA 3Q96A 1H07A 3FDNA 2Z02A 3CCNA 5AV0A 2J0IA 2W9FB 1Q8ZA 4O4DA 3CE3A 3SOCA 3QAME 3VRYA 3RI1A 4DBNA 5IQEA 1OKYA 4BCPA 4YU2A 3PXYA 3E5AA 3VUIA 4O86A 3PY0A 3K2LA 4AGCA 1VJYA 1FGKA 2BIYA 3PP0A 4ZJVA 3U55A 5KZIA 3PRFA 4GMYA 4CKIA 4V04A 3P5JC 2XKEA 3ELJA 4U81A 3CP9A 3JXWA 3PY1A 4XEYA 3UO4A 3DLZA 5KKRB 2CNUA 2WQBA 5ETFA 4ZSEA 3DK6A 4FF8A 1B39A 4P5QA 5C8KA 2UZDA 1SYKA 1JKLA 2O64A 2RFEA 1MUOA 3L9PA 4JMQA 2PVHA 2Z7QA 5HX6A 5FEEA 3C13A 3KRLA 4O7LA 4CD0A 1XH9A 4GIIA 3UIMA 3O5AA 2F2UA 1DI8A 1PXNA 3DNEA 4TYGA 4BKYA 2V5QA 3ATTA 5BNJA 2R3FA 4D55A 5KE0A 3ZXTA 3SRVB 4BDEA 1XHAA 3PTGA 4NU1A 1BL6A 1J91A 2OW3A 5D1JA 1O6KA 4F64A 3DJ6A 2JBOA 3FLZA 5IQBA 1M14A 4LRKA 4X3JA 1NA7A 5FDXA 1F0QA 3EFJA 2QNJA 2IZUA 5EQYA 3QU0A 3P86A 4R3RA 5HBJA 1M2QA 4WG5A 4PX6A 4D1SA 2PK9A 5KMMA 3I7CA 4D2WA 4C38A 5GJDA 3ZLWA 5F4NA 3HV4A 3WF8A 3OWKA 1Q41A 4H58A 5J7BA 2Y8OA 3QUEA 2VTIA 3W0QA 4D9UA 1UNHA 1YXSA 3ROYA 3QQLA 4TZRA 4FOCA 5DIAA 4GFOA 5KZ0A 5M55A 2O65A 3MIAA 3UPZA 3AG9A 3KA0A 5LWMA 2BRBA 2WXVA 1AD5A 4HVGA 2W5BA 4FNZA 1GIIA 3MVJA 4RJ3A 1ST4A 1FPUA 3ZC5A 2W1DA 5BVDA 4C4JA 3V5QA 1WVYA 2YIRA 2BFXA 4IWPA 2X2KA 3EQRA 3OEZA 4MNFA 4NKSA 2B9FA 4AOIA 5HNBA 1FGIA 2YIQA 5BV3A 5JGAA 2V7OA 4AXCA 3PXKA 4G3EA 4AT4A 4EONA 1ZXEA 3RK9A 2PMNX 2ITQA 4DDGA 1KOAA 4FOBA 2EUFB 5EW9A 2YITA 3I7BA 1SVHA 4EYJA 4X0MA 3LXPA 1Q8TA 5B0XA 5IA4A 4OLIA 2YIWA 4PF4A 4MUQA 2YAAA 4GSBA 2OSCA 5FWKK 4OBPA 4WNOA 2CGVA 1J1BA 2JDSA 1OL2A 1X8BA 4M0ZA 4EBWA 3EQDA 1ZARA 4S31A 3RGFA 3ZRKA 4F7JA 4O7SA 4F0IA 2BAKA 2QU5A 2X4FA 3ZS5A 1IA9A 3IW7A 2RIOA 2F9GA 4KNBA 2P55A 4E8AA 1URWA 2JGZA 1UA2A 5IQIA 3I6WA 3WARA 5IKWA 3TXOA 3ORXA 3OBGA 1XQZA 3G33A 5JZNA 3MY0A 3UTOA 4AW5A 4NH1A 1ZYJA 2YACA 4DFUA 5H8BA 4GH2A 1Q4LA 1I44A 3MYGA 3FI8A 3K3IA 1DS5A 4PMPA 4WD5A 4Q2AA 1XH4A 3NRMA 3CSVA 4AE9A 3FMJA 5M07A 3DS6A 2QHNA 3S1HA 2VNWA 1U5RA 3HECA 3U9CA 4FEVA 3A7GA 4QDEA 3RJCA 1W84A 3KXNA 3Q5IA 5HCYA 1PMVA 2QQ7A 1ZYCA 4FJVA 3MPMA 3G6GA 4IC7A 4AA5A 3A99A 3R7IA 3TNPC 2XKFA 4BCGA 1M52A 3ORZA 3C1XA 2WMBA 3HMNA 4YZDA 2OICA 3FZRA 4I20A 4AW2A 4AAAA 2OJJA 1WAKA 2C47A 2WQNA 3MN3A 5AP6A 4MXYA 4M8TA 4FG9A 1U54B 3AGMA 3F88A 2KULA 3GCSA 4FSTA 4RIYB 1MP8A 4KS8A 4NKAA 3OEFX 5KMJA 2NYAA 3DZOA 3OP5A 3DK3A 4DHJA 3BKBA 4YJVA 3BV2A 2IVUA 5GNKA 4I0RA 4XV3A 4L6QA 4TL0A 3MH1A 2BAJA 5HICA 3D14A 4CFXA 3ZDUA 3L8PA 5HLPA 5CU3A 3N4UA 5JFWA 3LFCA 2VRXA 3CXWA 4JDIA 4HJOA 3WYYA 3BYVA 2UV2A 1G8JA 1S9IA 5JFVA 1XO2B 2WMXA 2ZV8A 2XS0A 1G3NA 5FQDC 3GC7A 3UNJA 3WZUA 1ZMUA 4X3FC 2YIYA 1HCLA 1CSNA 1NVSA 3OCBA 4MH7A 5CEIA 2C68A 2BZHB 3AOXA 5DI1A 3QYWA 4JRVA 4CMOA 3OVVA 1S9JA 4P7EA 2HZNA 4I5CA 4DLJA 2WMWA 2XJ1A 2BDWA 3GC0A 3QCYA 1Y91A 4GVJA 5C03A 4BF2A 4BTMA 4F70A 3IKAA 4L44A 4OTIA 4LV7A 2VTJA 5LMKC 3NW7A 3LJ1A 3R1NA 4FZ7A 4DLIA 3ORNA 4ZSJA 3U6IA 2B9HA 2CGWA 1K3AA 5D11A 5DVRA 3UOKA 3MTLA 2VTOA 2PVFA 2ZM3A 4FZFB 5CF6A 5DBXA 2R3PA 3DBQA 4IJPA 1OM1A 3MGYA 4AE6A 5ETAA 3GU4A 4BTFA 4Z16A 5IUGA 4A9YA 2Y7JA 2NP8A 4E26A 4FNXA 3VS7A 3TUBA 4YTCA 5AV2A 4HPTE 3EQHA 4FL2A 4A06A 3FPMA 5G1XA 1PYXA 2QOOA 3QRTA 4A9UA 1KV1A 3KF4A 4HGTA 4IB1A 5AUXA 4D4SA 5DOSA 4C33A 4ZY5A 1W2DA 4G17A 3T8OA 2ZOQA 5ACBC 1XBCA 5M51A 3LMIA 2YFXA 4DCAA 2FSMX 3PJ8A 4HVIA 2R3GA 2RFNA 4BDFA 4EK5A 5A4QA 3V04A 3ID6C 3IONA 1JNKA 3ZSHA 3CPBA 5F9EA 1LEZA 3BBWA 5FTGA 2IJMA 3KF7A 1OL7A 3MFUA 2R3RA 4FV1A 4GCJA 4I6QA 4IZ7A 5CSXA 5DNRA 3VULA 4AP7A 3W0SA 1OUKA 2QOLA 1YWVA 4QP3A 2NPQA 4QYEA 5H9BA 4JDKA 1ATPE 3WI6A 4D5HA 1W2FA 5DWRA 4HGEA 2XNPA 3RHKA 3QA8A 5LCJA 2I0HA 4ZS4A 3Q60A 3W8LA 4YO6A 4RQVA 5BUIA 4FTRA 4RA4A 3QX2A 3WF5A 4AW1A 3IECA 3QRJA 3KK9A 4AZSA 4BZOA 3SXRA 3ZMMA 5B2LA 5I5ZA 3C7QA 1CDKA 3OXTA 4PNKA 2YM6A 1L3RE 5F20A 5BYZA 4Q5EA 3NSZA 5EQEA 2I0YA 3IK3A 2XM8A 2UW8A 4QMLA 3AXWA 4U80A 2OLCA 1SMHA 3JVSA 2UW9A 5M4FA 4S33A 4EBVA 2XH5A 3MW1A 2B55A 3KXZA 4I22A 2QG7A 2C6DA 5H2UA 2EU9A 2UW5A 5AP0A 5AV1A 3RALA 4RJ6A 5EI8A 3UYTA 4XLIA 5LXMA 3FI2A 1ZOGA 3KK8A 3LFQA 4W9WA 5LOHA 1YKRA 3C4EA 4I4FA 5IEYA 2XJ0A 3WILA 4GIHA 4MXZA 3I0OA 3UOLA 2WEIA 4ALVA 3IPHA 4R6VA 4BIDA 3F7ZA 4BWPA 4FIFA 3WZKA 4HCVA 2E9OA 1OGYA 4IAFA 3NFFB 4EH3A 4OAUC 3F5PA 4YNEA 3NNVA 4PDPA 4X3FA 4FKPA 5J87A 2YABA 1BL7A 1LPUA 4BB4A 4C61A 2ETMA 5IH4A 2KTYA 1OPKA 4EK3A 4K8AA 3QD4A 4CFWA 4CMUA 2RFDA 2YM4A 4JX3A 4G6NA 3MJ2A 4ANBA 2X0GA 4DCEA 2ERKA 3PRIA 5I9XA 4I41A 4O0SA 4IAAA 4KBCA 2ZDTA 5AEPA 2IN6A 3PA4A 4XBRA 3Q52A 3QD2B 3QKMA 4TWOA 3GUBA 2ZFYA 5E4HA 4UN0C 2VTQA 4ZS0A 1PMEA 5HLWA 4H36A 1ZZLA 3GFWA 5M4UA 4NCTA 3BHTA 2PY3A 5AP7A 3AT4A 5A4TA 3NYNA 1OKZA 5A9UA 1WVXA 3G0FA 2GDOA 3DV3A 4BDCA 1O6YA 2WTWA 4JI9A 4O96A 1H25A 4ERKA 5IZFA 3CBLA 2YDKA 3D2IA 5CT0A 4EWQA 3HEGA 3QQUA 5HIBA 4O7ZA 4FV5A 2Y9QA 2ITVA 1TFFA 4Z9LA 2VWUA 4DEGA 5L8JA 2Y4IC 3A60A 3BEAA 1GAGA 4J71A 3DB6A 4PNIA 5JMSA 4GKIA 4FSYA 2X8DA 3G15A 1JVPP 2VTSA 3FZPA 4YPSA 3OY1A 3SX9A 3ULIA 1JKTA 1REJA 3ZO2A 4U9AA 3Q4UA 2JKKA 3A4OX 2B9IA 2FVDA 3MA6A 4FMQA 4YC6A 4IVDA 3PLAE 4H3BA 5CAUA 1H28A 4IM0A 5JT2A 4A07A 2JBPA 3UVQA 4EH9A 4EOJA 3M1SA 4HCUA 5J9LA 3FHIA 3ZO4A 2R3KA 3BGZA 3FKLA 3GBZA 1KE5A 4PPCA 4G2FA 1WBVA 4QYGA 5CANA 1J7LA 3VUTA 3QHRA 3ZFXA 4M12A 1LUFA 3GOPA 4CCUA 3ZEWA 4RSSA 4JX7A 3TNHA 4A4XA 4L46A 4XMOA 4DA5A 4UXQA 2UVZA 2AC5A 3C0GA 2OJ9A 3BQRA 4ANSA 3RAKA 4HVDA 1XH7A 2FB8A 4OTRA 4BJJA 1PYEA 3DA6A 3QWJA 3V6SA 1ZAOA 3EN6A 3QCQA 4II5A 3TWJA 4EOLA 4O4EA 3FZSA 2XNBA 3SW4A 4EKLA 3DAKA 1PW2A 3I5ZA 4NUSA 5C4LA 2YCQA 2EB3A 3AC4A 3QCXA 3LW0A 3O17A 4I1ZA 4KKGA 4DTKA 2PMIA 3Q04A 3SDJA 4AACA 1KV2A 4FNYA 5KMNA 1H4LA 3EL7A 4EQCA 4YC8A 5ANGA 2QOKA 3A62A 3CY2A 1OIQA 2WPAA 4RJ7A 5TF9A 4DHZA 4CGAA 2PZRA 2QOIA 4P2KA 3RINA 4W4WA 3ERKA 4GT4A 3VBVA 4JQ7A 2EVAA 4RC4A 1ZMWA 2Z2WA 3DT1A 3ZUUA 2BTRA 2ITWA 2WTVA 5JQ8A 4MXOA 3O96A 3DGKA 5M08A 1U54A 2BHEA 2PZIA 3W2QA 2IEWA 4XG6A 1L8TA 3V5PA 4JBQA 4Y46A 3UMWA 4DGLC 2IPXA 1H00A 1J1CA 5E8YA 3BZ3A 4B0GA 5AR7A 3GCUA 4A4LA 1GJOA 2Y4PA 2RFSA 4FV0A 3RVGA 4KINA 4XG4A 5FEDA 4AN3A 4ANOA 3U4WA 4DF3A 4KIOA 3HA6A 3NAYA 4FV4A 4XV1A 5DN3A 5FLFA 4D9TA 1VR2A 4EUTA 3SLSA 1UU7A 3GU6A 2O2UA 2J0MB 4L7SA 4XUFA 3ETAA 2GNFA 3C9WA 3EL8A 4JDJA 4M14A 2G9XA 4V05A 1UNLA 3BHHA 5E1SA 4C59A 4XJ0A 4O0YA 3KFAA 4BCHA 4AXDA 4KUJA 3FXZA 1H1RA 3BE9A 2WGJA 3HKOA 4O0UA 5AR8A 2NNWB 3OROA 1IG1A 5T6KA 3BLRA 4C36A 4AFJA 1V1KA 3LCDA 5J5SA 3UO5A 4FSRA 2OXXA 5IH6A 3BWFA 4I5HA 2WU7A 4QMWA 2XIXA 3NGAA 4DEIA 3EWHA 3FBVA 3BHVA 3LM5A 5AR2A 4AOTA 5JH6A 5M53A 5FGKA 2WEVA 4BCKA 5IA0A 3LCSA 1EH4A 2YLFA 2I1MA 1JSVA 4FYNA 2CGUA 3P4KA 4GJ2A 4QTAA 1OIUA 3ALNA 2PE0A 1ZY5A 3E64A 3ZC6A 4NL0A 2UZEA 5CZHA 5CEOA 1H1SA 4GW8A 4CT2A 5KNJA 5DT4A 4AZVA 4DFXE 5HG7A 5E90A 3UP2A 4F09A 4X21A 3COKA 5HLNA 4FSUA 4BBMA 2EXEA 1UKHA 4FL1A 4QP2A 4IVCA 3Q3BA 3UQCA 3FSKA 1ZMVA 2BFYA 3FAAA 2QG5A 3A61A 3MTFA 3OY3A 4N0SA 2QVSE 4WHZA 4ZP5A 5L2QA 1XJDA 4RWIA 2HXLA 5EG3A 2A98A 2CHLA 4NM7A 4FIIA 1LR4A 1R1WA 4U3ZA 5FM2A 3CD3A 4B99A 4MQ2A 4I0SA 2GNGA 2PVKA 1OECA 4A9RA 4EH4A 4RLKA 3R8PA 5J9YA 3RM7A 3UIBA 4RRVA 2X6DA 3F9NA 4YURA 5HTCA 2WAJA 5DLSA 1QPEA 3E3BX 5J95A 2XYUA 3QTXA 3COIA 3LXLA 3P79A 4KKEA 2X9FA 5T3QA 4MBLA 3ZRLA 2IF8A 1OPLA 4MBJA 5CAOA 3F2AA 4XRJA 5EOBA 4FEWA 3EJ1A 4KAOA 2DYLA 1RDQE 3PG1A 3UIUA 2PZ5A 5HEZA 3PUFC 3AC1A 4KSPA 4IB5A 4U44A 3HDNA 4XG8A 3RHXA 2JAVA 2P3GX 4YJTA 3MESA 3Q5ZA 2W1EA 4E4XA 4NM3A 1YVJA 5EK7A 4RX9A 4UYNA 4MWHA 4WKQA 3R00A 4D4RA 3CY3A 3P5KA 4GG5A 4MAOA 2XIRA 2A4LA 3UJGA 2OI4X 3ANRA 4ZTLA 4ITJA 3F3WA 4ZZMA 3E3PA 5K5NA 5CYIA 4B4LA 1M2RA 4BDKA 4FTMA 3DLSA 4D0WA 3MFTA 3Q6UA 5HBHA 4QOXA 3BYOA 3WIKA 4FE2A 4O7RA 2UW0A 4LMUA 1KE9A 2PZPA 5E7RA 2FGIA 3OXIA 4K11A 4RVTA 3V3VA 4AT3A 4APPA 5K9IA 4GK2A 3LOKA 4IAYA 3DXNA 5JGDA 3BCEA 3LFAA 3FQEA 4RG0A 1TQIA 1WCCA 4FG7A 4MX9A 4RFYA 2XIZA 4BGHA 4BWXA 5HX8A 3ACKA 3CEKA 4R1VA 5D10A 4ZK5A 3KY2A 2PWLA 3HVCA 4D1ZA 3A4PA 2PHKA 4IZYA 4ZZOA 4ID7A 2ZDUA 4RGJA 2UZUE 4DINA 3N9XA 3NNXA 3RPOA 4W8DA 4RIWB 3EB0A 4IX5A 3DNDA 2WZJA 5AUZA 3RNIA 4QMUA 2LGCA 4IZ5A 4MVFA 2BROA 5JZJA 3BLHA 4MXAA 3MB7A 3VAPA 5GZ9A 2W06A 5IEVA 2CJMA 1U4DA 3EH9A 4H3QA 1OI9A 3NZ0A 1Y57A 4FYOA 2C6OA 2OF4A 4YJRA 4O0VA 3Q4TA 3KVXA 4JG7A 4MKCA 3O51A 2X81A 3F5GA 3O7LB 3BGPA 4FT5A 4K77A 3FWQA 3KRRA 4D2PA 5KX8A 2IW9A 5IQFA 2XNMA 5BQ0A 4MD7E 2X4ZA 4HW7A 1K9AA 3FY0A 1JQHA 2JKQA 3ZSIA 2BRHA 5FUTA 2RL5A 1QCFA 1WBPA 2UW7A 2V0DA 2XB7A 3D0EA 3DKFA 4WNPA 3CTHA 4FIJA 4GT5A 4A9SA 4KS7A 1TZDA 1RE8A 3VBXA 3OBJA 5A4CA 2W4OA 5A4LA 4HOKA 5L4QA 4J95A 2WB8A 4IQ6A 2F7EE 4EZ3A 3PDTA 4C2VA 2ITTA 4F6WA 4O7NA 4Z7HA 4WSQA 2YDJA 1JOWB 2V55A 4JL9A 3D7ZA 1QL6A 2X2MA 4MD9E 4O1OA 3TN8A 4AZWA 4AQKA 3KC3A 3VW6A 1RW8A 3O8UA 4IDVA 2XK6A 2YHVA 2YM3A 4MYGA 4M66A 4FRFA 5F94A 2J0JA 3PPZA 2IW8A 4RFZA 2YDIA 5DEWA 4O0XA 2PMOX 3LMHA 3JYAA 2BIKB 4FC0A 4FV2A 1IASA 4K1BA 4O7VA 5AADA 4I4EA 5F1ZA 3CS9A 3BU3A 1J7IA 1B38A 4FSMA 4XG3A 2XARA 3JUHA 2GSFA 2HXQA 2E9UA 3E92A 3W18A 5CALA 2B54A 3NUAA 4C3RA 3DBCA 4FX3A 5IPJA 2GTMA 3FMEA 3PSBA 4LUEA 5A14A 4NIFA 4O21A 4LDTA 1IAHA 2Y6MA 2Q83A 3UZRA 4XV9A 2YERA 4PY1A 4C2WA 4CQEA 2W7XA 5BMMA 3ZO1A 2PUNA 3Q32A 2GQSA 4LGHA 5I4NA 4N57A 3LPBA 3GC8A 3LJ2A 4R3PA 3F82A 3ODZX 4Y85A 5DR6A 2C5YA 4DH8A 4O1PA 2GMXA 3E87A 3LFSA 3R2BA 1UU3A 5CQUA 2OJFE 1IAJA 4F1OA 5K0KA 4M15A 5K0XA 5I9WA 3QRUA 4KIKA 5L3AA 3CLYA 4EHGA 2DWBA 2GHGA 4G31A 4JG8A 4FBXA 4IFCA 2HENA 3QCSA 4FODA 3BPRA 3DPKA 1M17A 2JEDA 1BYGA 4BCMA 4IAZA 4IZAA 4ZJIA 5H8GA 3GQLA 1OL5A 4R1YA 3UVPA 4EWHA 2UZTA 3PFYA 3VC4A 1BUHA 3BV3A 3TNWA 3ZZWA 1A48A 3CQWA 5AM7A 4AZEA 4FTTA 4LG4A 5H8EA 1GIHA 2ZM1A 3CQUA 3R8LA 5CF8A 3L9NA 4UBAA 3CKXA 3LM0A 1HCKA 4FTJA 4QYFA 3H4JA 5TE0A 4DEDA 5KHXA 3NIZA 3ZLSA 4IAKA 3PE2A 2ITUA 3BI6A 5CF4A 2CNQA 3AKLA 1F5QA 3UDSA 3THBA 2VV9A 4UYAA 5EYDA 2YWVA 4C4EA 4NIFB 3PIYA 2VN9A 4AA0A 3TV7A 1OGUA 3NUPA 3W8QA 4Y95A 4EOMA 1W83A 3DFCB 3NEWA 3NUYA 2ITZA 5AUYA 4BCIA 2GHLA 4GT3A 2GQGA 4FKVA 2YISA 4I3ZA 4XP0A 5AP5A 3HRBA 5KMIA 4H05A 2X6EA 3QTWA 4E6AA 4G34A 5CEMA 4UZHA 5GIOE 3HX4A 5CLPA 4YC3A 3CC6A 3OWPA 2C1BA 2Q0NA 3VS4A 3PJ1A 3OUKA 5J1VA 1Q3WA 3U8WA 2PTKA 4WUAA 2WKMA 1O6LA 3GEQA 4UZDA 5IUIA 4N6YA 2UUEA 5ANJA 2QOFA 5EYCA 3VIDA 3I0QA 3RAWA 3HMIA 4I0TA 1YHVA 2O3PA 3IGGA 3R02A 3BHUA 3FJQE 3NYOA 3ZSGA 2W1ZA 2PVRA 4LRMA 4LFIA 4ORKA 4LOQA 4S32A 4XG2A 4YZ9A 3RCDA 4H39A 5A6NA 4EH8A 4M69A 4TTHB 3WF9A 1PXJA 2J51A 2W1CA 5KUPA 4E20A 3O23A 5K3YA 4WG4A 4JQEA 3HMPA 3T9TA 3U51A 5AUUA 4DG2E 3H0YA 2B4SB 4MBIA 5EI6A 3ORMA 3B8RA 3E8EA 1R39A 3UGCA 5HG5A 2HAKA 3WBLA 2VGOA 2OH4A 1XKKA 3DBFA 1GOLA 3T9IA 3TG1A 3PG3A 4K0YA 4QP7A 2R3HA 1WBSA 5IG1A 3EN4A 3PY3A 4QMYA 4DN5A 5M57A 4YTFA 4JNWA 1B6CB 4GYIA 4JS8A 4M68A 4ZTRA 4BCOA 4QP8A 3QX4A 5LQFA 5M4IA 5I0BA 1XBAA 2VTPA 4Q9ZA 3FY2A 5CSVA 3QF9A 5HI2A 3OWJA 3F5XA 1ERKA 4J8NA 5GZAA 4FNWA 4W9XA 3ZO3A 5LMBA 4K6ZA 3UZTA 3K54A 4ZMFA 4RVMA 1LP4A 4BCQA 4C35A 2WMAA 4AAYA 3HV6A 4LOOA 3VF9A 3IW8A 4USFA 4KABA 3DKCA 5L2IA 2JIIA 2UZWE 1ND4A 4O84A 4DDIA 4BRXA 3HV7A 1Q97A 1WVWA 4EUUA 4GRBA 3VWAA 1Q24A 4O4BB 2HYYA 4XG9A 2XEZA 2QOCA 4BN1A 4XLVA 3NVKI 5M06A 4BFMA 5AAFA 2HZ4A 4OTWA 5AUWA 2WMQA 2O0UA 3REPA 3EHAA 5A3XA 4BDBA 5KMLA 3PVBA 3C0HA 3S00A 2SRCA 4L00A 1JKSA 1YI3A 5CU0A 3QWKA 3TKIA 4DBXA 1PKDA 1GY3A 3D4QA 4O6LA 3VF8A 4DTAA 1R0EA 3AMYA 3OTVA 1TVOA 3R83A 1IA8A 3MV5A 2PYWA 3O50A 3OMVA 2XNNA 1Q61A 3POZA 4MNEA 4YBKA 4E5WA 3SG9A 4DT9A 4GG7A 4KIKB 3Q4CA 4RIXB 4AXAA 2I6LA 4AGDA 3PJCA 4Q9SA 3KN5A 3PVGA 4XOZA 3B2TA 4IEBA 4XP2A 5CNOA 3DCVA 5DR9A 4FZ6A 2J5EA 4IC8A 3QZFA 3FC2A 4RWJA 3TYKA 4B9DA 1R78A 4L68A 2VAGA 3V5JA 3QZHA 3ZBFA 4BWKA 2QR7A 4X2JA 5B2KA 4DAWA 4FTCA 2VWWA 4MTAA 1CKJA 4IX3A 4J96A 5AP4A 5A46A 1GNGA 2C6KA 1JBPE 5DRDA 5IDNA 2YEXA 3HYHA 4YP8A 5I9VA 4FR4A 4F9AA 4DFBA 5FBOA 5EM8A 1OL1A 2VTNA 1KOBA 2CNVA 3QQFA 4G9RA 3WIGA 3MFRA 4DFZE 2C0TA 3E8DA 4OAVB 3LKMA 1ZZ2A 3BU5A 3KEXA 1V0OA 4D1XA 4O4FA 4IACA 3V5TA 3FXWA 3FMLA 4CTBA 3RMFA 3DBDA 4FV6A 1FVRA 2WIHA 3LLTA 3TIYA 5I9ZA 2R64A 2C3LA 3D15A 1MRVA 3QQKA 2HWPA 3LXKA 4AWIA 2CDZA 4G1WA 4IB0A 3TZ7A 3H0ZA 4PDOA 3UOHA 4EH2A 3KQ7A 4Y8DA 3GP0A 4RA5A 4G5JA 3LE6A 3PIZA 2OXDA 4I92A 4OTHA 3FXXA 2XALA 3MH0A 4CYIA 3KB7A 3VS3A 3LXNA 4EOKA 3KULB 4ZTNA 4DHFA 3IO7A 2YA9A 4BTKA 5JRSA 3I60A 4APCA 3U9NA 2PPQA 1PF8A 4AGWA 5DYJA 2ZMCA 4O7YA 4K2RA 4JBVA 3HGKA 4KKHA 4XP3A 4ZY6A 2BHHA 3FC1X 4CXAA 3A7IA 3NVMB 2R3IA 3KRXA 4C7TA 3TUDA 3P7CA 4FKWA 4U79A 2QR8A 2G15A 2G2HA 4ANLA 2XAMA 2VWVA 3W0PA 3M11A 4ZXTA 2P4IA 4EK4A 4QP9A 2GPHA 4F9CA 3ALOA 4W4VA 5IA3A 2IZTA 2PZYA 5FM3A 2ZVAA 2CKEA 4QMXA 4EZ7A 1UNGA 1WMKA 2V62A 2VTRA 2BALA 4DFNA 4FVQA 4R78A 3FLSA 2C5XA 3BL7A 4FKRA 3DTWA 3OD6X 4D2SA 5HG8A 4YJNA 3FLNC 2UZLA 3CR0A 2OJGA 3R9NA 2VO3A 2ZV9A 4E4NA 4UEUA 3VW8A 2B52A 4ZEGA 4GU6A 4EH6A 2C3JA 5ICPA 3R1SA 4UXLA 4F65A 2XBJA 3C50A 3R7GA 1SNXA 3OG7A 5IMEA 1SNUA 2X7OA 4RWLA 3UO6A 1H1PA 3D94A 3QUPA 4GK4A 3UZPA 1Z9XA 3RTPA 4U0IA 3U6HA 1MRUA 3JPVA 1H08A 1W8CA 2BCJA 1V0BA 2J4ZA 3L9LA 3OCSA 4JR3A 2PMLX 3A8WA 3NUUA 1H0VA 1ZY4A 3PE1A 2J5FA 4YHTA 3ORTA 4XHKB 5FDPA 1Y8YA 2UZOA 3CJFA 3GGFA 3ORIA 4W4XA 4UMPA 4C57A 4ZZNA 2NRYA 5C9CA 2A0CX 1FVTA 3FZOA 3QA0A 3SD0A 3CPCA 4IB3A 3TV6A 3ZU7A 2PUPA 3R8MA 5IU2A 1OKVA 1YQJA 3LJ0A 1P4FA 2CLQA 2JDOA 4PP9A 5CU4A 3ZLXA 3M2WA 4BDJA 4JQ8A 5G6VA 4FTOA 3ZTXA 4EOQA 3HL7A 3HUBA 3GT8A 4YO4A 4QQ5A 1HOWA 3QGYA 3U6JA 2R7BA 3MPTA 4QO9A 4E7WA 4KBAA 5AP2A 5K4IA 4FV9A 2C0OA 3HZTA 5EHLA 3DZQA 4CLJA 3DQXA 3VUDA 3V6RA 2W5AA 3V5LA 4DYMA 2CCIA 4P5ZA 4RFMA 1T46A 3AT3A 4WIHA 5JRQA 1LEWA 4O0RA 2CCHA 3E8CA 5GHVA 4DE4A 2OZOA 4Z7GA 2J2IB 3AD5A 5AAGA 4CFUA 5ANIA 2W05A 2XK8A 2G01A 4IM3A 2BZKB 5BVWA 3KCFA 5IA1A 5FP6A 3JVRA 1Q8YA 1PXIA 3A7JA 2F7XE 3DTCA 4R7BA 3DJ7A 4FTIA 4X2GA 5BYLA 3BX5A 1TQMA 4OBQA 3BHYA 4FT0A 4IANA 4CFFA 1ZOHA 3MJ1A 2DUVA 1G8AA 4JXFA 3S95A 3BGQA 1PXPA 3POOA 3MIYA 2FYSA 2Y0AA 3UDZA 4L67A