2REIA

Kinase domain of human ephrin type-a receptor 7 (epha7)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
296
structure length
277
Chain Sequence
TYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Ephrin type-A receptor 7
publication title Kinase Domain of Human Ephrin Type-A Receptor 7 (Epha7).
rcsb
source organism Homo sapiens
total genus 85
structure length 277
sequence length 296
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2reiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2reiA01
5D7VA 4OLIA 3IECA 2GFCA 2VN9A 3G33A 1Q8ZA 2PUUA 2BILB 2YIRA 4FV6A 3AD6A 3ROCA 2VTTA 2WQOA 1Q4LA 3MI9A 3DKFA 4DFNA 1U4DA 2W5HA 4O0YA 3D2KA 4R78A 2WNTA 4PP9A 4U43A 1ZYDA 1AD5A 2W0JA 2W1GA 4O7WA 3ZFYA 5C4LA 5FXRA 2PMOX 3QGYA 4XMOA 4ANSA 4IBMA 3R71A 5JEBA 4RJ3A 4FKQA 3PZHA 3R7UA 3UZTA 2J0JA 4NH1A 5EDQA 3HMIA 4WKQA 3WBLA 4K6ZA 4DA5A 5J8IA 4JG8A 3K54A 3S0OA 4C4GA 4KIOA 1IAHA 3G0FA 3WE4A 2PVRA 1PXJA 4CKIA 4EUUA 4ASZA 3KCFA 4I21A 1JWHA 5E8UA 3A4PA 4JRNA 5BVFA 3HNGA 1YWRA 3TM0A 3BYSA 3PG3A 1OPKA 4J99A 4RIYB 4FSUA 4UV0A 1R0PA 2JD5A 1W84A 3II5A 4O2ZA 4QP7A 1H01A 3B2WA 1IRKA 4EQCA 4HGTA 4GS6A 3BYUA 1Q41A 4IXPA 4XOZA 1PYXA 2F57A 3FHRA 2I0HA 3PIXA 3C9WA 4BF2A 5HESA 2H9VA 4GT4A 1FGKA 4R6VA 4L46A 4RIXB 2WIHA 3WILA 2QR8A 3R73A 1YVJA 2R3JA 1WCCA 4U40A 2PULA 4DC2A 2E9OA 3F66A 2G2FA 3QYWA 3GU6A 3AC5A 3GCSA 5CU4A 4ZY6A 3QZHA 5TR6A 4ANOA 2PVHA 4AW2A 4IZ7A 4R1YA 3PYYA 2QOBA 4KRDA 4D2SA 3BLRA 5CWZA 2PUIA 4IEBA 4FI1A 2FH9A 4NSTA 4I5CA 4W4XA 2XVDA 3F5PA 4IVCA 3GI3A 3HA8A 4LOQA 3IW7A 2Z7LA 4MD8E 4QQJA 5KZIA 3R8LA 3TNQB 4HCUA 4L45A 4C62A 5IA2A 2YCSA 2XIKA 5D12A 4KS8A 3W10A 4E93A 3FMMA 4CQEA 2YABA 2CKOA 2PVYA 2FSLX 2J7TA 2H6DA 3FJQE 3WI6A 5HG8A 4DLIA 5CEPA 2QOOA 5EW9A 2ETKA 3PUPA 4RX5A 2QHMA 1OKYA 4YC8A 4GK3A 2Z7SA 1BKXA 3Q3BA 4RX7A 2IW6A 3I1AA 2XNGA 4Y5QA 3RMFA 4S31A 3Q2MA 4NT4A 4YU2A 3R7IA 4AQCA 2OXXA 5M06A 2W5AA 4TTHB 4J95A 4JQEA 4UALA 4TYHA 5AJQA 5H8BA 5JGBA 3CQUA 4G9CA 3QQFA 4X0MA 3OXIA 5EM7A 1GZOA 3U4WA 1IAJA 5LCJA 5LCKA 4XG3A 1IG1A 3LM5A 3IKAA 4NJDA 4BCHA 2VO6A 5CU6A 2HZNA 3EN6A 1UA2A 3HVCA 5L6WL 4MD9E 4EEVA 4EL9A 4IAZA 4FBXA 4TXCA 3EKNA 3UTOA 4KIPA 3SD0A 2FUMA 3BYOA 4FG7A 4FUXA 1JSVA 2UZEA 1ZOHA 2HZ0A 5JT2A 1JSTA 5IISA 1JQHA 2QOQA 4WSYA 1PXIA 2NPQA 3SOAA 4YTCA 1OBDA 1V0OA 5AR8A 2OG8A 3FLYA 4OAVB 4QNAA 3DJ7A 1HOWA 4RZWA 2UZVA 4QMWA 2QU6A 2XNPA 3EYGA 3IDBA 4NWMA 1PXKA 2ITXA 3KN5A 3R30A 4FKJA 4AW5A 1JOWB 4QMQA 4O7ZA 4IJPA 4WIHA 3IW6A 4M12A 5E1EA 4ASEA 5C1QB 3MB6A 3ZS5A 3PXFA 3UC3A 3T9IA 4DG0E 3AC4A 5JZNA 1W83A 2XIRA 5CLPA 3WF8A 4CFWA 3EQFA 4YJTA 3UODA 3K5VA 1T46A 2BR1A 5ICPA 5J1WA 4YBJA 2WTDA 4ACHA 3WF5A 2CCIA 3L1SA 5EM8A 3QTUA 4L42A 2V0DA 2PZ5A 4RC4A 2OK1A 3LQ3A 3BYVA 4O1OA 4J98A 4MTAA 1JNKA 2NO3A 1YHVA 5D10A 2ESMA 5IUGA 3V8WA 3IOPA 4D0WA 3EN9A 2AC5A 3RP9A 4IC8A 5E8XA 2HZIA 5GJGA 4E1ZA 4KBCA 3MVMA 5JH6A 4RA5A 4Q9ZA 3R9RA 3RHXA 3OW3A 4AZWA 3ORTA 5IH5A 3ZOSA 5JMSA 3HV3A 4M8TA 3FQEA 4ZP5A 4F70A 5TT7A 4QPMA 4BRXA 3GC7A 4WG3A 3FSKA 5AX9A 3V5TA 5IG1A 2BHEA 3VC4A 3QYZA 4A9TA 2YERA 4I94A 3UO4A 2I0YA 4FT5A 4TWOA 4XG4A 5DHJA 3M1SA 2UZTA 5C8KA 4JDHA 4PWNA 5J1VA 4JXFA 1NVRA 3ROYA 2W9FB 5G6VA 2XNEA 3HV5A 4EK4A 4UMUA 1PW2A 2JLDA 3BHUA 3ORIA 4F6WA 4IB3A 3QCQA 5EQEA 4AGCA 4O38A 2C6LA 1H25A 2VGPA 5DRBA 4CEGA 3LFAA 4FZ7A 4M0ZA 4ZTQA 5LARA 3U51A 4FSZA 3EZRA 4FTOA 4YHFA 4BHNA 1ZOEA 1LUFA 2VTAA 4FTCA 4NTSA 4DEGA 2FGIA 2OZAA 3KA0A 5CEQA 3TKUA 1STCE 4K77A 3DBFA 4NCTA 5AUZA 3NX8A 2BKZA 2OXYA 5E91A 3NW5A 3BGQA 3VN9A 4I1ZA 4BCFA 2WB8A 4IVAA 4EJ7A 1O6KA 4DH1A 4G3FA 4EQUA 5EOLA 1XH7A 3B8RA 4RMZA 3WZEA 1YOJA 4O86A 4MK0A 1ZYLA 3H9OA 4MBIA 3ITZA 4GVAA 1RW8A 4FV5A 4HGLA 1Q3DA 2FVDA 4XEYA 4YJVA 5EM5A 4BCIA 3E63A 2WMUA 5D11A 4RVTA 4QTAA 4K18A 3GC8A 3CCNA 3CGOA 2H34A 3ORLA 1H26A 4XH6A 1W7HA 4FV4A 4FV8A 4CZUA 4DGNA 4FKIA 5CSVA 3RPSA 4FUYA 1WMKA 4YZ9A 2OICA 3NVMB 4TW9A 4CV9A 3RAHA 5LVNA 4I20A 4F0GA 4O0WA 5ETIA 3O8UA 2YZLA 2CGVA 3KGAA 3NVKI 5IQHA 5AADA 2A2AA 2CSNA 3MH0A 4QO9A 4IDVA 4RBLA 5AUVA 4FTNA 3WF7A 3OCTA 2OJGA 5J9YA 1YDSE 2W4OA 4DT9A 1YDRE 1WVYA 4ZZOA 3GENA 4BR3A 1GY3A 3FXWA 2XJ0A 4NKAA 3UE4A 4DGOA 3D94A 2BTSA 3U9CA 4CFFA 4A9RA 2YAKA 3EFWA 4BDDA 5FEQA 5JGDA 3SG8A 4I22A 2A1AB 4PMTA 3SV0A 4GT5A 1CM8A 4JBOA 3IDPA 1BI8A 1JAMA 1KE9A 1WBTA 2PZYA 4RC3A 3W2QA 3A8XA 1H07A 3BGPA 3BZ3A 2X4ZA 5I9YA 3HAMA 1ZZLA 3TZMA 3DXQA 4MYGA 2GSFA 4XRJA 3TCPA 3LLAA 2XJ1A 5AP3A 4FSRA 4O22A 3LXLA 5A6NA 3IONA 4QP2A 5AUXA 3BRBA 5A3XA 2OH0E 1OUKA 4G17A 3DPKA 2PWLA 3R83A 2WTKB 4GIIA 1J1BA 2WKMA 1ZWSA 3DQWA 4RWKA 1XJDA 3PXQA 3QWKA 4FV2A 2X2LA 5I9UA 2QONA 1PMUA 3GGFA 4PRJA 4ZK5A 4BKYA 5J7HA 3SOCA 4ANQA 1S9IA 2X9EA 4EH2A 3GNIB 3ZRLA 1XBAA 4QMOA 3ZMMA 4D1SA 2GS2A 4EOLA 4YNOA 2W7XA 5TO8A 5AWMA 2VX3A 3QRJA 5BYZA 2PUNA 3FLNC 2O0UA 2YIXA 4EI4A 2HY0A 2P4IA 4CZYB 4XNEA 3C4ZA 1H0WA 4U9AA 4A07A 4R8QA 4AW0A 2GNLA 2QG7A 2QG5A 3L9MA 3PJ1A 3W18A 3Q96A 4GYIA 4RLKA 4Z3VA 5DA3A 3VUMA 4IB0A 2WU7A 3KMWA 2CGXA 3KXGA 4CNHA 4O0RA 1FINA 2J6MA 3MY0A 3R1YA 4O0UA 4D9TA 3NCZA 1JBPE 4QMMA 5E8ZA 5AFVA 2PMNX 3Q4CA 4H36A 4IE9A 4RWJA 4AACA 2J0KA 4AS0A 4BZNA 3PXKA 3EB0A 3UOLA 4NZWB 4WNOA 5FDPA 5JN2A 3OBGA 4UMRA 4EBWA 3L8VA 3FE3A 2IPXA 1KE7A 1ZYCA 1GOLA 2QOKA 2ZAZA 2I7QA 2Q0NA 5DG5A 3VBXA 3QUPA 4IQ6A 4UMQA 4MF1A 2IZRA 4MXOA 4ITJA 5AP7A 5AR4A 4IAIA 2YDKA 3AGMA 3LCOA 3V5QA 4XBUA 4EOMA 4UYNA 2VTOA 2YDIA 5I0BA 2R3HA 2C1AA 2ERKA 3DBDA 4HVHA 4C0TA 4GFMA 4HVIA 2YJRA 3KF7A 2QLQA 4L8MA 4M15A 4F4PA 4CV8A 4CRLA 1SM2A 3BBTB 4IX3A 5KNJA 2VNWA 3ZSIA 5I5ZA 1Q8TA 2VNYA 2B7AA 4E4MA 4JBQA 2A0CX 5E92A 5J5SA 2PU8A 4GJ2A 4GUEA 4MXCA 4NW5A 3VHEA 4DINA 3COIA 1U59A 5EQPA 1OL7A 1TQMA 3LFBA 5E7RA 1ERKA 4RRVA 4BC6A 3KC3A 4O83A 2RG5A 4GEOA 3RPOA 2R2PA 2B9JA 4RJ7A 3KEXA 5DR6A 3NZ0A 4IX5A 4D4YA 3I5ZA 1ZZ2A 2RFSA 4CKJA 3RCDA 3WZDA 3SAYA 3TKHA 2XIZA 3QQLA 4HPTE 4BTKA 3NS9A 4NIFB 2ZV2A 3ORNA 5EYDA 4CVAA 1L3RE 3RNIA 2J0LA 4EHEA 4APCA 1OMWA 5IUHA 2BFYA 3FYKX 3T9TA 2JKKA 3D7TA 3LHJA 1LR4A 3EQBA 1ZY5A 2V7OA 5DPVA 5B2LA 4UBAA 3HMOA 4XG9A 4FYOA 5J7BA 4L3PA 3SXFA 1RQQA 5CQUA 1QPDA 4BDKA 5M51A 1MQBA 2P0CA 4YP8A 1NVQA 1YXTA 4L67A 3MESA 3QKMA 3OEZA 3VUGA 2WTJA 4I5PA 2AC3A 3VULA 2XRWA 1H0VA 2VTNA 3ACJA 3ZU7A 4F9CA 3ZFXA 4YSMA 2J51A 1ND4A 1H08A 1M14A 4F1MA 5IF1A 3Q9WA 1XHAA 4QYYA 5IA0A 4U3YA 4NL0A 1GZ8A 2V22A 4EKKA 4EQMA 4K9YA 4OT5A 4FIFA 1PXPA 2E9NA 5EW8A 4ACDA 4OTPA 5AUYA 5CXZA 3MJ1A 2C3IB 3D7ZA 5C8MA 1B38A 2W4KA 4NTTA 4Q2AA 4U6RA 5DT0A 3OW4A 5M44A 3UPZA 3K2LA 4FIEA 5A46A 5CZIA 4EZ5A 3ZM9A 1M7NA 5HD7A 5KMJA 5F4NA 5DNRA 4Z16A 3EN4A 4IZAA 4DFZE 4M67A 5K5XA 2QO2A 2R9SA 3RCJA 4JNWA 5AMNA 5IMXA 2ZVAA 3CTHA 3E7VA 5BUJA 3FLQA 3WOWA 2F7ZE 1YXXA 2CHLA 3CTJA 3QC4A 1G5SA 2ONLA 2QURA 4O7YA 5E9EA 2XYUA 4C02A 4YC6A 3FY0A 3RI1A 3MVHA 5JQ5A 4GU6A 3Q9YA 4CZTA 3TDWA 2GNFA 2PTKA 3BQRA 4ZTMA 4RFMA 5HTBA 4FMQA 4PMSA 4PQNA 4X6RA 1R1WA 4EOSA 3ZLSA 2R0IA 2HY81 3KY2A 3F7ZA 3NNUA 4ZTLA 4WG4A 5J5TA 4IJ9A 2XK7A 1K9AA 5CF8A 3ORPA 5DFPA 5L2WA 4O6EA 4AOIA 4DF3A 2HZ4A 3F6XA 2XNOA 4H39A 3UIBA 3DJ6A 2RIOA 4CD0A 2B52A 2YM7A 4U81A 5IQDA 4YJSA 2VTJA 2BZKB 3O96A 4MF0A 5TOZA 2WO6A 4A4XA 4L43A 5BUIA 4DT8A 4IACA 4X6QC 2OFVA 4NUSA 5M07A 1B6CB 4QTCA 2R3IA 1O6LA 3KXMA 4RIXA 4CMOA 3N4VA 3ZTXA 2H96A 2XKFA 1XH4A 1MRVA 2C3KA 3FQHA 3B2TA 2YCQA 5CSXA 3ZC5A 4NYEA 4FV0A 3A4OX 1KOAA 3RAIA 5HOAA 2R3NA 2WQMA 2QU5A 3ZEPA 5HQ0A 3W16A 2Y6OA 1VZOA 4JVGA 3BU6A 4LL5A 4DEIA 4KRCA 4DHFA 2CKQA 2X0GA 2JDRA 3C5UA 3O0GA 3ODZX 4MWHA 2ERZE 3OP5A 3CC6A 2JAVA 4XOYA 3T3VA 5TF9A 2EB2A 3CPCA 3TKIA 1J7IA 3PJCA 3FKOA 4PMPA 4PV0A 3GBZA 2IVUA 4WA9A 3OWPA 3LQ8A 4U8ZA 2CMWA 5CVFA 3BHYA 4Z9LA 3BKBA 5K9IA 4F0IA 3ID6C 3WIGA 4MH7A 2DUVA 4D4RA 3KREA 3SLSA 5CF4A 3SGCA 2WEIA 3TZ8A 5AIRA 3MTLA 4FZAB 3Q5ZA 3MPAA 3AC3A 4FV9A 5FXQA 2GS7A 4XJ0A 4C61A 4LRMA 5CXHA 2GTMA 4Y5HA 3ENHA 2I0EA 2ITNA 5LVMA 2WQBA 4DH5A 3VIDA 4XG6A 3I7BA 4F9YA 4KKGA 4YTHA 3I79A 4FIGA 4QPSA 4E3CA 4FL1A 4FX3A 4JQ7A 1PJKA 2UV2A 5IH6A 1EH4A 3UOHA 3F7WA 2JDOA 5CQWA 4RVKA 4PUZA 2F49A 3FDNA 4JL9A 2BRBA 2IWIA 3F9NA 1FBNA 3S4QA 3MV5A 1OI9A 4P5ZA 1ZLTA 3HKOA 5AP6A 2J5FA 4XV3A 4ZS0A 3QTZA 3VS5A 3MFSA 3NDMA 1DI9A 3ZBFA 1Q5KA 4DCAA 4QMPA 1JKKA 2ZM3A 3VQUA 3PWDA 4UYAA 4D9UA 1GZKA 3R2BA 3TN8A 2UW8A 4LGDA 3PVGA 3OWLA 1WBVA 3QQUA 5JFVA 4CXAA 3CLYA 4NW6A 3ZZWA 3PFQA 3RKBA 4LV8A 2BAQA 5H2UA 3MTFA 3LFEA 3P23A 3ZFMA 4FT9A 3KN6A 2DYLA 1TQPA 3O7LB 3E3BX 3CKXA 4U3ZA 1SMHA 3R9NA 4QNYA 3ZRMA 1OL6A 3VBWA 3KCKA 1MQ4A 4ZJVA 4EC8A 3MH3A 5EYCA 4E4LA 5CAUA 1PXOA 3KRWA 5LJJA 4C8BA 2ITPA 4OUCA 4R3PA 3UNZA 4KBKA 4I6FA 3QTIA 4YNEA 1QMZA 4FYNA 4TWNA 3BE2A 4NM5A 1UNGA 4YHJA 3FMEA 3NIEA 3C1XA 2F7EE 3E8NA 2UW7A 3POZA 4IMYA 4JLCA 4QP3A 1ZXEA 5C8NA 4GKHA 4WNPA 3DBQA 3TTJA 4RX8A 4K33A 5HBEA 2CLQA 3V04A 3ATSA 4FODA 4IADA 3ORXA 4Y72A 1XR1A 4M68A 3D0EA 4RSSA 4BKZA 3GFEA 3W2PA 2XNMA 3JUHA 1A48A 3LFCA 2XJ2A 2ZB1A 4CSVA 2ZDTA 2ACXA 5I9WA 2W9ZB 1H1RA 3E88A 3TT0A 4FKVA 2R3KA 4BL1A 5HX8A 3HV6A 3DNDA 4X2GA 5C01A 5BYLA 1VYZA 5IQIA 4CKRA 4RT7A 4NU1A 4Z7GA 2W1DA 3RHKA 1PHKA 5J95A 4LV5A 2R3RA 2O64A 5CU2A 2YLFA 4BI2A 4CCUA 3F82A 2ITVA 2OLCA 2V55A 1J91A 4MNEA 4W4WA 2OFUA 5HGIA 4CYIA 4KWPA 2OF2A 4BCKA 3L9LA 3QUEA 3DKOA 4YZBA 5HTIA 4QQCA 1ZY4A 4GFGA 3LM0A 5A9UA 3EOCA 1U54B 3KK9A 4FKSA 4YZDA 3FC2A 4FTJA 5E8TA 2W4JA 3BEAA 3GCPA 2CN5A 3M11A 3UO6A 4EH6A 3ZSHA 4F0FA 5EI2A 4F08A 1SNUA 4QMTA 3E8DA 1ZYJA 2QI8A 5T3QA 3CEKA 2OI4X 3UMWA 5E4HA 4IFCA 4QT1A 4EH4A 3EL8A 3BIZA 2VGOA 4YTIA 2XH5A 4DGMA 3BEGA 4HW7A 3OT3A 3CJFA 4DEEA 1FGIA 3PP1A 1BYGA 1YXUA 1JKTA 5HX6A 4ZSJA 4FSMA 4RIWA 5FXSA 1F3MC 2P2HA 3BLHA 3JVSA 1SVEA 4K1BA 3FZTA 3SRVA 3QD0A 1QPEA 4FKUA 3BWJA 3EN5A 3NLBA 2C0TA 2HENA 3W2RA 4F65A 5AIKA 1G8AA 3C5IA 1KV2A 3V5PA 4DH7A 2J5EA 4I6QA 2YM5A 4KKHA 2DWBA 4O21A 3JR1A 3SXSA 3ANQA 3OY3A 3DZOA 3WF6A 3BV2A 3O71A 2OO8X 3EQDA 3ZLYA 2JITA 4XS2A 4O91A 3ZONA 3HGKA 2WELA 3QZFA 2YACA 1Y6AA 5L2SA 3R02A 3ZDUA 4FTMA 1JKSA 1ZYSA 1Z57A 5IDPA 3K5UA 3GB2A 2LGCA 5L8JA 3M2WA 5M09A 4G6NA 2X8DA 3FC1X 3PLSA 4V04A 1H27A 2JKOA 4Q5HA 4GG7A 4AOJA 3VW6A 5LMBA 3EIDA 3QKLA 4B8LA 4C3PA 3PXRA 1NXKA 2WMAA 3U6IA 3CQWA 4GUBA 3RVGA 5CAOA 3OXTA 4AT4A 2OSCA 3NYVA 4YPDA 1BUHA 4DEHA 3ENMA 5IPJA 1V0BA 3PWYA 3ZXZA 1H4LA 3A7JA 2XA4A 4HGEA 3BX5A 3IW5A 5KZ0A 5EDRA 4FZFB 4AGDA 5L8LA 5GINE 3A60A 3MFRA 4LUDA 4DTKA 4N6ZA 2R3LA 4I5MA 1P14A 1FMOE 5AV1A 3L9NA 3QLFA 5FEEA 3RPYA 4J1RA 3ZBXA 1IEPA 4XHKB 2RGPA 2VO7A 1FQ1B 2XBJA 5GZ9A 1PKDA 3ELJA 4EYMA 4E5WA 4R7HA 4QTBA 2HW7A 2ZMCA 1H1SA 1E9HA 2OJJA 3FMLA 3DKGA 5ANOA 1YHWA 1O9UA 2XS0A 4PTGA 3SW7A 4O96A 4LG4A 2UW6A 5HVYA 2B9FA 4IZ5A 3QC9A 4U42A 2WQNA 1MP8A 1W98A 4QYFA 5M4IA 2BRHA 3E92A 3HV4A 3NW7A 4PDOA 5CEIA 4BI0A 3D5XA 1LP4A 4M14A 1J3HA 3GU4A 2E2BA 3LCKA 4HVSA 3VQHA 4ZMFA 1HCKA 3QHRA 3TUCA 4FV1A 4IVDA 4J8MA 5BVEA 2X7OA 3E7OA 2BKKA 4F9AA 2HXQA 3HA6A 2Z8CA 2EVAA 5I9XA 3DFCB 4A4LA 2C0IA 1URWA 5BNJA 3OCSA 1L8TA 2C68A 2WMQA 1MUOA 5BQ0A 2CKPA 3DK3A 4C58A 1Q8WA 1WAKA 2F4JA 3COMA 4O0SA 4FGRA 4CFNA 2YN8A 1YOMA 2BHHA 2GU8A 3KU2A 3PSDA 4MEDA 2HCKA 2V7AA 5AA8A 2UW5A 3QF9A 2ITQA 4FICA 3LMHA 3L8SA 2C5NA 4W4YA 3F3WA 4G6LA 4MXZA 3KFAA 2YIQA 5FM2A 4J53A 4FR4A 1FPUA 4AN9A 2XYNA 2GHMA 4TN6A 2UZDA 3VS0A 4ZLYA 4BB4A 4XG2A 2BAKA 2PHKA 4U45A 4KAOA 3IGGA 4QP8A 5CEOA 4FA2A 5B2KA 4FG8A 5HIEA 2I40A 4DFLA 2F2CB 3HZTA 3QQJA 5L6OA 4W4VA 3U6HA 1HCLA 5CI7A 3EZVA 2OKRA 3ALOA 4AGUA 4BCNA 2WEVA 1FVVA 1CSNA 5GIPE 2NP8A 1LPUA 4ERKA 5IEVA 2WOTA 3TWJA 2FSMX 3W8LA 3RWQA 4D2PA 4DFXE 3QD4A 1OBGA 4QP1A 5KCVA 3CXWA 3MW1A 2WMXA 2W1ZA 4DN5A 3QRUA 4C38A 3PG1A 5HO8A 3IDCA 4ZLOA 4PL4A 2OJ9A 2PE1A 2UZWE 2G2HA 4M69A 5HE1A 5AUUA 4BDEA 5DYJA 3DBEA 2WGJA 2FYSA 3D83A 3H3CA 2QD9A 5HIDA 4EOQA 5CAQA 4X3FA 5LMKA 1CKJA 2CNQA 3RZFA 4LOPA 2BCJA 5BMSA 2GPHA 2ITOA 3POOA 2JBOA 3MB7A 1CTPE 4MBLA 3ODYX 3CQEA 3EQHA 3OWKA 2C6MA 3CP9A 1OPJA 1IASA 3DB6A 1T45A 4LRKA 5HO7A 2BIKB 2R3QA 3HEGA 4AGWA 3MFTA 4PY1A 4E5AX 4ERWA 3RGFA 2A19B 4FKOA 5AR3A 3N4TA 4IFGA 1PYEA 4CLJA 3PPZA 3QD2B 4U44A 3UP2A 4YJQA 4FTIA 1KOBA 2YIWA 1NT2A 3ORZA 1OKZA 5IDNA 5LWMA 5DR2A 1BX6A 4BCGA 1E1XA 1P5EA 4E6DA 1NY3A 3ZUVA 5A14A 3VBVA 1UNLA 2B54A 2BVAA 5EH0A 1NW1A 3EKKA 3NUXA 1M2RA 5EM6A 1I09A 4FIIA 3GXLA 4DG2E 3RPRA 1LEWA 2IZSA 2NRUA 2PVLA 3E64A 3ULZA 3ZYAA 4EK3A 2VTPA 1H00A 3UOKA 3CPBA 1R39A 3L8XA 3MWUA 4MNFA 5AR2A 3FI4A 1TVOA 2C30A 1OIRA 4PPAA 3VRZA 1GIHA 2Y4IC 3N4UA 2ZV9A 1JKLA 2C6IA 2WFYA 2ITUA 4PNIA 5DBXA 5AV2A 5BVKA 3VBTA 5BVNA 5IQFA 3TUDA 2JEDA 1W82A 3IOKA 3A7HA 3RM7A 4CGAA 4P90A 3BHVA 2WMTA 5BVOA 4OTWA 3JS2A 4D1XA 4BCQA 3AOXA 4C3RA 5IQGA 4NJ3A 2YISA 3EQIA 4U97A 4HVDA 4Y73A 2UW4A 3RM6A 2VWWA 4LL0A 5KUPA 2CGWA 1YW2A 3OXZA 2BRGA 3ZLXA 4R77A 4RFYA 3UP7A 3IG7A 3W8QA 4GU9A 5HZNA 4A9YA 2VWBA 4QP6A 3TACA 4RLLA 4TZRA 4BDIA 4FK3A 4NM0A 4QMZA 4FTTA 2C5YA 4OTHA 2VX1A 4ZZMA 2RF9A 1ZAOA 4GH2A 4QP9A 3H10A 4ZOGA 3C4EA 4E73A 4C4FA 1BLXA 4O0TA 4QTEA 1KWPA 3DFAA 4IZYA 3BCEA 2XEZA 3TEIA 4A06A 4E5BA 2YEXA 3C0GA 4FOCA 2ETMA 3R1SA 2E9PA 3Q6UA 4XP3A 4GV1A 1QPCA 4BIBA 2BZHB 3ZO3A 5AR5A 5AM7A 5HLPA 3MIYA 4TL0A 1F5QA 1KSWA 4FT3A 1GJOA 4M0YA 3NW6A 3AMYA 4K2RA 1M7QA 2P2IA 3ERKA 1XH9A 4RJ6A 5DT4A 4EHZA 3HDMA 3Q4TA 4LGGA 3NSZA 2G1TA 3DAKA 3TIYA 4OTRA 3LE6A 5ANKA 3AMAA 1REKA 3WZJA 5DEYA 2C6TA 2B55A 5L3AA 3DB8A 5IKWA 3ZUUA 5M4FA 2YCRA 4B99A 3FZPA 4FKWA 3F3TA 5AAEA 5HIBA 4CFXA 3RAKA 3DS6A 4FSQA 2QC6A 4K8AA 4UWCA 1W8CA 4MWIA 5CU3A 3F2AA 3R7EA 2WTVA 2ITTA 3P78A 2C6EA 3QD3A 3AC1A 3EH9A 5EHLA 3WF9A 5ITAA 1UU9A 3R0TA 1UKHA 4PDPA 5DH3A 4TNDA 3Q9XA 4OBQA 3HP5A 3NUPA 5T6KA 4APPA 4HYHA 2JKMA 2A4LA 4G31A 5HE0A 2IVTA 4ASDA 3MGYA 4GVJA 5DLSA 4AWIA 4C4HA 3D2IA 4D0XA 5AV0A 5BX0A 4H05A 2W99B 3BBWA 1J1CA 3E93A 4G3EA 3EQRA 3P7AA 3OMVA 2BALA 4A9SA 1BI7A 4YBKA 4F64A 4D1ZA 3E87A 4E4XA 3I81A 2GNJA 4ANLA 4HYUA 4AA4A 4RQVA 3ZO2A 4B7TA 5AX3A 2IW9A 3LXNA 2JBPA 3P86A 3FMHA 2HK5A 5KBQA 2F7XE 4O7LA 5IQBA 2XK4A 4PMMA 1AQ1A 1K3AA 3N51A 5KHXA 4I24A 4JS8A 2A27A 5ANEA 4CTBA 5DRDA 4EUTA 3OEFX 1H8FA 2RFNA 3C4WA 3I4BA 5JSMA 5H3QA 3QZGA 2G9XA 1KE5A 2BAJA 5CYIA 3DLSA 3FI3A 3FYJX 4BCPA 3ZHPC 4DEDA 4EWQA 3F88A 4AFJA 4JAIA 4ZSGA 4TYGA 3LJ1A 3V5WA 5JQ8A 4EOPA 2G15A 4GRBA 4O6LA 5EFQA 4EBVA 2BFXA 5JKGA 2JDSA 4PPCA 4UXQA 3TJDA 4IB1A 5AUWA 2XMYA 4N0SA 2HELA 4IIRA 3DQXA 2J9MA 4NFNA 4R5YA 3PA4A 4FVQA 4TYHB 2YWPA 4LUEA 3QQHA 1URCA 3A8WA 2Y0AA 5H8EA 3CE3A 2WOUA 1OPLA 1NA7A 3TJCA 5B7VA 4DBXA 4PF4A 2WTWA 4OTGA 5AAFA 5IQEA 2Y8OA 3NEWA 3VS4A 5CSHA 3QWJA 4PL5A 3O17A 2OH4A 2VTRA 1GIJA 4ORKA 3E8CA 4EOJA 3C0IA 3PPJA 5CX9A 4EOKA 5DN3A 2HYYA 4FK6A 4YLLA 3WZUA 3LFNA 3OFMA 3LQ5A 4RVMA 5ANJA 4EWHA 3S1HA 4TYIA 1DAYA 2XEYA 4IAFA 2OWBA 1U5QA 1PY5A 4ZY4A 4FGBA 1XBCA 3P4KA 3LXPA 4FZ6A 1XWSA 2YM8A 3NGAA 2QNJA 5ANGA 5F20A 3KVXA 3QHWA 5CT0A 5E90A 2CGUA 4DAWA 4ZTRA 4IAKA 4CYJA 2OIQA 4EH8A 1VYWA 3EHAA 2UZOA 4I0SA 3UYSA 4F6SA 1JVPP 2W06A 2R5TA 3BPRA 3VW8A 2VTMA 3QGWA 4G2FA 2QKWB 2X39A 4QYHA 1KE8A 4B4LA 4MX9A 3Q2JA 5EW3A 5K4JA 4IAAA 5IA5A 4BWXA 4WBBB 4WUAA 3R9HA 1XH8A 1OITA 4UZDA 3D5VA 3G51A 4H1JA 4BTJA 4HNIA 3UZRA 1BL6A 2GNHA 4FV3A 3UVRA 3FXXA 4H1MA 4WNKA 4FEVA 4FTUA 4FIJA 3AC2A 3IQ7A 2XUUA 3TV6A 3G5DA 2QQ7A 3FMNA 4BKJA 4F99A 3SVVA 4MHAA 3SKCA 4D2RA 1PKGA 2QOCA 5CANA 2PVJA 4I3ZA 4LOOA 4JDKA 4QMUA 4TKSA 3UIXA 4EORA 4ZSEA 3D15A 4I0RA 5HEZA 2VUWA 1OL2A 3DDPA 4BDBA 1GIIA 1Q24A 3GU5A 2W17A 4M84A 3DNEA 4U5JA 4GSBA 3R8ZA 2PMIA 4CMTA 5I9VA 4AW1A 4Z7HA 5JRSA 3PA3A 5B2MA 2OZOA 2YCFA 3FZOA 1QL6A 4GYGA 4D58A 2QCSA 2YFXA 3LAUA 4F9WA 2KULA 5HBHA 4WOVA 2XIXA 5DIAA 3ZUTA 3UO5A 3MPMA 3QRTA 3TI1A 4P7EA 4RIYA 3HX4A 4XP0A 3AT3A 2CPKE 4AP7A 4XG7A 3KMUA 3QX2A 3AG9A 3NNXA 3COHA 4I0TA 5HE3A 5JFXA 3CBLA 4YGAA 4FSWA 2OF4A 2ZV8A 4N4SA 3V6RA 4L7SA 5A4CA 2Z02A 3F3UA 4UWBA 5IEXA 4BDCA 4LMUA 4Q9SA 4ZZNA 5C03A 3DXPA 1H1WA 2UUEA 3FPMA 5CVHA 1ZMVA 1OL5A 5M55A 3WE8A 3Q60A 3LIJA 4E7WA 2X6DA 3FBVA 5E8WA 4EH7A 5IA1A 3DZQA 2XKEA 4B8MA 4HVGA 4KABA 3RAWA 1JSUA 1W0XC 3AXWA 2ITZA 1Y6BA 2ZM1A 3R7YA 3VUHA 2B9IA 3QA0A 4NCTC 3MN3A 4ZIMA 5GZ8A 3Q4UA 3R21A 1OVEA 2P3GX 4FG9A 4J7BA 4FTLA 2QHNA 3GVUA 4BBMA 4C33A 4BIEA 5AEPA 2O5KA 3UQCA 3TDVA 3LXKA 5HU3A 5IZFA 3E5AA 3GC0A 3RJCA 3DTWA 3SDJA 3MFUA 4RWIA 4ACGA 5CF6A 2BRNA 2VWIA 3FUPA 3QKKA 4FTRA 5AUTA 3L9PA 3DT1A 3GOPA 3VS6A 4XCUA 2JDVA 4I6BA 3TNHA 4KS7A 4YJUA 3FZRA 5FGKA 3M42A 3LJ0A 5FBOA 1UU3A 3OTVA 5HKMA 4FE2A 2W1HA 4L68A 3ZLWA 3HRFA 2GDOA 4JI9A 1SYKA 4UB7A 3PTGA 3F3ZA 2WAJA 3GCUA 2X7FA 2YAAA 4GG5A 4L44A 4L7FA 4R5SA 2ZJWA 3SQQA 4BZDA 4YC3A 4UMTA 3CTQA 4MD7E 5EKOA 5FG8A 4D5KA 3W2CA 4DGGA 5J87A 1GAGA 3NUYA 3UVQA 3PY1A 3DU8A 4FNYA 4L53A 4QP4A 4PTEA 2W1IA 3I0OA 3LCSA 4MVFA 4OBPA 5TE0A 4QMYA 2VWUA 3AD5A 4IM0A 4EOOA 4FTQA 3NIZA 4R7BA 2UW9A 1SZMA 3A7FA 5KBRA 3SW4A 2WTIA 2WIPA 4JR7A 1JLUE 4XV1A 4XYFA 2CCHA 1A06A 2EB3A 3BE9A 3OY1A 3PE2A 4H3PA 3PP0A 2XK3A 4XG8A 1I44A 2BIYA 5L8KA 3UG1A 4MQ1A 5AA9A 3CKWA 4ASXA 2QOHA 4AFEA 4RJ4A 2GTNA 3HRBA 3SC1A 3UJGA 2QOLA 1PXMA 3SG9A 4F1TA 3KULB 4LGHA 4BDJA 3VS1A 4FSTA 4TY1A 3IS5A 4QMNA 1MRUA 4BBFA 3GCQA 5C4KA 3E3PA 4CG9A 4CRSA 3QAME 4F6UA 3FMJA 4YTFA 1G8SA 3FWQA 2R3GA 5L6PA 3BHHA 3PJ8A 5KHWA 4AE6A 5KKRC 4ZTNA 3W2OA 4BICA 5AV4A 4D2TA 2WMVA 3BELA 4S34A 4IWDA 3RALA 4QOXA 4ZJIA 2JIIA 3CGFA 3RTPA 4EKLA 2W1EA 4DCEA 3UGCA 1WBOA 3R7OA 3GU7A 2RL5A 3R2YA 4ALUA 4JIAA 5FTOA 5L2QA 5FBNC 1CKPA 2UVYA 3TG1A 4C3FA 4BTMA 4BCJA 4LMNA 1R0EA 4JBPA 4M13A 2CKEA 3Q4ZA 1UU7A 2PE2A 3KRXA 3P9JA 4USEA 3OS3A 4IWQA 2YZAA 3ETAA 4U79A 1PMNA 3EQCA 3R1NA 1WBSA 3Q6WA 4TWCA 4V05A 3TNPC 4M97A 1YI4A 3H0YA 4IH8A 4O7TA 3PY0A 2UVZA 2X2KA 5F1ZA 1Y8GA 3HAVA 3KQ7A 4RGJA 4FEXA 2WU6A 3G6HA 3I7CA 4TRLA 3HP2A 5AP2A 4YJPA 3QTQA 1YOLA 4AZEA 2XP2A 4S30A 1P4OA 2ETRA 2WMBA 3R01A 3PY3A 4Y46A 4DTBA 5HCZA 2XZSA 3F5UA 3RK7A 4XBRA 4DBNA 2WQEA 4WRSA 5ANIA 5HNIX 1M2QA 4M66A 2X81A 3R04A 4OAUC 3FZSA 4H3BA 3CD3A 3Q04A 3ZRKA 3EJ1A 4FF8A 3BHTA 3REPA 4XUFA 2O2UA 4BIDA 4DYMA 1PMVA 1Q99A 2NNWB 3I6WA 4II5A 3R00A 4IM3A 3QQKA 4C4IA 5HBJA 2J90A 3NYOA 4D2VA 4BBEA 4L00A 4D4SA 2PK9A 3W1FA 4O82A 4L3JA 3D7TB 1OIYA 4EH3A 4RPVA 4YR8A 2CDZA 2QVSE 3ZO4A 4HPUE 3ZZEA 2YITA 2R3OA 4DG3E 4C37A 1CDKA 4RVLA 4UEUA 2R3MA 4BGGA 4C2VA 4V01A 5DVRA 2CN8A 5ETAA 3ZC6A 3G2FA 2VTIA 4Q5EA 3EFLA 3LCTA 4Y85A 5E8VA 5FTGA 4HCVA 2XRUA 3NCGA 4S2ZA 4UXLA 4IW0A 3UMXA 4IVBA 3UC4A 5JRQA 3FL4A 1P2AA 4C36A 4MXXA 4TT7A 5EHOA 1KUTA 1FVTA 2IVSA 4AOTA 1WBNA 2BDJA 2C6DA 2SRCA 2X2MA 3QCSA 3BU5A 4JOAA 3F3VA 3ULIA 3UQGA 4AA0A 3PJ2A 4HYIA 3DKCA 3O50A 4AT5A 3UVPA 2OIBA 2BUJA 1E1VA 1U46A 1WZYA 3D4QA 4NEUA 2GNIA 4NK9A 5HD4A 5F9EA 3RK5A 3VS2A 5CSWA 4N6YA 2F9GA 5D9HA 3PRFA 2IVVA 4BYIA 4WD5A 3UIMA 5HI2A 4EC9A 5FWKK 3OUNB 3QCXA 2B53A 4AN3A 3VRYA 3VUIA 3Q52A 5CS6A 5GJDA 3JY9A 5M4CA 2JKQA 3GP0A 5DEWA 4RJ8A 1YI3A 5CASA 5FP6A 3NWWA 1YQJA 4ZTSA 4IHPA 3LCDA 4YJNA 3VUDA 2GQRA 3WZKA 4BYJA 4FKGA 3H9RA 3FKLA 4MXYA 4I4FA 5ACKA 3CY3A 5KMOA 2J2IB 3VHKA 3DTCA 4BDGA 5KO1A 4FKTA 4QMXA 3VBYA 3NYXA 3SHEA 1RJBA 2YA9A 3ZXTA 5GNKA 3NUNA 4FC0A 2ONLC 3MVJA 3QL8A 3JPVA 3MA3A 4ANBA 4FEWA 4DGLC 4FSYA 3E62A 4DITA 3BV3A 2WMWA 1UWHA 2J0MB 2EUFB 3ZDIA 5CENA 3QTXA 4E6QA 2Q83A 4DFYA 5F94A 3R63A 2R7BA 5DOSA 5IUIA 1Y91A 3ZEWA 5JK3A 2VTQA 3R8VA 4DLJA 3PXZA 4MCVA 5HVKA 4LFIA 2WPAA 1K2PA 1H1QA 4FT0A 2E9VA 5B0XA 3DAJA 3QTRA 5AAGA 2Z7RA 1APME 2HAKA 3H4JA 4J8NA 4F63A 1PXNA 3PVBA 3K3IA 3NUUA 3O23A 3KL8A 2PMLX 3CSVA 1V0PA 4GW8A 4UY9A 4BWKA 2YIYA 2YJSA 3R7VA 3CS9A 2GS6A 2C47A 5TKDA 3PRIA 4BN1A 1DI8A 3VS7A 3RINA 4JG7A 3G9LX 3QCYA 4TPTA 5L4QA 4L52A 5LVOA 3NUSA 3F5GA 4O27B 3R9OA 4ZS4A 2W5BA 2R3FA 5AP5A 4OGRA 3CY2A 3GEQA 4G6OA 5EQYA 5JFSA 4YSJA 3PZEA 1LEZA 1Y57A 2FA2A 4A9UA 4DFUA 3F5XA 1OB3A 3MS9A 3HMNA 3AC8A 3MVLA 1OZ1A 3KMMA 3EL7A 3TIZA 5J9LA 4FT7A 2Y7JA 4AX8A 3V51A 5CAVA 1AGWA 2PZPA 2UZLA 5FM3A 3VVHA 3CIKA 4L6QA 1OKWA 2BDFA 4H58A 3BLQA 3UNKA 3R28A 2WTCA 4DH8A 3ZCLA 3Q32A 2ZMDA 3OZ6A 3PLAE 5HICA 4X2NA 5KE0A 4PP7A 2JIVA 1J7UA 2C6KA 2HOGA 2IN6A 2VAGA 5F95A 5GHVA 5FD2A 5K3YA 5I3RA 2X6EA 3NNVA 4UMPA 4C4EA 3CJGA 3PDTA 4J52A 3RZBA 3GFWA 3W32A 2IZTA 3HRCA 3FV8A 2EWAA 4FV7A 4M3QA 5CY3A 4AXAA 4NIFA 3G15A 3OCGA 1YKRA 3DXNA 4ALVA 4E20A 5CNOA 2OIDA 2OBJA 4BDHA 4AG8A 2GHLA 5IA3A 4IX6A 4C35A 5ACBC 5HHWA 2BMCA 2DS1A 3P7CA 5I9ZA 3ANRA 2PVKA 4KKEA 3FXZA 3R9DA 5A54A 4CQGA 2YHVA 3QBNA 2O65A 2QOIA 3KK8A 4XP2A 1YHSA 4USDA 3THBA 2XF0A 3EN7A 5I3OA 2PY3A 3V3VA 4ZXTA 4WBOA 4EONA 4FNZA 3TTIA 4FVRA 4RA4A 3UOJA 4CFVA 5AP4A 2GFSA 5A4LA 4N57A 4F7SA 1H24A 3UQFA 4QRCA 4X2KA 3NYNA 2Y4IB 5D41A 3LLTA 4MQ2A 3DV3A 1Z5MA 4WO5A 5HLWA 2X8IA 1VR2A 3EQPA 3VUKA 3SX9A 4L01A 1F0QA 2J0IA 3F69A 3PVWA 4FTAA 4FTKA 4RC2A 4TYEA 3JYAA 3OD6X 4JDIA 4LI5A 4PX6A 4KD1A 3FMDA 5CVGA 3LFSA 3OF0A 4OT6A 4ID7A 5FUTA 4EH5A 4JRVA 1IA9A 3RNYA 2VWVA 4BFMA 3JVRA 3R8PA 1UNHA 3PVUA 1WBWA 2JFLA 3QFVA 4XV2A 1KE6A 3JXWA 2F2UA 2XK8A 5ANDA 5E1SA 2B4SB 2OJIA 2XNNA 3MH2A 4P4CA 4I93A 4JG6A 4EH9A 4F9BA 2REIA 2W05A 3DY7A 3KXZA 3FHIA 3DK6A 1VJYA 3I0QA 3MA6A 4KIKB 1OGUA 2RFDA 1ZMWA 2W96B 2HWOA 4YURA 4PL3A 4V0GB 5C27A 1B39A 4C59A 3VO3A 1OL1A 5DR9A 3UPXA 5EHYA 2PE0A 3WYXA 5E8YA 2XNBA 3QXPA 4ZEGA 4NKSA 3IK3A 4MNEB 3VNTA 4EJNA 5K0XA 4YLJA 3EYHA 2XK9A 3EQGA 3U54A 5HNBA 2PUPA 4KIQA 1RDQE 1UV5A 1ZARA 2G01A 5ETFA 1OKVA 2W1FA 1SVGA 1M17A 4LM5A 4D55A 3Q53A 3MIAA 3PXYA 2QR7A 1BMKA 4J96A 2IJMA 3RPVA 2QLUA 3QX4A 4YMJA 3GC9A 4HOKA 3LPBA 1QPJA 1DM2A 4KINA 3TNWA 4C57A 1IA8A 2Y6MA 2BZIB 4TNBA 2JAMA 3GQIA 4I92A 5EI6A 5CAPA 5M56A 3FI8A 5C9CA 3OVVA 4GIHA 1O6YA 4R1VA 5CSPA 3AT4A 4W9WA 4FVPA 3ORKA 4YJOA 2XB7A 4HJOA 5FRIA 4L9IA 4K0YA 4I4EA 4RIWB 5FDXA 1PXLA 4ZY5A 3ZM4A 3ZSGA 3R6XA 1OIQA 2GMXA 3PIZA 4Y8DA 2C3JA 3P0MA 5AM6A 3SRVB 3ZO1A 4AN2A 4YUQA 3OC1A 3NAXA 3DBCA 3P08A 3LMIA 4TYJA 4DEBA 4RWLA 4CFUA 3V6SA 4NFMA 2EXCX 2C0OA 3QA8A 4O1PA 4X21A 5CEKA 2ZV7A 4KUJA 4DFBA 2HW6A 3QALE 3VS3A 4U7ZA 4OTDA 4EHGA 2BDWA 3QUDA 4OTIA 4D2WA 4FKPA 4F1OA 4FEUA 2UW0A 3WARA 3DOGA 3U6JA 4PTCA 3MPTA 5EYKA 4ZMEA 5CALA 2C4GA 4J97A 4ACCA 2CNUA 4ZJJA 1MRYA 1WBPA 3GCVA 4ARKA 3T8OA 5KMNA 3NR9A 1XBBA 3Q9ZA 4GMYA 3OBJA 1V1KA 3A7GA 2HXLA 3TNIA 4XLIA 2CNVA 3P1AA 3O51A 2P55A 2YM6A 2YM4A 4YHTA 4UN0C 3QTWA 4G3GA 5CU0A 4WSQA 5D7AA 5E8SA 4CG8A 3V5JA 2Y4PA 1UWJA 3U8WA 4CT2A 4UX9A 4YO6A 1FOTA 1J7LA 4OBOA 3UIUA 4BGHA 2HWPA 2XKCA 3WIKA 2VD5A 2OJFE 2X9FA 2VU3A 5GIOE 4MKCA 2GHGA 3NPCA 4E26A 3SXRA 3QRIA 3IPHA 2C5XA 1BL7A 2B9HA 4R3RA 2Z7QA 3VF8A 4P5QA 2X7GA 4I6HA 4YO4A 2X4FA 2C69A 4JQ8A 5FQDC 5HG9A 4JJRA 3S2PA 3W55A 3HMPA 4MAOA 2QKRA 4W8DA 4WHZA 3PJ3A 4O0XA 4F7JA 3KULA 3NAYA 4BZOA 2VO0A 4KB8A 2C6OA 2X1NA 4JX7A 4ZTHA 5LMAA 1XH6A 3WYYA 4GKIA 2WXVA 2GQGA 3A7IA 4Z55A 2EXMA 1REJA 4U0IA 2Z2WA 5I4NA 4ENXA 3TZ7A 3DJ5A 4F09A 3G9NA 4RZVA 3FLWA 5AP0A 2VWXA 3RK9A 2WTKC 3PIYA 4IM2A 2JIUA 2ZYBA 4B6LA 5IMEA 3V01A 2PPQA 1WVXA 4JR3A 2IZUA 4ANNA 2C1BA 5IU2A 4LYNA 2C5VA 2O8YA 4FL2A 5IQAA 3LJ2A 4X7QA 5FTQA 5HVJA 3SA0A 5BMMA 5HU9A 4P2KA 2H8HA 4YZCA 4IDTA 3ALNA 3KXNA 3U55A 3ET7A 3EFJA 2IO6A 5GJFA 4O7SA 4CCBA 3BWFA 5KMMA 3TV4A 3VAPA 2E9UA 3C0HA 3AQVA 5IEYA 4XLVA 2ZDUA 4QYGA 3AGLA 4XX9A 5DMZA 4LRJA 2C5OA 4D5HA 3BI6A 2PZIA 4U80A 2EU9A 2QO9A 4GL9A 2Z60A 3DLZA 4MXAA 3VBQA 4GJ3A 2UZNA 2X8EA 3VWAA 3C4FA 5IA4A 3HMMA 4X2FA 3ATTA 3W33A 3MDYA 3OG7A 4AT3A 2FO0A 3IW4A 3OCBA 4HCTA 3UG2A 4AZFA 4ZAUA 5EKNA 4YPSA 1Q62A 4IWOA 3BYMA 4DEAA 3RBWA 2QODA 4CT1A 4D28A 1ATPE 2AUHA 5HE2A 3LFDA 4C2WA 1PRYA 4YZNA 3OROA 2BPMA 4EK8A 4HZRA 4EK5A 2UW3A 4RG0A 2B0QA 1RE8A 4G1WA 4JDJA 1YXVA 5BPYA 4FIHA 4GT3A 4EHVA 3P7BA 4G9RA 1U54A 3PA5A 1GNGA 5G1XA 3RWPA 3H30A 1YWVA 5FLFA 3FEGA 4ZLZA 4CFMA 2YDJA 2PL0A 4IX4A 2UZBA 2O3PA 4I5HA 3S3IA 3KRJA 4AZTA 2DQ7X 4R3CA 4KNBA 3TL8A 4NM3A 3O8PA 4QMSA 1YRPA 4FNXA 4M69B 5HG5A 4IB5A 3QTSA 4QPAA 3V5LA 3ACKA 4CTCA 5A4QA 3CR0A 2GNGA 5EYMA 4O7RA 4X3FB 5T68A 3I5NA 4E4NA 2UZUE 4L3LA 5A6OA 4B9DA 4QQ5A 3ORMA 2R64A 5FEDA 1TKIA 2QOFA 4QMLA 4Y83A 2V5QA 4X2JA 5EI8A 5H9BA 1PF8A 4EZ7A 4RQKA 4HGSA 1Q61A 3H0ZA 1YI6A 3AMBA 4NM7A 3KF4A 1Y8YA 4PNKA 3OUKA 1XH5A 4BTFA 4O7VA 3A2CA 3FAAA 4WRGA 3DK7A 4M7IA 4QMVA 5HLNA 5HORA 5K4IA 5KMLA 1P4FA 5K0KA 2WHBA 3FQSA 4JAJA 3VUTA 3DGKA 3KVWA 3O2MA 1Q8UA 3QZIA 1VEBA 3U4UA 4AU8A 4N70A 4BCMA 4IANA 4RX9A 2AYPA 5HCXA 1H1PA 3MH1A 4BCOA 3K3JA 3N9XA 5DE2A 4BVUA 1UKIA 2GQSA 5JGAA 4O0VA 2QO7A 3UBDA 4X3FC 5LMKC 3KXHA 1PMEA 3OT8A 4KSPA 5AV3A 5ETCA 4ONAA 1OM1A 2OGVA 3G90X 2JC6A 2VZ6A 4HNFA 2PSQA 2ZOQA 2OZAB 5CNNA 4O7NA 1WVWA 2Q0BA 4G5PA 1X8BA 4FL3A 4PDSA 4C7TA 4FOBA 5HO6A 2YM3A 3H9FA 4E6AA 3HDNA 4F7LA 4PDYA 2J4ZA 3S95A 4RJ5A 4X3JA 3I6UA 1WFCA 3I60A 1YWNA 3QXOA 2UVXA 3HUBA 5CEMA 5LXMA 4H3QA 1FMKA 5L2TA 5L2IA 2B1PA 3GT8A 4R7IA 1A9UA 1DAWA 1NVSA 2BRMA 3NNWA 2FSOX 3DCVA 3QQGA 4ACMA 3R1QA 3HECA 2O63A 3BQCA 3D5UA 1Z9XA 1R78A 2VO3A 4G5JA 4AUAA 3A61A 3FPQA 3NMUF 4E6CA 4O2PA 5HCYA 4ZSLA 4JIKA 3ZH8A 4PPBA 4E8AA 1OUYA 3VJNA 5KMKA 3MSSA 3NUAA 1R3CA 2XK6A 4BHZA 3KKVA 1SVHA 3KXXA 4OR5A 4I41A 3TV7A 5JZJA 4AZSA 4A4OA 4EYJA 3MBLA 1CMKE 2XCHA 3LKMA 2YLEA 3C50A 3CD8A 3OOGA 3E8EA 3T3UA 2I6LA 2R4BA 5DI1A 3FY2A 4YLKA 3F2NA 3L8PA 5BUEA 4KBAA 5LOHA 4MBJA 4IWPA 3LOKA 3G0EA 4XV9A 4YJRA 3PSBA 3C4CA 5HTCA 2LAVA 3FZ1A 5LQFA 3HYHA 1CKIA 3P79A 2XKDA 3LMGA 3PE1A 5CTPA 1XQZA 3FKNA 4FEQA 5H8GA 4AAAA 4B0GA 5IH4A 4DTAA 2WD1A 3MY5A 3NRMA 5HG7A 3LFFA 5J79A 2J50A 2VRXA 3LW0A 2R7IA 4GK2A 3QRKA 3IGOA 3R8MA 3W2SA 2W1CA 4LQMA 2FB8A 5CT7A 5CF5A 4ITHA 4QYEA 3Q5IA 1ZOGA 3HUCA 3R22A 3EMGA 3PPKA 2PVFA 5LWNA 3V8SA 3MJ2A 1GZNA 5KKRB 3A99A 4FKLA 4G3CA 2JFMA 5LVLA 5IQCA 3F61A 3TUBA 4EOIA 1KV1A 1M52A 4GFOA 3UZPA 5KMIA 3U87A 1M2PA 4G3DA 2VWYA 2PYWA 4FSNA 2IG7A 4AA5A 1G3NA 2ZB0A 4W9XA 5A4EA 4DE4A 4C34A 3C51A 3O7LD 1ZMUA 2HIWA 3UNJA 4C4JA 2GCDA 5AP1A 5EOBA 2KTYA 4USFA 5A4TA 4S32A 3LVPA 3R8UA 3HLLA 5CZHA 3COKA 3BGZA 3VF9A 5GZAA 4I23A 4ANMA 3D14A 1OIUA 2OW3A 2WMSA 5DWRA 2BTRA 2P33A 2R0UA 3FLZA 4TWPA 5M4UA 4O84A 4WG5A 1FVRA 3OHTA 3QLGA 4XRLA 3OOMA 3D5WA 2OU7A 5M08A 4ITIA 2CJMA 4Y95A 4AE9A 2XM8A 3U9NA 3JY0A 2CLXA 2PVMA 1JPAA 5LVPA 3HV7A 5J9ZA 3LFQA 4CLIA 2PZRA 3QU0A 3FL5A 4GK4A 2RFEA 3G6GA 4UZHA 5CI6A 3UDBA 2I0VA 4BWPA 2V62A 2EXEA 3FI2A 2OXDA 4DH3A 1U5RA 5C26A 2XM9A 4KA3A 3GUBA 2RKUA 4J71A 4CMUA 2ITWA 4BDAA 1XKKA 1TQIA 4QQTA 2XBAA 4OTQA 2YWVA 1Q8YA 1S9JA 2VTHA 1IR3A 2VX0A 4OTFA 3MY1A 4AZVA 3PSCA 2JDTA 4BDFA 1XO2B 4AF3A 1YXSA 2ITYA 3KRLA 1YDTE 2I1MA 1UU8A 4K11A 3HL7A 3V8TA 4BI1A 5AR7A 2NRYA 3EWHA 4G34A 5BVWA 3F2RA 3GU8A 5BVDA 2WMRA 3FMKA 3P5KA 2RSVA 4WT6A 5EDPA 5EG3A 4O81A 2BROA 3VJOA 4RIOA 2XCKA 4S33A 4YZMA 1Q3WA 3DAEA 4BGQA 1SNXA 5DGZA 3B8QA 2IW8A 4EK6A 4HZSA 3S00A 3O8TA 2VTSA 2WZJA 4G16A 2PVNA 1OECA 3TXOA 4RFZA 4IC7A 3DDQA 5HNGA 4A7CA 5KX8A 3KB7A 2ZM4A 4ENYA 5D1JA 3A62A 2XIYA 2VTLA 2Y9QA 3C13A 4KIKA 3UYTA 4ALWA 3TZ9A 4FNWA 4UWYA 2C3LA 1QCFA 2JGZA 3DA6A 3R7GA 4V0GA 3BU3A 3AD4A 2R3PA 2VWZA 1H28A 3KRRA 2RG6A 4QTDA 5BYYA 4D4VA 4IAYA 4U41A 4HYSA 4EZ3A 1UVRA 3EFKA 3FSFA 2BZJA 4GCJA 4OW8A 4BY9E 3GQLA 4QD6A 3OTUA 2VV9A 1DS5A 4WNMA 2FSTX 4KSQA 5EK7A 4JT3A 5M57A 1Q97A 4FKRA 4WUNA 5M53A 4ZSAA 1ZRZA 4F7NA 3FLSA 3LZBA 3MYGA 4FZDB 4JBVA 3OWJA 4W8EA 5FP5A 5K5NA 3IW8A 4JX3A 3GOKA 3C7QA 2G2IA 3AT2A 3C4XA 3IO7A 5JFWA 3D9VA 5DT3A
chains in the Genus database with same CATH superfamily
5D7VA 4OLIA 3IECA 2GFCA 2VN9A 3ML1A 3G33A 1Q8ZA 2PUUA 2BILB 2YIRA 4FV6A 3AD6A 3ROCA 2VTTA 2WQOA 1Q4LA 3MI9A 3DKFA 4DFNA 1U4DA 2W5HA 4O0YA 3D2KA 4R78A 2WNTA 4PP9A 4U43A 1ZYDA 1AD5A 2AQXA 2W0JA 2W1GA 4O7WA 3ZFYA 5C4LA 5FXRA 2PMOX 3QGYA 4XMOA 4ANSA 4IBMA 3R71A 5JEBA 4RJ3A 4FKQA 3PZHA 3R7UA 3UZTA 2J0JA 4NH1A 5EDQA 3HMIA 4WKQA 3WBLA 4K6ZA 4DA5A 5J8IA 4JG8A 3K54A 3S0OA 4C4GA 4KIOA 1IAHA 3G0FA 3WE4A 2PVRA 1PXJA 4CKIA 4EUUA 4ASZA 3KCFA 4I21A 1JWHA 5E8UA 3A4PA 4JRNA 5BVFA 3HNGA 1YWRA 3TM0A 3BYSA 3PG3A 1OPKA 4J99A 4RIYB 4FSUA 4UV0A 1R0PA 2JD5A 1W84A 3II5A 4O2ZA 4QP7A 1H01A 3B2WA 1IRKA 4EQCA 4HGTA 4GS6A 3BYUA 1Q41A 4IXPA 4XOZA 1PYXA 2F57A 3FHRA 2I0HA 3PIXA 3C9WA 4BF2A 5HESA 2H9VA 4GT4A 1FGKA 4R6VA 3UDZA 4L46A 4RIXB 2WIHA 3WILA 2QR8A 3R73A 1YVJA 2R3JA 1WCCA 4U40A 2PULA 4DC2A 2E9OA 3F66A 2G2FA 3QYWA 3GU6A 3AC5A 3GCSA 5CU4A 4ZY6A 3QZHA 5TR6A 4ANOA 2PVHA 4AW2A 4IZ7A 4R1YA 3PYYA 2QOBA 4KRDA 4D2SA 2X0PA 3BLRA 5CWZA 2PUIA 4IEBA 4FI1A 2FH9A 4NSTA 4I5CA 4W4XA 2XVDA 3F5PA 4IVCA 3GI3A 3HA8A 4LOQA 3IW7A 2Z7LA 4MD8E 4QQJA 5KZIA 3R8LA 3TNQB 4HCUA 4L45A 4C62A 5IA2A 2YCSA 2XIKA 5D12A 4KS8A 3W10A 4E93A 3FMMA 4CQEA 2YABA 2CKOA 2PVYA 2FSLX 2J7TA 2H6DA 3FJQE 3WI6A 5HG8A 4DLIA 5CEPA 2QOOA 5EW9A 2ETKA 2A98A 3PUPA 4RX5A 2QHMA 1OKYA 4YC8A 4GK3A 2Z7SA 1BKXA 3Q3BA 4RX7A 2IW6A 3I1AA 2XNGA 4Y5QA 3RMFA 4S31A 3Q2MA 4NT4A 4YU2A 3R7IA 4AQCA 2OXXA 5M06A 2W5AA 4TTHB 4J95A 4JQEA 4UALA 4TYHA 5AJQA 5H8BA 5JGBA 3CQUA 4G9CA 3QQFA 4X0MA 3OXIA 5EM7A 1GZOA 3U4WA 1IAJA 5LCJA 3UDSA 5LCKA 4XG3A 1IG1A 3LM5A 3IKAA 4NJDA 4BCHA 2VO6A 5CU6A 2HZNA 3EN6A 1UA2A 3HVCA 5L6WL 4MD9E 4EEVA 4EL9A 4IAZA 4FBXA 4TXCA 3EKNA 3UTOA 4KIPA 3SD0A 2FUMA 3BYOA 4FG7A 4FUXA 1JSVA 2UZEA 1ZOHA 2HZ0A 5JT2A 1JSTA 5IISA 1JQHA 2QOQA 4WSYA 1PXIA 2NPQA 3SOAA 4YTCA 1OBDA 1V0OA 5AR8A 2OG8A 3FLYA 4OAVB 4QNAA 4MUQA 3DJ7A 1HOWA 4RZWA 2UZVA 4QMWA 2QU6A 2XNPA 3EYGA 3IDBA 4NWMA 1PXKA 2ITXA 3KN5A 3R30A 4FKJA 4AW5A 1JOWB 4QMQA 4O7ZA 4IJPA 4WIHA 3IW6A 4M12A 5E1EA 4ASEA 5C1QB 3MB6A 3ZS5A 3PXFA 3UC3A 3T9IA 4DG0E 3AC4A 5JZNA 1W83A 2XIRA 5CLPA 3WF8A 4CFWA 3EQFA 4YJTA 3UODA 3K5VA 1T46A 2BR1A 5ICPA 5J1WA 4YBJA 2WTDA 4ACHA 3WF5A 2CCIA 3L1SA 5EM8A 3QTUA 4L42A 2V0DA 2PZ5A 4RC4A 2OK1A 3LQ3A 4O4CA 2IEWA 3BYVA 4O1OA 4J98A 4MTAA 1JNKA 2NO3A 1YHVA 5D10A 2ESMA 5IUGA 3V8WA 3IOPA 4D0WA 3EN9A 2AC5A 3RP9A 4IC8A 5E8XA 2HZIA 5GJGA 4E1ZA 4KBCA 3MVMA 5JH6A 4RA5A 4Q9ZA 3R9RA 3RHXA 3OW3A 4AZWA 3ORTA 5IH5A 3ZOSA 5JMSA 3HV3A 4M8TA 3FQEA 4ZP5A 4F70A 5TT7A 4QPMA 4BRXA 3GC7A 4WG3A 3FSKA 5AX9A 3V5TA 5IG1A 2BHEA 3VC4A 3QYZA 4A9TA 2YERA 4I94A 3UO4A 2I0YA 4FT5A 4TWOA 4XG4A 5DHJA 3M1SA 2UZTA 5C8KA 4JDHA 4PWNA 5J1VA 4JXFA 1NVRA 3ROYA 2W9FB 5G6VA 2XNEA 3HV5A 4EK4A 4UMUA 1PW2A 2JLDA 3BHUA 3ORIA 4F6WA 4IB3A 3QCQA 5EQEA 4AGCA 4O38A 2C6LA 1H25A 2VGPA 5DRBA 4CEGA 3LFAA 4FZ7A 4M0ZA 4ZTQA 5LARA 3U51A 4FSZA 3EZRA 4FTOA 4YHFA 4BHNA 1ZOEA 1LUFA 2VTAA 4FTCA 4NTSA 4DEGA 2FGIA 2OZAA 3KA0A 5CEQA 3TKUA 1STCE 4K77A 3DBFA 4NCTA 5AUZA 3NX8A 2BKZA 2OXYA 5E91A 3NW5A 3BGQA 3VN9A 4I1ZA 4BCFA 2WB8A 4IVAA 4EJ7A 1O6KA 4DH1A 4G3FA 4EQUA 5EOLA 1XH7A 3B8RA 4RMZA 3WZEA 1YOJA 4O86A 4MK0A 1ZYLA 3H9OA 4MBIA 3ITZA 4GVAA 1RW8A 4FV5A 4HGLA 1Q3DA 2FVDA 4XEYA 4YJVA 5EM5A 4BCIA 3E63A 2WMUA 5D11A 4RVTA 4QTAA 4K18A 3GC8A 3CCNA 3CGOA 2H34A 3ORLA 1H26A 4XH6A 1W7HA 4FV4A 4FV8A 4CZUA 4DGNA 4FKIA 5CSVA 3RPSA 4FUYA 1WMKA 4YZ9A 2OICA 4AXCA 3NVMB 4TW9A 4CV9A 3RAHA 5LVNA 4I20A 4F0GA 4O0WA 5ETIA 3O8UA 2YZLA 2CGVA 3KGAA 3NVKI 5IQHA 5AADA 2A2AA 2CSNA 3MH0A 4QO9A 4IDVA 4RBLA 5AUVA 4FTNA 3WF7A 3OCTA 2OJGA 5J9YA 1YDSE 2W4OA 2NYAA 4DT9A 1YDRE 1XMLA 1WVYA 4ZZOA 3GENA 4BR3A 1GY3A 3FXWA 2XJ0A 4NKAA 3UE4A 4DGOA 3D94A 2BTSA 3U9CA 4CFFA 4A9RA 2YAKA 3EFWA 4BDDA 5FEQA 5JGDA 3SG8A 4I22A 2A1AB 4PMTA 3SV0A 4GT5A 1CM8A 4JBOA 3W0OA 3IDPA 1BI8A 1JAMA 1KE9A 1WBTA 2PZYA 4RC3A 3W2QA 3A8XA 1H07A 3BGPA 3BZ3A 2X4ZA 5I9YA 3HAMA 1ZZLA 3TZMA 3DXQA 4MYGA 2GSFA 4XRJA 3TCPA 3LLAA 2XJ1A 5AP3A 4FSRA 4O22A 3LXLA 5A6NA 3IONA 4QP2A 5AUXA 3BRBA 5A3XA 2OH0E 1OUKA 4G17A 3DPKA 2PWLA 3R83A 2WTKB 4GIIA 1J1BA 1TZDA 2WKMA 1ZWSA 3DQWA 4RWKA 1XJDA 3PXQA 3QWKA 4FV2A 2X2LA 5I9UA 2QONA 1PMUA 3GGFA 4PRJA 4ZK5A 4BKYA 5J7HA 3SOCA 4ANQA 1S9IA 2X9EA 4EH2A 3GNIB 3ZRLA 1XBAA 4QMOA 3ZMMA 4D1SA 2GS2A 4EOLA 4YNOA 2W7XA 5TO8A 5AWMA 2VX3A 3QRJA 5BYZA 2PUNA 3FLNC 2O0UA 2YIXA 4EI4A 2HY0A 2P4IA 4CZYB 4XNEA 3C4ZA 1H0WA 4U9AA 4A07A 4R8QA 4AW0A 2GNLA 2QG7A 3TYKA 2QG5A 3L9MA 3PJ1A 3W18A 3Q96A 4GYIA 4RLKA 4Z3VA 5DA3A 3VUMA 4IB0A 2WU7A 3KMWA 2CGXA 3KXGA 4CNHA 4O0RA 1FINA 2J6MA 3MY0A 3KIOC 3R1YA 4O0UA 4D9TA 3NCZA 1JBPE 4QMMA 5E8ZA 5AFVA 2PMNX 3Q4CA 4H36A 4IE9A 4RWJA 4AACA 2J0KA 4AS0A 4BZNA 3PXKA 3EB0A 3UOLA 4NZWB 4WNOA 5FDPA 5JN2A 3OBGA 4UMRA 4EBWA 3L8VA 3FE3A 2IPXA 1KE7A 1ZYCA 1GOLA 2QOKA 2ZAZA 2I7QA 2Q0NA 5DG5A 3VBXA 3QUPA 4IQ6A 4UMQA 4MF1A 2IZRA 4MXOA 4ITJA 5AP7A 5AR4A 4IAIA 2YDKA 3AGMA 3LCOA 3V5QA 4XBUA 4EOMA 4UYNA 2VTOA 2YDIA 5I0BA 2R3HA 2C1AA 2ERKA 3DBDA 4HVHA 4C0TA 1TFFA 4GFMA 4HVIA 2YJRA 3KF7A 2QLQA 4L8MA 4M15A 4F4PA 4CV8A 4CRLA 1SM2A 3BBTB 4IX3A 5KNJA 2VNWA 3ZSIA 5I5ZA 1Q8TA 2VNYA 2B7AA 4E4MA 4JBQA 2A0CX 5E92A 5J5SA 2PU8A 3BLAA 4GJ2A 4GUEA 4MXCA 4NW5A 3VHEA 4DINA 3COIA 1U59A 5EQPA 1OL7A 1TQMA 3LFBA 5E7RA 1ERKA 4RRVA 4BC6A 3KC3A 4O83A 2RG5A 4GEOA 3RPOA 2R2PA 2B9JA 4RJ7A 3KEXA 5DR6A 3NZ0A 4IX5A 4D4YA 3I5ZA 1ZZ2A 2RFSA 4CKJA 3RCDA 3WZDA 3SAYA 3TKHA 2XIZA 3QQLA 4HPTE 4BTKA 3NS9A 4NIFB 2ZV2A 3ORNA 5EYDA 4CVAA 1L3RE 3RNIA 2J0LA 4EHEA 4APCA 4O4EA 1OMWA 3AKLA 5IUHA 2BFYA 3FYKX 3T9TA 2JKKA 3D7TA 3LHJA 1LR4A 3EQBA 1ZY5A 2V7OA 5DPVA 5B2LA 4UBAA 3HMOA 4XG9A 4FYOA 5J7BA 4L3PA 3SXFA 1RQQA 5CQUA 1QPDA 4BDKA 5M51A 1MQBA 2P0CA 4YP8A 1NVQA 1YXTA 4L67A 3MESA 3QKMA 3OEZA 3VUGA 2WTJA 4LV7A 4I5PA 2AC3A 3VULA 2XRWA 1H0VA 2VTNA 3ACJA 3ZU7A 4F9CA 3ZFXA 4YSMA 2J51A 1ND4A 1H08A 1M14A 4F1MA 5IF1A 3Q9WA 1XHAA 4QYYA 5IA0A 4U3YA 4NL0A 1GZ8A 2V22A 4EKKA 4EQMA 4K9YA 4OT5A 4FIFA 1PXPA 2E9NA 5EW8A 4ACDA 4OTPA 5AUYA 5CXZA 3MJ1A 2C3IB 3D7ZA 5C8MA 1B38A 2W4KA 4NTTA 4Q2AA 4U6RA 5DT0A 3OW4A 5M44A 3UPZA 3K2LA 3P5JC 4FIEA 5A46A 5CZIA 4EZ5A 3ZM9A 1M7NA 5HD7A 5KMJA 5F4NA 5DNRA 4Z16A 3EN4A 4IZAA 4DFZE 4M67A 5K5XA 2QO2A 2R9SA 3RCJA 4JNWA 5AMNA 5IMXA 2ZVAA 3CTHA 3E7VA 5BUJA 3FLQA 3WOWA 2F7ZE 1YXXA 2CHLA 3CTJA 3QC4A 1G5SA 2ONLA 2QURA 4O7YA 5E9EA 2XYUA 4C02A 4YC6A 3FY0A 3RI1A 3MVHA 5JQ5A 4DHZA 4GU6A 3Q9YA 4CZTA 3TDWA 2GNFA 2PTKA 3BQRA 4ZTMA 4RFMA 5HTBA 4FMQA 4PMSA 4QEBA 4PQNA 4X6RA 1R1WA 4EOSA 3ZLSA 2R0IA 2HY81 3KY2A 3F7ZA 3NNUA 4ZTLA 4WG4A 5J5TA 4IJ9A 2XK7A 1K9AA 4DDGA 5CF8A 3ORPA 5DFPA 5L2WA 4O6EA 4AOIA 4DF3A 2HZ4A 3F6XA 2XNOA 4H39A 3UIBA 3DJ6A 2RIOA 4CD0A 2B52A 2YM7A 4U81A 5IQDA 4YJSA 2VTJA 2BZKB 3O96A 4MF0A 5TOZA 2WO6A 4A4XA 4L43A 5BUIA 4DT8A 4IACA 4X6QC 2OFVA 4NUSA 5M07A 1B6CB 4QTCA 2R3IA 1O6LA 3KXMA 4RIXA 4CMOA 3N4VA 3ZTXA 2H96A 2XKFA 1XH4A 1MRVA 2C3KA 3FQHA 3B2TA 2YCQA 5CSXA 3ZC5A 4NYEA 4FV0A 3A4OX 1KOAA 3RAIA 5HOAA 2R3NA 2WQMA 2QU5A 3ZEPA 5HQ0A 3W16A 2Y6OA 1VZOA 4JVGA 3BU6A 4LL5A 4DEIA 4KRCA 4DHFA 2CKQA 2X0GA 2JDRA 3C5UA 3O0GA 3ODZX 4MWHA 2ERZE 3OP5A 3CC6A 2JAVA 4XOYA 3T3VA 5TF9A 2EB2A 3CPCA 3TKIA 1J7IA 3PJCA 3FKOA 4PMPA 4PV0A 3GBZA 2IVUA 4WA9A 3OWPA 3LQ8A 4U8ZA 2CMWA 5CVFA 3BHYA 4Z9LA 3BKBA 5K9IA 4F0IA 3ID6C 3WIGA 4MH7A 2DUVA 4D4RA 3KREA 3SLSA 5CF4A 3SGCA 2WEIA 3BL9A 3TZ8A 5AIRA 3MTLA 4FZAB 3Q5ZA 3MPAA 3AC3A 4FV9A 5FXQA 2GS7A 4XJ0A 4C61A 4LRMA 5CXHA 2GTMA 4Y5HA 3ENHA 2I0EA 2ITNA 5LVMA 2WQBA 4DH5A 3VIDA 4XG6A 3I7BA 4F9YA 4KKGA 4YTHA 3I79A 4FIGA 4QPSA 4E3CA 4FL1A 4FX3A 4JQ7A 1PJKA 2UV2A 5IH6A 1EH4A 3UOHA 3F7WA 2JDOA 5CQWA 4RVKA 2XAOA 4PUZA 2F49A 3FDNA 4JL9A 2BRBA 2IWIA 3F9NA 1FBNA 3S4QA 3MV5A 1OI9A 4P5ZA 1ZLTA 3HKOA 5AP6A 3VONA 2J5FA 4XV3A 4ZS0A 3QTZA 3VS5A 3MFSA 3NDMA 1DI9A 3ZBFA 1Q5KA 4DCAA 4QMPA 1JKKA 2ZM3A 3VQUA 3PWDA 4UYAA 4D9UA 1GZKA 3R2BA 3TN8A 4AXEA 2UW8A 4LGDA 3PVGA 3OWLA 1WBVA 3QQUA 5JFVA 4CXAA 3CLYA 4NW6A 3ZZWA 3PFQA 3RKBA 4LV8A 2BAQA 5H2UA 3MTFA 3LFEA 3P23A 3ZFMA 4FT9A 3KN6A 2DYLA 1TQPA 3O7LB 3E3BX 3CKXA 4U3ZA 1SMHA 3R9NA 4QNYA 3ZRMA 1OL6A 3VBWA 3KCKA 1MQ4A 4ZJVA 4EC8A 3MH3A 5EYCA 4E4LA 5CAUA 1PXOA 3KRWA 5LJJA 4C8BA 2ITPA 4OUCA 4R3PA 3UNZA 4KBKA 4I6FA 1VLRA 3QTIA 4YNEA 4LDTA 1QMZA 4FYNA 4TWNA 3BE2A 4NM5A 1UNGA 4YHJA 3FMEA 3NIEA 3C1XA 2F7EE 3E8NA 2UW7A 3POZA 4IMYA 4JLCA 4QP3A 1ZXEA 5C8NA 4GKHA 4WNPA 3DBQA 3TTJA 4RX8A 4K33A 5HBEA 2CLQA 3V04A 3ATSA 4FODA 4IADA 3ORXA 4Y72A 1XR1A 4M68A 3D0EA 4RSSA 4BKZA 3GFEA 3W2PA 2XNMA 3JUHA 1A48A 3LFCA 2XJ2A 2ZB1A 4CSVA 2ZDTA 3NFFB 2ACXA 5I9WA 2W9ZB 1H1RA 3E88A 3TT0A 4FKVA 2R3KA 4BL1A 5HX8A 3HV6A 3DNDA 4X2GA 5C01A 5BYLA 1VYZA 5IQIA 4CKRA 4RT7A 4NU1A 2XANA 4Z7GA 2W1DA 3RHKA 1PHKA 5J95A 4LV5A 2R3RA 2O64A 5CU2A 2YLFA 4BI2A 4CCUA 3F82A 2ITVA 2OLCA 2V55A 1J91A 4MNEA 4W4WA 2OFUA 5HGIA 4CYIA 4KWPA 2OF2A 4BCKA 3L9LA 3QUEA 3DKOA 4YZBA 5HTIA 4QQCA 1ZY4A 4GFGA 3LM0A 5A9UA 3EOCA 1U54B 3KK9A 4FKSA 4YZDA 3FC2A 4FTJA 5E8TA 2W4JA 3BEAA 3GCPA 2CN5A 3M11A 3UO6A 4EH6A 3ZSHA 4F0FA 5EI2A 4F08A 1SNUA 4QMTA 3E8DA 1ZYJA 2QI8A 5T3QA 3CEKA 2OI4X 3UMWA 5E4HA 4IFCA 4QT1A 4EH4A 3EL8A 3BIZA 2VGOA 4YTIA 2XH5A 4DGMA 3BEGA 4HW7A 3OT3A 3CJFA 4DEEA 3AKKA 1FGIA 3PP1A 1BYGA 1YXUA 1JKTA 5HX6A 4ZSJA 4FSMA 4RIWA 5FXSA 1F3MC 2P2HA 3BLHA 3JVSA 1SVEA 4K1BA 3FZTA 3SRVA 3QD0A 1QPEA 4FKUA 3BWJA 3EN5A 3NLBA 2C0TA 2HENA 3W2RA 4F65A 5AIKA 1G8AA 3C5IA 1KV2A 3V5PA 4DH7A 2J5EA 4I6QA 2YM5A 4KKHA 2DWBA 4O21A 3JR1A 3SXSA 3ANQA 3OY3A 3DZOA 3WF6A 3BV2A 3O71A 2OO8X 3EQDA 3ZLYA 2JITA 4XS2A 4O91A 3ZONA 3HGKA 2WELA 3QZFA 2YACA 1Y6AA 5L2SA 3R02A 3ZDUA 4FTMA 1JKSA 1ZYSA 1Z57A 5IDPA 3K5UA 3GB2A 2LGCA 5L8JA 3M2WA 5M09A 4G6NA 2X8DA 3FC1X 3PLSA 4V04A 1H27A 2JKOA 4Q5HA 3O5AA 4GG7A 4AOJA 3VW6A 5LMBA 3EIDA 3QKLA 4B8LA 4C3PA 3PXRA 1NXKA 2WMAA 3U6IA 3CQWA 4GUBA 3RVGA 5CAOA 3OXTA 4AT4A 2OSCA 3NYVA 4YPDA 1BUHA 4DEHA 3ENMA 5IPJA 1V0BA 3PWYA 3ZXZA 1H4LA 3A7JA 2XA4A 4HGEA 3BX5A 3IW5A 5KZ0A 5EDRA 4FZFB 4AGDA 5L8LA 5GINE 3A60A 3MFRA 4LUDA 4DTKA 4N6ZA 2R3LA 4I5MA 1P14A 1FMOE 5AV1A 3L9NA 3QLFA 5FEEA 3RPYA 4J1RA 3ZBXA 1IEPA 4XHKB 2RGPA 2VO7A 1FQ1B 2XBJA 5GZ9A 1PKDA 3ELJA 4EYMA 4E5WA 4R7HA 4QTBA 2HW7A 2ZMCA 1H1SA 1E9HA 2OJJA 3FMLA 3DKGA 5ANOA 1YHWA 1O9UA 2XS0A 4PTGA 3SW7A 4O96A 4LG4A 2UW6A 5HVYA 2B9FA 4IZ5A 3QC9A 4U42A 2WQNA 1MP8A 1W98A 4QYFA 5M4IA 2BRHA 3E92A 3HV4A 3NW7A 4PDOA 5CEIA 4BI0A 1G8KA 3D5XA 1LP4A 4M14A 1J3HA 3GU4A 2E2BA 3LCKA 4HVSA 3VQHA 4ZMFA 1HCKA 3QHRA 3TUCA 1W2CA 4FV1A 4IVDA 4J8MA 5BVEA 2X7OA 3E7OA 2BKKA 4F9AA 2HXQA 3HA6A 2Z8CA 2EVAA 5I9XA 3DFCB 4A4LA 2C0IA 1URWA 5BNJA 3OCSA 1L8TA 2C68A 2WMQA 1MUOA 5BQ0A 3PFYA 2CKPA 3DK3A 4C58A 1Q8WA 1WAKA 2F4JA 3COMA 4O0SA 4FGRA 4CFNA 2YN8A 1YOMA 2BHHA 2GU8A 3KU2A 3PSDA 4MEDA 2HCKA 2V7AA 5AA8A 2UW5A 3QF9A 2ITQA 4FICA 3LMHA 3L8SA 2C5NA 4W4YA 3F3WA 4G6LA 4MXZA 3KFAA 2YIQA 5FM2A 4J53A 4FR4A 1FPUA 4AN9A 2XYNA 2GHMA 4TN6A 2UZDA 3UDTA 3VS0A 4ZLYA 4BB4A 4XG2A 2BAKA 2PHKA 4U45A 4KAOA 3IGGA 4QP8A 5CEOA 4FA2A 5B2KA 4FG8A 5HIEA 2I40A 4DFLA 2F2CB 3HZTA 3QQJA 5L6OA 4W4VA 3U6HA 1HCLA 5CI7A 3EZVA 2OKRA 3ALOA 4AGUA 4BCNA 2WEVA 1FVVA 1CSNA 5GIPE 2NP8A 1LPUA 4ERKA 5IEVA 2WOTA 3TWJA 2FSMX 3W8LA 3RWQA 4D2PA 4DFXE 3QD4A 1OBGA 4QP1A 5KCVA 3CXWA 3MW1A 3PUFC 2WMXA 2W1ZA 4DN5A 3QRUA 4C38A 3PG1A 5HO8A 3IDCA 4ZLOA 4PL4A 2OJ9A 2PE1A 2UZWE 2G2HA 4M69A 5HE1A 5AUUA 4BDEA 5DYJA 3DBEA 2WGJA 2FYSA 3D83A 1G8JA 3H3CA 2QD9A 5HIDA 4EOQA 5CAQA 4X3FA 5LMKA 1CKJA 2CNQA 3RZFA 4LOPA 2BCJA 5BMSA 2GPHA 2ITOA 3POOA 2JBOA 3MB7A 1CTPE 4MBLA 3ODYX 3CQEA 3EQHA 3OWKA 2C6MA 3CP9A 1OPJA 1IASA 3DB6A 1T45A 4LRKA 5HO7A 2BIKB 2R3QA 3HEGA 4AGWA 3MFTA 4PY1A 4E5AX 4ERWA 3RGFA 2A19B 4FKOA 5AR3A 3N4TA 4IFGA 1PYEA 4CLJA 3PPZA 3QD2B 4U44A 3UP2A 4YJQA 4FTIA 1KOBA 2YIWA 1NT2A 3ORZA 1OKZA 5IDNA 5LWMA 5DR2A 1BX6A 4BCGA 1E1XA 1P5EA 4E6DA 1NY3A 3ZUVA 5A14A 3VBVA 1UNLA 2B54A 2BVAA 5EH0A 1NW1A 3EKKA 3NUXA 1M2RA 5EM6A 1I09A 4FIIA 3GXLA 4DG2E 3RPRA 1LEWA 2IZSA 2NRUA 2PVLA 3E64A 3ULZA 3ZYAA 4EK3A 2VTPA 1H00A 3UOKA 3CPBA 1R39A 3L8XA 3MWUA 4MNFA 5AR2A 3FI4A 1TVOA 2C30A 1OIRA 4PPAA 3VRZA 1GIHA 2Y4IC 3N4UA 2ZV9A 1JKLA 2C6IA 2WFYA 2ITUA 4PNIA 5DBXA 5AV2A 5BVKA 3VBTA 5BVNA 5IQFA 3TUDA 2JEDA 1W82A 3IOKA 3A7HA 3RM7A 4CGAA 4P90A 3BHVA 2WMTA 5BVOA 4OTWA 3JS2A 4D1XA 4BCQA 3AOXA 4C3RA 5IQGA 4NJ3A 2YISA 3EQIA 4U97A 4HVDA 4Y73A 2UW4A 3RM6A 2VWWA 4LL0A 5KUPA 2CGWA 1YW2A 3OXZA 2BRGA 3ZLXA 4R77A 4RFYA 3UP7A 3IG7A 3W8QA 4GU9A 5HZNA 4A9YA 2VWBA 4QP6A 3TACA 4RLLA 4TZRA 4BDIA 4FK3A 4NM0A 4QMZA 4FTTA 2C5YA 4OTHA 2VX1A 4ZZMA 2RF9A 1ZAOA 4GH2A 4QP9A 3H10A 4ZOGA 3C4EA 4E73A 4C4FA 1BLXA 4O0TA 4QTEA 1KWPA 3DFAA 4IZYA 3BCEA 2XEZA 3TEIA 4A06A 4E5BA 2YEXA 3C0GA 3NFGB 4FOCA 2ETMA 3R1SA 2E9PA 3Q6UA 4XP3A 4GV1A 1QPCA 4BIBA 2BZHB 3ZO3A 5AR5A 5AM7A 5HLPA 3MIYA 4TL0A 1F5QA 1KSWA 4FT3A 1GJOA 4M0YA 3NW6A 3AMYA 4K2RA 1M7QA 2P2IA 3ERKA 1XH9A 4RJ6A 5DT4A 4EHZA 3HDMA 3Q4TA 4LGGA 3NSZA 2G1TA 3DAKA 3TIYA 4OTRA 3W0RA 3LE6A 5ANKA 3AMAA 1REKA 3WZJA 5DEYA 2C6TA 2B55A 5L3AA 3DB8A 5IKWA 3ZUUA 5M4FA 2YCRA 4B99A 3FZPA 4FKWA 3F3TA 5AAEA 5HIBA 4CFXA 1XMMA 3RAKA 3DS6A 4FSQA 2QC6A 4K8AA 4UWCA 1W8CA 4MWIA 5CU3A 3F2AA 3R7EA 2WTVA 2ITTA 3P78A 2C6EA 3QD3A 3AC1A 3EH9A 5EHLA 3WF9A 5ITAA 1UU9A 3R0TA 1UKHA 4PDPA 5DH3A 4TNDA 3Q9XA 4OBQA 3HP5A 3NUPA 5T6KA 4APPA 4HYHA 2JKMA 2A4LA 4G31A 5HE0A 2IVTA 4ASDA 3MGYA 4GVJA 5DLSA 4AWIA 4C4HA 3D2IA 4D0XA 5AV0A 5BX0A 4H05A 2W99B 3BBWA 1J1CA 3E93A 4G3EA 3EQRA 3P7AA 3OMVA 2BALA 4A9SA 1BI7A 4YBKA 4F64A 4D1ZA 3E87A 4E4XA 3I81A 2GNJA 4ANLA 4HYUA 4AA4A 4RQVA 3ZO2A 4B7TA 5AX3A 2IW9A 3LXNA 2JBPA 3P86A 3FMHA 2HK5A 5KBQA 2F7XE 4O7LA 4BJJA 5IQBA 2XK4A 4PMMA 1AQ1A 1K3AA 3N51A 5KHXA 4I24A 4JS8A 2A27A 5ANEA 4CTBA 5DRDA 4EUTA 3OEFX 1H8FA 2RFNA 3C4WA 3I4BA 5JSMA 5H3QA 3QZGA 2G9XA 1KE5A 2BAJA 5CYIA 3DLSA 3FI3A 3FYJX 4BCPA 3ZHPC 4DEDA 2IF8A 4EWQA 3F88A 4AFJA 4JAIA 4ZSGA 4TYGA 3LJ1A 3V5WA 5JQ8A 4EOPA