4EH7A

Human p38 map kinase in complex with np-f6 and rl87
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
351
structure length
337
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Natural-product-derived fragments for fragment-based ligand discovery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 108
structure length 337
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eh7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eh7A01
2QG5A 2WFYA 3ROCA 3ORLA 3SVVA 2XJ1A 3PXZA 3CTQA 2CN5A 3QGYA 2PVKA 4J96A 5CF6A 4EBVA 4IX4A 4NJDA 5FXQA 2YAKA 4E1ZA 4XG9A 4EQMA 2J6MA 3PFQA 4QTDA 3GQIA 5EYCA 3UP2A 4OT6A 2QOBA 3CE3A 3HMMA 3NSZA 4LRKA 2BAJA 2X7FA 4RIYB 1ZMWA 3O7LB 3CGFA 1PY5A 3PIZA 2HXQA 3D7ZA 3UNJA 5I0BA 4C59A 5F95A 4M68A 4BCIA 5DRDA 4YP8A 4BDCA 3QD0A 3LVPA 4EONA 2GQSA 1YXXA 3MIYA 5FRIA 4EH5A 5JFWA 4CKJA 1HCKA 1ZZLA 3MWUA 5EYDA 2W0JA 4J1RA 1OUKA 3D7TA 3O17A 1OL1A 3KF4A 3NZ0A 3AC5A 4C0TA 4DINA 1U54A 3P79A 2QU5A 3FYKX 4ASDA 2JFLA 3LMIA 2PMIA 3PJ2A 4TY1A 3DB6A 2KULA 4OR5A 4FK3A 3WE8A 4RZVA 2P55A 1H0VA 4RC4A 3W8QA 4R7BA 4O96A 5ANOA 4FEVA 3F6XA 4G5JA 1IEPA 4S2ZA 4MX9A 2IW8A 2OXYA 2WMAA 2WQMA 3FZRA 3NCZA 4IZ5A 4MAOA 4D1SA 4QQ5A 4XG3A 2B9FA 1URCA 2WTDA 2O5KA 1FMKA 4F1TA 3A99A 4QMVA 5HG7A 3LXLA 2QHNA 1JKTA 2O0UA 3DBFA 4W4VA 4CYIA 3TN8A 5ANKA 5IA2A 1VYWA 2QC6A 2DWBA 3FQHA 3K5VA 3D7TB 4EZ7A 1OZ1A 5FDPA 4YNEA 1U54B 2XK6A 4CT2A 5A4QA 3SW4A 4FNZA 3I0OA 3R1SA 5AV1A 1XH9A 3FUPA 2I0YA 4K33A 2QD9A 5EM6A 2JC6A 4ZTRA 3KFAA 1WVWA 3IPHA 4IHPA 5HHWA 4BN1A 2YWPA 4PTEA 4YJNA 5HLNA 3FC2A 2UW0A 4H1MA 5IF1A 5C4LA 5AX3A 4FL3A 4RSSA 3IK3A 4CMUA 5CZHA 4RJ5A 3ZCLA 3QL8A 3SAYA 1OI9A 4PL3A 2GTMA 3VUDA 4W8EA 4FKTA 4OGRA 4NK9A 3QLFA 2X9FA 3COHA 4U80A 5I9ZA 3VJOA 4MBLA 1OL2A 3QD4A 1UU9A 5M51A 2ZM3A 3PVBA 3DPKA 4Q2AA 4YZBA 5HO8A 4IDVA 3C4XA 3FLWA 4QP9A 4FTLA 2VWWA 4TNBA 3QC4A 3FMKA 3SW7A 5BVNA 2OU7A 3T9IA 4RWKA 4BI2A 3EN7A 1ZARA 3A7FA 1OBGA 2Y0AA 4CKRA 4NEUA 3RGFA 4XEYA 1CKIA 3OWJA 1V0OA 2XIZA 4C4JA 3UIBA 5CS6A 4F1OA 4J95A 4W4YA 3OFMA 4HGSA 3RK5A 1BMKA 3BPRA 5EQEA 3MVJA 4RIWB 1XH5A 4LV8A 4DT9A 2EU9A 3E63A 5K0XA 2OI4X 4QMYA 4ZTMA 4FEWA 3HV5A 4IIRA 4IVDA 4X21A 5HICA 3FQSA 4TYIA 2CCHA 3T3UA 3PWDA 4G6LA 1JSVA 4FTQA 3EQRA 1YOLA 4CTBA 5FXRA 4JL9A 2IO6A 2HZIA 5I9UA 2VWVA 1UKHA 2WU7A 3DOGA 5FM3A 3WZUA 4LMNA 4F1MA 1YI6A 5HD4A 3QCSA 2WD1A 3MA6A 3IW5A 5CXHA 2EXEA 4NM3A 1W8CA 3W2CA 4F0FA 4YLLA 3TKHA 4YGAA 2IG7A 4A07A 4JG6A 4RA5A 1O6YA 3R8UA 3O23A 1FOTA 1DI8A 4IB0A 5GJDA 4RZWA 1MRYA 3MFRA 4ANSA 4L42A 5JZNA 2UVZA 3KN6A 1JSTA 1WBOA 3DQWA 4NH1A 5KX8A 3L9PA 2BUJA 2WAJA 3EKNA 4XLVA 5AP2A 5IA5A 4KABA 4X2JA 3MS9A 2I1MA 2YLEA 5J8IA 2HCKA 3C0GA 2IW6A 4CFXA 2VWIA 1R1WA 1A9UA 2UW9A 3H0ZA 4C38A 4XBRA 1FINA 2GS2A 4EHVA 4WRGA 4CMTA 4L7FA 3FMHA 3U87A 3GFEA 3DBDA 3VHKA 3V5JA 4DAWA 1M52A 4ZTNA 4XJ0A 5AA8A 3UP7A 3AGMA 3F88A 4IAKA 1K9AA 2VTRA 2WIPA 3H10A 3WF8A 1GY3A 4WG3A 3VW8A 2P2HA 5HLWA 2JDOA 2OSCA 5BUJA 4I0TA 3GEQA 3MI9A 5K0KA 3UOKA 4CFWA 2HZNA 4O38A 4LL5A 3B8QA 3AMYA 3VC4A 5HVYA 4DGNA 2VTIA 3OD6X 2XVDA 3V8TA 4U3ZA 4MTAA 2C5OA 2LGCA 1DM2A 4HVDA 3VQUA 4IW0A 4TL0A 2CGXA 2YCFA 3OROA 5L8JA 1IAHA 4QMLA 4GYIA 5CALA 4JAIA 4XRLA 3GP0A 4K8AA 5AUVA 4BCGA 2Z7LA 5M4IA 4DEGA 5I9VA 4JBQA 3HL7A 2BRHA 3CGOA 3VF9A 2YITA 5DLSA 2W17A 4O7RA 2ZMDA 2YN8A 2R3LA 2CSNA 3A7JA 3VQHA 4PY1A 1WBVA 3GCPA 4UWBA 3BV2A 3BV3A 3P78A 3ZEPA 5J1VA 2FSTX 4TNDA 3QX2A 3MB7A 1JNKA 4FKOA 5CF8A 3II5A 3H9RA 2OWBA 5HBHA 3PVWA 3SHEA 4AX8A 3PRFA 4PPAA 3P0MA 4OW8A 3C50A 4ALWA 4LRJA 3QRIA 3KXHA 5FQDC 2OZOA 3PPZA 3U4UA 5C1QB 4XV3A 3FEGA 3Q96A 5A54A 3K54A 3O8UA 4RJ8A 3PXQA 4WOVA 4D1XA 5LCKA 3QKLA 2YHVA 3KRRA 5M09A 1PJKA 4IX3A 5L6OA 1ZLTA 2WQEA 2PZRA 4QMUA 4ORKA 2C1AA 5I9YA 2R3FA 3MY0A 2VO7A 2HENA 5E92A 4K2RA 4J98A 1R39A 3ACJA 2PE0A 5AV4A 3QQFA 4H3BA 4XNEA 5BUEA 3WI6A 4ZMEA 2R3JA 2R4BA 3B2TA 4O81A 2WGJA 4EHZA 4GT4A 4JG7A 1DS5A 4RJ4A 5M4UA 3QGWA 4QNAA 2V22A 3LLAA 2XH5A 4ACCA 2J50A 2X4ZA 4FODA 3OUNB 4IVBA 1OIQA 4HNFA 3OW4A 3S4QA 5KNJA 3DZOA 3EIDA 3O7LD 4B6LA 2GNGA 4YJOA 1QMZA 3EYGA 1GIIA 3RINA 3RK7A 3ENHA 5KKRC 4FZDB 3NPCA 5HVKA 4KS7A 3WZEA 2A27A 3OBJA 2X4FA 2PVLA 3G6HA 3C0HA 4BBEA 4PDOA 3Q52A 4ERWA 3TZ8A 5CU0A 2OFVA 2WOUA 4IAAA 3HA8A 3UZPA 4FV9A 4PF4A 2PVHA 4HYSA 1YI3A 3S00A 2JDRA 1VYZA 2GHGA 4PDYA 3FZ1A 5F20A 3H9OA 3DK7A 2HK5A 5I9WA 4NM5A 4BKYA 4F70A 3OS3A 2PZPA 4JQ7A 4YSMA 4ZZOA 4DBXA 4MNEA 1J3HA 1G3NA 3AC1A 3E8CA 3OEFX 2WQNA 2J2IB 3UGCA 4O7LA 2QR8A 5IH6A 5AWMA 1YXTA 3JPVA 2R3KA 2YIXA 4YBKA 2YCSA 4JIAA 4BDKA 2CHLA 2FSOX 5DT0A 3SDJA 1O6LA 3HECA 4U79A 3S2PA 4ZJVA 3AC3A 3UZRA 2XS0A 4EUUA 4BTKA 3AD5A 3B2WA 5KO1A 4RJ3A 2VNWA 1U4DA 4DC2A 3QTIA 4FV1A 5CI7A 5DRBA 4DH1A 4ACMA 2VTJA 4G34A 3PJ1A 3GGFA 4UWCA 4EL9A 3E7VA 3AGLA 5AA9A 1H0WA 4MBIA 4MNEB 3A61A 3NLBA 3UMWA 4GRBA 2OK1A 4ZLZA 3G2FA 3O51A 3MBLA 3CP9A 4JX3A 2XIRA 3OCGA 4Q5EA 4WBBB 4EJNA 4U44A 2R3QA 2JITA 4OTRA 2P2IA 2OW3A 4L8MA 2GFSA 2UZWE 2XNPA 5DHJA 5K4JA 4FSZA 2JKMA 2BDWA 2UZOA 4CSVA 2C6IA 4EOIA 3HUCA 5CF4A 4IX6A 3U9CA 3LFFA 5CEPA 3MPTA 3LOKA 5C8MA 3OHTA 2JAVA 1OUYA 4ACDA 2W1GA 3KL8A 3KN5A 4EHGA 2YM3A 3HMOA 4O2PA 5HQ0A 5DYJA 4HVIA 3W8LA 3QZFA 4IC8A 3R83A 4ZP5A 2Q0NA 3ZMMA 3VJNA 4ZMFA 3ET7A 5D7AA 2E9UA 2YIRA 3I0QA 4XV1A 4LFIA 2WMSA 2EUFB 4FT0A 4O7YA 3BX5A 4GMYA 3ODYX 2VX0A 4RPVA 5CU6A 4CNHA 4X2FA 4EOPA 4F4PA 5IA3A 2PU8A 3AMBA 4FTTA 4BDIA 5JT2A 4F99A 4AE9A 2BZIB 2EB3A 2QOIA 3MA3A 4M8TA 3CD3A 5JGAA 4P5ZA 4N6YA 2B55A 4N4SA 4RVLA 1W7HA 3ALNA 4X3FC 3VO3A 5T6KA 2GMXA 4OT5A 5DN3A 2H96A 3E3PA 3SX9A 1R78A 3UBDA 1H4LA 4BL1A 1GOLA 3AT3A 3W2OA 5DT3A 4YR8A 4FSYA 2WMWA 4J97A 3GU5A 5I3OA 5HG5A 4FTJA 1PMEA 3BIZA 3GC0A 4FKPA 2ZM1A 3SA0A 4I21A 3DKCA 3DTCA 3OTVA 4YJUA 1BL6A 3LFSA 5CU3A 5IH5A 1PXNA 5IDPA 2R3GA 4NWMA 5DOSA 2IVSA 1ZWSA 3HKOA 3GC8A 4KKEA 5C8NA 3CQEA 3ZO4A 1WBNA 4ARKA 2OG8A 3A2CA 4AZFA 2LAVA 1FMOE 1UWJA 4AZWA 2E9VA 3TJCA 2J51A 3WZJA 1SYKA 4HVGA 3E8EA 2Z2WA 4NKSA 5HKMA 2QO2A 2ZDTA 3R2BA 4FICA 2OIQA 2QO9A 3VVHA 4V01A 5ETCA 1WBPA 3RJCA 2YM7A 3IW6A 2I0HA 4AW1A 4BWKA 3FI8A 5AP4A 1WFCA 5IQFA 3ZDUA 2XB7A 2XNGA 3L8XA 3LPBA 3FLNC 2QKRA 4QP4A 3PLSA 3TKUA 5CLPA 1M2RA 3KULA 5HU9A 4ITIA 4O0UA 3RPVA 1J7LA 2BAKA 2QLUA 4U8ZA 3LHJA 1UNLA 1XQZA 2YCQA 5FP5A 2YM6A 4I92A 4QTAA 2ITQA 5LVNA 2YDKA 2O63A 4GG5A 5AIKA 4AA4A 4E73A 4E8AA 3PA4A 4S32A 3ZZWA 4BTFA 4YBJA 4Y5QA 2BRNA 4NTSA 4C35A 5E4HA 4QP2A 4OTGA 4O0VA 3CCNA 3MFTA 4O0TA 4BC6A 3CQWA 4E5WA 3LCSA 5AV3A 5KKRB 3UVRA 2Z02A 1ZXEA 3BBWA 3GUBA 1IG1A 1OL7A 4NUSA 1URWA 3K3IA 4ENYA 5CX9A 5BVFA 3A4PA 2WOTA 5DFPA 2ITNA 5CSWA 4QQCA 4II5A 4UMRA 4L01A 3KULB 2R3NA 3THBA 3DK3A 5HBJA 2EXMA 1YW2A 4ALUA 4DFYA 2X8DA 2JDSA 1V0PA 4TWPA 4FL1A 2VWBA 5CEMA 2PZIA 3TL8A 5KMOA 3FZSA 4ZZNA 4FV4A 3CC6A 2UZEA 2ONLC 3R9OA 1XR1A 3VBVA 3IO7A 1ND4A 3RZBA 3TUDA 3R9NA 4D28A 3EN5A 4M3QA 3QUPA 3VUGA 3QA0A 2ITZA 3R7EA 4FV0A 5CNNA 3K2LA 4DTAA 3N51A 4KIQA 4BDBA 3DXQA 4CV9A 2OIDA 4QMZA 3O96A 3LFBA 3KEXA 5HX6A 3F2RA 3PDTA 1Q62A 3Q6UA 3OT3A 1VR2A 2P3GX 3EQCA 4BY9E 4PNKA 3BQCA 4MXAA 2E9OA 2XNMA 5KMIA 2FB8A 3FL4A 5F1ZA 2PUIA 5ITAA 1GZ8A 2UV2A 4CXAA 2G2FA 1MQBA 2CN8A 3WILA 4PPCA 4GFOA 3ZEWA 2XYNA 3EOCA 2E9NA 3FHIA 4DYMA 4E5BA 1PXJA 3EQPA 3OXIA 4JAJA 4FG8A 4QP6A 4DHFA 5CY3A 2X6DA 4GSBA 1GNGA 4UXQA 1GZOA 3OEZA 4XLIA 3QU0A 3ATTA 2PTKA 5LVLA 2GFCA 3K5UA 3L9NA 4B0GA 4NW6A 5DEWA 2C69A 2UW3A 5DEYA 4EOOA 5KMJA 2G2IA 3LCOA 4I6BA 4P7EA 3T3VA 3OY1A 4ZY6A 3PPJA 3D2KA 2HWPA 2WEIA 3F3VA 4X3FA 1M7NA 3LCTA 2X8IA 4FNXA 4LRMA 4AQCA 4EZ3A 3DFAA 4K18A 4D9TA 2B4SB 3ZU7A 4U81A 1KE6A 3PLAE 1I09A 2JDVA 4IVCA 1PKGA 3KXXA 3LIJA 3SRVA 5JFVA 4YLKA 4FZFB 5TE0A 1OKYA 2CNVA 1B39A 4TYJA 3HAMA 5EYKA 5EHOA 4M14A 1U5RA 3FJQE 4R8QA 4NFNA 5EW9A 4BCQA 3ZS5A 3HAVA 4NSTA 3Q4CA 1U59A 1YRPA 3ORNA 3DDPA 4FKVA 5AAGA 3DXPA 4O83A 1LEWA 4APPA 4FUXA 4FT9A 4R5SA 2OZAA 3UPXA 2WNTA 4X3FB 2R7IA 3OWPA 2BDFA 2GU8A 2ZB1A 4G5PA 4CZTA 3BGPA 4Z9LA 3U6JA 3PY3A 3BGZA 1J1BA 2JDTA 3FKLA 3QQHA 2W99B 2FUMA 4GK2A 4H3QA 4L67A 5FGKA 3E3BX 4GFMA 4FSNA 3E87A 1JOWB 2ACXA 4ID7A 4QYHA 4MD9E 4RIOA 4RIXA 3SRVB 2HELA 4EOQA 3QQKA 4E6AA 2EWAA 5HE0A 5F4NA 4IVAA 3NS9A 4GS6A 4O21A 4WHZA 4ZS0A 4BCPA 3L8PA 4YJPA 4R6VA 1BI8A 3LMGA 4HYIA 2VX1A 3F3TA 1QPJA 2XIKA 4OTWA 4JRVA 1KUTA 5I4NA 3DXNA 3GCVA 4O7TA 1KSWA 4I5HA 4YJTA 3JYAA 5DR6A 3MW1A 1BKXA 4IWOA 3OC1A 5IEVA 2XCKA 5HESA 3FXXA 2YZAA 3ZLWA 4FL2A 4MBJA 1ATPE 2OZAB 4IJ9A 4IC7A 1XWSA 5CU2A 5H8BA 5I5ZA 3OT8A 4G3GA 2Z7SA 2C5NA 5IUIA 4RMZA 2B53A 2BRMA 4L44A 3W32A 1UKIA 2W1FA 3DY7A 5IEXA 3QTXA 2V0DA 3C4CA 2W4JA 2F7XE 4FIGA 4RIXB 4A9UA 3TNWA 3QHWA 2WMXA 3C4WA 3PIYA 4BZNA 3SV0A 4K6ZA 4BCJA 2P0CA 4FTCA 4MWIA 2RKUA 2X6EA 3WYYA 4YNOA 2H6DA 4ZLOA 4ZXTA 5DMZA 1GIJA 3MPMA 2JKOA 4QP8A 3QZHA 4WNPA 1ZOGA 4FV7A 4O27B 2O3PA 1WBSA 3DS6A 5CZIA 3V3VA 2R3OA 3PVUA 3QZIA 4E7WA 2VV9A 4D4VA 4BFMA 5FD2A 3QX4A 3L8SA 4Z7GA 2ONLA 1Y91A 3VIDA 4FGBA 3NUSA 3R28A 4F6UA 3LFDA 4JR7A 3R9DA 1KV1A 5ACKA 5HO7A 4GU6A 4W8DA 3GCUA 4YZNA 4U41A 1O6KA 3FDNA 2PYWA 4G31A 3ZUUA 1VZOA 3FLZA 3UNKA 4DG2E 4PRJA 4NIFA 4ZEGA 4AACA 4CFFA 5IMXA 4O7SA 2C6KA 3F66A 2ITXA 4LYNA 4R7IA 2JIIA 5K5NA 4GVJA 5AR4A 2HZ0A 4G2FA 4AFEA 1TQIA 4GG7A 5T68A 4FTKA 3ZXZA 1IRKA 5TR6A 2JGZA 1PHKA 5CT7A 3TV4A 3NVKI 4IFCA 4XYFA 2ZM4A 4QMXA 3RM7A 4E4LA 4EH9A 3BGQA 4X2GA 3DA6A 1H27A 3EQDA 4BZDA 2GNLA 2YM4A 3R6XA 3AT4A 3UIXA 4FSQA 4J7BA 3LQ8A 5J79A 5LMBA 5EQYA 3EYHA 1UV5A 4QP7A 2CNQA 4AZEA 2XK4A 1JKKA 1QPEA 2VTAA 2XMYA 4KKHA 4NIFB 2C0OA 2OICA 1PRYA 3IDPA 3GU8A 3QCQA 3CY3A 4MVFA 1DAWA 3CIKA 3UC4A 4HZSA 2GNHA 4L3PA 4DEHA 2Y6OA 1TVOA 4BGGA 3UIUA 3QCXA 4AOTA 2ZJWA 3E88A 5IU2A 2WQOA 4MD8E 1FBNA 3IOPA 5AP7A 1YDRE 4DGMA 4EI4A 5KBQA 3TUCA 3COMA 4C4HA 3NUUA 1S9JA 4C3FA 3O8PA 2WTKC 5J95A 4NM0A 3MIAA 3VBXA 4B8MA 4Q9ZA 1PXPA 3NUAA 3C1XA 3TXOA 2R64A 3D9VA 3K3JA 3R01A 3POOA 2G15A 3PTGA 4USFA 3OCBA 4PP9A 4J8NA 5FBOA 5F9EA 1H08A 2QNJA 4ZSEA 3COIA 2Y8OA 3VULA 5AAEA 1QPCA 3DBQA 3OTUA 5HIDA 5AM6A 3ATSA 3TT0A 1W98A 3E93A 3EMGA 3DKFA 5AUUA 4EC9A 4D4RA 4MD7E 3SOAA 3ORZA 1W82A 3ACKA 3M2WA 4DE4A 3BU3A 3LM0A 3DV3A 3VHEA 4LGDA 5GZAA 4B99A 4DEEA 2C3IB 3E92A 5AJQA 5CEIA 2VRXA 3EL7A 1H1WA 3ZYAA 4QPMA 4E5AX 1TKIA 3F5GA 4ASEA 3F7ZA 2XIYA 4EKKA 4FEUA 5IQCA 2HWOA 2C6TA 2OH0E 5EM5A 4FT5A 4MNFA 4AGCA 5M57A 3PSBA 5L4QA 1J91A 5K5XA 2X7OA 4XG2A 1YHVA 2YERA 2UW7A 3EZRA 3G51A 4KBAA 4TZRA 2AC5A 1YDSE 5E8UA 2PE1A 4G1WA 4EH4A 4L46A 2CKOA 4FIIA 5CAOA 3QFVA 2YJSA 4AF3A 2PZYA 4EYMA 4DCEA 5L8KA 3NAXA 5HI2A 1OIUA 3PY0A 3L8VA 4KIOA 4YTIA 2C0IA 4XUFA 2G01A 4FTRA 1Q61A 4FG7A 4TN6A 4P5QA 4DH8A 4ERKA 2WPAA 4IM3A 4ZAUA 3ETAA 4WG5A 3MTLA 4Y85A 3OCSA 2JIUA 4RVTA 2C0TA 5H8GA 1SM2A 3ALOA 3KMUA 3EQGA 4LQMA 4EQUA 3OG7A 2J7TA 3DTWA 3MV5A 3U4WA 3VRYA 3BLQA 5FEDA 3LE6A 2BRBA 2XK8A 4PQNA 4JLCA 3VS6A 1PXOA 2UZVA 2ZV9A 3R00A 4FKJA 4DF3A 4MEDA 3RHXA 4AWIA 4TWCA 2I6LA 3SLSA 4GJ3A 4DH5A 1NT2A 4ANQA 3D2IA 4IWDA 4KBKA 1GZKA 3V01A 4I20A 4HPUE 3ZLYA 2W9FB 5DT4A 4O86A 1OB3A 4PMPA 2VGPA 4RX8A 5FUTA 4XHKB 3GU6A 4WBOA 4DLJA 3IECA 2NPQA 2OIBA 1U5QA 2PUNA 5BPYA 4RFMA 1SNXA 3RPSA 1UU7A 3VF8A 2F2UA 2XIXA 3NR9A 3HDNA 2IJMA 2UZLA 4GCJA 3FSKA 4HCVA 3DGKA 4WKQA 3TZMA 4C33A 1CKJA 4N0SA 5CANA 4D4SA 2WIHA 1ZOEA 5A9UA 4GUBA 5HCXA 4KD1A 4OAUC 2F9GA 3EN9A 3FI2A 3IDBA 5HG9A 1P2AA 3DZQA 3S95A 5C8KA 4NU1A 3QQJA 4G6NA 3WF6A 3FI4A 3TKIA 3KXMA 3R7VA 3KK9A 4TWNA 4QMQA 4MXYA 3MH2A 2UVYA 5D9HA 4R77A 3DK6A 3VUHA 4Y8DA 5EQPA 4M12A 2OJFE 3ZONA 1PYEA 4XCUA 4ZLYA 2X2LA 4EH6A 2UW4A 3MH3A 5JRSA 3LM5A 3NYNA 5D7VA 4M15A 4AW0A 2A0CX 1ZOHA 2J0IA 2I40A 3UMXA 3L9MA 4U42A 4AZVA 3C7QA 4E6DA 3CKWA 4TXCA 5IUHA 2I7QA 4IBMA 1LEZA 1LR4A 4I3ZA 5BUIA 1Q41A 1UNHA 4FR4A 1VJYA 4G3EA 5CWZA 3T9TA 2JFMA 3PIXA 4BTJA 3PZEA 4KIPA 3KU2A 4BDJA 5M06A 3F5XA 2PHKA 2KTYA 4FK6A 1YWNA 2W05A 4FV2A 2VNYA 3E8NA 3ULIA 4IDTA 2YWVA 3W55A 3RALA 1XH8A 4C4GA 3G9LX 1F3MC 1YHSA 4KB8A 3BHVA 5TF9A 3WZDA 2VTLA 2O64A 2RIOA 3ODZX 5J9YA 2CKEA 5CTPA 3FV8A 4YHFA 3QWJA 4C3PA 3M11A 3OWLA 3W16A 4O0SA 4WO5A 3U6HA 3POZA 1JKLA 3MY1A 2ERZE 3G6GA 3FKOA 4JJRA 3JXWA 3WF7A 4Y72A 2O65A 2IPXA 3KRJA 4FEXA 5IQGA 5IQDA 4DLIA 5AADA 2Y4PA 2DYLA 2Y4IC 3R0TA 5HO6A 2BDJA 2WTKB 2AYPA 5AEPA 5K9IA 2GQGA 2X2MA 5G1XA 4WD5A 4C2VA 3LZBA 1WVXA 3CXWA 3EFJA 3KY2A 4BHNA 4QMOA 3TACA 4JIKA 5L6PA 4EQCA 3FI3A 3BYUA 5AX9A 2HZ4A 3UDBA 1CDKA 4E6CA 4QOXA 1RJBA 2B1PA 2CGUA 2UZBA 4M13A 2QCSA 2XK9A 3F61A 4XP0A 4CFNA 4E4XA 1OECA 5FXSA 3HV6A 5GIOE 3UZTA 4QD6A 5CQUA 3BRBA 4NFMA 3W2PA 5CAQA 3I5NA 2C5YA 5IH4A 3TDVA 4IM2A 4DFUA 5GHVA 5A6OA 5AUTA 5IEYA 5KZ0A 4ITHA 4OTDA 5IDNA 1O9UA 4C8BA 3OBGA 2YM5A 1MQ4A 5EDPA 4MH7A 3W18A 4ZSAA 2YACA 4AXAA 3VBWA 5IUGA 2GQRA 3VBTA 4BIEA 5HX8A 3Q53A 4QTCA 2HOGA 3MFUA 1JAMA 2OGVA 3G0FA 1Z5MA 2BVAA 4FTIA 1R0EA 2DQ7X 2ZDUA 2R7BA 3DJ6A 4NKAA 4O6LA 5EKOA 1HOWA 3FMLA 3TUBA 4MQ1A 3CS9A 5BVOA 3R04A 4ZS4A 3RNYA 3FMDA 3TJDA 1OBDA 3O8TA 5E8SA 3QTWA 1ZYLA 3VBQA 2VO6A 5DH3A 4WNMA 3IGGA 2ZAZA 2WB8A 3B8RA 3JUHA 4KNBA 1A06A 4RX7A 5EDQA 3KRLA 1K2PA 5B7VA 4CRSA 5JFSA 2C4GA 1LUFA 2IVTA 3MY5A 1ZAOA 2BHHA 2GHMA 4H39A 3C0IA 2CLQA 4EWHA 4O1OA 5C03A 1ZMUA 3GBZA 5LMAA 2Z7QA 3R7YA 5IG1A 4FTUA 3L9LA 2OF4A 3V5PA 4ASZA 4CCBA 4EOMA 4ZJJA 5GZ9A 4O7ZA 4YC8A 3C4FA 3C5UA 3PZHA 2JAMA 4RFYA 2JIVA 3P08A 5AR7A 1I44A 5H9BA 4A9RA 4IWPA 1H25A 4RJ7A 3UOJA 3BHHA 4TYGA 2X1NA 5E9EA 4R1VA 2PWLA 3UE4A 4R3PA 4UN0C 2XNEA 2VTTA 3GQLA 4GYGA 3KK8A 4CYJA 4UXLA 1XH6A 5AP5A 5EM7A 1ZY5A 2W9ZB 5GJFA 5CSVA 1OKZA 2EB2A 1J1CA 3PVGA 4C61A 1NVQA 2FSMX 3PXFA 4IADA 3TV6A 3TV7A 3ZUTA 4MXCA 4AG8A 4EOLA 2R2PA 3PA5A 3HMNA 4X0MA 3QYZA 2WMUA 3KRXA 3F7WA 4LOOA 5HU3A 2R3HA 5IQEA 4M67A 1K3AA 2ETMA 2XKCA 4UZDA 3VW6A 2JBPA 4UWYA 4O1PA 3VUIA 3DKOA 3NIZA 1CM8A 4FSWA 4X7QA 1GJOA 2VTQA 4W9XA 4DA5A 5TT7A 3RHKA 2XJ0A 4BGQA 5DIAA 3RP9A 3V5LA 2HW7A 3PWYA 4EH8A 5K4IA 3JVRA 4BDEA 4UMPA 3LMHA 2VD5A 5C9CA 2E2BA 4D2WA 5HLPA 3R63A 2NNWB 3LXPA 4U43A 4RWIA 4UMUA 4X6RA 1NVSA 3SG9A 2C3JA 5A3XA 1JPAA 2A1AB 4HPTE 4QRCA 4FIHA 4OBQA 2C5VA 3NRMA 3ZBXA 2UW6A 1R3CA 3ZRLA 4KINA 2I0EA 4S34A 1ZZ2A 2WTCA 4OUCA 1Q8UA 5D1JA 3ANRA 3LFNA 5EH0A 5BYZA 4S33A 4AS0A 3LFEA 4R78A 1L8TA 4H1JA 4UMTA 4EZ5A 3AC8A 2CGWA 2HY0A 4V0GA 4F6WA 4CV8A 1WBTA 4FKQA 4XOYA 3VS4A 3R8VA 4J99A 5EFQA 2PUUA 4AE6A 4PL5A 4IB5A 3I4BA 4AGDA 3I7BA 3QTSA 3ZO1A 3IOKA 2C3KA 3DNEA 5BX0A 1OPLA 2H34A 1PXLA 2V7OA 3LFCA 3A7HA 3Q4ZA 4BBMA 3UQCA 2ZVAA 2C1BA 4M0YA 2QLQA 4AGUA 2G2HA 1NVRA 1Q8TA 1SMHA 3P7CA 4EORA 3ENMA 4M66A 3ZRKA 5DVRA 3PYYA 1H00A 2Y4IB 1PF8A 4DFNA 4R7HA 4C57A 4F7SA 2CJMA 2ETRA 2GTNA 3I6WA 4BKJA 5GINE 4KKGA 3ZO2A 1RE8A 3R02A 4V0GB 4WIHA 2O2UA 3KA0A 4AN9A 2B52A 5KE0A 4YTFA 4FKUA 3DU8A 2QQ7A 3REPA 4L53A 3UOLA 3NDMA 5HNIX 3P7BA 2PULA 3I1AA 3N4TA 2P4IA 2X2KA 2W7XA 5BVEA 3NYVA 3CJGA 4I6HA 4QMNA 2Q83A 4Q5HA 4YURA 4E20A 2PPQA 3EFLA 3IS5A 3ULZA 1H01A 4YUQA 4NYEA 2YIWA 4DG0E 3FLQA 1ERKA 3I6UA 4JDHA 1EH4A 2OJGA 4L7SA 3VUTA 5AR8A 5J9LA 3E5AA 1REKA 2IW9A 3KXZA 4UYNA 3OCTA 4U45A 1XBAA 5CEQA 4YZDA 3UODA 5T3QA 1Q3DA 3ORKA 3IKAA 4O2ZA 4CG8A 3Q2JA 2XK7A 3CQUA 1JBPE 4TYHA 4I22A 2Q0BA 4RVMA 5AP6A 3ZHPC 4BCFA 4X2KA 4JDIA 3UIMA 2BZKB 2VN9A 4OTPA 5J7BA 4S31A 1XBBA 2YM8A 4M0ZA 3KXGA 3R7OA 4FMQA 4EBWA 3LXKA 5ANIA 3DBCA 4O0YA 1T46A 4YJVA 3VWAA 4ANBA 3RCJA 1Z9XA 4DGLC 3P23A 4FVQA 2WQBA 1V1KA 3IQ7A 4IJPA 2PVJA 5M4FA 4TW9A 2GS7A 2VWZA 4EOJA 3EQHA 3R7GA 3E7OA 3C5IA 3IW4A 4JDKA 4BDFA 4BDGA 4BI1A 4I5MA 3QQLA 3ROYA 4BVUA 2DUVA 2WTJA 3M42A 2OFUA 5IZFA 4TYHB 4A9SA 2RF9A 4H05A 1F5QA 5HCZA 1RDQE 5CSXA 1FVRA 4FZ7A 3HLLA 5HTCA 3LCDA 3SKCA 4D2VA 2W4OA 3QRUA 3RAKA 4LG4A 3EQFA 1ZYDA 5FP6A 2VUWA 1Y8YA 4ASXA 5CEKA 3DKGA 1Y6AA 4GV1A 2QOHA 2PUPA 2PL0A 4DFZE 5IQIA 2EXCX 2Z60A 1YDTE 4PV0A 3IONA 2WMVA 3IW8A 3UPZA 5EOLA 5AUXA 2AUHA 5AR5A 3W2SA 3QRKA 5A4TA 3U51A 3JR1A 1XH7A 4JT3A 5C27A 1UVRA 2WO6A 1AQ1A 4C37A 3FHRA 3QUEA 4RJ6A 3D5UA 4Y73A 3UOHA 2PVMA 3VS1A 3WARA 3ZFYA 4HYUA 4EH3A 3U6IA 2QOOA 3NNWA 3EJ1A 2IZSA 2CPKE 4GJ2A 5KCVA 2WU6A 5J7HA 3QRJA 3OOMA 2XP2A 3E62A 3E8DA 3QKKA 3RAIA 3PSCA 4E4MA 1JWHA 3BI6A 4K0YA 4UB7A 4B8LA 4PTGA 2CLXA 3GT8A 3NEWA 2RFSA 3CEKA 3O50A 3QXPA 2R3IA 4CFUA 5HCYA 2QR7A 4FC0A 5DNRA 5EYMA 4QQTA 3EB0A 3LFQA 4BCMA 3NUNA 2FSLX 3CJFA 3Q9ZA 4I0RA 3ZSGA 4BZOA 3D5VA 4IQ6A 4FVRA 4XS2A 2JKQA 4F08A 3Q3BA 4L68A 5M56A 2W96B 2WMQA 5FM2A 2IVVA 4HOKA 3UC3A 3ZRMA 1G5SA 4GEOA 4XG8A 2BHEA 3P1AA 4IAYA 1JSUA 3CY2A 3MYGA 4NCTC 2VTPA 5FG8A 3RPRA 3OF0A 3RWPA 1RW8A 4OBOA 3MVLA 2C30A 4F0GA 4CZUA 1XH4A 4I4FA 4RFZA 4AN2A 5JMSA 4PNIA 5AUWA 5E7RA 3QTQA 3A4OX 4G16A 4E3CA 3O71A 3FL5A 3GXLA 3NWWA 3PXKA 4O91A 5M53A 4DN5A 2YLFA 2X9EA 3BKBA 4A9TA 3FMMA 3QF9A 3QXOA 3OMVA 4KIKA 3UVPA 4O0RA 2C6MA 3NX8A 4UEUA 4F9YA 1YXVA 1DAYA 2Z8CA 5BMSA 4HVHA 4PMSA 1E9HA 2BALA 4FSUA 3D15A 4RC3A 3ORTA 2XKEA 2F49A 5J5SA 4JX7A 2VTHA 3DAEA 3NYXA 2BR1A 3G9NA 5TOZA 3MDYA 3N4VA 4APCA 5CI6A 4YPSA 2VWUA 3TIZA 3NCGA 4D2SA 4V04A 2WMBA 5LCJA 1IASA 5ANEA 3IGOA 2CNUA 4KUJA 3UNZA 5BNJA 4I23A 3BU6A 5LMKC 2W1CA 2WKMA 4ITJA 4XP3A 5TO8A 4QYEA 3A7IA 4BKZA 2PY3A 1QL6A 4RT7A 4JI9A 1BX6A 2FYSA 5D41A 4ZJIA 4DFXE 2W1HA 3P5KA 5KMLA 1SVHA 4KIKB 1J7UA 1BLXA 4X3JA 2W5BA 3HUBA 3BWJA 2ERKA 5L2IA 2V7AA 3MTFA 1Y57A 3CKXA 3F5PA 5DPVA 2PVNA 4U0IA 3OVVA 4FKRA 2A4LA 3RZFA 4XP2A 2UZNA 5JQ5A 5CNOA 4AAAA 4D1ZA 4EEVA 4IZ7A 3ZXTA 4A06A 4XG4A 4PX6A 3RM6A 4AOIA 5M07A 3R7IA 3MH0A 5H8EA 4BICA 3SXSA 3IW7A 1WBWA 4U9AA 3WZKA 3IG7A 4CFVA 5A4CA 2QI8A 4KSQA 2JEDA 4OLIA 4F9CA 2CKPA 5GZ8A 3FQEA 3VBYA 4CLJA 2G1TA 1JKSA 4L3LA 2YIYA 4AW2A 2O8YA 2FGIA 3V6RA 4C2WA 4B4LA 5E8YA 4ZZMA 3I81A 4FI1A 4NTTA 3DQXA 4D2PA 4AOJA 4WNKA 3F2AA 5EI2A 3KC3A 2Z7RA 3FBVA 4ZK5A 4EK8A 3PA3A 3RAWA 5LQFA 4YMJA 4UMQA 1Q97A 3MJ1A 4KA3A 3FLSA 5JGBA 3GNIB 1OL5A 2W1ZA 3BEGA 4IEBA 5DGZA 5FTQA 5EHLA 4FIEA 3BBTB 3RKBA 2IZRA 4DH3A 3R8ZA 1FVVA 3MESA 2R3PA 1G8SA 3F3WA 3S1HA 3C51A 2X8EA 3HNGA 2OKRA 3QCYA 3Q4UA 1YXUA 3GOKA 4K11A 4JQEA 5IA0A 4PDSA 4IH8A 2X0GA 4TWOA 4PMMA 5G6VA 4N6ZA 2AC3A 2GNFA 4A4OA 2OLCA 2JD5A 4I6FA 3TZ7A 5IA4A 3W33A 5LOHA 3WF5A 4CRLA 4XV2A 5ETAA 2REIA 4E4NA 1XO2B 2NP8A 2A19B 2XNBA 2IN6A 2QOKA 2YEXA 5HBEA 2V62A 4FTOA 5I9XA 3G0EA 4IMYA 4I94A 3AD6A 5AP1A 3COKA 4CT1A 2BRGA 4CMOA 2VWXA 4Y46A 4A4XA 4FYNA 2VTMA 2NRYA 3UVQA 4MCVA 2A2AA 3AC4A 3NW6A 3LAUA 4A9YA 3CSVA 4N70A 4QPSA 3UYTA 4DEBA 3UO6A 2VO3A 4C62A 4OBPA 3DFCB 4EHEA 4JDJA 2CGVA 4O84A 3QRTA 2B54A 3BU5A 4KAOA 1UU3A 3OP5A 4HGEA 2QKWB 3A62A 4RBLA 4CKIA 3QD3A 3BWFA 3NUXA 4L3JA 1YVJA 3WF9A 3C4ZA 3GU7A 3PY1A 3BCEA 2I0VA 4WUAA 4BGHA 3LW0A 1Q99A 5CAUA 2BIKB 4HGLA 4NCTA 4BI0A 3FXWA 2RG5A 5KHXA 2F2CB 4IAZA 4O7VA 2XKDA 4ZY5A 1XBCA 3TNPC 1QPDA 2WTVA 1AD5A 1UU8A 4YC6A 2XM9A 1RQQA 3OXZA 3H4JA 2ETKA 4GK3A 2YCRA 4XG7A 4U7ZA 4OTIA 2VX3A 3GOPA 1F0QA 3O2MA 4MYGA 4V05A 3NGAA 1OM1A 4D58A 3RCDA 3QC9A 5AFVA 4RC2A 4DT8A 3ZSIA 5JEBA 1H1QA 3QZGA 5AUZA 4BCHA 2F4JA 4YZCA 2J4ZA 3BE2A 3EWHA 3LQ5A 5EKNA 4GT3A 4UBAA 3NW7A 2J0LA 3QTUA 3BHUA 4WNOA 5DA3A 4XRJA 2ITPA 5DI1A 1J7IA 2P33A 3MPAA 3F3UA 1Z57A 4WT6A 2JLDA 3UO4A 3OWKA 5E8VA 4YTCA 3S3IA 5JQ8A 1KE9A 4O0XA 3U55A 3H30A 2BIYA 4FSMA 4USEA 1SNUA 5A14A 2VTOA 3GI3A 5LMKA 4BDDA 5JK3A 3EN6A 3OW3A 3RBWA 1KE8A 3EFKA 4RQVA 4ACHA 4DFBA 2YAAA 4XMOA 3HRBA 4JS8A 4FTAA 4TT7A 4PL4A 3WIKA 4FT3A 3HV7A 4XBUA 1W84A 5M08A 1P14A 3EZVA 3Q32A 5AM7A 1L3RE 3P7AA 1ZYSA 3HVCA 4YLJA 5M4CA 2OJJA 4CGAA 4KSPA 2J5EA 4ONAA 4RWLA 3PG1A 4RA4A 4YHJA 3Q5IA 5AV2A 4BCOA 5L8LA 2PVFA 3VNTA 2QONA 3R71A 5C4KA 3VUMA 4C34A 3HV4A 4AU8A 4E6QA 3QYWA 4L43A 1SVGA 3N4UA 4WA9A 1UWHA 4U3YA 4FZAB 4DEIA 4FKLA 3KB7A 1H28A 3UG2A 2C6LA 5E91A 2J90A 2CDZA 2XZSA 3AD4A 5E8TA 3D5WA 2FA2A 5E8WA 4BCNA 3MVMA 2CMWA 3ZFXA 4YC3A 2Y6MA 4G9RA 4RIWA 5LVMA 4TYEA 3R7UA 1H8FA 4K1BA 1OMWA 3ZTXA 3QUDA 4BF2A 5DBXA 2E9PA 2YIQA 4MK0A 5E90A 3NNUA 5HD7A 5KUPA 4W4WA 4GT5A 3TG1A 4D9UA 4F64A 3Q6WA 3NAYA 3WOWA 2GNIA 4QP3A 5EW3A 4A7CA 4H3PA 3I7CA 4Z7HA 4RRVA 1PMNA 4IWQA 4R3RA 5AUYA 3CD8A 4FUYA 2HIWA 4G17A 4QMWA 3AMAA 4X6QC 3FSFA 3CLYA 4BDAA 3Q60A 1KV2A 3NVMB 3FMNA 3KVWA 1OL6A 2ITYA 2ZYBA 4UV0A 5AP3A 5HE2A 3EFWA 4AGWA 3HX4A 1YWRA 2NRUA 3BLHA 2R3MA 4YZ9A 3EQBA 4UZHA 3CR0A 3ZH8A 5GIPE 4USDA 3MB6A 4Y5HA 3R8PA 2FH9A 3LLTA 4QMTA 3G33A 3ZBFA 4D55A 5J5TA 2IWIA 2DS1A 3Q9YA 4ZSLA 4YSJA 2ITWA 5TKDA 3R2YA 4KS8A 2XA4A 1OGUA 2WZJA 1ZY4A 3R22A 4AZSA 5FBNC 5A4EA 4FE2A 5JFXA 1WCCA 4QNYA 4ANMA 3KCFA 2WELA 3PPKA 5KMKA 5B2MA 4GFGA 1LPUA 3QHRA 4RG0A 3VRZA 2B7AA 4QTBA 4B7TA 3FE3A 5JKGA 4YPDA 5AV0A 2OXDA 4CVAA 2B9IA 2H9VA 2QOCA 4QQJA 4C7TA 4O7NA 5IQHA 2G9XA 5BVDA 3MVHA 1MUOA 2PMLX 4WSYA 3V51A 4DGOA 4TKSA 5M44A 1GIHA 3FZTA 4P4CA 3HGKA 1YHWA 2QO7A 1M14A 3RNIA 2F7EE 5BYYA 4IM0A 4HCUA 4YO4A 3PP1A 4PMTA 5IMEA 4BR3A 2IZTA 4DBNA 1H1RA 1XKKA 4LL0A 5B0XA 2UW5A 2ZOQA 4D4YA 1P4OA 3PJCA 5KMNA 3M1SA 4EK6A 4C4IA 1Q8ZA 4FBXA 2GDOA 3TI1A 2C47A 4G3DA 5B2LA 2C6DA 5DE2A 4JBOA 3LJ2A 3A8XA 4G3FA 3F9NA 4EC8A 3D4QA 2ZV7A 4YU2A 5CASA 1NA7A 3ERKA 3C9WA 2QOQA 4X2NA 3GCSA 3N9XA 4CD0A 3DNDA 5ETFA 1OKVA 3KREA 4BBFA 3Q4TA 4UYAA 2C68A 5L3AA 3Q04A 4HVSA 2OO8X 3WBLA 3V5QA 3BEAA 2OJ9A 3F82A 3JY0A 3NW5A 4IAFA 3D0EA 2VU3A 4AN3A 3ID6C 2BPMA 3DAJA 4F63A 3KMMA 5ANJA 2ITOA 1ZYCA 3GENA 2UZUE 3R1YA 4NT4A 4IZYA 4EWQA 4DEDA 4LMUA 4F0IA 1SVEA 4JG8A 5HNGA 4RX9A 1Q5KA 4HJOA 2IZUA 4ANOA 3KXNA 4HW7A 2QHMA 3A7GA 2QVSE 4JRNA 4C4EA 2ITUA 5HG8A 2W5AA 1H1SA 3V5WA 1MRUA 4GL9A 4DH7A 4BRXA 3SGCA 5EW8A 1V0BA 2HAKA 5IQAA 1NW1A 3Q9WA 1GZNA 2IVUA 3TTJA 2WTIA 3FAAA 5L2WA 1FQ1B 3HDMA 3JVSA 2PZ5A 3CTJA 4XV9A 4Y83A 4PDPA 5KBRA 1FGIA 5FTGA 2UUEA 4NW5A 4JXFA 3ZO3A 4BWPA 4D0XA 1TQPA 3QALE 4ZSGA 3WE4A 4IXPA 4GUEA 4QTEA 2ESMA 4AUAA 4C3RA 3VUKA 2BZJA 3R73A 3V5TA 1GAGA 3P9JA 4L45A 5GJGA 4Z55A 3CPCA 2XJ2A 3FY2A 3GU4A 2V55A 3SXRA 4XX9A 5BYLA 2XYUA 3RPYA 4FEQA 2OH4A 3AC2A 5L2SA 4M84A 1XJDA 4GVAA 3V04A 2JKKA 4JNWA 3KRWA 5GNKA 5IPJA 3QQUA 2QOFA 3DLSA 3DB8A 3PRIA 4O6EA 5HTBA 2WHBA 4PP7A 4OAVB 4NJ3A 2H8HA 3G15A 3ZM4A 5LVOA 2UVXA 3KQ7A 4YHTA 4I5CA 4G3CA 4RVKA 4AA5A 4TPTA 2C6EA 2OBJA 2XUUA 1Q4LA 3LCKA 4EH7A 4PTCA 5BQ0A 4GKIA 4ZOGA 2V5QA 3F2NA 3PSDA 3QAME 1BL7A 1ZYJA 3DCVA 2Y7JA 4FTNA 4HYHA 4O0WA 3CPBA 3FY0A 4JR3A 2BMCA 2XNOA 2XBAA 3QWKA 5EOBA 2R5TA 2PSQA 4FVPA 4RWJA 4BDHA 3F69A 4EOKA 1AGWA 3AOXA 4QO9A 4I5PA 4FOBA 4RQKA 4U5JA 4EK3A 1DI9A 3G90X 4R3CA 1FGKA 2W1DA 5HOAA 5J9ZA 3RK9A 2WEVA 5KHWA 2HXLA 4LGHA 5C26A 4XG6A 5CVHA 3A8WA 3OZ6A 4FV5A 4MHAA 3V8WA 2CKQA 2YJRA 3ANQA 1H24A 4C36A 2BILB 3SOCA 2YFXA 4O22A 4XH6A 3UTOA 5IQBA 4PWNA 4MQ2A 4QYYA 2WTWA 3HYHA 4OTQA 1BYGA 2BTRA 4J52A 3RWQA 3LQ3A 3KF7A 1W83A 4KBCA 4ACGA 4CG9A 3QQGA 5A46A 3QD2B 4AA0A 3FPQA 3VS7A 2W4KA 4HGTA 5CAVA 4G6OA 5EM8A 4ZTHA 4IB3A 4TTHB 5HTIA 1H1PA 3HP2A 2HYYA 3CTHA 5M55A 1Y8GA 3AQVA 2YA9A 5L6WL 1OIYA 2J5FA 4NL0A 2ITTA 1Q8WA 4KWPA 5J87A 3R1NA 4ZTQA 2PK9A 5FEEA 4UALA 2BTSA 3TZ9A 1STCE 1YKRA 4NZWB 4P90A 4BHZA 1MRVA 2J0KA 3BYVA 4FV3A 4RLKA 2RFDA 3DBEA 4AT3A 5CEOA 4E26A 4GW8A 2XRWA 3DDQA 1S9IA 3UQGA 4PUZA 1IA8A 4C02A 3HZTA 4ZY4A 3R8LA 1CMKE 5JGDA 3U8WA 1IAJA 4F6SA 3DAKA 3BZ3A 5JH6A 2PVYA 5CENA 2OJIA 1PXMA 3AG9A 3W10A 4DTKA 1SZMA 3HV3A 3LJ0A 2PMOX 5EI8A 4AT4A 2RFEA 2W06A 4FKSA 4BWXA 4U6RA 3PUPA 5CXZA 5HVJA 3ZLSA 2BFYA 4W9WA 5CSPA 5J1WA 3GB2A 3TCPA 3R21A 4FG9A 5IKWA 3ZC5A 4LOQA 5CVGA 2YZLA 3MSSA 1OVEA 3TNHA 4F7LA 3VN9A 2ZV2A 1YI4A 2R0UA 1IR3A 3LJ1A 4ZTLA 4ZIMA 3R8MA 4GIIA 2XCHA 4ZSJA 4M7IA 3V8SA 3ZSHA 3FLYA 2RL5A 3EKKA 5FLFA 3WIGA 5HIBA 4JBPA 3D14A 4HZRA 5F94A 3MFSA 2QURA 2VAGA 3GFWA 3HRCA 4F09A 3OXTA 1NY3A 3TEIA 1M2PA 5ETIA 2QG7A 4QMPA 3HA6A 5ANDA 5K3YA 4CFMA 4D2TA 4MWHA 5LJJA 3DJ5A 3BQRA 3P4KA 3VS2A 3NNVA 3UQFA 4DGGA 4A4LA 4I0SA 2XBJA 5KMMA 3OUKA 5AIRA 4I41A 2R3RA 4QMMA 4QP1A 4I93A 4YJRA 4FV6A 3H3CA 4I4EA 1BUHA 2XRUA 4WG4A 4CLIA 3VS5A 4OTFA 2W1EA 5DWRA 2ZMCA 4R1YA 2OXXA 3C13A 3OOGA 4FGRA 1OPKA 3QA8A 4LOPA 1WVYA 4R5YA 5H2UA 4Y95A 2R9SA 3FYJX 3RMFA 4CZYB 3TDWA 5BVWA 1UA2A 2NO3A 5FTOA 1NXKA 2PE2A 2HW6A 5AR3A 3LKMA 4LUEA 1CTPE 2J0MB 3U9NA 4AFJA 3BHYA 2QU6A 5HEZA 2XNNA 5CAPA 3EL8A 3ZZEA 4LM5A 5CVFA 4EK5A 2XEZA 3NNXA 4MF1A 3TNQB 2B9JA 4LI5A 2EVAA 5E1EA 1U46A 1IA9A 4O82A 4FNYA 5D12A 4NM7A 5H3QA 1B38A 3UYSA 4MXXA 1G8AA 3O0GA 1PXKA 4YJQA 1ZRZA 4FX3A 3Q5ZA 4EK4A 1OITA 2BZHB 2XF0A 4BIBA 3G5DA 2RFNA 5AR2A 4BCKA 4D5HA 5E8ZA 5LWMA 3NMUF 3QTRA 1Q8YA 2HY81 4J8MA 4K77A 4LUDA 1CKPA 3I5ZA 3JS2A 3D5XA 2GS6A 4H36A 4IFGA 4YO6A 2C5XA 2BKZA 2X81A 4M69A 5BVKA 4GIHA 3C4EA 1XHAA 3PE2A 4CEGA 4IX5A 3BHTA 1A48A 2XK3A 3ORMA 1KE7A 4IZAA 4OTHA 4FSRA 1KOBA 2J0JA 3JY9A 4W4XA 2VWYA 1E1VA 2GSFA 4JOAA 2QODA 4QYFA 3ZC6A 4CQEA 2JBOA 3FKNA 5FWKK 3HEGA 2F57A 3CBLA 3I79A 5L2QA 3AXWA 3ELJA 4GH2A 4M97A 4FKWA 3EH9A 1JLUE 1PMVA 2XKFA 2X7GA 3EQIA 4TRLA 4FKIA 5HIEA 5LXMA 2BKKA 1R0PA 4EYJA 3ORPA 4MKCA 5AMNA 4AT5A 1H07A 3Q9XA 5HZNA 2W5HA 2XEYA 2GPHA 4IANA 5AAFA 4RX5A 1P5EA 1KOAA 3VS0A 3RVGA 4BYIA 3DJ7A 4F65A 4JQ8A 2R0IA 3T8OA 4YJSA 4EH2A 1ZMVA 3QBNA 3MGYA 4M69B 4ZTSA 5EI6A 4B9DA 5I3RA 4UX9A 4BYJA 4AW5A 5A4LA 2YDIA 4FV8A 3SC1A 3KCKA 1CSNA 5DR2A 5B2KA 2VGOA 3PJ3A 3FMEA 5D11A 2F7ZE 2UZTA 4RGJA 5JSMA 5LWNA 3HRFA 5EDRA 1TQMA 2QOLA 2VZ6A 1PMUA 4QYGA 4F9BA 1H26A 3HMPA 3HMIA 3LXNA 1LP4A 1YXSA 5E8XA 5D10A 4DTBA 2UZDA 4BB4A 2J9MA 4WUNA 3UG1A 2YABA 4FZ6A 1WAKA 1X8BA 5HE3A 4KRCA 2WMTA 3KMWA 1P4FA 2BROA 1QCFA 4FNWA 5IA1A 3MH1A 4LV5A 3S0OA 4U40A 2PVRA 3PXRA 2RG6A 4FT7A 3KGAA 4FF8A 3P86A 4K9YA 3RPOA 3R30A 4F7NA 4DCAA 1E1XA 4ALVA 3ORXA 1YQJA 2YDJA 3RI1A 4FA2A 5CQWA 3ZDIA 3V6SA 3W1FA 4CQGA 2C3LA 5LVPA 3BLRA 4EKLA 3SXFA 2W1IA 3QTZA 4FTMA 4ANNA 2ZV8A 3GVUA 4IAIA 3QLGA 3SD0A 4HCTA 3FXZA 4WSQA 1KE5A 4YZMA 1HCLA 1M17A 3FMJA 3D83A 2WXVA 3OY3A 4JBVA 4Z3VA 5EHYA 3ZLXA 3Q2MA 5BMMA 2YISA 4ANLA 1Y6BA 4DEAA 5DG5A 1APME 5KZIA 3H9FA 3UO5A 5LARA 5HORA 2RSVA 3PP0A 4QPAA 4IB1A 3PG3A 5DR9A 5E1SA 5C01A 1VEBA 2GCDA 1W0XC 2ITVA 1PW2A 4ENXA 3FZPA 4WRSA 4DITA 4E93A 4AP7A 5JZJA 1T45A 3ZOSA 4D0WA 4C4FA 4RLLA 5EK7A 5ANGA 2BFXA 3D94A 5EG3A 4D2RA 5JN2A 4XOZA 4EJ7A 3FZOA 2X39A 2FVDA 4IE9A 2WMRA 5CT0A 3U54A 1PYXA 3BELA 5CYIA 3FWQA 4F7JA 3R1QA 1YOJA 2B9HA 2GHLA 3BYSA 3GC9A 3QKMA 3EHAA 1Q24A 5FDXA 3TM0A 4P2KA 4L00A 5CU4A 4KRDA 1KWPA 2PMNX 1JVPP 2UW8A 2C6OA 2ZB0A 4QMSA 4J53A 3NYOA 3HP5A 2RGPA 3BYMA 2CCIA 5CSHA 3SG8A 1OPJA 1Q3WA 4BIDA 3BE9A 4F9AA 4EUTA 3GCQA 2SRCA 4FIJA 3PE1A 3TIYA 2BCJA 3EN4A 3MJ2A 3NUPA 3PXYA 3WYXA 4Q9SA 3L1SA 5HE1A 5ACBC 4MXOA 3H0YA 4FSTA 4LGGA 4MXZA 4S30A 3TTIA 4EOSA 1YWVA 1FPUA 5A6NA 4FYOA 1OKWA 3LFAA 4I24A 4UY9A 4GKHA 4FKGA 3PJ8A 1BI7A 5HNBA 3I60A 4C58A 4H58A 2B0QA 4FOCA 4YTHA 3RTPA 4F9WA 4BTMA 2GNJA 3AT2A 3TWJA 2VTNA 3DT1A 1M7QA 3IDCA 1WZYA 3NIEA 4PPBA 4I6QA 5HGIA 4IACA 1JQHA 4N57A 3VS3A 2BAQA 5JRQA 1FVTA 3ITZA 3DLZA 4D5KA 3TNIA 3UJGA 4DG3E 3R9RA 1MP8A 3NUYA 3RAHA 3MN3A 3KKVA 5L2TA 3KVXA 1WMKA 4L9IA 5IISA 3F3ZA 3W2RA 5ICPA 4I1ZA 5FEQA 1B6CB 2VTSA 2OF2A 3GC7A 2FO0A 4MF0A 1YOMA 4L52A 5CF5A 3FC1X 2XM8A 4HNIA 3ZUVA 3VAPA 3SQQA 5AP0A 1PXIA 3BYOA 4L6QA 1OIRA 4JVGA 4DFLA 4RIYA 1PKDA 1REJA 3FPMA 3ZM9A 1M2QA 4J71A 3A60A 3W2QA 4CCUA 3R9HA 3E64A 4AZTA 1UNGA 4O7WA 4QT1A 2VO0A 4FIFA 3ZFMA 3F5UA 4GK4A 4CTCA 2Y9QA 4GU9A 4G9CA 4Z16A 3ORIA 4U97A
chains in the Genus database with same CATH superfamily
2QG5A 2WFYA 3ROCA 3ORLA 3SVVA 2XJ1A 3PXZA 3CTQA 2CN5A 3QGYA 2PVKA 4J96A 5CF6A 4EBVA 4IX4A 4NJDA 5FXQA 2YAKA 4E1ZA 4XG9A 4EQMA 2J6MA 3PFQA 4QTDA 3GQIA 5EYCA 3UP2A 4OT6A 2QOBA 3CE3A 3HMMA 3NSZA 4LRKA 2BAJA 2X7FA 4RIYB 1ZMWA 3O7LB 3CGFA 1PY5A 3PIZA 2HXQA 3D7ZA 3UNJA 5I0BA 4C59A 5F95A 4M68A 4BCIA 5DRDA 4YP8A 4BDCA 3QD0A 3LVPA 4EONA 2GQSA 1YXXA 3MIYA 5FRIA 3W0OA 4EH5A 5JFWA 4CKJA 1HCKA 1ZZLA 3MWUA 5EYDA 2W0JA 4J1RA 1OUKA 3D7TA 3O17A 1OL1A 3KF4A 3NZ0A 3AC5A 4C0TA 4DINA 3O5AA 1U54A 3P79A 2QU5A 3FYKX 4ASDA 2JFLA 3LMIA 2PMIA 3PJ2A 4TY1A 3DB6A 2KULA 4OR5A 4FK3A 3WE8A 4RZVA 2P55A 1H0VA 4RC4A 3W8QA 4R7BA 4O96A 5ANOA 4FEVA 3F6XA 4G5JA 1IEPA 4S2ZA 4MX9A 2IW8A 2OXYA 2WMAA 2WQMA 3FZRA 3NCZA 4IZ5A 4MAOA 4D1SA 4QQ5A 4XG3A 2B9FA 1URCA 2WTDA 2O5KA 1FMKA 4F1TA 3A99A 4QMVA 5HG7A 3LXLA 2QHNA 1JKTA 2O0UA 3DBFA 4W4VA 4CYIA 3TN8A 5ANKA 5IA2A 1VYWA 2QC6A 2DWBA 3FQHA 3K5VA 3D7TB 4EZ7A 1OZ1A 5FDPA 4YNEA 1U54B 2XK6A 4CT2A 5A4QA 3SW4A 4FNZA 3I0OA 3R1SA 5AV1A 1XH9A 3FUPA 2I0YA 4K33A 2QD9A 5EM6A 2JC6A 4ZTRA 3KFAA 1WVWA 3IPHA 4IHPA 5HHWA 4BN1A 2YWPA 4PTEA 4YJNA 5HLNA 3FC2A 2UW0A 4H1MA 5IF1A 5C4LA 5AX3A 4FL3A 4RSSA 3IK3A 4CMUA 5CZHA 4RJ5A 3ZCLA 3QL8A 3SAYA 1OI9A 4PL3A 2GTMA 3VUDA 4W8EA 4FKTA 4OGRA 4NK9A 3QLFA 2X9FA 3COHA 4U80A 5I9ZA 3VJOA 4MBLA 1OL2A 3QD4A 1UU9A 5M51A 2ZM3A 3PVBA 3DPKA 4Q2AA 4YZBA 5HO8A 4IDVA 3C4XA 3FLWA 4QP9A 4FTLA 2VWWA 4TNBA 3QC4A 3FMKA 3SW7A 5BVNA 2OU7A 3T9IA 4RWKA 4BI2A 3EN7A 4AXCA 1ZARA 2AQXA 3A7FA 1OBGA 2Y0AA 4CKRA 4NEUA 3RGFA 4XEYA 1CKIA 3OWJA 1V0OA 2XIZA 4C4JA 3UIBA 5CS6A 4F1OA 4J95A 4W4YA 3OFMA 4HGSA 3RK5A 1BMKA 3BPRA 5EQEA 3MVJA 4RIWB 1XH5A 4LV8A 3TMOA 3VONA 2EU9A 4DT9A 3E63A 5K0XA 2OI4X 4QMYA 4ZTMA 4FEWA 3HV5A 4IIRA 4IVDA 4X21A 5HICA 3W0SA 3FQSA 4TYIA 2CCHA 3T3UA 3PWDA 4G6LA 1JSVA 4FTQA 3EQRA 1YOLA 4CTBA 5FXRA 4JL9A 2IO6A 2HZIA 2IEWA 2VWVA 5I9UA 1UKHA 2WU7A 3DOGA 5FM3A 3WZUA 4LMNA 4F1MA 1YI6A 5HD4A 3QCSA 2WD1A 3MA6A 3IW5A 5CXHA 2EXEA 4NM3A 1W8CA 3W2CA 4F0FA 4YLLA 3TKHA 4YGAA 2IG7A 4A07A 4JG6A 4RA5A 2XALA 1O6YA 3R8UA 3O23A 1FOTA 1DI8A 4IB0A 5GJDA 4RZWA 1MRYA 3MFRA 4ANSA 4L42A 5JZNA 2UVZA 3KN6A 1JSTA 1WBOA 3DQWA 4NH1A 5KX8A 3L9PA 2BUJA 2WAJA 3EKNA 4XLVA 5AP2A 5IA5A 4KABA 4X2JA 3MS9A 2I1MA 2YLEA 5J8IA 2HCKA 3C0GA 2IW6A 4CFXA 2VWIA 1R1WA 1A9UA 2UW9A 3H0ZA 4C38A 3ML1A 4XBRA 1FINA 2GS2A 4EHVA 4WRGA 4CMTA 4L7FA 3FMHA 3U87A 3GFEA 3DBDA 3VHKA 3V5JA 4DAWA 1M52A 4ZTNA 4XJ0A 5AA8A 3UP7A 3AGMA 3F88A 4IAKA 1K9AA 2VTRA 2WIPA 3H10A 3WF8A 1GY3A 4WG3A 3VW8A 2P2HA 5HLWA 2JDOA 2OSCA 5BUJA 4I0TA 3GEQA 3MI9A 5K0KA 3UOKA 4CFWA 2HZNA 4O38A 4LL5A 3B8QA 3AMYA 3VC4A 5HVYA 4DGNA 2VTIA 3OD6X 2XVDA 3V8TA 4U3ZA 4MTAA 2C5OA 2LGCA 1DM2A 4HVDA 3VQUA 4IW0A 4TL0A 2CGXA 2YCFA 3OROA 5L8JA 1IAHA 4QMLA 4GYIA 5CALA 4JAIA 4DHZA 4XRLA 3GP0A 4K8AA 5AUVA 4BCGA 2Z7LA 5M4IA 4DEGA 5I9VA 4JBQA 3HL7A 2BRHA 3UDTA 3CGOA 3VF9A 2YITA 5DLSA 2W17A 4O7RA 2ZMDA 2YN8A 2R3LA 2CSNA 3A7JA 3VQHA 4PY1A 1WBVA 3GCPA 4UWBA 3BV2A 3BV3A 3P78A 3ZEPA 5J1VA 2FSTX 4TNDA 3QX2A 3MB7A 1JNKA 4FKOA 5CF8A 3II5A 3H9RA 2OWBA 5HBHA 3PVWA 3SHEA 4AX8A 3PRFA 4PPAA 3P0MA 4OW8A 3C50A 4ALWA 4LRJA 3QRIA 3KXHA 5FQDC 2OZOA 3PPZA 3U4UA 5C1QB 4XV3A 3FEGA 3Q96A 5A54A 3K54A 3O8UA 4RJ8A 3PXQA 4WOVA 4D1XA 5LCKA 3QKLA 2YHVA 3KRRA 5M09A 1PJKA 4IX3A 5L6OA 2NYAA 1ZLTA 2WQEA 2PZRA 4QMUA 4ORKA 2C1AA 5I9YA 2R3FA 3MY0A 2VO7A 2HENA 5E92A 4K2RA 4J98A 1R39A 3ACJA 2PE0A 5AV4A 3QQFA 4H3BA 4XNEA 5BUEA 3WI6A 4ZMEA 2R3JA 2R4BA 3B2TA 4O81A 2WGJA 4EHZA 4GT4A 4JG7A 1DS5A 4RJ4A 4I6LA 5M4UA 3QGWA 4QNAA 2V22A 3LLAA 2XH5A 4ACCA 2J50A 2X4ZA 4FODA 3OUNB 4IVBA 1OIQA 4HNFA 3OW4A 3S4QA 5KNJA 3DZOA 3EIDA 3O7LD 4B6LA 2GNGA 4YJOA 1QMZA 3EYGA 1GIIA 3RINA 3RK7A 3ENHA 5KKRC 4FZDB 3NPCA 5HVKA 4KS7A 3WZEA 2A27A 3OBJA 2X4FA 2PVLA 3G6HA 3C0HA 4BBEA 4PDOA 3Q52A 4ERWA 3TZ8A 5CU0A 2OFVA 2WOUA 4IAAA 3HA8A 3UZPA 4FV9A 4PF4A 2PVHA 4HYSA 1YI3A 3S00A 2JDRA 1VYZA 2GHGA 4PDYA 3FZ1A 5F20A 3H9OA 3DK7A 2HK5A 5I9WA 4NM5A 4BKYA 4F70A 3OS3A 2PZPA 4JQ7A 4YSMA 4ZZOA 4DBXA 4MNEA 1J3HA 1G3NA 3AC1A 3E8CA 3OEFX 2WQNA 2J2IB 3UGCA 4O7LA 2QR8A 5IH6A 5AWMA 1YXTA 3JPVA 2R3KA 2YIXA 4YBKA 2YCSA 4JIAA 4BDKA 2CHLA 2FSOX 5DT0A 3SDJA 1O6LA 3HECA 4U79A 3S2PA 4ZJVA 3AC3A 3UZRA 2XS0A 4EUUA 4BTKA 3AD5A 3B2WA 5KO1A 4RJ3A 2VNWA 1U4DA 4DC2A 3QTIA 4FV1A 5CI7A 5DRBA 4DH1A 4ACMA 2VTJA 4G34A 3PJ1A 3GGFA 4UWCA 4EL9A 3E7VA 3AGLA 5AA9A 1H0WA 4MBIA 4MNEB 3A61A 3NLBA 3UMWA 4GRBA 2OK1A 4ZLZA 3G2FA 3O51A 3MBLA 3CP9A 4JX3A 2XIRA 3OCGA 4Q5EA 4WBBB 4EJNA 4U44A 2R3QA 2JITA 4OTRA 2P2IA 2OW3A 4L8MA 2GFSA 2UZWE 2XNPA 5DHJA 5K4JA 4FSZA 2JKMA 2BDWA 2UZOA 4CSVA 2C6IA 4EOIA 3HUCA 5CF4A 4IX6A 3U9CA 3LFFA 5CEPA 3MPTA 3LOKA 5C8MA 3OHTA 2JAVA 1OUYA 4ACDA 2W1GA 3KL8A 3KN5A 4EHGA 2YM3A 3HMOA 4O2PA 5HQ0A 5DYJA 4HVIA 3W8LA 3QZFA 4IC8A 3R83A 4ZP5A 2Q0NA 3ZMMA 3VJNA 4ZMFA 3ET7A 5D7AA 2E9UA 2YIRA 3I0QA 4XV1A 4LFIA 2WMSA 2EUFB 4FT0A 3W0RA 4O7YA 3BX5A 4GMYA 3ODYX 2VX0A 4RPVA 5CU6A 4CNHA 4X2FA 4EOPA 4F4PA 5IA3A 2PU8A 3AMBA 3BL9A 4FTTA 4BDIA 5JT2A 4F99A 4AE9A 2BZIB 2EB3A 2QOIA 3MA3A 4M8TA 3CD3A 5JGAA 4P5ZA 4N6YA 2B55A 4N4SA 4RVLA 1W7HA 3ALNA 4X3FC 3VO3A 5T6KA 2GMXA 4OT5A 5DN3A 2XARA 2H96A 3E3PA 3SX9A 1R78A 3UBDA 1H4LA 4BL1A 1GOLA 3AT3A 3W2OA 5DT3A 4YR8A 4FSYA 2WMWA 4J97A 3GU5A 5I3OA 5HG5A 4FTJA 1PMEA 3BIZA 3GC0A 4FKPA 2ZM1A 3SA0A 4I21A 3DKCA 3DTCA 3OTVA 4YJUA 1BL6A 3LFSA 5CU3A 5IH5A 1PXNA 5IDPA 2R3GA 4NWMA 5DOSA 2IVSA 1ZWSA 3HKOA 3GC8A 4KKEA 5C8NA 3CQEA 3ZO4A 1WBNA 4ARKA 2OG8A 3A2CA 4AZFA 2LAVA 1FMOE 1UWJA 4AZWA 2E9VA 3TJCA 2J51A 3WZJA 1SYKA 4HVGA 3E8EA 2Z2WA 4NKSA 5HKMA 2QO2A 2ZDTA 3R2BA 4FICA 2OIQA 2QO9A 3VVHA 4V01A 5ETCA 1WBPA 3RJCA 2YM7A 3IW6A 2I0HA 4AW1A 4BWKA 3FI8A 5AP4A 1WFCA 5IQFA 3ZDUA 2XB7A 2XNGA 3L8XA 3LPBA 3FLNC 2QKRA 4QP4A 3PLSA 3TKUA 5CLPA 1M2RA 3KULA 5HU9A 4ITIA 4O0UA 3RPVA 1J7LA 2BAKA 2QLUA 4U8ZA 3LHJA 1UNLA 1XQZA 2YCQA 5FP5A 2YM6A 4I92A 4QTAA 2ITQA 5LVNA 2YDKA 2O63A 4GG5A 5AIKA 4AA4A 4E73A 4E8AA 3PA4A 4S32A 3ZZWA 4BTFA 4YBJA 4Y5QA 2BRNA 4NTSA 4C35A 5E4HA 4QP2A 4OTGA 4O0VA 3CCNA 3MFTA 4O0TA 4BC6A 3CQWA 4E5WA 3LCSA 5AV3A 5KKRB 3UVRA 2Z02A 1ZXEA 3BBWA 3GUBA 1IG1A 1OL7A 4NUSA 1URWA 3K3IA 4ENYA 5CX9A 4QDVA 5BVFA 1XMLA 3A4PA 2WOTA 5DFPA 2ITNA 5CSWA 4QQCA 4II5A 4UMRA 4L01A 3KULB 2R3NA 3THBA 3DK3A 5HBJA 2EXMA 1YW2A 4ALUA 4DFYA 2X8DA 2JDSA 1V0PA 4TWPA 4FL1A 2VWBA 5CEMA 2PZIA 3TL8A 5KMOA 3FZSA 4ZZNA 4FV4A 3CC6A 2UZEA 2ONLC 3R9OA 1XR1A 3VBVA 3IO7A 1ND4A 3RZBA 3TUDA 3R9NA 4D28A 1ST4A 3EN5A 4M3QA 3QUPA 3VUGA 3QA0A 2ITZA 3R7EA 4FV0A 5CNNA 3K2LA 4DTAA 3N51A 4KIQA 4BDBA 3DXQA 4CV9A 2OIDA 4QMZA 3O96A 3LFBA 3KEXA 5HX6A 3F2RA 3PDTA 1Q62A 3Q6UA 3OT3A 1VR2A 2P3GX 3EQCA 4BY9E 4PNKA 3BQCA 4MXAA 2E9OA 2XNMA 5KMIA 2FB8A 3FL4A 5F1ZA 2PUIA 5ITAA 1GZ8A 2UV2A 4CXAA 2G2FA 1MQBA 2CN8A 3WILA 4PPCA 4GFOA 3ZEWA 2XYNA 3EOCA 2E9NA 3FHIA 4DYMA 4E5BA 1PXJA 3EQPA 3OXIA 4JAJA 4FG8A 4O4DA 4QP6A 4DHFA 5CY3A 1TFFA 2X6DA 4GSBA 1GNGA 4UXQA 1GZOA 3OEZA 4XLIA 3QU0A 3ATTA 2PTKA 5LVLA 2GFCA 3K5UA 3L9NA 4B0GA 4NW6A 5DEWA 2C69A 2UW3A 5DEYA 4EOOA 5KMJA 2G2IA 3LCOA 4I6BA 4P7EA 3T3VA 3OY1A 4ZY6A 3AKKA 3PPJA 3D2KA 2HWPA 2WEIA 3F3VA 4X3FA 1M7NA 3LCTA 2X8IA 4FNXA 4LRMA 4AQCA 4EZ3A 3DFAA 4K18A 4D9TA 2B4SB 3ZU7A 4U81A 1KE6A 3PLAE 1I09A 2JDVA 4IVCA 2XAOA 1PKGA 3KXXA 3LIJA 3SRVA 5JFVA 4YLKA 4FZFB 5TE0A 1OKYA 2CNVA 1B39A 4TYJA 3HAMA 5EYKA 5EHOA 4M14A 1U5RA 3FJQE 4R8QA 4NFNA 5EW9A 4BCQA 3ZS5A 3HAVA 4NSTA 3Q4CA 1U59A 1YRPA 3ORNA 3DDPA 4FKVA 5AAGA 3DXPA 4O83A 1LEWA 4APPA 4FUXA 4FT9A 4R5SA 2OZAA 3UPXA 2WNTA 4X3FB 2R7IA 3OWPA 2BDFA 2GU8A 2ZB1A 4G5PA 4CZTA 3BGPA 4Z9LA 3U6JA 3PY3A 3BGZA 1J1BA 2JDTA 3FKLA 3QQHA 2W99B 2FUMA 4GK2A 4H3QA 4L67A 5FGKA 3E3BX 4GFMA 4FSNA 3E87A 1JOWB 2ACXA 4ID7A 4QYHA 4MD9E 4RIOA 4RIXA 3SRVB 2HELA 4EOQA 3QQKA 4E6AA 2EWAA 5HE0A 5F4NA 4IVAA 3NS9A 4GS6A 4O21A 4WHZA 4ZS0A 4BCPA 3L8PA 4YJPA 4R6VA 1BI8A 3LMGA 4HYIA 2VX1A 3F3TA 1QPJA 2XIKA 4OTWA 4JRVA 1KUTA 5I4NA 3DXNA 3GCVA 4O7TA 1KSWA 4I5HA 4YJTA 3JYAA 5DR6A 3MW1A 1BKXA 4IWOA 3OC1A 5IEVA 2XCKA 5HESA 3FXXA 2YZAA 1TZDA 3ZLWA 3AKJA 4FL2A 4MBJA 1ATPE 2OZAB 4IJ9A 4IC7A 1XWSA 5CU2A 5H8BA 5I5ZA 3OT8A 4G3GA 2Z7SA 2C5NA 5IUIA 4RMZA 2B53A 2BRMA 4L44A 3W32A 1UKIA 2W1FA 3DY7A 5IEXA 3QTXA 2V0DA 3C4CA 2W4JA 2F7XE 4FIGA 4RIXB 4A9UA 3PUFC 3TNWA 3QHWA 4LV7A 2WMXA 3C4WA 3PIYA 4BZNA 3SV0A 4K6ZA 4BCJA 2P0CA 4FTCA 4MWIA 2RKUA 2X6EA 3WYYA 4YNOA 2H6DA 4ZLOA 4ZXTA 5DMZA 1GIJA 3MPMA 2JKOA 4QP8A 3QZHA 4WNPA 1ZOGA 4FV7A 4O27B 2O3PA 1WBSA 3DS6A 5CZIA 3V3VA 2R3OA 3PVUA 3QZIA 4E7WA 2VV9A 4D4VA 4BFMA 5FD2A 3QX4A 3L8SA 4Z7GA 2ONLA 1Y91A 3VIDA 4FGBA 3NUSA 3R28A 2X0OA 4F6UA 3LFDA 4JR7A 3R9DA 1KV1A 5ACKA 5HO7A 4GU6A 4W8DA 3GCUA 4YZNA 4U41A 1O6KA 3FDNA 2PYWA 4G31A 3ZUUA 1VZOA 3FLZA 3UNKA 4DG2E 4PRJA 4NIFA 4ZEGA 1W2DA 4AACA 4CFFA 5IMXA 2C6KA 4O7SA 3F66A 2ITXA 4LYNA 4R7IA 2JIIA 5K5NA 4GVJA 5AR4A 2HZ0A 4G2FA 4AFEA 1TQIA 4GG7A 5T68A 4FTKA 3ZXZA 1IRKA 5TR6A 2JGZA 1PHKA 5CT7A 3TV4A 3NVKI 4IFCA 4XYFA 2ZM4A 4QMXA 3RM7A 4E4LA 4EH9A 3BGQA 4X2GA 3DA6A 1H27A 3EQDA 4BZDA 2GNLA 2YM4A 3R6XA 3AT4A 3UIXA 3W0NA 4FSQA 4J7BA 3LQ8A 5J79A 5LMBA 5EQYA 3EYHA 1UV5A 4QP7A 2CNQA 4AZEA 2XK4A 1JKKA 1QPEA 2VTAA 2XMYA 4KKHA 4NIFB 2C0OA 2OICA 1PRYA 3IDPA 3GU8A 3QCQA 3CY3A 4MVFA 1DAWA 3CIKA 3UC4A 4HZSA 2GNHA 4L3PA 4DEHA 2Y6OA 1TVOA 4BGGA 3UIUA 3QCXA 4AOTA 2ZJWA 4AXFA 3E88A 5IU2A 2WQOA 4MD8E 1FBNA 3IOPA 5AP7A 1YDRE 4DGMA 4EI4A 5KBQA 3TUCA 3COMA 4C4HA 3NUUA 1S9JA 4C3FA 3O8PA 2WTKC 5J95A 4NM0A 3MIAA 3VBXA 4B8MA 4Q9ZA 1PXPA 3NUAA 3C1XA 3TXOA 2R64A 3D9VA 3K3JA 3R01A 3POOA 2G15A 3PTGA 4USFA 3OCBA 4PP9A 4J8NA 5FBOA 5F9EA 1H08A 2QNJA 4ZSEA 3COIA 2Y8OA 3VULA 5AAEA 1QPCA 3DBQA 3OTUA 5HIDA 5AM6A 3ATSA 3TT0A 1W98A 3E93A 3EMGA 3DKFA 5AUUA 4EC9A 4D4RA 4MD7E 3SOAA 3ORZA 1W82A 3ACKA 3M2WA 4DE4A 3BU3A 3LM0A 3DV3A 3VHEA 4LGDA 5GZAA 3KIOC 4B99A 4DEEA 2C3IB 3E92A 5AJQA 5CEIA 2VRXA 3EL7A 1H1WA 3ZYAA 4QPMA 4E5AX 1TKIA 3F5GA 4ASEA 3F7ZA 2XIYA 4EKKA 4FEUA 5IQCA 2HWOA 2C6TA 2OH0E 5EM5A 4FT5A 4MNFA 4AGCA 5M57A 3PSBA 5L4QA 1J91A 5K5XA 2X7OA 4XG2A 1YHVA 2YERA 2UW7A 3EZRA 3G51A 4KBAA 4TZRA 2AC5A 1YDSE 5E8UA 2PE1A 4G1WA 4EH4A 4L46A 2CKOA 4FIIA 5CAOA 3QFVA 2YJSA 4AF3A 2PZYA 4EYMA 4DCEA 5L8KA 3NAXA 5HI2A 1OIUA 3PY0A 3L8VA 4KIOA 4YTIA 2C0IA 4XUFA 2G01A 4FTRA 1Q61A 4FG7A 4TN6A 4P5QA 4DH8A 4ERKA 2WPAA 4IM3A 4ZAUA 3ETAA 4WG5A 3MTLA 4Y85A 3OCSA 2JIUA 4RVTA 2C0TA 5H8GA 1SM2A 3ALOA 3KMUA 3EQGA 4LQMA 4EQUA 3OG7A 2J7TA 3DTWA 3MV5A 4DDGA 3U4WA 3VRYA 3BLQA 5FEDA 3LE6A 2BRBA 2XK8A 4PQNA 4JLCA 3VS6A 1PXOA 2UZVA 2ZV9A 3R00A 4FKJA 4DF3A 4MEDA 3RHXA 4AWIA 4TWCA 2I6LA 3SLSA 4GJ3A 4DH5A 1NT2A 4ANQA 3D2IA 4IWDA 4KBKA 1GZKA 3V01A 4I20A 4HPUE 3ZLYA 2W9FB 5DT4A 4O86A 1OB3A 4PMPA 2VGPA 4RX8A 5FUTA 4XHKB 3GU6A 4WBOA 4DLJA 3IECA 2NPQA 2OIBA 1U5QA 2PUNA 5BPYA 4RFMA 1SNXA 3RPSA 1UU7A 3VF8A 2F2UA 2XIXA 3NR9A 3HDNA 2IJMA 2UZLA 4GCJA 3FSKA 4HCVA 3DGKA 4WKQA 3TZMA 4C33A 1CKJA 4N0SA 5CANA 4D4SA 2WIHA 1ZOEA 5A9UA 4GUBA 4O4EA 4KD1A 5HCXA 2F9GA 3EN9A 3FI2A 3IDBA 4OAUC 2X0QA 5HG9A 1P2AA 3DZQA 3S95A 5C8KA 4NU1A 3QQJA 4G6NA 3WF6A 3FI4A 3TKIA 3KXMA 3R7VA 3BL7A 3KK9A 4TWNA 4QMQA 4MXYA 3MH2A 2UVYA 5D9HA 4R77A 3DK6A 3VUHA 4Y8DA 5EQPA 4M12A 2OJFE 3ZONA 1PYEA 4XCUA 4FRFA 4ZLYA 2X2LA 4EH6A 2UW4A 3MH3A 5JRSA 3LM5A 3NYNA 5D7VA 4M15A 4AW0A 2A0CX 1ZOHA 2J0IA 2I40A 3UMXA 3L9MA 4U42A 4AZVA 3C7QA 4E6DA 3CKWA 4TXCA 5IUHA 2I7QA 4IBMA 1LEZA 1LR4A 4I3ZA 5BUIA 1Q41A 1UNHA 4FR4A 1VJYA 4G3EA 5CWZA 3T9TA 2JFMA 3PIXA 4BTJA 3PZEA 4KIPA 3KU2A 4BDJA 5M06A 3F5XA 2PHKA 2KTYA 4FK6A 1YWNA 2W05A 4FV2A 2VNYA 3E8NA 3ULIA 4IDTA 2YWVA 3W55A 3RALA 1XH8A 4C4GA 3G9LX 1F3MC 1YHSA 4KB8A 3BHVA 5TF9A 3WZDA 3BLAA 2VTLA 2O64A 2RIOA 3ODZX 5J9YA 2CKEA 5CTPA 3FV8A 4YHFA 3QWJA 4C3PA 3M11A 3OWLA 3W16A 4O0SA 4WO5A 3U6HA 3POZA 1JKLA 3MY1A 2ERZE 3G6GA 3FKOA 4JJRA 3JXWA 3WF7A 4Y72A 2O65A 2IPXA 3KRJA 4FEXA 5IQGA 5IQDA 4DLIA 5AADA 3NFGB 2Y4PA 2DYLA 2Y4IC 3R0TA 5HO6A 2BDJA 1G8JA 2WTKB 2AYPA 5AEPA 5K9IA 2GQGA 2X2MA 5G1XA 4MUQA 4WD5A 4C2VA 3LZBA 1WVXA 3CXWA 3EFJA 3KY2A 4BHNA 4QMOA 3TACA 4JIKA 5L6PA 4EQCA 3FI3A 3BYUA 5AX9A 2HZ4A 3UDBA 1CDKA 4E6CA 4QOXA 1RJBA 2B1PA 2CGUA 2UZBA 4M13A 2QCSA 2XK9A 3F61A 4XP0A 4CFNA 4E4XA 1OECA 1ST0A 5FXSA 3HV6A 5GIOE 3UZTA 4QD6A 5CQUA 3BRBA 4NFMA 3W2PA 5CAQA 3I5NA 2C5YA 5IH4A 3TDVA 4IM2A 4DFUA 5GHVA 5A6OA 5AUTA 5IEYA 5KZ0A 4ITHA 4OTDA 5IDNA 1O9UA 4C8BA 3OBGA 2YM5A 1MQ4A 5EDPA 4MH7A 3W18A 4ZSAA 2YACA 4AXAA 3VBWA 5IUGA 2GQRA 3VBTA 4BIEA 5HX8A 3Q53A 4QTCA 2HOGA 3MFUA 1JAMA 2OGVA 3G0FA 1Z5MA 2BVAA 4FTIA 1R0EA 2DQ7X 2ZDUA 2R7BA 3DJ6A 4NKAA 4O6LA 5EKOA 1HOWA 3FMLA 3TUBA 4MQ1A 3CS9A 5BVOA 3R04A 4ZS4A 3RNYA 3FMDA 3TJDA 1OBDA 3O8TA 5E8SA 3QTWA 1ZYLA 3VBQA 2VO6A 5DH3A 3TYKA 4WNMA 3IGGA 2ZAZA 2WB8A 3B8RA 3JUHA 4KNBA 1A06A 4RX7A 5EDQA 3KRLA 1K2PA 5B7VA 4CRSA 5JFSA 2C4GA 1LUFA 2IVTA 3MY5A 1ZAOA 2BHHA 2GHMA 4H39A 3C0IA 2CLQA 4EWHA 4O1OA 5C03A 1ZMUA 3GBZA 5LMAA 2Z7QA 3R7YA 5IG1A 4FTUA 3L9LA 2OF4A 3V5PA 4ASZA 4CCBA 4EOMA 4ZJJA 5GZ9A 4O7ZA 4YC8A 3C4FA 3C5UA 3PZHA 2JAMA 4RFYA 2JIVA 3P08A 4AQKA 4DDIA 5AR7A 1I44A 5H9BA 4A9RA 4IWPA 1H25A 4RJ7A 3UOJA 3BHHA 4TYGA 2X1NA 5E9EA 4R1VA 2PWLA 3UE4A 4R3PA 4UN0C 2XNEA 2VTTA 3GQLA 4GYGA 3KK8A 4CYJA 4UXLA 1XH6A 5AP5A 5EM7A 1ZY5A 2W9ZB 5GJFA 5CSVA 1OKZA 2EB2A 1J1CA 3PVGA 4C61A 1NVQA 2FSMX 3PXFA 4IADA 3TV6A 3TV7A 3ZUTA 4MXCA 4AG8A 4EOLA 2R2PA 3PA5A 3HMNA 4X0MA 3QYZA 2WMUA 3KRXA 1W2FA 3F7WA 4LOOA 5HU3A 2R3HA 5IQEA 4M67A 1K3AA 2ETMA 2XKCA 4UZDA 3VW6A 2JBPA 4UWYA 4O1PA 3VUIA 3DKOA 3NIZA 1CM8A 4FSWA 4X7QA 1GJOA 2VTQA 4W9XA 4DA5A 5TT7A 3RHKA 2XJ0A 4BGQA 5DIAA 3RP9A 3V5LA 2HW7A 3PWYA 4EH8A 5K4IA 3JVRA 4BDEA 4UMPA 3LMHA 2VD5A 5C9CA 2E2BA 4D2WA 5HLPA 3R63A 2NNWB 3LXPA 4U43A 4RWIA 4UMUA 4X6RA 1NVSA 3SG9A 2C3JA 5A3XA 1JPAA 2A1AB 4HPTE 4QRCA 4FIHA 4OBQA 2C5VA 3NRM