4EH7A

Human p38 map kinase in complex with np-f6 and rl87
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
351
structure length
337
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Mitogen-activated protein kinase 14
publication title Natural-product-derived fragments for fragment-based ligand discovery.
pubmed doi rcsb
source organism Homo sapiens
total genus 108
structure length 337
sequence length 351
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4eh7A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4eh7A01
3WF6A 4AU8A 4IEBA 4ZLZA 3OOMA 3EWHA 3QQUA 2IW9A 3PXYA 2W4JA 1H4LA 1M2QA 4RQKA 3KRLA 2UV2A 2WAJA 2NO3A 4MX9A 3QTZA 1T45A 4DG0E 4XV3A 2BDWA 5HG9A 3OC1A 1P4OA 4IJPA 1PKDA 5ITAA 3QCQA 2QHMA 3FLNC 4EH9A 2ZB1A 3K3JA 3RCDA 3ZFXA 4DEAA 4CGAA 4RIWB 3UO5A 3RAKA 2B9JA 2OIDA 1H24A 4HPUE 5ANEA 3VS4A 2PVMA 4CYIA 2QOBA 4ZTRA 3CPBA 3O2MA 4WNOA 4DEDA 4KKEA 4E4XA 3QD0A 3LFQA 5EYKA 2FSMX 5JFVA 1PXLA 2UW3A 2B1PA 4G3DA 4I23A 5A9UA 4YJPA 5A4QA 2OXDA 4Y73A 5AUZA 2E9UA 4RX5A 2XKCA 4UZHA 3FHIA 4IH8A 3MYGA 4KIOA 5B2KA 5DT0A 1JKKA 4AA4A 2DYLA 4MD8E 1BL6A 3NUPA 2JIVA 4NKAA 4AOJA 1NVRA 4C2VA 4A9UA 4EOIA 4AW1A 2R0IA 4EH4A 3BQRA 5JSMA 4GIHA 2GS6A 1B38A 1VR2A 3OVVA 5HVYA 3RTPA 3OWJA 3D7TB 4D0WA 5EKNA 4II5A 3RM7A 1MP8A 1MRVA 5HD7A 3RPVA 3IW5A 5CXZA 4FE2A 4F9WA 2UZEA 5HO6A 4I0RA 2HW6A 4MHAA 5CLPA 5BUEA 3KMMA 4TYGA 2BILB 4BBMA 4CTBA 2GQRA 3RP9A 3CR0A 3GGFA 4YJQA 5HQ0A 3AGLA 1TQPA 2V7OA 2Y8OA 3F2NA 3G6GA 2X6DA 1R0EA 5IQBA 4NIFB 3V5WA 3UC3A 5K9IA 2VTTA 3DLSA 1LPUA 3BYSA 3F3VA 3BLHA 1YOLA 2CN5A 2VO0A 4QP8A 1Q61A 2XNBA 4TYHB 3C0GA 2JDTA 3EMGA 1AQ1A 2ITUA 2C69A 3GQIA 5TE0A 3I5NA 2UZTA 5EH0A 2H8HA 4UXQA 4ANOA 1KE6A 3FY2A 3R1QA 5AUVA 4U45A 5EHLA 5L2QA 3SHEA 3FL5A 5JGBA 2YZLA 3LMHA 4CMUA 4GYIA 3JPVA 5BVOA 3LXLA 1OIUA 4RT7A 3TNHA 4HZSA 3Q5IA 4FKWA 4XUFA 2W4OA 4BBEA 4O7TA 4K6ZA 3MFTA 5AIKA 4I5MA 5AMNA 3QRJA 3ALOA 5DVRA 3QQGA 5LQFA 3UOJA 3ORIA 3QTUA 5K5XA 1WVXA 4EH5A 4JJRA 4EH6A 2NRYA 1YDTE 2C6EA 3BLQA 3ZBFA 3ZONA 4IIRA 4C4JA 4CQGA 5CNOA 3FL4A 4L43A 4Y5QA 5EW8A 2RF9A 3UG2A 3BE9A 3C0IA 3OT3A 1W82A 3FQHA 3IG7A 3BGPA 3Q9ZA 4WRGA 4KNBA 4F64A 1K9AA 5HTCA 3O8UA 3QD2B 1V0OA 3AC3A 2JDOA 4UYAA 4BY9E 5J9YA 3LQ3A 1YDSE 5DG5A 2YCFA 3OW3A 3D9VA 3SRVB 3SW7A 4L9IA 2UVXA 5E8TA 4S33A 3V6SA 4OUCA 4R1YA 4EQCA 3FHRA 3HVCA 3DZOA 4AS0A 4GEOA 4C33A 2X8EA 4P7EA 2C5YA 4S31A 5ACKA 3MBLA 1KOBA 2R9SA 4FSRA 4A4XA 5KMOA 4NUSA 5BYZA 2GNIA 4G1WA 5CSWA 2VTIA 4Y5HA 4EI4A 3LCOA 4V0GA 4WUNA 4EOJA 3OP5A 1IAHA 2QG5A 5EM7A 4FODA 4DBNA 4D1SA 2O8YA 2VWXA 2BHHA 4X2GA 3E93A 1HCLA 1PXIA 5HE3A 4GH2A 4EHGA 5KCVA 3LFAA 5LMKA 1URCA 1QPDA 1Q41A 3LOKA 3FI2A 3EKKA 5GJFA 4ZZMA 4CNHA 3PLAE 1YRPA 4NEUA 4ASEA 4WNMA 4IVAA 1PMVA 5AUWA 4AA0A 3RK7A 4WG3A 2H34A 3H3CA 3FMJA 4EYJA 1ZMVA 3JY0A 4FI1A 2WMVA 2Z02A 4HOKA 4ZOGA 4FT5A 4C3RA 4EUUA 2HWOA 4EUTA 4FKIA 3TZ8A 1JQHA 2C6LA 3WF7A 3C1XA 5TKDA 4D4RA 2PYWA 3OHTA 1PHKA 3IECA 3EQRA 3A61A 3KB7A 5BUIA 2W7XA 2ITPA 4DGNA 3EL8A 5IA4A 5AM7A 3U8WA 4XG2A 4YHJA 1GZNA 2ITXA 4FV6A 4OBOA 1G8AA 4OBQA 1XH6A 1FVRA 3EQGA 4RQVA 3UZPA 1YHVA 3LQ5A 2F57A 3QKLA 2V7AA 4RLLA 2XMYA 3BPRA 3ZC6A 4ZP5A 2QOLA 3HAMA 1ZYDA 4HGSA 3UZRA 2JITA 3WZJA 4AT5A 5M08A 4NH1A 5KKRC 4BDKA 2PVLA 5A3XA 5IQGA 3RK9A 5AP5A 3NUXA 5IISA 2FB8A 4QPMA 4BB4A 5KMKA 4RRVA 4BCOA 2YISA 3EJ1A 2I0YA 4PDPA 3CTQA 4EHEA 3W2SA 1XH8A 1UV5A 1FGKA 3V5PA 3GVUA 4M66A 4QNAA 2VN9A 3LXNA 4XG7A 4O0UA 3DXPA 5EI8A 1GIHA 1NA7A 3A62A 4RJ6A 2OK1A 4NFNA 3H0YA 2XIXA 4F99A 2ZM3A 5EDQA 1Z57A 3ZEWA 3EFWA 4EK4A 3EL7A 2A2AA 4FV1A 2VTRA 2VWWA 3CY2A 3DK6A 2W1CA 4KIKA 3Q60A 4R5YA 3V3VA 4A4LA 3TI1A 4F9YA 3FAAA 3RAWA 4BL1A 2OJIA 4O7ZA 1ZZLA 1JLUE 1WZYA 4ENYA 4EK6A 3TKUA 3A99A 3ZSIA 4AG8A 3LXKA 3SG8A 4TY1A 4A9YA 4F6UA 1YI4A 5FXQA 5IMEA 4HGEA 4XG4A 3AC4A 3QC4A 4PNIA 2F7XE 4R7HA 4XRJA 1CTPE 3FLWA 5M44A 3NWWA 4LUEA 4JR7A 2YDKA 3AT2A 4RLKA 4Y95A 4O0WA 5I0BA 1GY3A 3BHYA 1S9JA 2QOQA 5GZ9A 4BIEA 4PNKA 5CU2A 5JZJA 5L6OA 4RFMA 3QTSA 5I9UA 3EZVA 4YP8A 2PZRA 5J87A 4BHZA 1YWVA 3GBZA 1R78A 3QXPA 3WE8A 4O7NA 4EL9A 4USEA 4IM2A 3GCQA 3O17A 4D4VA 3GUBA 3KMUA 5IF1A 3C4ZA 2YIQA 4GK2A 1A9UA 4QMLA 5EQEA 3TV6A 5H8GA 3GCUA 3PRFA 4U79A 2YM3A 4YSMA 3EQFA 2PVRA 1PXKA 3QYWA 3FLZA 4BZDA 4BWXA 2WMXA 4JBVA 4RIXB 3SOAA 2JLDA 5F4NA 3COKA 5ANJA 5I3OA 4E73A 3L9PA 1DI8A 3HA6A 2WOUA 4A06A 2G15A 4BKZA 5IQFA 4ZXTA 3F9NA 4R3PA 5AP2A 2PHKA 1UWJA 1M52A 4PY1A 4XCUA 4IAYA 1H0WA 3UYSA 2XZSA 3PPKA 2XNPA 2C5OA 3LLTA 1ZOGA 4IANA 3LKMA 3DKFA 1TKIA 3LJ2A 4XLVA 1DM2A 1REKA 2ITYA 2UW5A 3CKWA 3EQDA 4JT3A 5CSVA 5FTOA 4PWNA 2WZJA 3PPJA 3UC4A 4BI2A 4FKTA 3EN6A 5CWZA 3RNIA 4PV0A 3UBDA 4WG4A 3C51A 3O8PA 4YBJA 4ZJVA 1JNKA 2H96A 3HP2A 1J1BA 2X2LA 5ANIA 3P5KA 4CRSA 1H1PA 5G6VA 4E6AA 2R3QA 5EFQA 3LFFA 2ZV9A 3G9NA 3PA5A 3Q4TA 3BBWA 3QX2A 5HIBA 4FMQA 3MA3A 4G6NA 3LFEA 3ORNA 4CQEA 2CSNA 2R3NA 3RHKA 5GJGA 3LXPA 5AA9A 3R9OA 2ETRA 4ZY4A 3SGCA 5J5SA 1Q3WA 3P4KA 3UNJA 2WQBA 2HAKA 4PTEA 4NW6A 2WOTA 2G01A 4U40A 3UO6A 3FDNA 3A4OX 4OTFA 2EU9A 4FL3A 1CKIA 3E8DA 2J2IB 3IW8A 4P4CA 4XHKB 4XOYA 4Z9LA 4BKYA 5K4IA 5KKRB 4BGGA 4AW0A 2WELA 3FE3A 4QQ5A 5A4LA 5E4HA 4UV0A 4HJOA 2C6TA 4H3PA 3CQWA 1VYWA 1P5EA 2YDJA 3KRJA 3NS9A 4R5SA 3TUCA 2W1ZA 4EOPA 5JRSA 3LFBA 2WU7A 4FNYA 4D5HA 2A1AB 5AP7A 1MUOA 4C0TA 3LFDA 2YIRA 3DK3A 3HMIA 3EQCA 3FZ1A 5BMMA 2JDVA 3MY0A 1DS5A 4DG2E 3PVUA 4KBCA 4GYGA 3U55A 4ZS4A 3QTQA 2O0UA 4G31A 3KCFA 1CKJA 4IB1A 3G9LX 3KA0A 5CT0A 3R8LA 5J9LA 3N4VA 3MDYA 3K54A 3CXWA 3LFSA 4ITJA 4AE9A 4U41A 4I4FA 4IW0A 1J3HA 3WARA 3BKBA 1SVEA 1PYEA 4WD5A 2UZLA 1UU3A 2OF4A 3KRXA 4X2JA 5AUYA 4Q2AA 3FLYA 2J0JA 2PE0A 4BRXA 1BI8A 3UP2A 2OG8A 4RVLA 2OJFE 4TN6A 2GTMA 4K9YA 3QAME 4NW5A 4I41A 4QO9A 3N51A 5H8EA 5EM6A 4PP9A 5IUIA 5HLWA 1H26A 1KWPA 1U54A 1O6LA 3F69A 4QMWA 2JFLA 3NW6A 4KS7A 4PQNA 3WIKA 2CHLA 5FBNC 4FICA 3NAXA 4FUYA 4I6HA 4PDSA 4RA4A 4DEIA 2YCQA 3R04A 4ZTLA 1L3RE 2FSLX 3LM5A 3KXNA 2V0DA 1SNXA 3Q6WA 3QQLA 2WTIA 4QMVA 2R2PA 4F9BA 3NVMB 2BUJA 3NPCA 4IVDA 5CU3A 3DZQA 3U9NA 2ZB0A 4N6YA 3Q53A 4GL9A 5DR6A 1F3MC 3HMPA 3VRZA 3AD6A 2O5KA 4TWCA 4E5BA 3BYVA 2XJ2A 2B4SB 5E8WA 3I7BA 3PP0A 3I4BA 3NIZA 3RPSA 4BVUA 4YHTA 4CFXA 3ORTA 3FLSA 5HX6A 3D4QA 4YNOA 4ERKA 3VS5A 2WB8A 2ACXA 4H39A 3R7IA 2ZMDA 4L3PA 5A6NA 5G1XA 2IVTA 4FV9A 4D28A 5IDPA 3HDMA 2P3GX 2A19B 5IQDA 1SM2A 1BKXA 1B39A 4EOSA 2YAAA 5FEEA 3ZYAA 4FV8A 3BQCA 5F94A 5C4KA 4YLJA 4I5CA 3MGYA 2FSTX 3LAUA 4O7RA 4FKJA 2OJGA 3QCXA 5EKOA 5HI2A 4EK5A 2CN8A 3L1SA 3ZU7A 4AT4A 4QMYA 3T9TA 1W83A 3R7YA 2PMLX 2WGJA 2I0EA 3E5AA 2FO0A 4Y72A 5J1WA 5FTGA 2PMIA 3HYHA 4DH3A 4JX7A 4FTOA 4GKIA 1BI7A 2JKQA 1OL2A 3NIEA 4GV1A 4J1RA 1ATPE 2QONA 3FZSA 5FM2A 4F08A 4B0GA 2C6DA 5TT7A 3O7LD 4CXAA 1OI9A 3TIZA 4Q9ZA 3CPCA 5M09A 3KULA 5HESA 4DA5A 2WNTA 5TOZA 3VUMA 4C3PA 3T8OA 3VS7A 3WI6A 1OL6A 3ZZWA 3ZLWA 2PTKA 3JY9A 1YXUA 4AN3A 5CS6A 5CASA 4IJ9A 3R1YA 5HG8A 5L8LA 4I4EA 3KL8A 4JIAA 1M2PA 2GNLA 1HOWA 1V1KA 1QL6A 3R1NA 3MFSA 4FT3A 2C6KA 5IUGA 3JVSA 4LUDA 5FXSA 3C4FA 4MYGA 3VRYA 3PXRA 1NVSA 5HTBA 2KTYA 5HGIA 3EIDA 5EK7A 3UPXA 3DCVA 3PY1A 4APCA 3S00A 5HE0A 3GU8A 4XH6A 3ORKA 1KV2A 3OTUA 4UYNA 5CANA 5LCJA 3ZXTA 4JAJA 3DBCA 5ANKA 1OBDA 4JOAA 4X3FC 3ZCLA 3QRKA 1Q4LA 2O63A 3LPBA 4FSNA 5F95A 5FDPA 4XV2A 4BCNA 1J7LA 2UZVA 1M7QA 3M42A 3WF8A 4OGRA 2HCKA 1H8FA 3PSBA 5ETFA 5JN2A 3R30A 4FGBA 3OXTA 4XLIA 2ZDUA 4MEDA 4U7ZA 1HCKA 4FBXA 5C8KA 2RG5A 5EOBA 2OBJA 3G90X 4JX3A 3KC3A 5BNJA 2BALA 2YITA 4DEBA 5CAPA 3LVPA 3GOPA 5HICA 3FYKX 4IFCA 2F2CB 1F5QA 3W2OA 3QTWA 2WTKB 2UZNA 4P5ZA 5CZIA 4FK3A 2VD5A 4YU2A 4YGAA 4FV0A 2X2KA 3ZZEA 3CLYA 2C3LA 5EW3A 2BRMA 1ZOEA 2QO2A 1ZARA 2OIQA 3P1AA 4MXAA 4YHFA 3ZMMA 3ERKA 4XG9A 3TNPC 2XYUA 1XO2B 4FKSA 3VS6A 3QU0A 5HNIX 4G34A 4J95A 4DH1A 3GCVA 3U9CA 2VX0A 4F65A 3CSVA 3FEGA 2J90A 4GSBA 5CTPA 2EXEA 3ANRA 5IQHA 1ZLTA 5M57A 3G0FA 4FTIA 2OZOA 3QTRA 3VIDA 4X21A 2IW6A 2X9EA 4M69A 2CCIA 3IOKA 3VHKA 1Z9XA 3ELJA 4ANLA 3FJQE 3VBWA 2IG7A 2WO6A 4DT9A 4GU9A 4ASXA 2ITTA 4QPAA 4YTCA 1G3NA 3GI3A 4XP3A 2Y7JA 4RJ8A 2HXLA 5IA3A 2XB7A 4F0FA 3SG9A 3HV7A 2PE2A 3W2RA 2PMOX 3E92A 5JH6A 4GT3A 4YZMA 2VAGA 2Q0BA 4KA3A 3RAIA 4K8AA 5HNGA 3W2QA 2HZIA 4FGRA 3DJ6A 4AOIA 4CFFA 3MN3A 4MBJA 1J91A 2I40A 4ONAA 2RFEA 4R7IA 5M51A 3TZ9A 4JBOA 3RPYA 5L8KA 2XK8A 2UW9A 2XRUA 3FMKA 4DFUA 1E9HA 1YOJA 4GVAA 3IS5A 4BDJA 4KSPA 4ACCA 1ZYSA 1OPJA 5JMSA 4C3FA 3EB0A 1LEWA 2QOFA 2WQEA 4FEWA 3PG1A 4FOBA 5AR7A 4BDEA 3DLZA 4WT6A 5L3AA 4QTCA 5DPVA 4ZTHA 5H8BA 4D9TA 5AR5A 4O96A 2ERZE 4EZ3A 1WMKA 1YI3A 3KN6A 2BIYA 4BI0A 4QTEA 3H4JA 5EYCA 1OL5A 4ZAUA 1E1VA 1GIJA 4MQ1A 4I1ZA 3ZHPC 4FEUA 3BEAA 5GIOE 4C4FA 1VZOA 3MJ1A 4O22A 1VJYA 3DQWA 3IK3A 3TL8A 5HHWA 3V01A 4J8NA 4IB5A 4J71A 2G2HA 3P0MA 4XBUA 3R28A 2GQSA 3T3VA 4FTAA 3NCGA 2Z7SA 2YACA 4X2NA 4TKSA 4UX9A 4AF3A 1CM8A 3DNEA 3EN5A 5C26A 4UWBA 4QYHA 3GNIB 4G3GA 2XNNA 3ZH8A 4JBQA 1SNUA 3B2WA 1YOMA 5IA1A 4A7CA 3VUDA 4C57A 3RGFA 4CT1A 3EQIA 1BMKA 3FQSA 4H58A 3QZIA 4HZRA 2GS2A 3FMMA 5CF6A 4B9DA 2XVDA 2VTMA 2UW6A 4U3ZA 4QMNA 3AMAA 1XQZA 3IW7A 4BTJA 1WBWA 3AMYA 4HYSA 2Y9QA 3HDNA 1SMHA 1S9IA 1WFCA 1IAJA 2FSOX 5JFWA 4M14A 4IZYA 3F88A 5CZHA 3VJNA 3R7VA 4BCGA 1UNGA 4X2FA 2W05A 3WZEA 2C30A 3QUDA 1ZWSA 4JR3A 3H10A 4FZAB 3W18A 4H3QA 4GMYA 2GHLA 4AAAA 4LOOA 5C8MA 2WXVA 3TZMA 5GZAA 5D10A 1NXKA 5KX8A 5B2LA 5AADA 3QZGA 2XH5A 3LFCA 3DBFA 3Q9WA 4IWPA 4V01A 2QD9A 4ERWA 4ACMA 3OBGA 3LZBA 3UJGA 5BMSA 2X6EA 4HNFA 3ACKA 3R9DA 4AN2A 3FQEA 3QA0A 2YM8A 4RIYA 3CKXA 1OECA 4RWKA 3PJ3A 4KBKA 2R3KA 1BX6A 4RFZA 1FVVA 2E9PA 1WVYA 2JKMA 3DJ5A 2OGVA 3ZEPA 4BKJA 4DGOA 1ZYJA 3SC1A 3OEZA 4XX9A 2C5VA 3CIKA 3MPMA 4NFMA 3AC8A 3KEXA 2GQGA 4I21A 3UP7A 3V8TA 2BPMA 4FZ6A 2J0LA 2AYPA 3GU4A 4IVBA 4E4NA 1DAYA 3NYVA 4EC9A 4UN0C 3M2WA 4Y83A 3DXQA 2JBPA 3EOCA 5CT7A 4PMPA 3FV8A 4X3FA 1Y8GA 5D9HA 5EM5A 3C4XA 3FWQA 5E8YA 2JKKA 2YDIA 3DXNA 2BFYA 2IWIA 4WOVA 3V8WA 3TCPA 3G6HA 4FEQA 4BF2A 4FNZA 5DEYA 3R01A 4BCQA 2ONLC 5DR2A 3R21A 4C8BA 3UNKA 2WQOA 2BCJA 5DWRA 2GS7A 3IOPA 5AA8A 2HY0A 1XBBA 1IR3A 5AV3A 5BVWA 1PRYA 1SYKA 5D12A 5FM3A 3LCSA 5AX9A 5K5NA 2ETKA 4UMQA 1O6YA 1OB3A 3F3UA 2PE1A 4O0VA 3R8VA 1OBGA 2GPHA 3NMUF 4MNEA 4AGDA 2ESMA 4O0TA 3I0QA 2OI4X 2XNOA 3IW4A 5HU9A 2PULA 3TV4A 2BZJA 2BZKB 3ALNA 3D0EA 3L8XA 5LWNA 3D5UA 4WIHA 2B53A 4HCTA 1H27A 4B4LA 3UIXA 4FYOA 3WF9A 4FTJA 3FMHA 2YJRA 2HZ4A 3VF9A 4KB8A 4GRBA 4YNEA 4JDJA 2XIKA 5M07A 4XG8A 4EZ7A 3SD0A 2BDFA 2PVYA 3QQFA 4RX8A 5KMIA 5FD2A 2W0JA 4I6QA 4EC8A 5HO7A 4LFIA 3ZUUA 5DNRA 4YZNA 4A9RA 4CMTA 3RWPA 1YKRA 3R6XA 5HIEA 3E7VA 4MD9E 3CQUA 5M4CA 3VQHA 4WKQA 5I4NA 4YZCA 4F7NA 1P2AA 3A8XA 3A7GA 2Z7QA 3HP5A 4RIWA 5FXRA 3CCNA 4YJVA 3ZS5A 4XRLA 2VTJA 2G9XA 2GNFA 4AWIA 4CMOA 4DGLC 4OTWA 3HV4A 4EHVA 1F0QA 1QCFA 2OZAB 1WAKA 5K0XA 3KFAA 4BWPA 3QD4A 4XMOA 4YO6A 5LVMA 2AC5A 5BVDA 5AP3A 3Q9YA 3RMFA 4CD0A 1JBPE 1PYXA 1PMUA 2DUVA 4QMXA 1IG1A 2FUMA 1YDRE 3CGFA 5IEXA 1UNHA 3G2FA 4NJDA 4F0IA 3ENMA 3RK5A 3R8PA 2BR1A 4M84A 1QPJA 2R3GA 1FPUA 2G1TA 4U43A 5FLFA 2EXMA 5AUUA 5M06A 5AFVA 3ZM9A 3ORMA 2VTPA 3WZKA 3O0GA 3BYMA 4TXCA 5IDNA 4LRMA 2HK5A 2XIZA 4NCTC 2GTNA 4MXCA 4F09A 1DI9A 3GCPA 3Q04A 3R7OA 5CI7A 5IPJA 3BHUA 4H3BA 4LM5A 5E92A 3D7TA 4H36A 4TPTA 2ZV2A 4FEVA 2V55A 4AX8A 3AOXA 4PX6A 3N4TA 5A54A 3DV3A 4W8EA 3HV3A 1GAGA 1OL1A 2B52A 3PJCA 3BHTA 3AD5A 2WMWA 3ZSHA 4GT4A 3UOKA 4AOTA 3WE4A 3LJ1A 3IGOA 4NIFA 2E9VA 5IA5A 3R9NA 3ZOSA 3NCZA 2BRBA 5D41A 3EFLA 4G3FA 2VX3A 5LXMA 2CNVA 4O6EA 2XNEA 2B55A 4TYHA 2A4LA 4BDIA 4YURA 3V51A 2C6OA 5AAEA 4TNBA 3H9OA 3PIZA 4RMZA 3OMVA 4D4SA 5BYYA 3ENHA 4FUXA 3OOGA 5FUTA 4FSZA 1H0VA 1JSTA 3I7CA 3VS3A 3L9MA 2PUNA 3PG3A 4KABA 1WBTA 4N70A 4OAVB 2JGZA 2X7GA 4LG4A 3LHJA 2R7IA 5EOLA 3F7WA 4MVFA 3OWKA 4ZSEA 2BIKB 3CP9A 2GDOA 4EORA 1J7UA 4FG9A 1Q62A 5AAFA 4D2RA 3F66A 2O64A 4V04A 5LMAA 2PZYA 4B6LA 4QP6A 2UZWE 3A2CA 2R3LA 3KK9A 1BLXA 2PPQA 2OH0E 3LE6A 3D2KA 3EH9A 4FSUA 1OPLA 1U5RA 4LL0A 4BZNA 4HNIA 4HW7A 1ZYLA 5CF5A 4XV9A 3E64A 4PPAA 2QURA 5CEKA 2ITZA 4EH8A 1W98A 2XCKA 2VTOA 3ORZA 2W96B 1JOWB 4FTUA 4ZY6A 4E4MA 5CAQA 2F7EE 2XIRA 4FTRA 2ZAZA 3EZRA 5HKMA 2Z60A 4MAOA 2HWPA 4EYMA 4GKHA 3FZOA 4YJTA 3ZO2A 2W9ZB 1OUKA 4IHPA 1TQIA 4IX5A 4U0IA 2EB3A 3UPZA 4X6RA 3KRWA 2X7OA 5ICPA 4ZTQA 4S34A 4I3ZA 4FV7A 5K3YA 2VTSA 3QQKA 4CLJA 1JPAA 2ONLA 4JRVA 2NPQA 2P33A 3MFUA 3FZTA 4L00A 4TTHB 4XBRA 5EDPA 2UZDA 1CSNA 5DEWA 3PXKA 3IKAA 3K5VA 1Y6AA 2CGWA 4KAOA 2CCHA 2CGVA 4U80A 1Q97A 2C6MA 4C02A 3BE2A 2PL0A 3NYXA 5BYLA 5BVEA 1YXSA 2OSCA 2OXXA 3JUHA 4MCVA 5CEIA 3C50A 4ZTNA 2W4KA 2WFYA 1FQ1B 2X8IA 1WBSA 3G33A 3TDWA 2XP2A 4D2SA 5E8SA 3OW4A 3DA6A 4LOPA 2R3IA 3RZBA 2ZDTA 2Z7RA 3PP1A 2UZBA 2NRUA 3D94A 3L9NA 5DIAA 3OT8A 2BTRA 2GHGA 1GJOA 4DEGA 4JVGA 3KREA 4LGHA 3RNYA 2XJ1A 2CPKE 4O84A 4OTPA 3ID6C 4JDHA 3POZA 5L6PA 4W9WA 4JL9A 3R7UA 4GU6A 4KWPA 4U8ZA 3R2YA 5I9ZA 2UW8A 4E3CA 3PJ1A 2C3JA 4YR8A 5HBHA 5FEDA 3QWJA 3VO3A 4BYJA 1GZ8A 5CF8A 3PVGA 4FSYA 1ZXEA 5CI6A 3IDBA 5DLSA 2YZAA 5DH3A 5GHVA 4PDYA 3GT8A 4AZTA 3IW6A 3TM0A 2YM6A 4E6DA 3P23A 4KSQA 1OVEA 2XCHA 3E8EA 3JXWA 4IAFA 4BIBA 2QO7A 3R7GA 3OWPA 3TJDA 4MBIA 4UMPA 3DBQA 2VNYA 3DB8A 5EW9A 1Q8TA 1JKSA 4J7BA 4YPDA 5KE0A 5C4LA 1O9UA 3AGMA 3QL8A 3RPRA 3KF4A 4FTQA 1ERKA 3OG7A 4UWCA 5I9YA 2CGUA 3TN8A 4CZUA 4UMRA 5IQCA 3KCKA 3TJCA 4MKCA 3F61A 3FMEA 4M0ZA 5JQ5A 4LRJA 5IH4A 1H1SA 3S4QA 3S1HA 3G0EA 4FZ7A 3I1AA 3VUKA 4PTGA 5H2UA 3K3IA 2BROA 2R5TA 3ZTXA 3EN7A 5E8ZA 3EQBA 4AGWA 3VUIA 2YLEA 3NUYA 4FNXA 4E26A 1OIQA 2JAMA 4JNWA 2J0KA 1XBCA 4HCVA 5DI1A 2O3PA 1UWHA 1KE8A 3G5DA 5KBRA 4ZJJA 2ZV7A 3FMNA 4U3YA 4XNEA 4D9UA 4QMSA 4Z55A 1OGUA 3MH2A 3U6JA 2CNQA 2CKPA 2VX1A 3WYYA 2WMRA 2OIBA 2OF2A 2F9GA 5AR4A 3W8QA 3ZDIA 4ZEGA 4BZOA 2ZVAA 2CMWA 1KE9A 3BBTB 5A46A 3M11A 3PXZA 3Q52A 1H07A 3H0ZA 3UG1A 3W1FA 4QP3A 5E90A 4TNDA 4WBOA 2J50A 3EN4A 3KXGA 4ALVA 5HORA 4IE9A 4CFWA 4EOQA 3FZRA 4MXYA 2Q0NA 4RX9A 2R3OA 3HEGA 3BHHA 3MI9A 2F2UA 3MVHA 3VS1A 4RIXA 4MWHA 2YN8A 1JAMA 5LJJA 2ERKA 2PVHA 5JRQA 4O21A 4GIIA 3W55A 2OH4A 4GFOA 1ZY5A 2JBOA 3HECA 5EHYA 4K2RA 3MVJA 5DN3A 2ETMA 3UZTA 3PRIA 2C5NA 1BUHA 1IA8A 3AT4A 3VBYA 1GOLA 4MF0A 3R9HA 3AQVA 3V6RA 2XYNA 4USFA 5A4TA 2AUHA 3EYHA 3QWKA 4JRNA 3ZLYA 3IQ7A 3N4UA 2YIYA 3SXRA 3DK7A 3FI4A 1I09A 4FIGA 4JG6A 5DYJA 3UQCA 4DHFA 4L44A 4O6LA 4BCFA 4EWQA 4QTBA 3RBWA 2XBJA 4C4IA 4EK3A 3MTFA 2RL5A 4QOXA 1GZOA 4I20A 2RSVA 3ULIA 2IZSA 4LGDA 5JZNA 4YTIA 3FUPA 3JYAA 2P55A 1PF8A 2QC6A 4WA9A 1LEZA 1YW2A 3RJCA 5I9VA 3IPHA 4OW8A 5J7BA 4NM3A 4F1TA 3AC1A 4BHNA 5AUTA 4DLJA 3TDVA 4BR3A 4G17A 1FMOE 3BGZA 4YBKA 4RFYA 5E1EA 2VO7A 3CEKA 3Q9XA 5K0KA 2BAQA 3DTWA 5DT3A 4B99A 4CCBA 2XJ0A 3ROCA 3HUBA 4GFMA 3NAYA 2IW8A 3UIUA 2WTKC 4ZZOA 3PJ2A 3C4CA 1Q8UA 3OD6X 3VBVA 4EH7A 2W5AA 4FSMA 4YJSA 3KXZA 3TG1A 3U51A 2EUFB 2YM4A 4HVHA 3UOLA 4MTAA 4GJ3A 4NM5A 3UQGA 4XV1A 4EOOA 3U6IA 3D7ZA 3COIA 3V5JA 4F4PA 2JIIA 1AGWA 2BZHB 2WIHA 4R7BA 5CXHA 4AE6A 5FEQA 4FIFA 1KE7A 2CGXA 3BRBA 3FBVA 4MD7E 4WRSA 4OTHA 4GK3A 2B0QA 1H01A 2YWVA 5KMNA 3R73A 1W7HA 2Z7LA 3QZFA 1H1RA 5DR9A 5ETIA 5AUXA 2C1BA 2LGCA 4QPSA 5IA0A 4JIKA 3DAKA 4L68A 5D7VA 3C4WA 3W10A 1MQ4A 4GG5A 4DAWA 2WTDA 3D5WA 3BV3A 1PKGA 3BU5A 2GU8A 3DJ7A 4FV3A 5TR6A 1OIYA 3IO7A 2R3PA 3ZUVA 4O83A 3QF9A 3TV7A 3VS0A 2E9OA 1H00A 2YA9A 5AX3A 3GC0A 4R78A 2ZV8A 5F1ZA 3AXWA 1QMZA 2XK7A 4LQMA 5CALA 3PXQA 3FXZA 3F2AA 4LRKA 2Q83A 3II5A 4V05A 4EH3A 4IWOA 3D2IA 2X7FA 5HE2A 3G15A 2P4IA 2X9FA 3DKOA 4FTKA 2C6IA 3KULB 5E91A 3ORPA 5E1SA 5LVNA 4XG3A 2XEYA 5D7AA 3BX5A 3P7AA 5GINE 4EONA 5CAOA 1CKPA 3VVHA 4A07A 4CFVA 4XP0A 3QA8A 4JLCA 1A48A 1OMWA 4FG7A 4FV5A 4J98A 1DAWA 4RJ5A 4ZSLA 3PLSA 4AP7A 1U4DA 2JC6A 1OZ1A 4NT4A 4U44A 1UVRA 3PVBA 4CG9A 3OUNB 2W1EA 2ITNA 3CTJA 3E3PA 1JKTA 4CKIA 3ODZX 2UZUE 3HGKA 2XS0A 3POOA 4IB3A 1JWHA 4ZY5A 2YAKA 2ZOQA 5DA3A 3QZHA 4AGUA 4KIPA 1NY3A 3VBQA 3AC5A 4UY9A 3UOHA 4ANSA 2J0IA 4IACA 4FT7A 5HLNA 4GT5A 4IAKA 4UBAA 1PXMA 3BELA 3QCYA 4BWKA 1PMEA 4UMTA 3IDPA 4YPSA 5AEPA 5KUPA 2F49A 4K1BA 4TRLA 4K77A 1APME 3S0OA 3PY3A 1RJBA 3KK8A 1X8BA 3LCTA 4UXLA 1ZY4A 3WOWA 3ZC5A 3FXWA 3U54A 1W8CA 5DE2A 4IM3A 4N6ZA 4J53A 5BVFA 3ZBXA 3PJ8A 4X2KA 1JSUA 1JSVA 3FKOA 3E62A 3ET7A 3BYUA 5B2MA 3P79A 3V5TA 3B8QA 3WZDA 1LR4A 2IVUA 3A4PA 4W4WA 3O23A 4AN9A 3S3IA 3D5XA 4DC2A 4QYEA 4YC8A 5FP5A 3FC1X 1PXNA 5D1JA 2QKRA 3MH0A 3QRIA 3KKVA 4YC3A 5J8IA 4CSVA 4FL2A 1PJKA 2A27A 2G2IA 4W8DA 2QKWB 5AP6A 4K18A 4Z16A 3TWJA 5M4IA 2V62A 4C4EA 3NR9A 1NT2A 1FINA 5CAUA 1Q24A 3L9LA 4O7SA 2J5EA 4I22A 2GFCA 3H9RA 4TWNA 4WSYA 4BI1A 4C37A 3NUAA 4Q5HA 5FP6A 2W06A 2W1DA 2HZ0A 4D2PA 2CJMA 4D0XA 4IDTA 2XBAA 2WMSA 3LJ0A 4J99A 3VJOA 2RFSA 3SKCA 2XA4A 4PMMA 4E1ZA 3PSCA 4ACDA 2BAKA 3SLSA 4HPTE 2BRHA 1J1CA 3OWLA 3PTGA 4R3RA 3MY5A 2ZMCA 3TEIA 4CKJA 4QD6A 3F3ZA 1BL7A 4ZK5A 3MPAA 2PVJA 1R0PA 5A14A 2IZTA 2OFUA 4QP1A 4RGJA 1XH5A 4O91A 3VWAA 4IMYA 4ANBA 4DGMA 4MXOA 3KVWA 2R3JA 4E6CA 4F6SA 3RZFA 3NNUA 2XEZA 3O7LB 2WQMA 3E8CA 3VNTA 4BGHA 2R3MA 4B7TA 3CY3A 3DS6A 3E7OA 5DRDA 4Q9SA 3FMDA 3REPA 4F63A 4ARKA 5IA2A 2P2HA 2OW3A 5EI2A 4BDBA 4E6QA 2P0CA 1OKWA 5HCYA 3ODYX 4Z7HA 3ZLSA 4G16A 4QMMA 4BBFA 4BCIA 2BAJA 5KMJA 4RWIA 3W8LA 1JKLA 1PMNA 4QNYA 4YUQA 3FXXA 4O2PA 2YIWA 4EOKA 4RVKA 3NUUA 5CF4A 4BCKA 2W1FA 3FSKA 3OS3A 2Y0AA 4OTIA 5FQDC 2Y4IC 4IWQA 5C8NA 3VULA 5FWKK 2H9VA 2SRCA 2BRGA 3AD4A 3HZTA 5JFXA 5CYIA 2C3KA 4N57A 3P7BA 4TYIA 3FZPA 1LUFA 3I0OA 1Q5KA 3ZRKA 1WBOA 2QLUA 3VQUA 4FSTA 3TACA 2QOHA 4RWJA 4L7SA 4NM0A 4F7SA 5BQ0A 5HU3A 3C0HA 1NW1A 4H1MA 3CJGA 4EBVA 2XM8A 3ZXZA 2R3RA 4JQ7A 4QP2A 3MH1A 1K2PA 4KKGA 5FBOA 4WHZA 1XBAA 4IZ5A 3QQJA 4Y8DA 2FVDA 2WD1A 3KGAA 4H05A 4QP9A 4FVPA 2J7TA 3W16A 3QQHA 5KHXA 4IAAA 1E1XA 3KXMA 5L2WA 2UVYA 5LVPA 3MWUA 1WBVA 5I5ZA 4AXAA 4FT0A 3BEGA 3A7IA 4G6LA 3QALE 5KZIA 1W84A 2C5XA 4FTTA 4FTCA 1QPEA 4OAUC 4DFNA 3EQPA 3L8PA 5AR2A 4LMNA 4LYNA 4TWOA 3F3TA 2VTQA 2VZ6A 5B7VA 4FNWA 5HVKA 3SDJA 1MRYA 5IQIA 4K33A 4EQUA 3OY3A 5KMLA 5TF9A 2FGIA 3TTIA 3EHAA 4F9AA 3HMMA 4X3JA 3ATSA 4CV8A 2VTHA 4RX7A 4IFGA 4FKVA 1UU7A 2GNGA 3OFMA 4O82A 2CDZA 2I0VA 1P4FA 2W1HA 3UIBA 3NZ0A 4DE4A 4KIQA 4DF3A 3NGAA 5HCXA 4M8TA 4G6OA 3P78A 3PIYA 4U81A 4AA5A 2UW0A 4N4SA 3SX9A 3NYOA 3HX4A 4LI5A 4FF8A 2KULA 3U4WA 3SOCA 4M7IA 3NNWA 1FOTA 3PY0A 2VWUA 3PUPA 3JS2A 3VUTA 3FKLA 4FIIA 1Q99A 5EM8A 5AR8A 4GUEA 2XIYA 4RJ7A 3I6UA 3CC6A 4I6BA 3R7EA 5HG5A 2BMCA 2DWBA 3GC7A 2J9MA 3MS9A 4MQ2A 5DRBA 4E5AX 1RDQE 2QO9A 1SVGA 5CSHA 1XR1A 3V8SA 5E9EA 1OL7A 3NW7A 3MB6A 3OXIA 4JAIA 3QLFA 4RWLA 5CEQA 5C01A 3SAYA 4F7LA 3PSDA 5HTIA 2HY81 3FKNA 4HGLA 1KOAA 2DS1A 2WPAA 4FA2A 2QOOA 3SXSA 3UVQA 3PWDA 3R8ZA 3SA0A 3R0TA 3PWYA 2UVZA 4P90A 2QU5A 5L8JA 4I0SA 1NVQA 2WMTA 2HXQA 3H30A 4QYGA 5HCZA 4WUAA 3R8UA 4QYFA 4LV5A 4HVSA 1VYZA 4EJ7A 3DOGA 3F82A 4IXPA 1YQJA 1YVJA 2I6LA 5HEZA 3Q2JA 3UYTA 3D5VA 5C1QB 3UTOA 3RI1A 2GHMA 4BGQA 3BU6A 5HLPA 5CVHA 5IUHA 4OT6A 3CBLA 1OKZA 4EEVA 4DFXE 4NU1A 3QFVA 5HIDA 3BGQA 4DH8A 1WCCA 1RE8A 2VRXA 4DFLA 3LLAA 4QMTA 2B7AA 1OUYA 4FYNA 2Y4IB 2VU3A 4FIJA 3A7JA 5HBEA 3OROA 4MF1A 2BDJA 4B8MA 4F7JA 2WTCA 4Y46A 4RIOA 2XNGA 4NK9A 3B8RA 2YCSA 3ZFYA 4CFNA 3HKOA 1KV1A 4BTKA 4ZSAA 5EDRA 2VO6A 3O96A 2X0GA 2YJSA 2QNJA 2WQNA 2YWPA 4RBLA 3FPQA 1TVOA 2E9NA 3O51A 3PYYA 3TZ7A 3L8SA 4HGTA 4L7FA 4W4YA 4C38A 2VUWA 4CRLA 3OBJA 3EN9A 5E7RA 5FDXA 2C1AA 2R0UA 1PXJA 3SVVA 4QTAA 1PW2A 4UWYA 4C2WA 3GXLA 3QGWA 2NP8A 3DFCB 3QD3A 2X1NA 4FV2A 4ALUA 4L01A 3ROYA 3V5LA 3QUEA 2PZ5A 4RVMA 4IB0A 3PVWA 4FZDB 5DGZA 4CEGA 4ASZA 5BVNA 3LMIA 4EHZA 5LVLA 3AC2A 3RKBA 2R4BA 4PL3A 3DU8A 2VV9A 5AJQA 3KU2A 4AT3A 4BDHA 5IKWA 2WMQA 3ZFMA 3E88A 4DYMA 5IMXA 4D2VA 5IQEA 1YXVA 3KXHA 3OZ6A 4HCUA 2CLQA 4GFGA 4G3EA 3U6HA 4LL5A 3RVGA 5GIPE 3TXOA 4FVQA 4ZMFA 1H08A 3ACJA 4JI9A 5I9XA 3BCEA 4DTBA 4ORKA 2WTJA 4KKHA 2PUIA 3ZO3A 1XJDA 3DKCA 4O86A 5CQUA 2X4FA 4G2FA 2XK9A 2GFSA 3BWJA 1CMKE 4XOZA 4AFEA 1WVWA 2YHVA 2OZAA 2PUUA 2WTWA 5AV0A 4Z3VA 3R02A 5JQ8A 4ITIA 3ZSGA 4YZ9A 3W2CA 5A4EA 3PZHA 1KUTA 3PA3A 2HENA 1Y91A 1YXTA 4WBBB 4RC3A 1FMKA 3Q4ZA 3DBEA 4Z7GA 1R3CA 3KN5A 4L46A 4LOQA 4NZWB 2ITWA 4V0GB 3MB7A 4F9CA 2UW4A 2C47A 4MNFA 3PE1A 4I0TA 3LCKA 3P9JA 4JS8A 4M13A 5JEBA 3DAJA 3DPKA 4FVRA 2BKZA 2YIXA 3KVXA 3Q6UA 2WMBA 3HL7A 4X0MA 3NYNA 3PDTA 2F7ZE 4PUZA 4QMOA 4YTHA 1IEPA 3NLBA 2C0OA 2Y6OA 1Y8YA 4FG8A 4UEUA 3TUDA 1RW8A 4JQ8A 4DH7A 4U97A 3WF5A 4TW9A 3Q5ZA 1YXXA 4QRCA 3VUGA 4ALWA 3UQFA 4OR5A 5JK3A 5CSXA 2AC3A 4R8QA 2UUEA 2XUUA 3EFJA 2X2MA 4YLLA 2JEDA 4FC0A 5ANOA 2LAVA 2XF0A 4EOLA 1M14A 4IBMA 3COMA 5AP4A 3OF0A 1GIIA 2PSQA 2REIA 4DEEA 5M53A 2BZIB 4E8AA 4F6WA 4J52A 2WMUA 2BFXA 4USDA 3QKKA 2VGOA 4M67A 3VF8A 4EH2A 5ANDA 1UKIA 1ZOHA 5HZNA 4TZRA 1OPKA 3SRVA 2XK3A 2XM9A 4ENXA 2VTLA 2Y6MA 5C03A 5AV2A 5A4CA 2BHEA 4C34A 3CTHA 5T6KA 5CVFA 3NNVA 5DT4A 2WTVA 3DT1A 1REJA 3HA8A 4FIEA 5ACBC 3MJ2A 3S95A 1XHAA 3AMBA 3I60A 3MIYA 1Z5MA 5EHOA 3FYJX 2BVAA 1JVPP 3TTJA 3R9RA 5J95A 3NUSA 2ITOA 2VWZA 2R64A 2WIPA 3BIZA 5H9BA 5HG7A 4C58A 3JR1A 4GCJA 3BV2A 4FKGA 4DEHA 4KIKB 4C59A 1XH4A 5KO1A 3CD8A 1R1WA 4ZZNA 3O50A 4FR4A 2EVAA 3F3WA 4OBPA 4L53A 1CDKA 1AD5A 4G3CA 4NM7A 3VC4A 4RJ4A 4IX6A 4X6QC 3NW5A 3IDCA 4LGGA 4DFZE 2IN6A 4FX3A 4L67A 4WNKA 5F20A 4QP4A 3BWFA 3D14A 3W32A 2J6MA 2OWBA 3UVPA 4MWIA 1XWSA 5CU6A 4Y85A 5KBQA 1ZYCA 4RJ3A 4ANMA 4YMJA 3OY1A 5LOHA 4I93A 3Q2MA 4WSQA 4TYEA 5CEMA 2FA2A 2C0IA 2VWYA 4I94A 2RFNA 1OKVA 2QOKA 4KRCA 3BYOA 4PF4A 4AUAA 4DCAA 3HRBA 5BVKA 4NKSA 4A9SA 4E93A 4FKUA 3HV6A 4KRDA 4CCUA 4BN1A 2QR7A 2CKEA 5E8XA 3UIMA 1OKYA 1GNGA 4XYFA 4D2TA 3PFQA 4HVGA 2V22A 5CU0A 1ND4A 2PMNX 3QLGA 4G5PA 3M1SA 3I81A 5CENA 3QUPA 2VTAA 4NTTA 4YO4A 1R39A 1URWA 3KF7A 4O1PA 3NX8A 4FTMA 2O2UA 2Z8CA 4IZAA 2IPXA 2OFVA 2W9FB 4XEYA 4YJUA 4FKOA 4CYJA 3HMNA 4IAZA 4M0YA 3R8MA 4BDAA 1PXPA 5DHJA 2ITVA 4EKKA 3P86A 3RM6A 2PWLA 3UMWA 2OLCA 3VN9A 3OUKA 3Q4CA 5LCKA 2W5HA 2I1MA 2VWBA 2OICA 2OKRA 4IQ6A 4W4VA 2CNUA 2W1IA 3F7ZA 3RINA 4RC2A 3A8WA 4RSSA 5E8VA 3MVMA 4AZEA 2YABA 2YM5A 2WMAA 3FI3A 2QOCA 3U87A 5CQWA 3NNXA 3RWQA 3LMGA 4GUBA 4RZVA 2GNHA 2XK6A 4NCTA 3OXZA 4C62A 5JFSA 2PZIA 4TWPA 4ACGA 3CD3A 3WYXA 4FEXA 4BCMA 3CGOA 5AM6A 5L4QA 4EK8A 4E4LA 3MPTA 4QP7A 5L2SA 2PZPA 4DTAA 1UKHA 4QMPA 4MXXA 3GP0A 4G9CA 1ZMUA 5IU2A 3TUBA 3BZ3A 1L8TA 1I44A 3G51A 4CTCA 3GFWA 4D5KA 2H6DA 3QKMA 3ULZA 2X81A 5EYMA 4KD1A 4DGGA 3MTLA 2C0TA 3ORXA 5K4JA 5DMZA 2BKKA 3THBA 2XK4A 3DB6A 2RFDA 3UMXA 5D11A 3R71A 4B8LA 5DFPA 2QU6A 3FC2A 2RIOA 1XKKA 2WU6A 4CV9A 3JVRA 3IGGA 2X8DA 5JKGA 3EKNA 4IAIA 3F5PA 5M56A 3FY0A 5I3RA 5HNBA 2UZOA 1Q8YA 4NWMA 2JFMA 4DFYA 4F0GA 3HLLA 4PP7A 4O27B 1H25A 4HYHA 3R22A 4XJ0A 3Q3BA 3VW8A 4FOCA 3GEQA 3FSFA 3F6XA 4J96A 4X7QA 4GJ2A 4DITA 1Y57A 1KE5A 2JAVA 3A60A 4BCJA 3Q4UA 3ZRMA 4ZMEA 4CLIA 2BRNA 3BU3A 4NJ3A 5HVJA 4MK0A 5DOSA 4ZSGA 4J8MA 3VW6A 5KHWA 1Q3DA 3RCJA 3QHWA 2YM7A 3QTXA 2ITQA 4CFUA 4NL0A 4BC6A 1YWNA 2F4JA 3E3BX 4UZDA 4CFMA 3QGYA 4FL1A 3TNQB 4PTCA 2GCDA 4XP2A 1XH9A 4FTNA 4D58A 4QMQA 5IQAA 4RZWA 2WHBA 2O65A 4U6RA 3N9XA 2HOGA 2PVFA 2ZM4A 3UO4A 4Q5EA 2DQ7X 3MW1A 5LWMA 2PUPA 1IRKA 4L42A 1MRUA 1U54B 4L52A 4U5JA 3EYGA 4YZBA 4ZS0A 3TNWA 2CKOA 4I6FA 3TKIA 2EWAA 4HYIA 3QX4A 1OITA 4JQEA 4O0SA 4F1MA 2IVSA 2OJ9A 3WIGA 4RC4A 2IZUA 3VHEA 2YLFA 5JGAA 2PK9A 3PE2A 4IM0A 4QQTA 4GK4A 4D4YA 5BPYA 5EQYA 3QYZA 5I9WA 3DFAA 2J0MB 3DY7A 5GZ8A 3SXFA 3UNZA 2QG7A 3C4EA 4IX4A 1PXOA 1Y6BA 3GFEA 1B6CB 5FGKA 1U5QA 4KS8A 5ETCA 4YSJA 4YLKA 2RG6A 5T68A 2PVKA 5HD4A 2I7QA 3VUHA 3E87A 3O71A 4O1OA 2YEXA 3OCTA 4OTRA 5CX9A 4ZTMA 1BYGA 3QBNA 2QCSA 2A0CX 3ETAA 4PMSA 4DH5A 1UU9A 1G8SA 5L2IA 5J7HA 5BX0A 4RA5A 4MH7A 3COHA 4FT9A 2XRWA 5B0XA 3K5UA 3GC8A 3LCDA 3P7CA 4I24A 5F9EA 4J97A 2YCRA 2OO8X 4FZFB 2QR8A 3HAVA 1UA2A 3E63A 5CY3A 4MBLA 5IH6A 2QVSE 2VNWA 4L3JA 5FTQA 3WILA 3RHXA 4O0RA 4BIDA 5H3QA 4DN5A 5M55A 4AZWA 5AAGA 4JDIA 4S30A 3QCSA 5GJDA 3NDMA 3WZUA 5IG1A 3ATTA 4IADA 1FBNA 1H28A 3MA6A 2EB2A 2J51A 2VO3A 4DCEA 4DBXA 3DDQA 2Z2WA 4I5PA 3GC9A 1GZKA 5LARA 4AZFA 3R00A 3TKHA 4YJRA 3FPMA 4CG8A 3GCSA 5FG8A 4BICA 4M15A 5HE1A 4A4OA 2X39A 1IA9A 3L8VA 3QTIA 3ANQA 4PRJA 2FYSA 4GW8A 3SW4A 3VBXA 4L8MA 4OTDA 5JT2A 3UVRA 2E2BA 3UDBA 3ZDUA 3QXOA 3EFKA 1YHSA 5LMBA 5AWMA 3U4UA 2HYYA 2P2IA 4BTFA 3UGCA 4ANNA 4DG3E 1FVTA 3R2BA 4UALA 4G5JA 5HOAA 3FLQA 3C5UA 3SV0A 4FKRA 4K0YA 4CVAA 1U46A 3F5XA 4JXFA 5AIRA 3D83A 3ITZA 4C4HA 4BDFA 4S32A 4YTFA 2BTSA 2VWIA 3QRUA 3PA4A 5J5TA 3BHVA 3RPOA 3VBTA 5IZFA 4E7WA 1KSWA 2X4ZA 4IWDA 3A7HA 5E8UA 4WO5A 4ZIMA 3NVKI 2B54A 1YHWA 4H1JA 1XH7A 4ASDA 3ZRLA 4IC7A 4NYEA 4O7WA 4L6QA 5LVOA 2C3IB 3KRRA 4R6VA 2VTNA 3MFRA 5CU4A 4TYJA 5JGDA 1VEBA 4OTGA 5AV1A 4W9XA 2B9IA 3UODA 5A6OA 4R3CA 3I79A 4MXZA 4BFMA 2XKFA 3AG9A 3HMOA 4A9TA 4BTMA 4KBAA 5CSPA 2W1GA 3SQQA 2R3FA 5C9CA 2PY3A 2W17A 4RPVA 5HO8A 2B9FA 2CLXA 4QYYA 4AW5A 3F5UA 4BDDA 2JIUA 4RG0A 5T3QA 4BDGA 2J4ZA 3R1SA 5IEYA 4QQCA 4O7YA 1A06A 2VGPA 2OU7A 3D15A 2OXYA 2QOIA 3PPZA 2WEVA 1M17A 4HYUA 4YZDA 4AGCA 3BLRA 4EOMA 2JD5A 2C68A 3DGKA 3HRCA 3NUNA 5C27A 4ZLOA 3HV5A 3T9IA 5AV4A 1SVHA 3A7FA 2HELA 4IC8A 4ZJIA 4JG8A 5AP1A 1J7IA 1QPCA 2R3HA 3O8TA 4AACA 4EZ5A 2G2FA 4OTQA 4UB7A 5ANGA 3GOKA 4CZTA 4AQCA 3I5ZA 4M69B 3OCSA 4HVDA 5FRIA 1IASA 5ETAA 2XNMA 5HBJA 4PL5A 3MVLA 3MV5A 2PVNA 3QC9A 4AZSA 4IVCA 1V0PA 2I0HA 3IONA 4DLIA 5M4FA 5KZ0A 1WBNA 4LMUA 3RALA 3EQHA 2ZYBA 3T3UA 3C7QA 3GU5A 5KMMA 5IH5A 3GU7A 2GSFA 4TT7A 3ZLXA 4C36A 4D1ZA 5CEPA 4EQMA 2V5QA 3V04A 2PU8A 4C4GA 1W0XC 4PL4A 3KY2A 4CT2A 3CE3A 4IDVA 3ZO4A 5KNJA 4NTSA 5TO8A 3ORLA 5CNNA 1MQBA 1TQMA 2HW7A 2QHNA 3GB2A 2WEIA 4PPCA 3UE4A 3HUCA 3BI6A 3C9WA 4OLIA 3OCBA 4IX3A 3C13A 3ZM4A 1ZZ2A 5CEOA 1T46A 4L45A 4PPBA 4BDCA 3DNDA 4ID7A 4QMUA 5J79A 3MSSA 4F1OA 4U9AA 3DTCA 4S2ZA 4N0SA 4D55A 4FSQA 4PMTA 4KUJA 5AP0A 2EXCX 2R7BA 4JDKA 2VWVA 3FMLA 2QLQA 3DBDA 3LIJA 1Q8ZA 4O0XA 4XS2A 3LFNA 4ZLYA 1SZMA 4DT8A 2C4GA 1Q8WA 2JDRA 3OTVA 5J9ZA 2QODA 3GENA 3Q96A 4O0YA 4GS6A 5M4UA 4QQJA 1K3AA 3Q32A 2Y4PA 1EH4A 4PDOA 2JDSA 1M2RA 4KINA 3KQ7A 2XKDA 3LQ8A 2QQ7A 2YERA 1FGIA 2IJMA 4WG5A 3NEWA 4FTLA 2HIWA 4U42A 4AFJA 3LM0A 4M97A 4P2KA 4WNPA 4ZTSA 3FI8A 3LW0A 4BCPA 2RGPA 3KXXA 4C35A 3P08A 2GNJA 4R1VA 3PXFA 4EBWA 4ITHA 4FV4A 2W99B 1UNLA 3QRTA 4YJNA 2IZRA 5HX8A 2OJJA 3TT0A 3ZO1A 5DBXA 1PY5A 3OCGA 3S2PA 2IO6A 3PIXA 4YJOA 4O7LA 1STCE 3PZEA 1ZAOA 3W2PA 4XG6A 4CZYB 4FK6A 4LV8A 4UMUA 3CS9A 3MESA 4OT5A 4O7VA 5EQPA 3WBLA 3MY1A 3GU6A 3DDPA 4AZVA 4E5WA 4L3LA 4APPA 4P5QA 4I92A 4EJNA 2ZM1A 4FKLA 4ANQA 3KMWA 1H1QA 3DKGA 4G9RA 4GVJA 2XKEA 4K11A 4M12A 3F5GA 4RIYB 4D2WA 3HRFA 4O81A 2FH9A 1ZRZA 4JBPA 1UU8A 4IZ7A 4QT1A 2GMXA 1RQQA 2RKUA 5EYDA 2YFXA 2B9HA 3F2RA 3OEFX 4M68A 4ACHA 4HVIA 3HNGA 1O6KA 5AR3A 4GG7A 5EG3A 5GNKA 4AW2A 4R77A 4C7TA 4E20A 4DFBA 1P14A 1YWRA 1YI6A 4X3FB 4BCHA 4EWHA 2W5BA 1OIRA 2UW7A 4D1XA 2JKOA 3R83A 3C5IA 2ZJWA 5CVGA 1V0BA 5CAVA 3AT3A 3VAPA 3E8NA 4O2ZA 4QTDA 4FSWA 3NRMA 3V5QA 5IEVA 5BUJA 4FKPA 2HZNA 3NSZA 1LP4A 1OM1A 3B2TA 4CKRA 1H1WA 4NSTA 4DINA 3DQXA 4EKLA 3RAHA 3CQEA 3MH3A 3R63A 3MIAA 4MNEB 5LMKC 1ZMWA 5L6WL 3W33A 4F70A 3QHRA 2CKQA 1G5SA 2J5FA 2WKMA 4JG7A 4I5HA 5EI6A 2IVVA 3ZUTA 5J1VA 3DAEA 3CJFA 3H9FA 4RVTA 3TNIA 3I6WA 4C61A 4QMZA 4M3QA 1WBPA 5L2TA 1U59A 4W4XA 3GQLA 4FKQA 4BYIA 3K2LA 4YC6A 4TL0A 4O38A 1M7NA 2NNWB 4FIHA 3TIYA 4DTKA 3VS2A 4ZSJA 2QI8A
chains in the Genus database with same CATH superfamily
3WF6A 4AU8A 4IEBA 4ZLZA 3OOMA 3EWHA 3QQUA 2IW9A 3PXYA 2W4JA 1H4LA 1M2QA 4RQKA 3KRLA 2UV2A 2WAJA 2NO3A 4MX9A 3QTZA 1T45A 4DG0E 4XV3A 2BDWA 5HG9A 3OC1A 1P4OA 4IJPA 1PKDA 5ITAA 3QCQA 2QHMA 3FLNC 4EH9A 2ZB1A 3K3JA 3RCDA 3ZFXA 4DEAA 4CGAA 4RIWB 3UO5A 3RAKA 2B9JA 2OIDA 1H24A 4HPUE 5ANEA 3VS4A 2PVMA 4CYIA 2QOBA 4ZTRA 3CPBA 3O2MA 4WNOA 4DEDA 4KKEA 4E4XA 3QD0A 3LFQA 5EYKA 2FSMX 5JFVA 1PXLA 2UW3A 2B1PA 4G3DA 4I23A 5A9UA 4YJPA 5A4QA 2OXDA 4Y73A 5AUZA 2E9UA 4RX5A 2XKCA 4UZHA 3FHIA 4IH8A 3MYGA 4KIOA 5B2KA 5DT0A 1JKKA 4AA4A 3P5JC 2DYLA 4MD8E 1BL6A 3NUPA 2JIVA 4NKAA 4AOJA 1NVRA 4C2VA 4A9UA 4EOIA 4AW1A 2R0IA 4EH4A 3BQRA 5JSMA 4GIHA 2GS6A 4LV7A 1B38A 1VR2A 3OVVA 5HVYA 3RTPA 3W0SA 3OWJA 3D7TB 4D0WA 5EKNA 4II5A 3RM7A 1MP8A 1MRVA 5HD7A 3RPVA 3IW5A 5CXZA 4FE2A 4F9WA 2UZEA 5HO6A 4I0RA 2HW6A 4MHAA 5CLPA 5BUEA 3KMMA 4TYGA 2BILB 4BBMA 4CTBA 2GQRA 3RP9A 3CR0A 3GGFA 4YJQA 5HQ0A 3AGLA 1TQPA 2V7OA 2Y8OA 3F2NA 3G6GA 2X6DA 1R0EA 5IQBA 4NIFB 3V5WA 3UC3A 5K9IA 2VTTA 3DLSA 1LPUA 3BYSA 3F3VA 3BLHA 1YOLA 2CN5A 2VO0A 4QP8A 1Q61A 2XNBA 4TYHB 3C0GA 2JDTA 3EMGA 1AQ1A 2ITUA 2C69A 3GQIA 5TE0A 3I5NA 2UZTA 5EH0A 2H8HA 4UXQA 4ANOA 1KE6A 3FY2A 3R1QA 5AUVA 3W0MA 4U45A 5EHLA 5L2QA 3SHEA 3FL5A 5JGBA 1G8KA 2YZLA 3LMHA 4CMUA 4GYIA 3JPVA 5BVOA 3LXLA 1OIUA 4RT7A 3TNHA 4HZSA 3Q5IA 4FKWA 4XUFA 2W4OA 4BBEA 4O7TA 4K6ZA 3MFTA 5AIKA 4I5MA 5AMNA 3QRJA 3ALOA 5DVRA 3QQGA 5LQFA 3UOJA 3ORIA 3QTUA 5K5XA 1WVXA 4EH5A 4JJRA 4EH6A 2NRYA 1YDTE 2C6EA 3BLQA 3ZBFA 3ZONA 4IIRA 4C4JA 4CQGA 5CNOA 3FL4A 4L43A 4Y5QA 5EW8A 2RF9A 3UG2A 3BE9A 3C0IA 3OT3A 1W82A 3FQHA 3IG7A 3BGPA 3Q9ZA 4WRGA 4KNBA 4F64A 1K9AA 5HTCA 3O8UA 3QD2B 4LDTA 1V0OA 3AC3A 2JDOA 4UYAA 4BY9E 2X0PA 5J9YA 3LQ3A 1YDSE 5DG5A 2YCFA 3OW3A 3D9VA 3SRVB 3SW7A 4L9IA 2UVXA 5E8TA 4S33A 3V6SA 4OUCA 4R1YA 4EQCA 3FHRA 3HVCA 3DZOA 4AS0A 4GEOA 4C33A 2X8EA 4P7EA 2C5YA 4S31A 5ACKA 3MBLA 1KOBA 2R9SA 4FSRA 4A4XA 5KMOA 4NUSA 5BYZA 2GNIA 4G1WA 5CSWA 2VTIA 4Y5HA 4EI4A 3LCOA 4V0GA 4WUNA 4EOJA 3OP5A 1IAHA 2QG5A 5EM7A 4FODA 4DBNA 4D1SA 2O8YA 2VWXA 2BHHA 4X2GA 3E93A 1HCLA 1PXIA 5HE3A 4GH2A 4EHGA 5KCVA 3LFAA 5LMKA 1URCA 1QPDA 1Q41A 3LOKA 3FI2A 3EKKA 5GJFA 4ZZMA 4CNHA 3PLAE 1YRPA 4NEUA 4ASEA 4WNMA 4IVAA 1PMVA 5AUWA 4AA0A 3RK7A 4WG3A 2H34A 3H3CA 3FMJA 4EYJA 1ZMVA 3JY0A 4FI1A 2WMVA 2Z02A 4HOKA 4ZOGA 4FT5A 4C3RA 4EUUA 2HWOA 4EUTA 4FKIA 3TZ8A 1JQHA 2C6LA 3WF7A 3C1XA 5TKDA 4D4RA 2PYWA 3OHTA 1PHKA 3IECA 3EQRA 3A61A 3KB7A 5BUIA 2W7XA 2ITPA 4DGNA 3EL8A 5IA4A 5AM7A 3U8WA 4XG2A 4YHJA 1GZNA 2ITXA 4FV6A 4OBOA 1G8AA 4OBQA 1XH6A 1FVRA 3EQGA 4RQVA 3UZPA 1YHVA 3LQ5A 2F57A 3QKLA 2V7AA 4RLLA 2XMYA 3BPRA 3ZC6A 4ZP5A 2QOLA 3HAMA 1ZYDA 4HGSA 3UZRA 2JITA 3WZJA 4AT5A 5M08A 4NH1A 5KKRC 4BDKA 2PVLA 5A3XA 5IQGA 3RK9A 5AP5A 3NUXA 5IISA 2FB8A 4QPMA 4BB4A 5KMKA 4RRVA 4BCOA 2YISA 3EJ1A 2I0YA 4PDPA 3CTQA 4EHEA 3W2SA 1XH8A 1UV5A 1FGKA 3V5PA 3GVUA 4M66A 4QNAA 2VN9A 3LXNA 4XG7A 4O0UA 3DXPA 5EI8A 1GIHA 1NA7A 3A62A 4RJ6A 2OK1A 4NFNA 3H0YA 2XIXA 4F99A 2ZM3A 5EDQA 1Z57A 3ZEWA 3EFWA 4EK4A 3EL7A 2A2AA 4FV1A 2VTRA 2VWWA 3CY2A 3DK6A 2W1CA 4KIKA 3Q60A 4R5YA 3V3VA 4A4LA 3TI1A 4F9YA 3FAAA 3RAWA 4BL1A 2OJIA 4O7ZA 1ZZLA 1JLUE 1WZYA 4ENYA 4EK6A 3TKUA 3A99A 3ZSIA 4AG8A 3LXKA 3SG8A 4TY1A 4A9YA 4F6UA 1YI4A 5FXQA 5IMEA 4HGEA 4XG4A 3AC4A 3QC4A 4PNIA 2F7XE 4R7HA 4XRJA 1CTPE 3FLWA 5M44A 3NWWA 4LUEA 4JR7A 2YDKA 3AT2A 4RLKA 4Y95A 4O0WA 5I0BA 1GY3A 3BHYA 1S9JA 2QOQA 5GZ9A 4BIEA 4PNKA 5CU2A 5JZJA 5L6OA 4RFMA 3QTSA 5I9UA 3EZVA 4YP8A 2PZRA 5J87A 4BHZA 1YWVA 3GBZA 1R78A 3QXPA 3WE8A 4O7NA 4EL9A 4USEA 4IM2A 3GCQA 3O17A 4D4VA 3GUBA 3KMUA 5IF1A 3C4ZA 2YIQA 4DHJA 4GK2A 1A9UA 4QMLA 5EQEA 3TV6A 5H8GA 3GCUA 3PRFA 4U79A 2YM3A 4YSMA 3EQFA 2PVRA 1PXKA 3QYWA 3FLZA 4BZDA 4BWXA 2WMXA 4JBVA 4RIXB 3SOAA 2JLDA 5F4NA 3COKA 5ANJA 5I3OA 4E73A 3L9PA 1DI8A 3HA6A 2WOUA 4A06A 2G15A 4BKZA 5IQFA 4ZXTA 3F9NA 4R3PA 5AP2A 2PHKA 1UWJA 1M52A 4PY1A 4XCUA 4IAYA 3BL9A 1H0WA 3UYSA 2XZSA 3PPKA 2XNPA 2C5OA 3LLTA 1ZOGA 4IANA 3LKMA 3DKFA 1TKIA 3LJ2A 4XLVA 1DM2A 1REKA 2ITYA 2UW5A 3CKWA 3EQDA 4JT3A 5CSVA 5FTOA 4PWNA 2WZJA 3PPJA 3UC4A 4BI2A 4FKTA 3EN6A 5CWZA 3RNIA 4PV0A 3UBDA 4WG4A 3C51A 3O8PA 4YBJA 4ZJVA 1JNKA 1XMLA 2H96A 3HP2A 1J1BA 2X2LA 5ANIA 3P5KA 4CRSA 1H1PA 5G6VA 4E6AA 2R3QA 5EFQA 3LFFA 2ZV9A 3G9NA 3PA5A 3Q4TA 3BBWA 3QX2A 5HIBA 4FMQA 3MA3A 4G6NA 3LFEA 3ORNA 4CQEA 2CSNA 2R3NA 3RHKA 5GJGA 3LXPA 5AA9A 3R9OA 2ETRA 4ZY4A 3SGCA 5J5SA 1Q3WA 3P4KA 3UNJA 2WQBA 2HAKA 4PTEA 4NW6A 2WOTA 2G01A 4U40A 3UO6A 3FDNA 3A4OX 4OTFA 2EU9A 4FL3A 1CKIA 3E8DA 2J2IB 3IW8A 4P4CA 4XHKB 4XOYA 4Z9LA 4BKYA 5K4IA 5KKRB 4BGGA 4AW0A 2WELA 3FE3A 4QQ5A 5A4LA 5E4HA 4UV0A 4HJOA 2C6TA 4H3PA 3CQWA 1VYWA 1P5EA 2YDJA 3KRJA 3NS9A 4R5SA 3TUCA 2W1ZA 4EOPA 5JRSA 3LFBA 2WU7A 4FNYA 4D5HA 2A1AB 5AP7A 1MUOA 4C0TA 3LFDA 2YIRA 3DK3A 3HMIA 3EQCA 3FZ1A 5BMMA 2JDVA 3MY0A 1DS5A 4DG2E 3PVUA 4KBCA 4GYGA 3U55A 4ZS4A 3QTQA 2O0UA 4G31A 3KCFA 1CKJA 4O4EA 4IB1A 3G9LX 3KA0A 5CT0A 3R8LA 5J9LA 3N4VA 3MDYA 3K54A 3CXWA 3LFSA 4ITJA 4AE9A 4U41A 4I4FA 4IW0A 1J3HA 3WARA 3BKBA 1SVEA 1PYEA 4WD5A 2UZLA 1UU3A 2OF4A 3KRXA 4X2JA 5AUYA 4Q2AA 3FLYA 2J0JA 2PE0A 4BRXA 1BI8A 3UP2A 2OG8A 4RVLA 2OJFE 4TN6A 2GTMA 4K9YA 3QAME 4NW5A 1G8JA 4I41A 4QO9A 3N51A 5H8EA 5EM6A 4PP9A 5IUIA 5HLWA 1H26A 1KWPA 1U54A 1O6LA 3F69A 4QMWA 2JFLA 3NW6A 4KS7A 4PQNA 3WIKA 2CHLA 5FBNC 4FICA 3NAXA 4FUYA 4I6HA 4PDSA 4RA4A 4DEIA 2YCQA 3R04A 4ZTLA 1L3RE 2FSLX 3LM5A 3KXNA 2V0DA 1SNXA 3Q6WA 3QQLA 2WTIA 4QMVA 2R2PA 4F9BA 3NVMB 2BUJA 3NPCA 4IVDA 5CU3A 3DZQA 3U9NA 2ZB0A 4N6YA 3Q53A 4GL9A 5DR6A 1F3MC 3HMPA 3VRZA 3AD6A 2O5KA 4TWCA 4E5BA 3PFYA 3BYVA 2XJ2A 2B4SB 5E8WA 3I7BA 3PP0A 3I4BA 3NIZA 3RPSA 4BVUA 4YHTA 4CFXA 3ORTA 3FLSA 5HX6A 4BJJA 3D4QA 4YNOA 4ERKA 3VS5A 2WB8A 2ACXA 4H39A 3R7IA 2ZMDA 4L3PA 5A6NA 5G1XA 2IVTA 4FV9A 4D28A 5IDPA 3HDMA 2P3GX 2A19B 5IQDA 1SM2A 1BKXA 1B39A 4EOSA 2YAAA 5FEEA 3ZYAA 4FV8A 3BQCA 5F94A 5C4KA 4YLJA 4QDVA 4I5CA 3MGYA 2FSTX 3LAUA 4O7RA 4O4FA 4FKJA 2OJGA 3QCXA 5EKOA 5HI2A 4EK5A 2CN8A 3L1SA 3ZU7A 4AT4A 4QMYA 3T9TA 1W83A 3R7YA 2PMLX 2WGJA 2I0EA 3E5AA 2FO0A 4Y72A 5J1WA 5FTGA 2PMIA 3HYHA 4DH3A 4JX7A 4FTOA 3PUFC 1BI7A 2JKQA 1OL2A 3NIEA 4GV1A 4GKIA 4J1RA 1ATPE 2QONA 3FZSA 5FM2A 4F08A 4B0GA 2C6DA 5TT7A 3O7LD 4CXAA 1OI9A 3TIZA 4Q9ZA 3CPCA 5M09A 3KULA 5HESA 4DA5A 2WNTA 5TOZA 3VUMA 2ZFYA 4C3PA 3T8OA 3VS7A 3WI6A 1OL6A 3ZZWA 3ZLWA 2PTKA 3JY9A 1YXUA 4AN3A 5CS6A 5CASA 4IJ9A 3R1YA 5HG8A 5L8LA 4I4EA 2A98A 3KL8A 4JIAA 1M2PA 2GNLA 1HOWA 1V1KA 1QL6A 3R1NA 3MFSA 4FT3A 2C6KA 5IUGA 1TZDA 5BV3A 3JVSA 4LUDA 5FXSA 3C4FA 4MYGA 3VRYA 3PXRA 1NVSA 5HTBA 2KTYA 5HGIA 3EIDA 5EK7A 3UPXA 3DCVA 3PY1A 4APCA 3S00A 5HE0A 3GU8A 4XH6A 3ORKA 1KV2A 3OTUA 4UYNA 5CANA 5LCJA 3ZXTA 4JAJA 3DBCA 5ANKA 1OBDA 4JOAA 4X3FC 3ZCLA 3QRKA 1Q4LA 2O63A 3LPBA 4FSNA 5F95A 5FDPA 4XV2A 4BCNA 1J7LA 2UZVA 1M7QA 3M42A 3WF8A 4OGRA 2HCKA 1H8FA 3PSBA 5ETFA 5JN2A 3R30A 4FGBA 3OXTA 4XLIA 2ZDUA 4MEDA 4U7ZA 1HCKA 4FBXA 5C8KA 2RG5A 5EOBA 2OBJA 3G90X 4JX3A 3KC3A 5BNJA 2BALA 2YITA 4DEBA 5CAPA 3LVPA 3GOPA 5HICA 3FYKX 4IFCA 2F2CB 1F5QA 3W2OA 3QTWA 2WTKB 2UZNA 4P5ZA 5CZIA 4FK3A 3TYKA 2VD5A 4YU2A 4YGAA 4FV0A 2X2KA 3ZZEA 3CLYA 2C3LA 5EW3A 2BRMA 1ZOEA 2QO2A 1ZARA 2OIQA 3P1AA 4MXAA 4YHFA 3ZMMA 3ERKA 4XG9A 3TNPC 2XYUA 1XO2B 4FKSA 3VS6A 3QU0A 5HNIX 4G34A 4J95A 4DH1A 3GCVA 3U9CA 2VX0A 4F65A 3CSVA 3BLAA 3FEGA 2J90A 4GSBA 5CTPA 2EXEA 3ANRA 5IQHA 1ZLTA 5M57A 3G0FA 4FTIA 2OZOA 3QTRA 3VIDA 4X21A 2IW6A 2X9EA 4M69A 2CCIA 3IOKA 3VHKA 1Z9XA 2X0OA 3ELJA 4ANLA 3FJQE 3VBWA 2IG7A 4I6LA 2WO6A 4DT9A 4GU9A 4ASXA 2ITTA 4QPAA 4YTCA 1G3NA 3GI3A 4XP3A 2Y7JA 4RJ8A 2HXLA 5IA3A 4O4DA 2XB7A 4F0FA 3SG9A 3HV7A 4AXCA 2PE2A 3W2RA 2PMOX 3E92A 5JH6A 4GT3A 4YZMA 2VAGA 2Q0BA 4KA3A 3RAIA 4K8AA 5HNGA 3W2QA 2HZIA 4FGRA 3DJ6A 4AOIA 4CFFA 3MN3A 4MBJA 1J91A 2I40A 4ONAA 2RFEA 4R7IA 5M51A 3TZ9A 4JBOA 3RPYA 5L8KA 2XK8A 2UW9A 2XRUA 3FMKA 4DFUA 1E9HA 1YOJA 4GVAA 3IS5A 4BDJA 4KSPA 4ACCA 1ZYSA 1OPJA 5JMSA 4C3FA 3EB0A 1LEWA 2QOFA 2WQEA 4FEWA 3PG1A 4FOBA 5AR7A 4BDEA 3DLZA 4WT6A 5L3AA 4QTCA 5DPVA 4ZTHA 5H8BA 4D9TA 5AR5A 4O96A 2ERZE 4EZ3A 1WMKA 1YI3A 3KN6A 2BIYA 4BI0A 4QTEA 3H4JA 5EYCA 1OL5A 4ZAUA 1E1VA 1GIJA 4MQ1A 4I1ZA 3ZHPC 4FEUA 3BEAA 5GIOE 4C4FA 1VZOA 4DDIA 3MJ1A 4O22A 1VJYA 3DQWA 3IK3A 3TL8A 5HHWA 3V01A 3AKKA 4J8NA 4IB5A 4J71A 2G2HA 3P0MA 4XBUA 3R28A 2GQSA 3T3VA 4FTAA 3NCGA 2Z7SA 2YACA 4X2NA 4TKSA 4UX9A 4AF3A 1CM8A 3DNEA 3EN5A 5C26A 4UWBA 4QYHA 3GNIB 4G3GA 2XNNA 3ZH8A 4JBQA 1SNUA 3B2WA 1YOMA 5IA1A 4A7CA 3VUDA 4C57A 3RGFA 4CT1A 3EQIA 1BMKA 3FQSA 4H58A 3QZIA 4HZRA 2GS2A 3FMMA 5CF6A 4B9DA 2XVDA 2VTMA 2UW6A 4U3ZA 4QMNA 3AMAA 1XQZA 3IW7A 4BTJA 1WBWA 3AMYA 4HYSA 2Y9QA 3HDNA 1SMHA 1S9IA 1WFCA 1IAJA 2FSOX 5JFWA 4M14A 4IZYA 3F88A 5CZHA 3VJNA 3R7VA 4BCGA 1UNGA 4X2FA 2W05A 3WZEA 2C30A 3QUDA 1ZWSA 4JR3A 3H10A 4FZAB 2XAOA 3W18A 4H3QA 4GMYA 2GHLA 4AAAA 4LOOA 5C8MA 2WXVA 3TZMA 5GZAA 5D10A 1NXKA 5KX8A 5B2LA 3BL7A 5AADA 3QZGA 2XH5A 3LFCA 3DBFA 3Q9WA 4IWPA 4V01A 2QD9A 4ERWA 4ACMA 3OBGA 4FJVA 3LZBA 3UJGA 5BMSA 2X6EA 4HNFA 3ACKA 3R9DA 4AN2A 3FQEA 3QA0A 2YM8A 4RIYA 3CKXA 1OECA 4RWKA 3PJ3A 4KBKA 2R3KA 1BX6A 4RFZA 1FVVA 2E9PA 1WVYA 2JKMA 3DJ5A 2OGVA 3ZEPA 4BKJA 4DGOA 1ZYJA 3SC1A 3OEZA 4XX9A 2C5VA 3CIKA 3MPMA 4NFMA 3AC8A 3KEXA 2GQGA 4I21A 3UP7A 3V8TA 2BPMA 4FZ6A 2J0LA 2AYPA 3GU4A 4IVBA 4E4NA 1DAYA 3NYVA 4EC9A 4UN0C 3M2WA 4Y83A 3DXQA 2JBPA 3EOCA 5CT7A 4PMPA 3FV8A 4X3FA 1Y8GA 5D9HA 5EM5A 3C4XA 3FWQA 5E8YA 2JKKA 2YDIA 3DXNA 2BFYA 3W0PA 2IWIA 4WOVA 3V8WA 3TCPA 3G6HA 4FEQA 4BF2A 4FNZA 5DEYA 3R01A 4BCQA 2ONLC 5DR2A 3R21A 4C8BA 3UNKA 2WQOA 2BCJA 5DWRA 2GS7A 3IOPA 5AA8A 2HY0A 1XBBA 1IR3A 5AV3A 5BVWA 1PRYA 1SYKA 5D12A 5FM3A 3LCSA 5AX9A 5K5NA 2ETKA 4UMQA 1O6YA 1OB3A 3F3UA 2PE1A 4O0VA 3R8VA 1OBGA 2GPHA 3NMUF 4MNEA 4AGDA 2ESMA 4O0TA 3I0QA 2OI4X 2XNOA 3IW4A 5HU9A 2PULA 3TV4A 2BZJA 2BZKB 3ALNA 3D0EA 3L8XA 5LWNA 3D5UA 4WIHA 2B53A 4HCTA 2XAMA 1H27A 4B4LA 3UIXA 4FYOA 3WF9A 4FTJA 3FMHA 2YJRA 2HZ4A 3VF9A 4KB8A 4GRBA 4YNEA 4JDJA 2XIKA 5M07A 4XG8A 4EZ7A 3SD0A 2BDFA 2PVYA 3QQFA 4RX8A 5KMIA 5FD2A 2W0JA 4I6QA 4EC8A 5HO7A 4LFIA 3ZUUA 5DNRA 4YZNA 4A9RA 4CMTA 3RWPA 1YKRA 3R6XA 5HIEA 3E7VA 4MD9E 3CQUA 5M4CA 3VQHA 4WKQA 5I4NA 4YZCA 4F7NA 1P2AA 3A8XA 3A7GA 2Z7QA 3HP5A 4RIWA 5FXRA 3CCNA 4YJVA 3ZS5A 4XRLA 2VTJA 2G9XA 2GNFA 4AWIA 4CMOA 4DGLC 4OTWA 3HV4A 4EHVA 1F0QA 1QCFA 2OZAB 1WAKA 5K0XA 3KFAA 4BWPA 3QD4A 4XMOA 4YO6A 5LVMA 2AC5A 5BVDA 5AP3A 3Q9YA 3RMFA 4CD0A 1JBPE 1PYXA 1PMUA 2DUVA 4QMXA 1IG1A 2FUMA 1YDRE 3CGFA 5IEXA 1UNHA 3G2FA 4NJDA 4F0IA 3ENMA 3RK5A 3R8PA 2BR1A 4M84A 1QPJA 2R3GA 1FPUA 2G1TA 4U43A 5FLFA 2EXMA 5AUUA 5M06A 5AFVA 3ZM9A 3ORMA 2VTPA 3WZKA 3O0GA 3BYMA 4TXCA 5IDNA 4LRMA 2HK5A 2XIZA 4NCTC 2GTNA 4MXCA 4F09A 1DI9A 3GCPA 3Q04A 3R7OA 5CI7A 5IPJA 3BHUA 4H3BA 4LM5A 5E92A 3D7TA 4H36A 4TPTA 2ZV2A 4FEVA 2V55A 4AX8A 3AOXA 4PX6A 3N4TA 5A54A 3DV3A 4W8EA 3HV3A 1GAGA 1OL1A 2B52A 3PJCA 3BHTA 3AD5A 2WMWA 3ZSHA 4GT4A 3UOKA 4AOTA 3WE4A 3LJ1A 3VONA 3IGOA 4NIFA 2E9VA 5IA5A 3R9NA 3ZOSA 3NCZA 2BRBA 5D41A 3EFLA 4G3FA 2XARA 2VX3A 5LXMA 2CNVA 4O6EA 2XNEA 2B55A 4TYHA 2A4LA 4BDIA 4YURA 3V51A 2C6OA 5AAEA 4TNBA 3H9OA 3PIZA 4RMZA 3OMVA 4D4SA 5BYYA 3ENHA 4FUXA 3OOGA 5FUTA 4FSZA 1H0VA 1JSTA 3I7CA 3VS3A 3L9MA 2PUNA 3PG3A 4KABA 1WBTA 3AKLA 4N70A 4OAVB 2JGZA 2X7GA 4LG4A 3LHJA 2R7IA 5EOLA 3F7WA 4MVFA 3OWKA 4ZSEA 2BIKB 3CP9A 2GDOA 4EORA 1J7UA 4FG9A 1Q62A 5AAFA 4D2RA 3F66A 2O64A 4V04A 5LMAA 2PZYA 4B6LA 4QP6A 2UZWE 3A2CA 2R3LA 3KK9A 1BLXA 2PPQA 2OH0E 3LE6A 3D2KA 3EH9A 4FSUA 1OPLA 1U5RA 4LL0A 4BZNA 4HNIA 4HW7A 1ZYLA 5CF5A 4XV9A 3E64A 4PPAA 2QURA 5CEKA 2ITZA 4EH8A 1W98A 2XCKA 2VTOA 3ORZA 2W96B 1JOWB 4FTUA 4ZY6A 4E4MA 5CAQA 2F7EE 2XIRA 4FTRA 2ZAZA 3EZRA 5HKMA 2Z60A 4MAOA 2HWPA 4EYMA 4GKHA 3FZOA 4YJTA 3ZO2A 2W9ZB 1OUKA 4IHPA 1TQIA 4IX5A 4U0IA 2EB3A 3UPZA 4X6RA 3KRWA 2X7OA 5ICPA 4ZTQA 4S34A 4I3ZA 4FV7A 5K3YA 2VTSA 3QQKA 4CLJA 1JPAA 2ONLA 4JRVA 2NPQA 2P33A 3MFUA 3FZTA 4L00A 4TTHB 4XBRA 5EDPA 2UZDA 1CSNA 5DEWA 3PXKA 3IKAA 3K5VA 1Y6AA 2CGWA 4KAOA 2CCHA 2CGVA 4U80A 1Q97A 2C6MA 4C02A 3BE2A 2PL0A 3NYXA 5BYLA 5BVEA 1YXSA 2AQXA 2OSCA 2OXXA 3JUHA 4MCVA 5CEIA 3C50A 4ZTNA 2W4KA 2WFYA 1FQ1B 2X8IA 1WBSA 3G33A 3TDWA 2XP2A 4D2SA 5E8SA 3OW4A 3DA6A 4LOPA 2R3IA 3RZBA 2ZDTA 2Z7RA 3PP1A 2UZBA 2NRUA 3D94A 3L9NA 5DIAA 3OT8A 2BTRA 2GHGA 1GJOA 4DEGA 4JVGA 3KREA 4LGHA 3RNYA 2XJ1A 2CPKE 4O84A 4OTPA 3ID6C 4JDHA 3POZA 5L6PA 4W9WA 4JL9A 3R7UA 4GU6A 4KWPA 4U8ZA 3R2YA 5I9ZA 2UW8A 4E3CA 3PJ1A 2C3JA 4YR8A 5HBHA 5FEDA 3QWJA 3VO3A 4BYJA 1GZ8A 5CF8A 3PVGA 4FSYA 1ZXEA 5CI6A 3IDBA 5DLSA 2YZAA 5DH3A 5GHVA 4PDYA 3GT8A 4AZTA 3IW6A 3TM0A 2YM6A 4E6DA 3P23A 4KSQA 1OVEA 2XCHA 3E8EA 3JXWA 4IAFA 4BIBA 2QO7A 3R7GA 3OWPA 3TJDA 4MBIA 4UMPA 3DBQA 2VNYA 3DB8A 3ML1A 5EW9A 1Q8TA 1JKSA 4J7BA 4YPDA 5KE0A 5C4LA 1O9UA 3AGMA 3QL8A 3RPRA 3KF4A 4FTQA 1ERKA 3OG7A 4UWCA 5I9YA 2CGUA 3TN8A 4CZUA 4UMRA 5IQCA 3KCKA 3TJCA 4MKCA 3F61A 3FMEA 4M0ZA 5JQ5A 4LRJA 5IH4A 1H1SA 3S4QA 3S1HA 3G0EA 4FZ7A 3I1AA 3VUKA 4PTGA 5H2UA 3K3IA 2BROA 2R5TA 3ZTXA 3EN7A 5E8ZA 3EQBA 4AGWA 3VUIA 2YLEA 3NUYA 4FNXA 4E26A 1OIQA 2JAMA 4JNWA 2J0KA 1XBCA 4HCVA 5DI1A 2O3PA 1UWHA 1KE8A 3G5DA 5KBRA 4ZJJA 2ZV7A 3FMNA 4U3YA 4XNEA 4D9UA 4QMSA 4Z55A 3UDTA 1OGUA 3MH2A 3U6JA 2CNQA 2CKPA 2VX1A 3WYYA 2WMRA 2OIBA 2OF2A 2F9GA 5AR4A 3W8QA 3ZDIA 4ZEGA 4BZOA 2ZVAA 2CMWA 1KE9A 3BBTB 5A46A 3M11A 3PXZA 3Q52A 1H07A 3H0ZA 3UG1A 3W0NA 3W1FA 4QP3A 5E90A 4TNDA 4WBOA 2J50A 3EN4A 3KXGA 4ALVA 5HORA 4IE9A 4CFWA 4EOQA 3FZRA 4MXYA 2Q0NA 4RX9A 2R3OA 3HEGA 3BHHA 3MI9A 2F2UA 3MVHA 3VS1A 4RIXA 4MWHA 2YN8A 1JAMA 5LJJA 2ERKA 2PVHA 5JRQA 4O21A 4GIIA 3W55A 2OH4A 4GFOA 1ZY5A 2JBOA 3HECA 5EHYA 4K2RA 3MVJA 5DN3A 2ETMA 3UZTA 3PRIA 2C5NA 1BUHA 1IA8A 3AT4A 3VBYA 1GOLA 4MF0A 3R9HA 3AQVA 3V6RA