2REIA

Kinase domain of human ephrin type-a receptor 7 (epha7)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
296
structure length
277
Chain Sequence
TYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 7
publication title Kinase Domain of Human Ephrin Type-A Receptor 7 (Epha7).
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 277
sequence length 296
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2reiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2reiA01
5HLNA 4YBJA 4ALWA 5FTGA 3EJ1A 3QQJA 4QMTA 2CN8A 4IAKA 2QHNA 4PNIA 4WA9A 5AIKA 5FM3A 5KMKA 4DFYA 2X0GA 5TOZA 3O50A 4ZIMA 5CNNA 3Q52A 5EI6A 3ODYX 3BYVA 3VHEA 3U8WA 4AX8A 5BUIA 1YHWA 2PMLX 2ZV9A 2WMUA 4IMYA 4DGOA 2XYUA 2WMQA 3MJ2A 3CKWA 1BUHA 5E8YA 5LVPA 2XJ0A 2JIIA 4V04A 3L1SA 2C6MA 1MRVA 1KE8A 1R0EA 2VWUA 3AC8A 3KCKA 4WUNA 4CLJA 5AUXA 3D5VA 3MN3A 4BDFA 4IEBA 4FSNA 5AUWA 3QD2B 3I81A 5IQEA 3PA4A 4EH9A 5G1XA 5A4CA 2UUEA 3F5PA 3TXOA 3FZTA 3C0HA 5KMOA 3MPMA 3T3UA 3UC4A 4YJSA 4WSQA 3Q5IA 4ZTHA 4DH3A 5IG1A 4RIWA 5B7VA 3HV6A 2XK6A 4JIKA 4BYJA 4TYEA 5GINE 4BWKA 3OWKA 3TTJA 4USEA 1Q99A 3JR1A 5EOBA 3QTUA 3DGKA 2P0CA 5EW9A 2E9UA 3LXPA 2B9FA 4AGUA 3UNKA 1ZMVA 5F4NA 4R5YA 2XRWA 4BGQA 5L8LA 2QI8A 4JG8A 1G5SA 3H4JA 3JY9A 4U80A 3BE9A 1JSUA 4HNIA 3PXYA 3BV3A 3R2BA 2J7TA 3QZGA 3IS5A 3QKMA 4OTPA 4U7ZA 2CHLA 4IVBA 5C8MA 2YZLA 5AV1A 3ZTXA 1JAMA 5CT7A 5IA4A 1BI7A 3NNWA 4EHVA 3QUPA 2EWAA 3QCXA 3VO3A 2JDOA 2PUIA 2HWOA 3DY7A 4EQMA 3K5VA 5IQAA 3U4WA 3WZEA 4C3PA 4HVIA 5CF4A 2BILB 2CKEA 4FA2A 4QNAA 5GZ8A 2X1NA 4NKSA 5M53A 4MVFA 5CENA 2BZKB 2HZ4A 5K0XA 2UV2A 3FQHA 4UMRA 2A4LA 5HTBA 4KB8A 3S3IA 4AGCA 1JQHA 3BI6A 3P86A 5CEKA 2UW7A 2KTYA 4IWQA 1JKLA 4C4FA 4FNXA 2HENA 2E9NA 4MHAA 3PWDA 1SVEA 5I3OA 4YC6A 4EH3A 5I9VA 3ZM9A 2XEZA 1A48A 4LV5A 5CF5A 1Z9XA 3KK9A 5HNIX 3TJDA 1YDTE 4DG3E 4FSYA 3BIZA 2WO6A 5CAUA 2C6EA 5FTOA 3GU8A 2ONLA 4ACCA 4F0FA 4GW8A 4EH6A 4YC8A 4UWCA 5CXHA 2ETKA 4IVAA 3PFQA 5ACBC 3DCVA 4O7ZA 2IW8A 2VNWA 5FWKK 3VUHA 3KA0A 1F3MC 3W2SA 2EXMA 3AT4A 3OFMA 4F0IA 5FP6A 3GVUA 5KNJA 3MFTA 4WBBB 1BI8A 3K5UA 2PE2A 2VWWA 2WMTA 3F3UA 5HE2A 4C4GA 4BCHA 2F4JA 5AADA 4O83A 4NUSA 4CD0A 3E8EA 1J7LA 3GOKA 3PXZA 3POZA 4RJ4A 3IG7A 3DBQA 3KXZA 4YJVA 4ZTRA 5CASA 2YLEA 1S9IA 3L9PA 4XBUA 3PIYA 4TYIA 2WTCA 4FV5A 1YDRE 1FMKA 5FDXA 4BDEA 3NMUF 4IAFA 2FB8A 4XG3A 3V51A 2BRGA 1GIIA 1QCFA 4WRGA 3RP9A 5FTQA 3WZJA 4HPTE 4IC7A 3HMOA 4Z7HA 5FG8A 5DT4A 3RPSA 5JQ8A 1YOMA 2PZIA 4PRJA 3FLZA 4GYGA 4I92A 4GSBA 3P1AA 3ZO4A 2OJGA 5IUGA 2HIWA 3OZ6A 3UZPA 3W55A 3QLGA 4FKTA 4XV3A 3ZZEA 5DRBA 3KKVA 4FV8A 2PTKA 3N9XA 1H00A 2XNOA 4EORA 5AUUA 3NIEA 1NXKA 4KA3A 4E73A 1J7IA 5AV2A 4FSUA 1NA7A 3SVVA 4BZDA 2HYYA 4IX5A 5CF8A 4KKHA 2GFCA 2V0DA 3BU6A 1TQMA 3QUDA 2R9SA 1B6CB 3ZEWA 4DFBA 5JT2A 4QMYA 3G33A 1E9HA 2VNYA 3ETAA 3ZO2A 4QTDA 1DAYA 1MUOA 2JAMA 4U42A 4EOQA 2UW6A 2G9XA 4AZTA 4RSSA 1F5QA 3DT1A 4FIGA 4N0SA 2H96A 3ATSA 2VTTA 4IX4A 4MBIA 4FKUA 2Y9QA 3CY3A 4FSWA 5AAFA 4DINA 4MEDA 1JKSA 3AQVA 3E8NA 2ZVAA 3SC1A 4DH7A 5KKRC 4EQUA 4BB4A 3SRVA 1NVQA 3D5XA 3OG7A 3KXNA 4L52A 5ETCA 5J7HA 1ZMUA 3FI2A 4ZY6A 3AC3A 4FTOA 3OC1A 2I0VA 3QCSA 4EOMA 4F65A 2GQSA 4UXLA 2W4JA 4QP6A 5LJJA 4IFCA 1CDKA 4M84A 2NPQA 4QYFA 4DE4A 5B0XA 1PXJA 3VN9A 3PJ1A 4BI2A 3EN6A 4NKAA 4WIHA 4YZNA 5L8KA 3AMAA 3QXOA 3TZ9A 2XK4A 4EK6A 5M4CA 1ZXEA 3GT8A 4UMUA 4OAVB 4PWNA 3E63A 3O2MA 4OTGA 3G9LX 4F1OA 3R7IA 3MH1A 2J2IB 3IGOA 3ORZA 4AAAA 1M7QA 2RG6A 5D12A 2SRCA 2VTPA 2XVDA 4JG6A 2WHBA 2I0YA 3PZEA 3LVPA 4RJ7A 5E90A 1OKVA 1R1WA 3VC4A 5CVFA 1BL6A 2C6LA 5DIAA 1O6KA 2J0MB 3ANRA 4G5JA 3ZFMA 1FOTA 5IMXA 3VAPA 3DXPA 3VS3A 2YIQA 4CRSA 4FBXA 3DB6A 4J53A 3QTWA 4FSMA 5H8BA 5J95A 1WMKA 3TIYA 4A9SA 2R3FA 2YWPA 4H39A 1Q62A 1ZYDA 3ANQA 4AS0A 5J9LA 5ANKA 4HZSA 3SX9A 4XG2A 3WARA 5F20A 2O5KA 1O6LA 4ITHA 3UJGA 4KIKA 4II5A 1PRYA 3PTGA 5HD7A 3HV4A 1OGUA 2X6DA 1WVWA 5CWZA 3P5KA 4QP9A 2FSOX 1R3CA 4DITA 1GZNA 3PG1A 4FOBA 4MXYA 1Q8TA 3G0EA 3H10A 5HD4A 1REKA 4GJ3A 3SOAA 3FBVA 2RFSA 2J0KA 4BDHA 2CNUA 5IH6A 3GC0A 1XH7A 3R1SA 2W5HA 5GJDA 3IW6A 2PVHA 3W2QA 3I5ZA 3ZM4A 4AA0A 5HO7A 3SDJA 5IA2A 3FMDA 1ZOGA 4F9AA 4QD6A 1LEZA 3OWLA 2JITA 3GCPA 4I21A 3TV4A 4UN0C 2IO6A 2VAGA 4BCMA 1WBNA 3CPCA 3E5AA 4FX3A 3NUAA 1ATPE 2WEVA 2C6TA 4EC9A 3OCGA 4NK9A 3VJNA 4BRXA 3DPKA 4ZTMA 5ICPA 4M8TA 4X2KA 4LV8A 2W1EA 4CQGA 2A27A 2HZIA 2O64A 2JDSA 2PZYA 3TKHA 4IZYA 1TVOA 5GJFA 4FV0A 3VS0A 4FI1A 1NY3A 3NVKI 5KHXA 1RQQA 2WB8A 4FV3A 2PVFA 2G2IA 3ZZWA 3ZS5A 3ORTA 2WU7A 4M0YA 4JLCA 4O7TA 3R0TA 5AUTA 4L46A 4BTKA 4D2RA 3OW3A 2X8DA 2XCKA 3PSBA 1Q3WA 4IQ6A 3E88A 3D2IA 2V55A 4GT5A 4FGBA 3MH2A 4F7LA 3VVHA 1APME 1KSWA 2ITPA 3CTHA 4DCEA 3Q9YA 4KABA 1YKRA 5B2MA 3HP2A 3IGGA 4H36A 4OW8A 4CKIA 2ZV2A 2UW4A 4AE6A 4XV2A 4A4LA 3R1YA 4NM5A 3IOKA 4L3JA 1OBGA 1SNUA 3B2TA 3QHWA 4TYHB 4EWQA 4E6QA 1KWPA 4CTBA 4OBQA 5HG8A 2VO0A 3TDWA 5J5TA 3CP9A 3NAXA 4FL1A 2PMNX 5IF1A 3BLQA 4CFWA 4QQ5A 3V5TA 2BDJA 4QPMA 2VWXA 2W05A 3BEGA 3Q9ZA 3DQWA 2X7GA 3FLSA 5CALA 3HRCA 4KKGA 4EJNA 5CU0A 3OTVA 1MQ4A 1PXIA 3BHHA 3MTFA 3VUMA 3QYWA 4IAYA 2EXCX 3DZQA 3LE6A 2JDRA 2ZMCA 5A14A 2Y8OA 3GNIB 1PXMA 4IJPA 4KIPA 4R7IA 4U9AA 2X6EA 2OXXA 3QRIA 2GQGA 3VS1A 4TL0A 2QKRA 1Q41A 1WAKA 3KN6A 1UA2A 3E64A 1A06A 2Y0AA 1QPJA 4GIIA 4ERWA 4USFA 3VRZA 2R3NA 2JC6A 1K3AA 2OFUA 3BHTA 5F9EA 4M12A 3HL7A 3RK9A 2W5AA 4YNEA 2CSNA 4PMTA 3E87A 2BCJA 4RC3A 5DNRA 5AR2A 5AIRA 4O6EA 2CJMA 5T3QA 4RIWB 2IZTA 3WF9A 4IANA 4I0RA 3AGMA 5M09A 4G5PA 2P4IA 1G8SA 3LMIA 3G90X 4PUZA 3HV3A 2UZVA 4AXAA 2GS7A 2UVYA 2ZM3A 4CYJA 3VRYA 4C3FA 4EBWA 2OZOA 5FP5A 5FXRA 4DTKA 4RLKA 5DG5A 2DUVA 3Q9WA 4MXZA 2BZHB 5CF6A 3UO5A 3TV7A 2XK7A 4B99A 1LP4A 3QQLA 3R30A 1DI8A 3A99A 4QMQA 2W1HA 4PTGA 2VO7A 1PMNA 4EHZA 3LFFA 1W84A 4MCVA 5AV3A 4D2TA 4HGLA 1ZMWA 4FEWA 5HESA 2VUWA 3GU5A 1WBOA 5LQFA 4PX6A 5EKOA 3WE4A 1R78A 5KZ0A 4WD5A 5CZHA 1PKGA 3C4EA 5DWRA 4DYMA 1URCA 2ZM4A 3JPVA 3CJGA 4U79A 4IZ5A 2YM5A 3QRKA 3UMWA 4ZJVA 2PVLA 3L9NA 3QD3A 1QL6A 2CPKE 3IDCA 3FWQA 1U46A 2PYWA 3NYVA 4YHFA 4EOKA 5BPYA 4GIHA 2YAAA 3HAVA 4MXCA 4I94A 3D4QA 4DGLC 2YM7A 3F5UA 4ZSJA 2BKZA 2C68A 2FA2A 3HDMA 2UZTA 2WIPA 3QYZA 4GV1A 3BHUA 4MBLA 2R3OA 3ZO3A 4ZEGA 4DT8A 4BI1A 3BQRA 2HZ0A 3EMGA 3OF0A 4F08A 2CNVA 3TT0A 2YDIA 3KN5A 4O0XA 2C0IA 4IWOA 5FD2A 4C33A 3DNEA 1LUFA 4EH5A 2B9HA 4ASZA 3DKCA 5AP2A 5JRSA 4KBKA 3NUYA 2W9FB 3NNXA 4ZXTA 2QO2A 3KRRA 3KB7A 3ULIA 3U6IA 3GEQA 4G34A 3AMYA 4FEVA 1Z57A 4ACDA 4IM0A 4F09A 2YAKA 4OTHA 4K8AA 3B8RA 4BF2A 2VTQA 5JGAA 4X0MA 3H3CA 4BCPA 4EOLA 3F82A 2G1TA 1OECA 3TN8A 3HUBA 4A07A 4F6UA 1KE9A 3ZRLA 2C6KA 4O38A 3NZ0A 5LWNA 4MXXA 2OH0E 2GTNA 4GVJA 3TIZA 4BZOA 3D15A 2PWLA 2XJ1A 4HCTA 4LGGA 4QTEA 4BCJA 4F64A 3CY2A 1M17A 3NGAA 3F3WA 5HIDA 3VS6A 1ZAOA 4E1ZA 4EH8A 5M55A 2OJIA 2OI4X 2C3KA 3VW8A 3QD4A 3KGAA 4JR7A 3UVQA 4EK4A 2UW0A 1OI9A 5ETIA 2F9GA 4DGMA 2ITYA 4KUJA 5IQFA 3WILA 2VWIA 2QOBA 3K3JA 4R7HA 5C4LA 4ZY4A 5KMJA 5BYZA 4G3GA 5M06A 3P7BA 4FNYA 1P14A 4V0GA 4EOOA 5KO1A 3MWUA 3KXXA 3H9RA 3FMJA 2WAJA 3L8VA 5FBOA 4BZNA 4DN5A 1YWNA 2QU5A 4C57A 4CMOA 5BVDA 4D28A 3FXWA 1GAGA 3ODZX 3OEZA 4D58A 4C34A 4C8BA 4AZEA 3RK5A 5IPJA 3JVRA 4BN1A 2VN9A 2P2HA 3HA6A 3NWWA 2W4KA 1Q3DA 3FQSA 5HBJA 5BVOA 4E5BA 1OUKA 1YI6A 3A4PA 3U54A 2BZJA 1Q61A 4DC2A 5D7AA 3NYXA 3R22A 4FOCA 3S4QA 3WIGA 4K0YA 3FMLA 3R9OA 3U51A 4AOIA 4D4VA 3O8PA 4MK0A 4W4XA 4XP0A 4EHEA 5FXQA 2RSVA 4Y72A 2YERA 4IHPA 4ZS0A 5AM6A 1H0VA 3R02A 5EI8A 5CEIA 2XJ2A 4ANQA 1U4DA 2W17A 3SAYA 4HW7A 4OAUC 2DQ7X 4FT7A 3Q5ZA 1PXKA 5JGDA 5AP3A 5IQIA 1XR1A 1ZARA 3O51A 4K77A 1BKXA 2QC6A 4LGHA 5KBQA 2YISA 1YWRA 4JDHA 4I5MA 3DKOA 4AT4A 3SRVB 3KRLA 5KMIA 5A4TA 3NLBA 1KV2A 3QFVA 1GZ8A 1ZYCA 4RMZA 3CTJA 4IFGA 4BWPA 2PVJA 4L3PA 3WZKA 2LGCA 3Q4TA 2I6LA 2IN6A 3AD6A 5LVOA 4YBKA 4FICA 2XF0A 4I1ZA 4I3ZA 4EOPA 1YQJA 3OXZA 3TUDA 2PPQA 1XH6A 2VO3A 4QYHA 4Y5QA 4BDAA 1UU8A 1Q97A 2GS6A 2Z7SA 4CMTA 3GCQA 3UOLA 5CZIA 5BMSA 3DDPA 5HE0A 4O91A 2BROA 3B8QA 4CZYB 1KOBA 1H07A 5J8IA 3RM7A 4RA5A 4YJTA 5DA3A 3DBDA 5J5SA 4RX7A 1ZYJA 2QONA 4LOOA 5EYDA 1YXSA 2VZ6A 4LFIA 4YJNA 3IKAA 3N51A 4FTCA 5G6VA 3RAKA 5L4QA 4PL3A 3R9NA 3JVSA 2R2PA 2YITA 3DQXA 3U6HA 4CKRA 1OKZA 5BMMA 3PIXA 4NCTC 4C61A 3POOA 3IECA 4GK2A 3VBXA 1W98A 3W18A 4AZFA 2WMBA 3C0IA 3OT8A 2ETMA 4YU2A 3F61A 5CXZA 4PDYA 2XM8A 4DBNA 1QPDA 2UW8A 2PMIA 2YA9A 3NUNA 4XRLA 2C5OA 2QQ7A 2YIRA 4RT7A 3VUGA 5GIOE 3NUUA 4KD1A 3LQ5A 5ANDA 3HYHA 5FLFA 4AFJA 3UMXA 4C4JA 4F9CA 4KIKB 5BYLA 1YI4A 5EM8A 4BCOA 2F2UA 4YJRA 3K54A 5D41A 4GFMA 2VTJA 2C3JA 2XNMA 4RX9A 5A3XA 3FKLA 1P2AA 3GBZA 4KIOA 4S33A 3IW4A 2F49A 5CI6A 3AXWA 4X2JA 4XOYA 1NVRA 4BCFA 4DLIA 4XJ0A 3C5IA 3DV3A 5IEVA 3HKOA 3ORMA 4IJ9A 3FPQA 5HVYA 3UYTA 4XV9A 1BX6A 3R00A 4Y85A 2G15A 3FL4A 2ETRA 5JRQA 2HK5A 3QF9A 2JD5A 3ENHA 3CQEA 4JDJA 3M42A 4MD9E 5EK7A 3W33A 3S1HA 2A2AA 2GNLA 4HGSA 1YDSE 2JLDA 5HNBA 2O3PA 4JQ8A 2VTSA 2GNHA 4TWNA 4ALUA 2UZNA 4NJ3A 2CNQA 3C5UA 2VTIA 4KWPA 4EEVA 3LM0A 3F66A 4IM2A 2I7QA 2WTVA 4UV0A 3BGZA 3Q60A 5L2WA 3KY2A 1PMVA 3OBJA 2WTIA 3E8CA 4AZWA 2ACXA 2CKOA 3PIZA 3O0GA 1Y6AA 5EM6A 3CD3A 2YDKA 3MH3A 5IZFA 4H05A 2PZPA 3GXLA 4FKJA 4FTKA 4RWJA 4U97A 5FM2A 3VS7A 1YWVA 5I9WA 5L6OA 2XNGA 3OWPA 3HLLA 4WSYA 1IASA 1IA9A 3QCYA 2XIXA 2ITOA 3FAAA 5CAQA 2R7IA 2XIYA 5AMNA 3V6SA 5HX8A 3NEWA 4G1WA 4HYIA 5KMNA 4I93A 5HIBA 5HTIA 2B1PA 4A7CA 2GTMA 1OPJA 3SLSA 3RPYA 3DLZA 3RK7A 1UU3A 4FTQA 4IX6A 3FSKA 3SXSA 3JUHA 1L8TA 4YLKA 4P90A 2PHKA 4CZTA 3H30A 3FUPA 4BTFA 2XIKA 2VGPA 3KXMA 5AUYA 4QYGA 4YP8A 2RFEA 2Y4IB 1UWHA 4G3DA 4BCNA 4O7RA 4KS7A 5HX6A 2CDZA 3COHA 3KVXA 1QPCA 3PRIA 4TWPA 4BBFA 1JOWB 1PW2A 3LIJA 3EN9A 5M4IA 2FO0A 2OH4A 4JL9A 4E7WA 4RLLA 3BU3A 4O0UA 4AN3A 3DTWA 4AZVA 1FBNA 4CRLA 2X81A 3FMNA 4CT1A 3PXFA 5ANIA 4FIEA 3I6UA 4FTUA 3FMEA 5DFPA 5C26A 2VV9A 1URWA 1WVYA 3KCFA 2PVKA 4AW0A 4BTJA 4NM3A 2VWBA 3BHYA 1XBBA 2IZRA 3CKXA 4QQJA 5EDPA 3W10A 4E4XA 1YW2A 5IEXA 5J79A 3DNDA 4QT1A 3AT3A 3ULZA 3UQFA 2UZDA 3JXWA 5E4HA 3BGPA 5AP1A 5HG7A 4CCUA 1PHKA 3KC3A 4KAOA 1YXTA 2B9IA 2A19B 3I5NA 4R3RA 4YO6A 3PY3A 4DFUA 3HEGA 3EL7A 4ASDA 3LOKA 4RWKA 4FKWA 4ZLYA 5HLWA 4AN9A 4KS8A 3DLSA 5M08A 3NUPA 2WMXA 3VS5A 4U40A 5H9BA 1OL7A 1VZOA 3BWFA 3A7FA 3CSVA 4MQ1A 4RX5A 4PMSA 2QOFA 3KMWA 5CEQA 5ETFA 3H9OA 3ORXA 4FG7A 3UODA 4F9YA 3NX8A 3UP7A 3W8LA 4BCKA 1KE5A 2XNPA 4D1XA 2UVZA 5DI1A 2B54A 4UXQA 5CSVA 1RJBA 3BYSA 1P4FA 4K1BA 4O6LA 5ANOA 3T8OA 3WI6A 3KRWA 3OROA 3QL8A 4O82A 2X4ZA 5IQCA 5J9YA 4D1ZA 4AA5A 4DG2E 4JBOA 5DE2A 4JI9A 1H28A 3LFCA 3CJFA 2J9MA 4J97A 3F2NA 2BPMA 3DBEA 2XH5A 3K3IA 3Q2JA 3DJ7A 3EQFA 4JNWA 4AOJA 2FSTX 1VYWA 4FTMA 4BFMA 4ZAUA 4GYIA 3W2RA 3ZMMA 3SXFA 5EHLA 2Z7QA 3OD6X 4JXFA 3C0GA 4M69A 4HVHA 5I9XA 2VWZA 2HXLA 2IVVA 4ZP5A 4GFGA 4MH7A 5JGBA 4G6OA 3ZH8A 2NNWB 1Q5KA 3NNVA 5E8XA 4FE2A 4EKKA 2ZOQA 5LARA 2V62A 4JRNA 2OZAB 1V1KA 2YIXA 4E4NA 3QZHA 3DBCA 4MAOA 2OKRA 5HORA 3LJ1A 4QNYA 3KF7A 3FKNA 4Y73A 2JKMA 4NTTA 3FLNC 4E4LA 4PL4A 3F3TA 5M51A 1KOAA 3ACJA 3VBVA 2PY3A 4F6SA 2BKKA 2OW3A 3ZLWA 5E7RA 3FKOA 5JFXA 5CSHA 5JH6A 2GU8A 4X3FA 2XNBA 4ENXA 1P4OA 3FEGA 2VD5A 4YTIA 4FTNA 2C4GA 1MRUA 4O0VA 5K9IA 4IB0A 1JBPE 5EYCA 2HY81 3E7OA 4QQTA 2X2LA 2P55A 2X7FA 2GDOA 1ZY5A 3HDNA 1W82A 1OM1A 5I0BA 3NYNA 4AE9A 4D55A 2ONLC 4FEQA 4X6RA 3VIDA 4QMNA 4AFEA 3ZFXA 2YZAA 4G3FA 3N4VA 2JDTA 5JEBA 4O81A 4EK3A 3OT3A 5DLSA 5JSMA 4CSVA 5ANJA 3PJ2A 4HYSA 5GZAA 1YHSA 2OJFE 2P3GX 4GVAA 4O7YA 1OKYA 2JGZA 4MNFA 3P08A 5BYYA 3R2YA 2QO9A 2C5NA 2UW3A 2XK3A 3MSSA 2FH9A 3C4CA 3ORPA 4XHKB 4D4SA 5HIEA 4RG0A 4TT7A 2PZ5A 1K9AA 1OMWA 3GFWA 2QNJA 2IWIA 2YIWA 5DBXA 2XK8A 4D4YA 4V0GB 1U5RA 5A46A 4EK8A 3O23A 3IW7A 4FUXA 3QRJA 5M57A 3GC9A 3QZIA 4YHTA 2BIYA 5FEQA 5EDQA 5GNKA 3ZOSA 4PPAA 3UP2A 4EJ7A 5AX9A 3SGCA 3TV6A 4BDKA 1TKIA 3HMIA 4G16A 4D5HA 4AW2A 4ENYA 4ZK5A 4IADA 1JWHA 2UW9A 5LCKA 3U55A 3WYYA 3SA0A 2CKPA 3UPZA 4OTRA 2G2HA 4WT6A 4F9WA 3EQDA 3ZSIA 4LRMA 3PVBA 5FXSA 1OBDA 2XB7A 4F63A 3C4FA 3HP5A 2BIKB 3TDVA 3BYUA 2R3LA 3C13A 3WF8A 3PLAE 3CQWA 2C30A 3MGYA 4LL0A 3P7CA 4CVAA 5IQBA 2XIZA 3FHIA 4DEAA 3EN5A 5C03A 4YZ9A 3BYMA 3TNWA 5BVNA 3HV7A 3NVMB 2Y4PA 4GG5A 4W8DA 5FGKA 2PE1A 4A9RA 3QWJA 4FKQA 4LMUA 4DGGA 1U54A 4FC0A 3DK3A 2JIVA 2QKWB 4JG7A 4EWHA 4NWMA 4YJQA 2CKQA 2EUFB 3R7OA 3QTXA 3BQCA 3EZRA 4YSJA 2VX1A 3CTQA 4ASXA 3EOCA 1ND4A 4HOKA 5AM7A 3ZUUA 2XIRA 2QD9A 3KL8A 4O2PA 3T3VA 2VTNA 4I6QA 5HZNA 3FI3A 4A06A 2YN8A 4NZWB 4YZBA 1HOWA 1KE6A 4Y5HA 4FK3A 4USDA 4ANBA 1YVJA 3QCQA 3RMFA 4QTCA 5LMAA 4I6HA 4IIRA 3UQGA 4JRVA 4FTTA 3PPJA 2BHHA 2XKDA 3JS2A 4HCUA 2PK9A 4MTAA 5HEZA 3FLYA 3EYHA 1RW8A 1OL6A 2OWBA 3GP0A 3HMPA 4W8EA 1ZYSA 5AUZA 3TI1A 1JPAA 3TEIA 3D94A 3MV5A 3DKFA 2NO3A 1OL1A 3ZLYA 3ZDUA 5ANEA 3UQCA 3ZFYA 1Y91A 3BX5A 4OUCA 5CX9A 3BCEA 5LXMA 2YIYA 4L67A 4MWHA 4FKLA 3NAYA 3GI3A 2YCQA 5IMEA 2J51A 1F0QA 4U43A 3UIXA 1WBWA 2WNTA 4W9WA 3BBTB 1E1VA 5AV4A 3ROCA 4CFXA 4LL5A 4MWIA 3MBLA 5HG9A 4EONA 1PF8A 3LJ2A 3DB8A 2OO8X 2ZM1A 4P7EA 3ATTA 4AF3A 1FMOE 4HVGA 4HJOA 3OMVA 3HNGA 4JBPA 1ZOEA 4F70A 4B4LA 4E20A 2IVSA 4FL2A 4Z7GA 3PA5A 5EG3A 3R01A 4HYHA 5DYJA 1B38A 4LG4A 3ZUVA 3ZXZA 5BQ0A 4ZTQA 3R9HA 3KREA 4QYEA 3QZFA 5HGIA 4PQNA 1XBCA 5E8TA 4AQCA 3LQ8A 1SVGA 2JKOA 2UW5A 4EUUA 3DZOA 1H27A 3BLHA 5CSPA 4FTAA 5DR2A 4OLIA 2VWYA 3MIYA 3ZEPA 3I7BA 1OL2A 4J99A 1B39A 3ZDIA 4RIXB 3O17A 4ZMEA 4ZSEA 3FJQE 2C1AA 4DEDA 3OBGA 4FKVA 2AUHA 4JDKA 4L6QA 5EM5A 4JT3A 1NT2A 4PMMA 1JKKA 4M97A 4C0TA 5D11A 4FKPA 2GHLA 4EKLA 3ALNA 3UOHA 1GOLA 4AACA 4O0WA 5IQHA 4B6LA 4AT3A 3SG9A 1XH4A 4U3YA 1JVPP 2OG8A 4AW1A 1LPUA 4JX3A 3EQGA 3ZRKA 4PDSA 3PVUA 4BBEA 4PY1A 2JEDA 1VYZA 1KE7A 4AN2A 4HGEA 4KSQA 5AAGA 4RBLA 1OPLA 1R39A 3P0MA 3OEFX 4FR4A 5FBNC 4C62A 4EH2A 1YI3A 5HG5A 3LCKA 1GNGA 2XCHA 3CGOA 3P4KA 3A2CA 4JAIA 4C37A 1GJOA 3SOCA 5I4NA 3OTUA 5L2TA 3GCSA 2GQRA 1AGWA 1SVHA 1VEBA 3BYOA 3QGYA 4TWCA 5AP5A 4UMTA 5CSXA 5KMLA 2UZLA 3ALOA 5AR3A 3AD5A 4GEOA 4TN6A 2J5FA 4LOPA 4UZDA 5AAEA 2WPAA 3DAJA 3FC2A 1EH4A 3PJCA 2WTWA 5KE0A 3L9LA 4AZSA 5J1WA 3HUCA 4QP4A 3ELJA 3MB7A 3PVWA 3AC2A 3HX4A 5FQDC 4BCQA 1P5EA 4D0WA 4F4PA 4U8ZA 3FHRA 3ZC5A 3FXXA 2O0UA 3DDQA 3QXPA 1BL7A 2XBAA 3HV5A 5HBEA 2XMYA 4GT3A 2Y4IC 2C69A 4CT2A 4FSQA 1ZZLA 4E6DA 5A6NA 2V7OA 3HAMA 4LUEA 2UZBA 3BLRA 2ITXA 4WKQA 4ANNA 4GG7A 3DFAA 4NW5A 3Q4UA 4M0ZA 5K4IA 5AP0A 1WFCA 2V22A 3R7VA 4AP7A 3OHTA 2YFXA 3DS6A 4O7SA 2J0LA 4TY1A 4D2VA 2YM6A 4ITIA 4IBMA 2QOCA 5EHYA 3I4BA 1KV1A 2JKKA 4C4EA 3ZRMA 5IEYA 5LMKA 3R7GA 4JR3A 4IX3A 2AC5A 2FGIA 2WEIA 4X2FA 1IRKA 1ZWSA 5T6KA 4EYMA 1H26A 5H8EA 4TRLA 2ZYBA 3NR9A 5BUJA 4FZFB 4H1MA 4HVDA 1YXVA 2XKFA 5E92A 3TG1A 4QMXA 4CYIA 4IVCA 5E8ZA 2YDJA 2WGJA 2W06A 3R63A 4IDTA 1FINA 3LFQA 3U9CA 2PUPA 3Q4CA 5KUPA 4BDGA 4DT9A 2E2BA 4Q9SA 1W83A 4FV6A 4GCJA 2E9OA 3GENA 3GB2A 3EKKA 4OT5A 5L6WL 2XK9A 2ERKA 5CANA 4D1SA 3C51A 3NCGA 4NJDA 4EBVA 2DYLA 4MF0A 3ZSHA 2PL0A 2W1IA 3KMMA 4CMUA 2VX3A 4CFNA 1IR3A 3UG2A 4FGRA 4C3RA 4MXOA 5HE3A 4KSPA 1UV5A 3FLWA 1UNHA 4O0SA 4UEUA 2RGPA 1H01A 1WBSA 4GJ2A 4XH6A 2WQOA 3QQKA 1IA8A 2QHMA 3E3PA 5TT7A 5JFWA 4ZZMA 3MS9A 2Z60A 2W4OA 4M69B 1GIJA 5HCXA 4N57A 4DEEA 4ARKA 3PVGA 4BKZA 4OTWA 5DN3A 4G3CA 2X9FA 3FY2A 3QC4A 3L9MA 3F6XA 2QG7A 4O86A 3M1SA 4E93A 3R7UA 3QTZA 4RQKA 3UOKA 3LAUA 2OSCA 1OKWA 4FG8A 2OJ9A 3MVMA 4I5PA 4P5QA 1FVVA 5ANGA 3VNTA 3QQFA 3DAKA 3CE3A 4L01A 2VTLA 2PUNA 3FZRA 1BMKA 4WBOA 2JIUA 3F88A 5HBHA 2R3GA 5TO8A 4RIYA 4X3FB 3SXRA 4O7VA 2O8YA 3DFCB 5FUTA 1Z5MA 5HVJA 1LEWA 2W99B 5LMBA 2J4ZA 3MB6A 4F1TA 4XP3A 4ZLZA 2PSQA 3FZPA 2J0JA 4CKJA 5AP4A 1OB3A 4NT4A 4Y95A 4FEXA 5B2KA 1LR4A 3FZSA 2GNGA 3C50A 3PE2A 5A4LA 4O7LA 5HVKA 4ZZOA 2IPXA 3COIA 3RPVA 4RJ6A 4MF1A 1MRYA 5DH3A 3NCZA 2QOKA 4CQEA 4GUEA 4E6CA 4FIFA 1IAHA 4M14A 1PY5A 2IVTA 4JIAA 3QTIA 4WRSA 3VQUA 4FUYA 4PNKA 5E9EA 3MW1A 3UZRA 4DBXA 4OT6A 4UB7A 4X2GA 2QOHA 4XNEA 5CEPA 2XM9A 4I4FA 3ZBFA 4C4HA 1H1PA 4PDPA 4LOQA 4FTRA 3CR0A 3Q04A 2Y6OA 1K2PA 5IH5A 2O2UA 4YO4A 4AOTA 3A7GA 3FQEA 3G0FA 1HCLA 1WCCA 4C7TA 3PYYA 2IW9A 4CGAA 4BDJA 4KKEA 5DGZA 4L42A 5AX3A 3B2WA 3EIDA 3VUKA 4HPUE 4CFUA 4OBOA 5TKDA 1VR2A 3S2PA 5M56A 4J95A 4MQ2A 2C3LA 2QURA 3AOXA 4CNHA 2R3KA 4CCBA 2ERZE 1CMKE 1UNGA 3GOPA 3MFRA 4O1PA 5C8NA 4ANMA 5C8KA 5DT3A 2BRHA 4L00A 5JN2A 2PVMA 4IE9A 3TM0A 2VX0A 3F2RA 3LFSA 4RZWA 3GGFA 3CGFA 4Y46A 1SMHA 4QMLA 3ITZA 3GC8A 2I0HA 4F0GA 4G31A 3BU5A 2GS2A 4L7FA 3RPOA 2BR1A 2R3RA 4F6WA 3TNQB 5A4EA 3MESA 4GKHA 3AMBA 4MKCA 4MYGA 4YPSA 3CS9A 3U9NA 3UNZA 2GHGA 2YJRA 2H8HA 4FT0A 3WZDA 2C0OA 3ORKA 3RAIA 4LUDA 4B8LA 2HWPA 1XHAA 3JY0A 5FEDA 2ITZA 3W2PA 4L44A 5ETAA 5CI7A 2OIDA 1U54B 2YM8A 3PXQA 3P79A 2JDVA 4IDVA 3V8TA 4R77A 3EB0A 1ZYLA 3O71A 4NM7A 2QOLA 4W9XA 4J1RA 5L2QA 2Y7JA 4BBMA 1WBTA 3IPHA 5CY3A 5AA9A 4FVRA 3OXTA 2OLCA 4FYNA 4RFMA 4EI4A 1DI9A 1PMEA 4D0XA 1KUTA 1UU9A 4L3LA 3NRMA 3OVVA 4RJ8A 5HICA 3ENMA 2X8EA 1VJYA 2NRUA 3A4OX 3II5A 1J1BA 1RDQE 1UVRA 1ZZ2A 4K2RA 4OTIA 2J90A 3F5GA 5TE0A 4UWBA 4FIHA 4XOZA 1H0WA 4O0TA 1QMZA 1GZKA 3LQ3A 1UU7A 5H2UA 3Q4ZA 3SHEA 3MPAA 2QLQA 2REIA 3RJCA 5IA0A 5IA1A 1WVXA 3FC1X 2FVDA 2IJMA 5HU3A 4UYAA 2J5EA 3LCSA 3KRJA 4NH1A 1PXOA 5KMMA 1OZ1A 2NRYA 4FSTA 4LQMA 4WHZA 1QPEA 2VO6A 4ZSGA 3N4UA 4RFYA 4RVMA 3VUDA 4ZMFA 3NIZA 4I5CA 4XG6A 2F7XE 3G6GA 1YXUA 2WD1A 3TKUA 2FYSA 2IW6A 1OIYA 4MBJA 1FQ1B 4FSRA 4G9RA 2ITNA 5TF9A 4K33A 3O7LB 3RCJA 4DEBA 4ZLOA 2Y6MA 2C6IA 5CAOA 3PP1A 2XKEA 3JYAA 1DAWA 3EHAA 4LM5A 2R7BA 5D7VA 2W1GA 3NYOA 4YC3A 2EB3A 3IDPA 1U59A 4FTLA 1YOJA 4DGNA 3UZTA 1O6YA 4RPVA 5IUIA 4JVGA 3Q6UA 3Q32A 4YUQA 3SG8A 4ANSA 3UOJA 5H8GA 5KZIA 3CQUA 2HELA 4BHNA 3QRUA 2WTJA 3D5WA 3MY1A 5C27A 2IG7A 2H9VA 3MIAA 1PYEA 2HY0A 3R21A 4QP2A 3PJ8A 2WQMA 1PXPA 4FKRA 3LFDA 5DR9A 3D0EA 5FDPA 2OK1A 2F2CB 4EZ5A 2C5YA 2CGUA 3R1NA 3AGLA 4RJ3A 4R3CA 4E5WA 3A8XA 3F2AA 2QOQA 3AC1A 3FLQA 3PPKA 2OXDA 2GPHA 4WOVA 3PWYA 4XCUA 3RTPA 4ACHA 1CTPE 2CN5A 3Q53A 5CS6A 4U81A 3OOMA 2PVYA 3GC7A 2I40A 2UZUE 3OY1A 4QMSA 2HOGA 4BVUA 3KMUA 3BKBA 4AG8A 4IZ7A 5DMZA 5I9ZA 5L6PA 4IWPA 4RA4A 4YTFA 4FVPA 1ZLTA 3IO7A 4IAIA 5CLPA 4BCIA 4O0YA 3KRXA 4UMQA 2BVAA 4ZTNA 4NW6A 2RFNA 3KFAA 3EN7A 4FKOA 3RCDA 4I4EA 3CC6A 4RX8A 3U4UA 2R4BA 1H4LA 4F7NA 4QO9A 4QPSA 3TZ8A 3KULA 2WOUA 4S32A 3ACKA 1W8CA 2UZEA 4DH5A 4ALVA 5BX0A 3R28A 4RJ5A 3GU7A 4IAZA 1AQ1A 3QHRA 3HRBA 1PJKA 4QP7A 5LOHA 5I9UA 4F99A 2C3IB 4G17A 4Q5HA 4W4YA 5CTPA 4YJUA 2J0IA 2XRUA 4F7JA 3FXZA 3A7JA 2CCIA 3PUPA 4XEYA 4X7QA 1NVSA 3QA8A 2YCSA 2ZB1A 5LVLA 3LXKA 4YNOA 1M2QA 3SW4A 3VW6A 4A4XA 4EH4A 4ZTSA 2QOOA 3RPRA 1YOLA 3OW4A 3PSCA 4FZ6A 5KCVA 4V01A 4D2WA 3HVCA 5D9HA 3A62A 3MI9A 1M2RA 3QA0A 4YLLA 4L68A 5HO6A 4I41A 4MD8E 2OBJA 3T9IA 4CV8A 4WNPA 4ERKA 4HZRA 3W8QA 4M3QA 4BKJA 5I5ZA 4RC2A 3NW5A 2OJJA 1Y8YA 3EQPA 4I6FA 4RVKA 4EZ7A 1AD5A 3G15A 3DA6A 3GU6A 4BCGA 2W1CA 4N4SA 3N4TA 4GKIA 4QYYA 5C4KA 4RWLA 5AFVA 5IQDA 2HW6A 4M7IA 1SZMA 4BDCA 4QRCA 3D7ZA 5K0KA 3TJCA 4JJRA 4IB3A 5DEYA 4E4MA 3V5LA 4EK5A 3WIKA 3ORIA 4XRJA 1W7HA 4UBAA 3FSFA 3PZHA 4JX7A 4R6VA 5HE1A 1WZYA 2WTKB 3MA6A 4RWIA 1Y57A 2Z7LA 3KF4A 1H1SA 4YGAA 4BICA 3EFKA 3EFLA 4NYEA 3LKMA 3W2OA 4APPA 4JBVA 3ZLXA 4X6QC 3DTCA 4QP8A 2DS1A 3MFUA 3AT2A 2E9VA 4AGDA 3LCTA 4I24A 3RM6A 4ZOGA 3VBYA 3EZVA 5J1VA 3IW8A 4UALA 4B0GA 3BE2A 3VS2A 3CLYA 3D2KA 3Q9XA 4KBCA 2IZUA 1MP8A 4NIFA 1M7NA 3ERKA 2Z8CA 3U6JA 3ID6C 4M67A 3LZBA 4S30A 3V5JA 5HO8A 4DEIA 2ITWA 4RZVA 3MFSA 2PMOX 3WF7A 2XA4A 2XKCA 1T46A 3TUCA 3TZMA 4UWYA 5I9YA 4L45A 4RVTA 2JFLA 1XWSA 4JAJA 3CCNA 3IONA 1ZY4A 3QX2A 4E26A 5M4FA 4C36A 4BY9E 3F9NA 3BELA 3R9RA 4J7BA 4FMQA 5AP7A 2BMCA 4L9IA 3E7VA 3EFWA 5EHOA 3C1XA 3HA8A 1O9UA 4PTEA 4XMOA 1FPUA 3P9JA 3AG9A 3VHKA 5IU2A 2CLQA 3BHVA 2IZSA 5CU3A 4AA4A 3P7AA 4JQ7A 3QWKA 4D9TA 4U41A 4FTIA 3EL8A 5CU2A 2YACA 3CBLA 1T45A 2WMAA 2BRMA 4XX9A 2R64A 3P23A 4TNDA 3RHKA 4XYFA 4YTHA 3GFEA 5J9ZA 4RQVA 5C9CA 3R8VA 3PP0A 3KEXA 4LI5A 5BVWA 2W7XA 3HZTA 3R8MA 4AU8A 4FZ7A 4NFMA 3V5QA 1Q8YA 2OFVA 3TTIA 5JK3A 4IW0A 4RIYB 4A9UA 3HMNA 4G6NA 3GUBA 3O8TA 3OUKA 5BNJA 1JSVA 3ORLA 4Y83A 2X8IA 3EQCA 3V04A 4HVSA 4GUBA 4A9YA 3IK3A 2BRBA 5JZNA 5EW3A 2RFDA 4P5ZA 4LYNA 3LCDA 2V7AA 3UE4A 2QLUA 3D7TA 4D2PA 4F9BA 5K5XA 4XG9A 4X3FC 4N6YA 3PXKA 3V6RA 3V01A 3Q2MA 5EQYA 2B52A 3QQHA 2FUMA 4O84A 1H08A 2BTRA 4G2FA 5HHWA 3A7HA 4IAAA 5L2IA 4ZZNA 5HQ0A 5EQEA 3C4XA 3E62A 3O96A 4W4WA 3UO4A 3ZBXA 3AC5A 5JFSA 3QALE 4TTHB 2ITQA 3QKKA 4OTQA 3VBTA 3WBLA 5IUHA 3MVLA 2QODA 2GFSA 3TUBA 3GCUA 3A61A 3R1QA 4JBQA 2HCKA 3ET7A 5IDNA 2ZAZA 2HAKA 5AP6A 1CM8A 4LRKA 1I09A 1L3RE 2VTMA 3GQIA 3LFBA 2BZIB 4CXAA 5AR4A 3UC3A 2XUUA 4OTDA 3QQUA 4WG5A 4PPCA 1H1WA 3PXRA 4TPTA 2R3IA 4AW5A 4H3QA 2X39A 3W32A 1M52A 2RF9A 3MY5A 2PVRA 4L8MA 3RNYA 4DH8A 5EM7A 5EFQA 5HOAA 4UYNA 4IZAA 3QRTA 1ERKA 5H3QA 2ZV7A 3I0QA 3DAEA 3FMMA 3I60A 3ZU7A 2GNIA 4DCAA 4BL1A 2YCRA 5AJQA 3MH0A 4FV9A 4C59A 1XH5A 4JQEA 4I0TA 3RALA 4XV1A 2C47A 3IDBA 5F1ZA 5DEWA 4GT4A 4OGRA 3RGFA 3COKA 4DFXE 3R7EA 2O65A 5D1JA 4YJPA 5M07A 3FI4A 2YEXA 2OIQA 3LLTA 2I0EA 3OCSA 4QOXA 4QTBA 3VF8A 4FKIA 4WG3A 5C01A 4P2KA 5AV0A 3LM5A 4ZJJA 4QMOA 2R3HA 3EN4A 3KQ7A 4M15A 5A54A 4FODA 2BAQA 3IOPA 4J98A 4GMYA 4Z9LA 2W5BA 2Z2WA 4O96A 2OICA 5EDRA 3BPRA 3UG1A 3BBWA 3DJ5A 2X2KA 5JQ5A 4UMPA 2Z7RA 1PYXA 1A9UA 2RL5A 2XNNA 3F3ZA 1OUYA 5BVEA 3ZCLA 2X7OA 1GZOA 2WELA 4TW9A 1SYKA 4ACMA 2W0JA 4JDIA 2W96B 4R7BA 5IA3A 3UIBA 2EVAA 3SV0A 2QVSE 2XBJA 4Q5EA 5E8WA 2F57A 1XQZA 4QMUA 1FGKA 3ORNA 3AD4A 4FZAB 4KRDA 3OCBA 4P4CA 4B9DA 3ZONA 4EHGA 3G5DA 3ZO1A 2B4SB 4R1VA 2QU6A 4O1OA 2ESMA 4L7SA 4EZ3A 3TL8A 4PP7A 4R5SA 3L8XA 5BVKA 2OGVA 5LVMA 4NEUA 1H8FA 4RVLA 2JBOA 3G6HA 2R0UA 4U3ZA 3RNIA 3PRFA 5CU6A 5E1SA 3I7CA 5HCYA 2A1AB 1WBPA 1E1XA 4BIDA 4M66A 2OU7A 4M68A 2NP8A 3ZHPC 5KX8A 4ORKA 4WNKA 3TZ7A 5FEEA 3QTSA 2ZV8A 4IH8A 4C4IA 2BAJA 4QTAA 4X2NA 3LFEA 3PG3A 2GSFA 3QC9A 3R7YA 3R8ZA 4BKYA 4IM3A 2A0CX 4Z16A 2WFYA 4EQCA 1G3NA 2H6DA 3F3VA 4PF4A 2WMRA 4EOSA 2YJSA 4Z55A 5E1EA 2P2IA 2EU9A 3DKGA 5F95A 4YTCA 2ZJWA 4YSMA 4A4OA 2J50A 4TNBA 3VUIA 2W9ZB 2PU8A 3UNJA 3QD0A 1IAJA 2I1MA 3G2FA 4E5AX 4U44A 3EFJA 4CV9A 4PMPA 3CXWA 5CU4A 2BAKA 3EQRA 2BFXA 4QMMA 2WQEA 4WNOA 3LHJA 3WF6A 3PPZA 4QP3A 5JFVA 4RIOA 3OCTA 5B2LA 1OVEA 2HZNA 3UIMA 3RINA 4BDBA 5EKNA 3SQQA 3SW7A 4PPBA 4AUAA 2WQBA 3PA3A 1Q8UA 2VTHA 3E93A 2B53A 1UKHA 3EYGA 3FMKA 4MNEA 2OF2A 3VJOA 2WU6A 1Q8ZA 2BFYA 4IWDA 4Q9ZA 3KK8A 4QP1A 2F7ZE 1FVRA 4J71A 4ZTLA 4ONAA 3FPMA 4WG4A 5EQPA 3G9NA 1H1RA 4O22A 1J3HA 2BALA 4Z3VA 5T68A 4GK3A 5GIPE 1M14A 3IQ7A 5CVHA 3FMHA 4BDDA 4FV4A 4C58A 2EB2A 3DU8A 4BGGA 4AT5A 4NTSA 3G51A 4FKGA 4ZSLA 3DK7A 3DOGA 3NDMA 2CGVA 3I79A 1X8BA 3FY0A 3ZSGA 1FGIA 4R8QA 2RKUA 1Y6BA 5HU9A 3KULB 5IKWA 3AC4A 2X2MA 4D9UA 3LCOA 1OPKA 3HRFA 3LW0A 1R0PA 1ZOHA 2YM4A 5DPVA 5GJGA 4XG8A 4E3CA 1GIHA 4S31A 2PZRA 3MTLA 1YXXA 3R04A 4L53A 2R5TA 4ACGA 5K4JA 1BYGA 4RC4A 3R8UA 3RAWA 3VUTA 3WOWA 4GH2A 4DTBA 3C4WA 1YRPA 1PMUA 1RE8A 3MPTA 1H1QA 2C6OA 3W2CA 3H0ZA 4I20A 4RFZA 3LPBA 4CLIA 2JAVA 3FYKX 3L8SA 4BC6A 4NM0A 2VTOA 4V05A 5CNOA 3BV2A 2DWBA 2HW7A 4IACA 4IB5A 4LRJA 5CAPA 4BIEA 2YM3A 1M2PA 2UZOA 2UZWE 3A60A 2OIBA 2Q83A 2C6DA 4GRBA 3MVHA 3HGKA 4XLVA 1PXLA 1Q8WA 4HYUA 4W4VA 3TNIA 4CZUA 5JZJA 1XBAA 3OUNB 4FV1A 2HXQA 5LCJA 4XLIA 3RVGA 3GU4A 4XP2A 2W1DA 4GS6A 3RBWA 4DFLA 3UDBA 3OY3A 1JKTA 3NNUA 4K6ZA 4RGJA 4ZJIA 2WTDA 3QX4A 4OR5A 4TZRA 2GNJA 2B0QA 4H1JA 1UWJA 4QMVA 4C02A 4ZSAA 4PDOA 5A6OA 4Q2AA 3RHXA 3W1FA 3KXHA 4D2SA 2VTAA 3F7WA 2Q0BA 4TXCA 3PE1A 3VF9A 1WBVA 3VULA 3REPA 4G3EA 4DLJA 4FG9A 4F1MA 1IEPA 2CMWA 4H3PA 1OITA 2WQNA 1SM2A 3CEKA 4FT5A 4CTCA 1Q24A 3PLSA 3K2LA 4FNWA 2C1BA 3PDTA 2XS0A 2CCHA 4PTCA 2AC3A 2RG5A 2WZJA 2AYPA 4N6ZA 2JBPA 5DVRA 3LXNA 1UNLA 4J52A 4CG8A 2WIHA 3PSDA 1CSNA 2WTKC 3RI1A 5LMKC 5CSWA 3NUXA 2WMSA 2B7AA 4C2WA 4FL3A 2YHVA 3LMGA 4O21A 4A9TA 1PKDA 4I5HA 4NIFB 1TQIA 3TWJA 4LGDA 3EKNA 4C35A 5HLPA 2O63A 3DBFA 3O7LD 5L8JA 4F7SA 1DM2A 3NS9A 2J6MA 1I44A 2GMXA 5DRDA 5HI2A 3H9FA 3TCPA 2CLXA 3FE3A 4YZCA 4O2ZA 1CKPA 1FVTA 3FZ1A 3E8DA 3D14A 2IVUA 2R3PA 2W1FA 2XNEA 3KXGA 3R9DA 4K9YA 4QQCA 4U45A 2JFMA 3V5PA 1JSTA 1XJDA 3VWAA 2XYNA 5K3YA 1XKKA 3CD8A 4H3BA 1V0OA 3UPXA 3NSZA 4R78A 4J8NA 2Z02A 1STCE 4S34A 2OZAA 1CKJA 3SD0A 2XZSA 3FDNA 3ZC6A 3H0YA 3C4ZA 2BUJA 3V8WA 1NW1A 5AWMA 4D4RA 4FT3A 4EOJA 3Q6WA 4K18A 5JMSA 2KULA 3BGQA 4I6BA 4BDIA 4ANOA 2W1ZA 3L8PA 4XG4A 3COMA 4K11A 1J1CA 3O8UA 2BDWA 2VRXA 3QTQA 4J96A 5HCZA 5EYKA 3R83A 2C0TA 3VQHA 4BTMA 4N70A 5J7BA 5KHWA 2XP2A 5HKMA 1YHVA 2B9JA 3A7IA 4CFFA 4IVDA 1S9JA 4KNBA 1SNXA 3VS4A 2G01A 4FF8A 3R73A 2X9EA 5BUEA 3PJ3A 4XS2A 3LLAA 3BRBA 2ITUA 3F7ZA 2BRNA 2YLFA 3KU2A 4EH7A 3PY0A 1V0PA 3WYXA 3F5XA 2YWVA 3D7TB 3LFAA 3R8PA 5ITAA 4U6RA 4APCA 2R0IA 5CQUA 1J7UA 1ZRZA 3Q3BA 3LJ0A 5AR5A 4YHJA 2C5VA 2R3MA 4FIIA 4ITJA 5TR6A 4BWXA 4EUTA 5ACKA 3FL5A 3QGWA 1J91A 2ZDTA 4R1YA 3NPCA 4MXAA 3RZFA 3R8LA 4RRVA 5E8UA 3TACA 5EOLA 3S00A 4NU1A 3HECA 4O7NA 4FSZA 5C1QB 5AUVA 1IG1A 4BI0A 4C38A 5IQGA 3GCVA 3D5UA 4EYJA 3RAHA 4MD7E 5A4QA 4QMWA 3QKLA 4LMNA 5CT0A 2H34A 4DHFA 3S0OA 1CKIA 1OIQA 4HNFA 3HMMA 2V5QA 3THBA 3DK6A 4ID7A 3LMHA 2JKQA 3DXQA 2GHMA 5EYMA 4HGTA 2QR7A 2QO7A 2VTRA 2R3QA 4QMPA 4CFMA 1XO2B 3RWPA 2PE0A 2QCSA 4M13A 5CVGA 5EH0A 5KKRB 5CEOA 3E3BX 2WMWA 5M4UA 3E92A 3MYGA 3IW5A 5F94A 1JLUE 4FV7A 3Q96A 1U5QA 4HCVA 1MQBA 4BR3A 5JKGA 1BLXA 3UYSA 2WKMA 4ZY5A 4PL5A 3VBWA 4DFNA 2ITTA 3TNPC 5DR6A 3ZLSA 4IC8A 4EC8A 3MY0A 4U0IA 4O27B 5HNGA 3UVRA 4O7WA 4S2ZA 4YPDA 2ZDUA 1PXNA 3QAME 2B55A 4AGWA 2WXVA 3QTRA 3OP5A 4U5JA 5GHVA 2Q0NA 5KBRA 2ZB0A 3D9VA 2PULA 4GL9A 4O0RA 4KINA 4JOAA 3EH9A 3UVPA 3V3VA 3ROYA 4YR8A 5IDPA 5GZ9A 2GCDA 3MDYA 2OXYA 5I3RA 3LFNA 4I23A 4FEUA 4KBAA 2P33A 3M2WA 1H24A 4KRCA 3WZUA 5IH4A 4YZDA 4NCTA 5D10A 5EI2A 2LAVA 4E8AA 3BEAA 3RWQA 2PVNA 3UBDA 5CEMA 4GFOA 3WF5A 3ZUTA 2F7EE 4DH1A 4UX9A 3PY1A 2FSMX 2XEYA 3F69A 4I0SA 4TKSA 3EWHA 1OL5A 1V0BA 4EL9A 2CGWA 4B7TA 4B8MA 4OTFA 3U87A 5K5NA 1UKIA 4OBPA 1OIRA 5DOSA 4Y8DA 4BGHA 3QBNA 4L43A 2X4FA 3I6WA 3M11A 2VU3A 3P78A 4FZDB 4MX9A 1XH9A 5CQWA 4BYIA 4I22A 4FTJA 4PP9A 3WE8A 4R3PA 4TYGA 4ZS4A 4WNMA 2C5XA 2RIOA 2BHEA 2YABA 5IA5A 5DT0A 5CAVA 4FK6A 3A8WA 3OWJA 4YMJA 3QU0A 5AEPA 3NW7A 1G8AA 4X3JA 3OS3A 2R3JA 4AWIA 3BWJA 5L3AA 3GQLA 3EQBA 5AR8A 4ASEA 3UGCA 4G6LA 3KVWA 2EXEA 5CYIA 3ZXTA 4YJOA 4FKSA 3C7QA 4XBRA 4FYOA 4XG7A 1W0XC 5E8SA 3RKBA 4FVQA 2G2FA 3RZBA 4KIQA 4DTAA 3OXIA 4GK4A 5AA8A 1OIUA 3R6XA 3UO6A 1Y8GA 4QMZA 4DEHA 4DG0E 2E9PA 3FZOA 4UZHA 2WOTA 4FV2A 3QQGA 4YZMA 3CPBA 3NUSA 5M44A 3MA3A 3BZ3A 4FIJA 3DJ6A 4D5KA 4BHZA 1REJA 3NW6A 5E91A 3VBQA 4FNZA 5J87A 2WMVA 4BIBA 4C2VA 5LWMA 5BVFA 2GNFA 4NFNA 5EW8A 4IB1A 3UTOA 4DF3A 1H25A 5A9UA 4G9CA 4DFZE 5AR7A 4H58A 4MNEB 2QR8A 5DHJA 4DEGA 4GU9A 2UVXA 2BTSA 5LVNA 4QPAA 4WUAA 2QOIA 4RIXA 1GY3A 1HCKA 4YLJA 2VWVA 3I1AA 4WO5A 3TKIA 4PV0A 4DAWA 3FYJX 3V5WA 4JS8A 5L2SA 4E6AA 4IXPA 3I0OA 3MVJA 3EQHA 1JNKA 4EOIA 4FT9A 4GU6A 3W16A 2ITVA 2OF4A 3DXNA 4DA5A 3C9WA 1Q4LA 3QLFA 2BDFA 2QG5A 3R71A 3T9TA 4CFVA 3UIUA 3FI8A 4UY9A 3ZYAA 3TNHA 3FV8A 3SKCA 2FSLX 4YURA 2ZMDA 4NL0A 2VGOA 3D83A 5E8VA 1DS5A 3QUEA 3CIKA 4X21A 5FRIA 3OOGA 4NSTA 4TYHA 3V8SA 4TYJA 3MJ1A 2PUUA 2CGXA 3EQIA 1TQPA 4J8MA 5IISA 4CEGA 5HTCA 1XH8A 3S95A 3LXLA 4XUFA 4CG9A 4TWOA 4ANLA 2YCFA
chains in the Genus database with same CATH superfamily
5HLNA 4YBJA 4ALWA 5FTGA 3EJ1A 3QQJA 4QMTA 2CN8A 4IAKA 2QHNA 4PNIA 4WA9A 5AIKA 5FM3A 5KMKA 4DFYA 2X0GA 5TOZA 3O50A 4ZIMA 5CNNA 3Q52A 5EI6A 3ODYX 3BYVA 3VHEA 3U8WA 4AX8A 5BUIA 1YHWA 2PMLX 2ZV9A 2WMUA 4IMYA 4DGOA 2XYUA 2WMQA 3MJ2A 3CKWA 1BUHA 5E8YA 2X0PA 5LVPA 2XJ0A 2JIIA 4V04A 3L1SA 2C6MA 1MRVA 1KE8A 1R0EA 2VWUA 3AC8A 3KCKA 4WUNA 4CLJA 5AUXA 3D5VA 3MN3A 4BDFA 4IEBA 4FSNA 5AUWA 3QD2B 3I81A 5IQEA 3PA4A 4EH9A 5G1XA 5A4CA 2UUEA 3F5PA 3TXOA 3FZTA 3C0HA 5KMOA 3MPMA 3T3UA 3UC4A 4YJSA 4WSQA 3Q5IA 4ZTHA 4DH3A 5IG1A 4RIWA 5B7VA 3HV6A 2XK6A 4JIKA 4BYJA 4TYEA 5GINE 4BWKA 3OWKA 3TTJA 4USEA 1Q99A 3JR1A 5EOBA 3QTUA 3DGKA 2P0CA 5EW9A 2E9UA 3LXPA 2B9FA 4AGUA 3UNKA 1ZMVA 4AXCA 5F4NA 4R5YA 2XRWA 4BGQA 5L8LA 2QI8A 4JG8A 1G5SA 3H4JA 3JY9A 2XAOA 4U80A 3BE9A 1JSUA 4HNIA 3PXYA 3BV3A 3R2BA 2J7TA 3QZGA 3IS5A 3QKMA 4OTPA 4U7ZA 2CHLA 4IVBA 5C8MA 2YZLA 3UDTA 5AV1A 3ZTXA 1JAMA 5CT7A 5IA4A 1BI7A 3NNWA 4EHVA 3QUPA 2EWAA 3QCXA 3VO3A 2JDOA 2PUIA 2HWOA 3DY7A 4EQMA 3K5VA 5IQAA 3U4WA 3WZEA 4C3PA 4HVIA 5CF4A 2BILB 2XALA 2CKEA 4FA2A 4QNAA 5GZ8A 2X1NA 4NKSA 5M53A 4MVFA 5CENA 2BZKB 2HZ4A 5K0XA 2UV2A 3FQHA 4UMRA 2A4LA 5HTBA 4KB8A 3S3IA 4AGCA 1JQHA 3BI6A 3P86A 5CEKA 2UW7A 2KTYA 4IWQA 1JKLA 4C4FA 4FNXA 2HENA 2E9NA 4MHAA 3PWDA 1SVEA 5I3OA 4YC6A 4EH3A 5I9VA 3ZM9A 2XEZA 1A48A 4LV5A 5CF5A 1Z9XA 3KK9A 5HNIX 3TJDA 1YDTE 4DG3E 4FSYA 3BIZA 2WO6A 5CAUA 2C6EA 5FTOA 3GU8A 2ONLA 4ACCA 4F0FA 4GW8A 4EH6A 4YC8A 4UWCA 5CXHA 2ETKA 4IVAA 3PFQA 5ACBC 3DCVA 4O7ZA 2IW8A 2VNWA 5FWKK 3VUHA 3KA0A 1F3MC 3W2SA 2EXMA 3AT4A 3OFMA 4F0IA 5FP6A 3GVUA 5KNJA 3MFTA 4WBBB 1BI8A 3K5UA 2PE2A 2VWWA 2WMTA 3F3UA 5HE2A 4C4GA 4BCHA 2F4JA 5AADA 4O83A 4NUSA 4CD0A 3E8EA 1J7LA 3GOKA 3PXZA 3POZA 4RJ4A 3IG7A 3DBQA 3KXZA 4YJVA 4ZTRA 5CASA 2YLEA 1S9IA 3L9PA 4XBUA 4O4BB 3PIYA 4TYIA 2WTCA 4FV5A 1YDRE 1FMKA 5FDXA 4BDEA 3NMUF 4IAFA 2FB8A 4XG3A 3V51A 2BRGA 1GIIA 1QCFA 4WRGA 3RP9A 5FTQA 3WZJA 4HPTE 4IC7A 3HMOA 4Z7HA 5FG8A 5DT4A 3RPSA 5JQ8A 1YOMA 2PZIA 4PRJA 3FLZA 4GYGA 4I92A 4GSBA 3P1AA 3ZO4A 2OJGA 5IUGA 2HIWA 3OZ6A 3UZPA 3W55A 3QLGA 4FKTA 4XV3A 3ZZEA 5DRBA 3KKVA 4FV8A 2PTKA 3N9XA 1H00A 2XNOA 4EORA 5AUUA 3NIEA 1NXKA 4KA3A 4E73A 1J7IA 2NYAA 5AV2A 4FSUA 1NA7A 3SVVA 4BZDA 2HYYA 4IX5A 5CF8A 4KKHA 2GFCA 2V0DA 3BU6A 1TQMA 3QUDA 2R9SA 1B6CB 3ZEWA 4DFBA 5JT2A 4QMYA 3G33A 1E9HA 2VNYA 3ETAA 3ZO2A 4QTDA 1DAYA 1MUOA 2JAMA 4U42A 4EOQA 2UW6A 2G9XA 4AZTA 4RSSA 1F5QA 3DT1A 4FIGA 4N0SA 2H96A 3ATSA 2VTTA 4IX4A 4MBIA 4FKUA 2Y9QA 3CY3A 4FSWA 5AAFA 4DINA 4MEDA 1JKSA 3AQVA 3E8NA 2ZVAA 3SC1A 4DH7A 5KKRC 4EQUA 4BB4A 1TFFA 3SRVA 1NVQA 3D5XA 3OG7A 3KXNA 4L52A 5ETCA 5J7HA 1ZMUA 3FI2A 4ZY6A 3AC3A 4FTOA 3OC1A 2I0VA 3QCSA 4EOMA 4F65A 2GQSA 4UXLA 2W4JA 4QP6A 5LJJA 4IFCA 1CDKA 4M84A 2NPQA 4QYFA 4DE4A 5B0XA 1PXJA 3VN9A 3PJ1A 4BI2A 3EN6A 4NKAA 4WIHA 4YZNA 5L8KA 3AMAA 3QXOA 3TZ9A 2XK4A 4EK6A 5M4CA 1ZXEA 3GT8A 4UMUA 4OAVB 4PWNA 3E63A 3O2MA 4OTGA 3G9LX 4F1OA 3R7IA 3MH1A 2J2IB 3IGOA 3ORZA 4AAAA 1M7QA 2RG6A 5D12A 2SRCA 2VTPA 2XVDA 4JG6A 2WHBA 2I0YA 3PZEA 3LVPA 4RJ7A 5E90A 1OKVA 1R1WA 3VC4A 5CVFA 1BL6A 2C6LA 5DIAA 1O6KA 2J0MB 3ANRA 4G5JA 3ZFMA 1FOTA 5IMXA 3VAPA 3DXPA 3VS3A 2YIQA 4CRSA 4FBXA 3DB6A 4J53A 3QTWA 4FSMA 5H8BA 5J95A 1WMKA 3TIYA 4A9SA 2R3FA 2YWPA 4H39A 1Q62A 1ZYDA 3ANQA 4AS0A 5J9LA 5ANKA 4HZSA 3SX9A 4XG2A 3WARA 5F20A 2O5KA 1O6LA 4ITHA 3UJGA 4KIKA 4II5A 1PRYA 3PTGA 5HD7A 3HV4A 1OGUA 2X6DA 1WVWA 5CWZA 3P5KA 4QP9A 2FSOX 1R3CA 4DITA 1GZNA 3PG1A 4FOBA 4MXYA 1Q8TA 3G0EA 3H10A 5HD4A 1REKA 4GJ3A 3SOAA 3FBVA 2RFSA 2J0KA 4BDHA 2CNUA 5IH6A 3GC0A 1XH7A 3R1SA 2W5HA 5GJDA 3IW6A 2PVHA 3W2QA 3I5ZA 3ZM4A 4AA0A 5HO7A 3SDJA 5IA2A 3FMDA 1ZOGA 4F9AA 4QD6A 1LEZA 3OWLA 2JITA 3GCPA 4I21A 3TV4A 4UN0C 2IO6A 2VAGA 4BCMA 1WBNA 3CPCA 3E5AA 4FX3A 3NUAA 1ATPE 2WEVA 2C6TA 4EC9A 3OCGA 4NK9A 3VJNA 4BRXA 3DPKA 2X0QA 4ZTMA 5ICPA 4M8TA 4X2KA 4LV8A 2W1EA 4CQGA 2A27A 2HZIA 2O64A 2JDSA 2PZYA 3TKHA 4IZYA 1TVOA 5GJFA 4FV0A 3VS0A 4FI1A 1NY3A 3NVKI 5KHXA 1RQQA 2WB8A 4FV3A 2PVFA 2G2IA 3ZZWA 3ZS5A 3ORTA 2WU7A 4M0YA 4JLCA 4O7TA 3R0TA 5AUTA 4L46A 4BTKA 4D2RA 3OW3A 2X8DA 2XCKA 3PSBA 1Q3WA 4IQ6A 3E88A 3D2IA 2V55A 4GT5A 4FGBA 2XAMA 3MH2A 4F7LA 3VVHA 1APME 1KSWA 2ITPA 3CTHA 4DCEA 3Q9YA 4KABA 1YKRA 5B2MA 3HP2A 3IGGA 4H36A 4OW8A 4CKIA 2ZV2A 2UW4A 4AE6A 4XV2A 4A4LA 3R1YA 4NM5A 3IOKA 4L3JA 1OBGA 1SNUA 3B2TA 3QHWA 4TYHB 4EWQA 3VONA 4E6QA 1KWPA 4CTBA 4OBQA 5HG8A 2VO0A 3TDWA 5J5TA 3CP9A 3NAXA 4FL1A 2PMNX 5IF1A 3BLQA 4CFWA 4QQ5A 3V5TA 2BDJA 4QPMA 2VWXA 2W05A 3BEGA 3Q9ZA 3DQWA 2X7GA 3FLSA 5CALA 3HRCA 4KKGA 4EJNA 5CU0A 3OTVA 1MQ4A 1PXIA 3BHHA 3MTFA 3VUMA 3QYWA 4IAYA 2EXCX 3DZQA 3LE6A 2JDRA 2ZMCA 5A14A 2Y8OA 3GNIB 1PXMA 4IJPA 4KIPA 4R7IA 4U9AA 2X6EA 2OXXA 3QRIA 2GQGA 3VS1A 4TL0A 2QKRA 1Q41A 1WAKA 3KN6A 1UA2A 3E64A 1A06A 2Y0AA 1QPJA 4GIIA 4ERWA 4USFA 3VRZA 2R3NA 2JC6A 1K3AA 2OFUA 3BHTA 5F9EA 4M12A 3HL7A 3RK9A 2W5AA 4YNEA 2CSNA 4PMTA 3E87A 2BCJA 4RC3A 5DNRA 5AR2A 5AIRA 4O6EA 2CJMA 5T3QA 4RIWB 2IZTA 3WF9A 4IANA 3KIOC 4I0RA 3AGMA 5M09A 4G5PA 2P4IA 1G8SA 3LMIA 3G90X 4PUZA 3HV3A 2UZVA 4AXAA 2GS7A 2UVYA 2ZM3A 4CYJA 3VRYA 4C3FA 4EBWA 2OZOA 5FP5A 5FXRA 4DTKA 4RLKA 5DG5A 1XMMA 2DUVA 3Q9WA 4MXZA 2BZHB 5CF6A 3UO5A 3TV7A 2XK7A 4B99A 1LP4A 3QQLA 3R30A 1DI8A 3A99A 4QMQA 2W1HA 4PTGA 2VO7A 1PMNA 4EHZA 3LFFA 1W84A 4MCVA 5AV3A 4D2TA 4HGLA 1ZMWA 4FEWA 5HESA 2VUWA 3GU5A 1WBOA 5LQFA 4PX6A 5EKOA 3WE4A 1R78A 5KZ0A 4WD5A 5CZHA 1PKGA 3C4EA 5DWRA 4DYMA 1URCA 2ZM4A 3JPVA 2XANA 3CJGA 4U79A 4IZ5A 2YM5A 3QRKA 3UMWA 4ZJVA 2PVLA 3L9NA 3QD3A 1QL6A 2CPKE 3IDCA 3W0MA 3FWQA 1U46A 2PYWA 3NYVA 4YHFA 4EOKA 5BPYA 4GIHA 2YAAA 3HAVA 4MXCA 4I94A 3D4QA 4DGLC 2YM7A 3F5UA 4ZSJA 2BKZA 2C68A 2FA2A 3HDMA 2UZTA 2WIPA 3QYZA 4GV1A 3BHUA 4MBLA 2R3OA 3ZO3A 4ZEGA 4DT8A 4BI1A 3BQRA 2HZ0A 3EMGA 3OF0A 4F08A 2CNVA 3TT0A 2YDIA 3KN5A 4O0XA 2C0IA 4IWOA 5FD2A 4C33A 3DNEA 1LUFA 4EH5A 2B9HA 4ASZA 3DKCA 5AP2A 5JRSA 4KBKA 3NUYA 2W9FB 3NNXA 4ZXTA 2QO2A 3KRRA 3KB7A 3ULIA 3U6IA 3GEQA 4G34A 3AMYA 4FEVA 1Z57A 4ACDA 4IM0A 4F09A 2YAKA 4OTHA 4K8AA 3B8RA 4BF2A 2VTQA 5JGAA 4X0MA 3H3CA 4BCPA 4EOLA 3F82A 2G1TA 1OECA 3TN8A 3HUBA 4A07A 4F6UA 1KE9A 3ZRLA 2C6KA 4O38A 3NZ0A 5LWNA 4MXXA 2OH0E 2GTNA 4GVJA 3TIZA 4BZOA 3D15A 2PWLA 2XJ1A 4HCTA 4LGGA 4QTEA 4BCJA 4F64A 3CY2A 1M17A 3NGAA 3F3WA 5HIDA 3VS6A 1ZAOA 4E1ZA 4EH8A 5M55A 2OJIA 2OI4X 2C3KA 3VW8A 3QD4A 3KGAA 4JR7A 3UVQA 4EK4A 2UW0A 1OI9A 5ETIA 2F9GA 4DGMA 2ITYA 4KUJA 5IQFA 3WILA 2VWIA 2QOBA 3K3JA 4R7HA 5C4LA 4ZY4A 5KMJA 5BYZA 4G3GA 5M06A 3P7BA 4FNYA 1P14A 4V0GA 4EOOA 5KO1A 3MWUA 3KXXA 3H9RA 3FMJA 2WAJA 3L8VA 5FBOA 4BZNA 4DN5A 1YWNA 2QU5A 4C57A 4CMOA 5BVDA 4D28A 3FXWA 1GAGA 3ODZX 3OEZA 4D58A 4C34A 4C8BA 2IF8A 4AZEA 3RK5A 5IPJA 3JVRA 3W0PA 4BN1A 2VN9A 2P2HA 3HA6A 3NWWA 2W4KA 1Q3DA 3FQSA 5HBJA 5BVOA 4E5BA 1OUKA 1YI6A 3A4PA 3U54A 2BZJA 1Q61A 4DC2A 5D7AA 3NYXA 3R22A 4FOCA 3S4QA 3WIGA 4K0YA 3FMLA 3R9OA 3U51A 4AOIA 4D4VA 3O8PA 4MK0A 4W4XA 4XP0A 4EHEA 5FXQA 2RSVA 4Y72A 2YERA 4IHPA 4ZS0A 5AM6A 1H0VA 3R02A 5EI8A 5CEIA 2XJ2A 4ANQA 1U4DA 2W17A 3SAYA 4HW7A 4OAUC 2DQ7X 4FT7A 3Q5ZA 1PXKA 5JGDA 3BLAA 5AP3A 5IQIA 1XR1A 1ZARA 3O51A 4K77A 1BKXA 2QC6A 4LGHA 5KBQA 2YISA 1YWRA 4JDHA 4I5MA 3DKOA 4AT4A 3SRVB 3KRLA 5KMIA 5A4TA 3NLBA 1KV2A 3QFVA 1GZ8A 1ZYCA 4RMZA 4QDVA 3CTJA 4IFGA 4BWPA 2PVJA 4L3PA 3WZKA 2LGCA 3Q4TA 2I6LA 2IN6A 3AD6A 5LVOA 4YBKA 4FICA 2XF0A 4I1ZA 4I3ZA 4EOPA 1YQJA 3OXZA 3TUDA 2PPQA 1XH6A 2VO3A 4QYHA 4Y5QA 4BDAA 1UU8A 1Q97A 2GS6A 2Z7SA 4CMTA 3GCQA 3UOLA 5CZIA 5BMSA 3DDPA 5HE0A 4O91A 2BROA 3B8QA 4CZYB 1KOBA 1H07A 5J8IA 3NFGB 3RM7A 4RA5A 4YJTA 5DA3A 3DBDA 5J5SA 4RX7A 1ZYJA 2QONA 4LOOA 5EYDA 1YXSA 2VZ6A 4LFIA 4YJNA 3IKAA 3N51A 4FTCA 5G6VA 3RAKA 5L4QA 4PL3A 3R9NA 3JVSA 2R2PA 2YITA 3DQXA 3U6HA 4CKRA 1OKZA 5BMMA 3PIXA 4NCTC 4C61A 3POOA 3IECA 4GK2A 3VBXA 1W98A 3W18A 4AZFA 2WMBA 3C0IA 3OT8A 2ETMA 4YU2A 3F61A 5CXZA 4PDYA 2XM8A 4DBNA 1QPDA 2UW8A 2PMIA 2YA9A 3NUNA 4XRLA 2C5OA 2QQ7A 2YIRA 4RT7A 3VUGA 5GIOE 3NUUA 4KD1A 3LQ5A 5ANDA 3HYHA 5FLFA 4AFJA 3UMXA 4C4JA 4F9CA 4KIKB 3O5AA 5BYLA 1YI4A 5EM8A 4BCOA 2F2UA 4YJRA 3K54A 5D41A 4GFMA 2VTJA 2C3JA 2XNMA 4RX9A 5A3XA 3FKLA 1P2AA 3GBZA 4KIOA 4S33A 3IW4A 2F49A 5CI6A 3AXWA 4X2JA 4XOYA 1NVRA 4BCFA 4DLIA 4XJ0A 3C5IA 3DV3A 5IEVA 3HKOA 3ORMA 4IJ9A 3FPQA 5HVYA 3UYTA 4XV9A 1BX6A 3R00A 4Y85A 2G15A 3FL4A 3AKKA 2ETRA 5JRQA 2HK5A 3QF9A 2JD5A 3ENHA 3CQEA 4JDJA 3M42A 4MD9E 5EK7A 3W33A 3S1HA 3NFFB 2A2AA 2GNLA 4HGSA 1YDSE 2JLDA 5HNBA 2O3PA 4JQ8A 2VTSA 2GNHA 4TWNA 4ALUA 2UZNA 4NJ3A 2CNQA 3C5UA 2VTIA 4KWPA 4EEVA 3LM0A 3F66A 4IM2A 2I7QA 2WTVA 4UV0A 3BGZA 3Q60A 5L2WA 3KY2A 3BL9A 3TMOA 1PMVA 3OBJA 2WTIA 3E8CA 4AZWA 2ACXA 2CKOA 3PIZA 3O0GA 1Y6AA 5EM6A 3CD3A 2YDKA 3MH3A 5IZFA 4H05A 2PZPA 3GXLA 4FKJA 4FTKA 4RWJA 4U97A 5FM2A 3VS7A 1YWVA 5I9WA 5L6OA 2XNGA 3OWPA 3HLLA 3W0SA 4WSYA 1IASA 1IA9A 3QCYA 2XIXA 2ITOA 3FAAA 5CAQA 2R7IA 2XIYA 5AMNA 3V6SA 5HX8A 3NEWA 4G1WA 4HYIA 5KMNA 4I93A 5HIBA 5HTIA 2B1PA 4A7CA 2GTMA 1OPJA 3SLSA 3RPYA 3DLZA 3RK7A 1UU3A 4FTQA 4IX6A 3FSKA 3SXSA 3JUHA 1L8TA 4YLKA 4P90A 2PHKA 4CZTA 3H30A 3FUPA 4BTFA 2XIKA 2VGPA 3KXMA 5AUYA 4QYGA 4YP8A 2RFEA 2Y4IB 1UWHA 4G3DA 4BCNA 4O7RA 4KS7A 5HX6A 2CDZA 3COHA 3KVXA 1QPCA 3PRIA 4TWPA 4BBFA 1JOWB 1PW2A 3LIJA 3EN9A 5M4IA 2FO0A 2OH4A 4JL9A 4E7WA 4RLLA 3BU3A 4O0UA 3BL7A 4AN3A 3DTWA 4AZVA 1FBNA 4CRLA 2X81A 3FMNA 4CT1A 3PXFA 5ANIA 4FIEA 3I6UA 4FTUA 3FMEA 5DFPA 5C26A 2VV9A 1URWA 1WVYA 3KCFA 2PVKA 4AW0A 4BTJA 4NM3A 2VWBA 3BHYA 1XBBA 2IZRA 3CKXA 4QQJA 5EDPA 3W10A 4E4XA 1YW2A 5IEXA 5J79A 3DNDA 4QT1A 3AKJA 3AT3A 3ULZA 3UQFA 2UZDA 3JXWA 5E4HA 3BGPA 5AP1A 5HG7A 4CCUA 1PHKA 3KC3A 4KAOA 1YXTA 2B9IA 2A19B 3I5NA 4R3RA 4YO6A 3PY3A 4DFUA 3HEGA 3EL7A 4ASDA 3LOKA 4RWKA 4FKWA 4ZLYA 5HLWA 4AN9A 4KS8A 3DLSA 5M08A 3NUPA 2WMXA 3VS5A 4U40A 5H9BA 1OL7A 1VZOA 3BWFA 3A7FA 3CSVA 4MQ1A 4RX5A 4PMSA 2QOFA 3KMWA 5CEQA 5ETFA 3H9OA 3ORXA 4FG7A 3UODA 4F9YA 3NX8A 3UP7A 3W8LA 4BCKA 2AEGA 1KE5A 2XNPA 4D1XA 2UVZA 5DI1A 2B54A 4UXQA 5CSVA 1RJBA 3BYSA 1P4FA 4K1BA 4O6LA 5ANOA 3T8OA 3WI6A 3KRWA 3OROA 3QL8A 4O82A 2X4ZA 5IQCA 5J9YA 4D1ZA 4AA5A 4DG2E 4JBOA 5DE2A 4JI9A 1H28A 3LFCA 3CJFA 2J9MA 4J97A 3F2NA 2BPMA 3DBEA 2XH5A 3K3IA 3Q2JA 3DJ7A 3EQFA 4JNWA 4AOJA 2FSTX 1VYWA 4FTMA 4BFMA 4ZAUA 4GYIA 3W2RA 3ZMMA 3SXFA 5EHLA 2Z7QA 3OD6X 4JXFA 3C0GA 4M69A 4HVHA 5I9XA 2VWZA 2HXLA 2IVVA 4ZP5A 4GFGA 4MH7A 5JGBA 4G6OA 3ZH8A 2NNWB 1Q5KA 3NNVA 5E8XA 4FE2A 4EKKA 2ZOQA 5LARA 2V62A 4JRNA 2OZAB 1V1KA 2YIXA 4E4NA 3QZHA 3DBCA 4MAOA 2OKRA 5HORA 3LJ1A 4QNYA 3KF7A 3FKNA 4Y73A 2JKMA 4NTTA 3FLNC 4E4LA 4PL4A 3F3TA 5M51A 1KOAA 3ACJA 3VBVA 2PY3A 4F6SA 2BKKA 2OW3A 3ZLWA 5E7RA 3FKOA 5JFXA 5CSHA 5JH6A 2GU8A 4X3FA 2XNBA 4ENXA 1P4OA 3FEGA 2VD5A 4YTIA 4FTNA 2C4GA 1MRUA 4O0VA 5K9IA 4IB0A 1JBPE 5EYCA 2HY81 3E7OA 4QQTA 2X2LA 2P55A 2X7FA 2GDOA 1ZY5A 3HDNA 1W82A 1OM1A 5I0BA 3NYNA 3UDSA 4AE9A 4D55A 2ONLC 4FEQA 4X6RA 3VIDA 4QMNA 4AFEA 3ZFXA 2YZAA 4G3FA 3N4VA 2JDTA 5JEBA 4O81A 4EK3A 3OT3A 5DLSA 5JSMA 4CSVA 5ANJA 3PJ2A 4HYSA 5GZAA 1YHSA 2OJFE 2P3GX 4GVAA 4O7YA 1OKYA 2JGZA 4MNFA 3P08A 5BYYA 3R2YA 2QO9A 3W0NA 2C5NA 2UW3A 2XK3A 3MSSA 2FH9A 3C4CA 3ORPA 4XHKB 4D4SA 5HIEA 4RG0A 4TT7A 2PZ5A 1K9AA 1OMWA 3GFWA 2QNJA 2IWIA 2YIWA 5DBXA 2XK8A 4D4YA 4V0GB 1U5RA 5A46A 4EK8A 3O23A 3IW7A 4FUXA 3QRJA 5M57A 3GC9A 3QZIA 4YHTA 2BIYA 5FEQA 5EDQA 5GNKA 3ZOSA 4PPAA 3UP2A 4EJ7A 5AX9A 3SGCA 3TV6A 4BDKA 1TKIA 3HMIA 4G16A 4D5HA 4AW2A 4ENYA 4ZK5A 4IADA 1JWHA 2UW9A 5LCKA 3U55A 3WYYA 3SA0A 2CKPA 3UPZA 4OTRA 2G2HA 4WT6A 4F9WA 3EQDA 3ZSIA 4LRMA 1TZDA 3PVBA 5FXSA 1OBDA 2XB7A 4F63A 3C4FA 3HP5A 2BIKB 3TDVA 3BYUA 2R3LA 3C13A 3WF8A 3PLAE 3CQWA 2C30A 3MGYA 4LL0A 3P7CA 4CVAA 4JMQA 5IQBA 2XIZA 3FHIA 4DEAA 3EN5A 5C03A 4YZ9A 3BYMA 3TNWA 5BVNA 3HV7A 3NVMB 2Y4PA 4GG5A 4W8DA 5FGKA 2PE1A 4A9RA 3QWJA 4FKQA 4LMUA 4DGGA 1U54A 4FC0A 3DK3A 2JIVA 2QKWB 4JG7A 4EWHA 4NWMA 4YJQA 2CKQA 2EUFB 4O4CA 3R7OA 3QTXA 3BQCA 3EZRA 4YSJA 2VX1A 3CTQA 4ASXA 3EOCA 1ND4A 4HOKA 5AM7A 3ZUUA 2XIRA 2QD9A 3KL8A 4O2PA 3T3VA 2VTNA 4I6QA 5HZNA 3FI3A 4A06A 2YN8A 4NZWB 4YZBA 1HOWA 1KE6A 4Y5HA 4FK3A 4USDA 4ANBA 1YVJA 3QCQA 3RMFA 4QTCA 5LMAA 4I6HA 4IIRA 3UQGA 4JRVA 4FTTA 3PPJA 2BHHA 2XKDA 3JS2A 4HCUA 2PK9A 4MTAA 5HEZA 3FLYA 3EYHA 1RW8A 1OL6A 2OWBA 3GP0A 3HMPA 4W8EA 1ZYSA 5AUZA 3TI1A 1JPAA 3TEIA 3D94A 3MV5A 3DKFA 2NO3A 1OL1A 3ZLYA 3ZDUA 5ANEA 3UQCA 3ZFYA 4QDEA 1Y91A 3BX5A 4OUCA 1W2FA 5CX9A 3BCEA 5LXMA 2YIYA 4L67A 4MWHA 4FKLA 3NAYA 3GI3A 2YCQA 5IMEA 2J51A 1F0QA 4U43A 3UIXA 4QEBA 1W2CA 1WBWA 2WNTA 4W9WA 3BBTB 1E1VA 5AV4A 3ROCA 4CFXA 4LL5A 4MWIA 3MBLA 5HG9A 4EONA 1PF8A 3LJ2A 3DB8A 2OO8X 2ZM1A 4P7EA 3ATTA 4AF3A 1FMOE 4HVGA 4HJOA 3OMVA 3HNGA 4JBPA 1ZOEA 4F70A 4B4LA 4E20A 2IVSA 4FL2A 4Z7GA 3PA5A 5EG3A 3R01A 4HYHA 5DYJA 1B38A 4LG4A 3ZUVA 3ZXZA 5BQ0A 4ZTQA 3R9HA 3KREA 4QYEA 3QZFA 5HGIA 4PQNA 1XBCA 5E8TA 4AQCA 3LQ8A 1SVGA 2JKOA 2UW5A 4EUUA 3DZOA 1H27A 3BLHA 5CSPA 4FTAA 5DR2A 4OLIA 2VWYA 3MIYA 3ZEPA 3I7BA 1OL2A 4J99A 1B39A 3ZDIA 4RIXB 4LDTA 3O17A 4ZMEA 4ZSEA 3FJQE 2C1AA 4DEDA 3OBGA 4FKVA 2AUHA 4JDKA 4L6QA 5EM5A 4JT3A 1NT2A 4PMMA 1JKKA 4M97A 4C0TA 5D11A 4FKPA 2GHLA 4EKLA 3ALNA 3UOHA 1GOLA 4AACA 4O0WA 5IQHA 4B6LA 4AT3A 3SG9A 1XH4A 4U3YA 1JVPP 2OG8A 4AW1A 1LPUA 4JX3A 3EQGA 3ZRKA 4PDSA 3PVUA 4BBEA 4PY1A 2JEDA 1VYZA 1KE7A 4AN2A 4HGEA 4KSQA 5AAGA 4RBLA 1OPLA 1R39A 3P0MA 3OEFX 4FR4A 5FBNC 4C62A 4EH2A 3UDZA 1YI3A 5HG5A 4O4FA 3LCKA 1GNGA 2XCHA 3CGOA 3P4KA 3A2CA 4JAIA 4C37A 1GJOA 3SOCA 5I4NA 3OTUA 5L2TA 3GCSA 2GQRA 1AGWA 1SVHA 1VEBA 3BYOA 3QGYA 4TWCA 5AP5A 2AQXA 4UMTA 5CSXA 5KMLA 2UZLA 3ALOA 5AR3A 3AD5A 4GEOA 4TN6A 2J5FA 4LOPA 4UZDA 5AAEA 2WPAA 3DAJA 4LV7A 3FC2A 1EH4A 3PJCA 2WTWA 5KE0A 3L9LA 4AZSA 5J1WA 3HUCA 4QP4A 3ELJA 3TYKA 3MB7A 3PVWA 3AC2A 3HX4A 5FQDC 4BCQA 1P5EA 4D0WA 4F4PA 4U8ZA 3FHRA 3ZC5A 3FXXA 2O0UA 3DDQA 3QXPA 1BL7A 2XBAA 3HV5A 5HBEA 2XMYA 4GT3A 2Y4IC 2C69A 4CT2A 4FSQA