2REIA

Kinase domain of human ephrin type-a receptor 7 (epha7)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
296
structure length
277
Chain Sequence
TYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAIKTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLRKHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSAHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ephrin type-A receptor 7
publication title Kinase Domain of Human Ephrin Type-A Receptor 7 (Epha7).
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 277
sequence length 296
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2007-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2reiA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2reiA01
2CSNA 2UZVA 2UZLA 2VTAA 2PUUA 5K0XA 2H96A 1DAWA 4G1WA 3HEGA 2JFMA 4MAOA 2IZTA 4JNWA 4CFFA 4F63A 5H8EA 2YHVA 3FJQE 2BZHB 3OCSA 4CCUA 4ITIA 2HWOA 4X2GA 4AXAA 4DTKA 3BCEA 2UVYA 1Z5MA 3Q04A 4PV0A 2HWPA 3UJGA 2IN6A 5M55A 3MN3A 4FI1A 4RC3A 3BYVA 4XBUA 5IG1A 4DFBA 3DT1A 5CALA 4YJRA 3JYAA 3S3IA 2PULA 1VJYA 3M11A 2KULA 4EKKA 2W1ZA 1URWA 3POZA 2VO0A 3MJ1A 5A4LA 3GCSA 5E4HA 2G01A 3UQCA 3WYYA 1Q99A 4G16A 2UW0A 5CT7A 3TL8A 4AA5A 1XBAA 3U6JA 4FEWA 4D5KA 2WMTA 2GSFA 1JPAA 4LRJA 2YWVA 2BPMA 3R7IA 4QD6A 4CFXA 3VBQA 3MH0A 4O0YA 4TNBA 5A6OA 2NNWB 1XO2B 1A9UA 1P5EA 5KMKA 4YJQA 5DEWA 4L3JA 2BRHA 4C7TA 3ERKA 5LMKA 4M69A 4FNZA 5JZNA 3CY2A 3UVRA 2PHKA 4U43A 3CQWA 4OBQA 4AZEA 1CSNA 4PY1A 5LXMA 4DFNA 2RFEA 3NNWA 4KIOA 3QTXA 4O0SA 4UMQA 5C9CA 4AOJA 5BYYA 5HOAA 5LVNA 2JEDA 5FUTA 1JKSA 3LCTA 4AS0A 4NW5A 5A3XA 2JD5A 2VNYA 3GU7A 2OK1A 3O17A 4JBOA 2GHMA 5DHJA 5FEDA 3FI2A 2Z8CA 3CKWA 4FIGA 5CU4A 3DTCA 1ZYCA 2C6MA 2J4ZA 4IAAA 4TWOA 3W33A 4D4SA 1LEWA 4F7LA 3R8PA 4BKZA 3Q2JA 4HGEA 1RDQE 4L68A 4J96A 3PY0A 2ZOQA 2W05A 3FI4A 4G34A 3LM0A 1MP8A 4OTHA 4BCOA 4L9IA 4MBIA 3A60A 4N0SA 4CYJA 3E93A 3UIUA 4YBJA 4EK3A 4AZSA 1OMWA 3F66A 3FZOA 4S2ZA 5AUUA 4G6OA 3TDWA 4NH1A 5G1XA 5TOZA 5K9IA 5E7RA 1UVRA 4TYIA 3FBVA 4OW8A 4WT6A 4F0IA 2CKQA 4XLVA 1H27A 2Z7LA 3U9NA 4D1ZA 4EH9A 1H24A 2B55A 3PIZA 3ZONA 4YZCA 2O2UA 2W9ZB 5ETIA 4ERKA 1U46A 3F82A 1XHAA 3O7LB 4MXXA 3FZTA 3PZHA 4B8LA 4LL5A 3PG3A 3TCPA 1PW2A 4XG9A 4IAKA 3FHIA 3ZRMA 5EH0A 4ALVA 2BAQA 1ZYSA 3EIDA 3KRXA 2R9SA 1FVTA 3LOKA 3NAXA 4L42A 5A4TA 5BUIA 4FV9A 5KNJA 5IZFA 1MRUA 1MRVA 4HOKA 4HZSA 2UW3A 4O84A 2YZLA 2OIDA 4BHZA 3MA6A 3TV4A 5HLNA 2HY0A 4BYJA 5C8MA 2WO6A 5L6OA 4BDEA 5AIRA 3DLSA 3FYJX 4QP1A 4ZLYA 4LM5A 1OPJA 4FV3A 3RK7A 3FHRA 4C2VA 3A8WA 3UIXA 3N4TA 2WELA 4CTCA 1KUTA 2QKWB 3VWAA 2I40A 2GPHA 3RK5A 4LRMA 4ZAUA 2HK5A 4FIFA 4NM5A 2P0CA 4TYHB 5AP5A 3R9NA 4NL0A 3NPCA 3KK8A 4GJ3A 4BVUA 4JRVA 2X4ZA 4M67A 2XF0A 4I20A 2GNJA 1Z9XA 4JAJA 5ACKA 3TV6A 3TDVA 2QOLA 4QMTA 4S31A 3VJOA 4FSMA 1JQHA 5FG8A 5AEPA 4X0MA 4YJOA 4K77A 4HPUE 2WTKC 4FL3A 4AQCA 1PYEA 1Q8YA 1M7NA 2BFXA 2YACA 3WBLA 3FXWA 3HP2A 4OTRA 4OTWA 4PMTA 4MH7A 4D2SA 4RX9A 1HCKA 5ANKA 5HG9A 2F7XE 5BVDA 5HD7A 5CU6A 4D9TA 5CWZA 3W8QA 4LFIA 2IG7A 4JI9A 3WARA 4XG7A 3KULB 2WEVA 4HVHA 5LMKC 4KNBA 3FMLA 1PXJA 5M4CA 2XUUA 4U5JA 4AACA 4BDBA 1BYGA 4GH2A 3NVKI 3QQLA 4MEDA 4D0XA 1NT2A 4F0FA 1W0XC 2ITOA 3U51A 4C8BA 4IFCA 1GIJA 2PZIA 3O0GA 1WBWA 4I93A 4QP2A 4CV8A 5I9ZA 3Q53A 4JJRA 1YWVA 4QOXA 1JKKA 4X2JA 4K8AA 3F2RA 2QOFA 2ZB1A 2XB7A 3LIJA 3SXSA 5EDQA 1F0QA 2C0IA 1VR2A 2P55A 4I6QA 5KUPA 3OBJA 4DFXE 5HZNA 4O0XA 3NMUF 3OXTA 3KMWA 2GQSA 3QHRA 5BUJA 2VGOA 3DJ6A 4FZAB 3E92A 3TXOA 2UZNA 4ACDA 4KABA 4GG5A 3VS3A 4RFYA 3QD2B 3MTLA 3MVLA 4IW0A 3BHUA 3F5PA 5E8UA 4RJ7A 4WHZA 5A46A 2HELA 3KFAA 5EYDA 1WAKA 5FXRA 4A4XA 5JKGA 1WZYA 3VBXA 4ASZA 2IJMA 5CVHA 4F65A 3IK3A 4FIJA 4GKHA 4RWJA 3R8UA 4EZ7A 2VTLA 4Y5HA 4ZTHA 4EH4A 3F88A 3DKOA 3NCGA 3L9NA 4FKJA 3VUKA 2CKOA 4D55A 5K4JA 3FEGA 4GIIA 4KBAA 4FIIA 2YWPA 5EFQA 3P5KA 5C1QB 1ZYJA 4AN3A 3P78A 4IXPA 2GHLA 2IW8A 4E4MA 4J52A 1MUOA 5BX0A 4HNIA 3CS9A 3ROYA 4XG2A 3AD5A 1YDRE 4FKTA 3TTIA 5L6WL 3EL8A 4A9RA 5CSWA 2GMXA 2W5HA 4UYAA 4EH3A 3DU8A 2R2PA 1OBDA 1NY3A 1URCA 1SZMA 4RFMA 4FTMA 4C0TA 5BVEA 3QQUA 5LQFA 5L8JA 4BI1A 5LVOA 4Y46A 1XJDA 2UZTA 4YR8A 2P2HA 1Y8GA 3SRVA 3WIGA 3LPBA 3WE4A 1L3RE 5HE3A 3VRZA 4BBMA 4Y73A 4CKJA 1VYZA 1DAYA 3EN5A 1L8TA 3CPCA 2ETMA 4QTAA 2RF9A 2O65A 4QTBA 3TTJA 3Q5IA 1BI7A 4GKIA 4A9TA 3MPAA 4O0WA 2IZRA 5DI1A 3TNPC 3UQFA 1PKGA 1KE7A 2NO3A 2PZ5A 1UU7A 5KMLA 3C0IA 2ITWA 3V8WA 2PL0A 4DCEA 3AD6A 3K3IA 5FTOA 3EOCA 3TUCA 2C6OA 3GI3A 2W1IA 4FT0A 2GTNA 4G3CA 3VBVA 3F6XA 3ZFMA 4BCGA 2WTCA 3DJ5A 3Q4CA 5HBHA 2H6DA 1KOBA 4J53A 3RAHA 4E26A 3R7VA 2C68A 4NJ3A 3EQPA 4DF3A 3QZFA 3VO3A 1R0EA 3F3TA 2VTSA 3ORKA 5DRBA 5K4IA 2XS0A 3NVMB 4NU1A 2R5TA 1GJOA 3QTUA 4G6LA 2OU7A 2CCHA 4FTJA 1OGUA 4K9YA 1A06A 3UZTA 3OUKA 3ALNA 4BFMA 2OI4X 3GVUA 4IVCA 3ZC6A 3GOKA 3EN6A 3PXKA 4H58A 3GEQA 5I9YA 4KKHA 3TZ8A 4UY9A 3RPYA 5A4CA 5DWRA 3THBA 3PY1A 2XKEA 4YJTA 4C4EA 3WI6A 4Z7HA 3OXZA 2HCKA 2Z7RA 2UZOA 5F95A 5JH6A 4J7BA 1Y6AA 3B2TA 4BTKA 2R3LA 4FSZA 1QPJA 3BPRA 4QQ5A 5CF6A 3UO6A 4ANMA 4P5ZA 2B4SB 4YSJA 2J0MB 4RIOA 3V5PA 3NIZA 3AG9A 3ODZX 5AV2A 3VS1A 4RVTA 3QCQA 1DI8A 3TKUA 3L8VA 5KE0A 3ULZA 4BGQA 4FOBA 3WF8A 3I7BA 3R1QA 5J95A 4I0SA 2XRWA 5L2IA 5I0BA 2FSLX 4IZ7A 3I5NA 4E6DA 4GT4A 2CNVA 4QYHA 2ZDUA 4AUAA 3VRYA 3QKKA 3NYOA 5FLFA 3FXZA 2NPQA 4GFGA 4PP7A 3PZEA 2YIWA 3COKA 1UWJA 4FK6A 3OCGA 4GFOA 4KIPA 4A9SA 3QXPA 1KE5A 3HMNA 1M52A 2QQ7A 3KCFA 5J79A 4PTGA 2VWBA 4GMYA 3KKVA 4I6HA 4EOQA 1UU3A 3SX9A 4F70A 1O9UA 4L67A 4IIRA 2ZM4A 4E1ZA 2C30A 3RAWA 4G9CA 4BI0A 5DMZA 1OL7A 1ZARA 4HNFA 1FGKA 1OKVA 4KRDA 5KCVA 1ZYLA 3HKOA 4WRSA 2JKQA 2YISA 1IAHA 3E8EA 1R78A 3TWJA 4EONA 4N70A 2HY81 4O6EA 5FQDC 1LEZA 4RZWA 3CBLA 5AR4A 4IAZA 3EYHA 4I21A 2HAKA 1BMKA 4LG4A 4OTIA 4ZS4A 3ZTXA 3SC1A 3Q52A 4ANQA 2I6LA 3VHEA 2OG8A 4EOPA 3ZUVA 3QU0A 2ZV2A 3Q2MA 4FOCA 2WXVA 4D1XA 3FLQA 3OEFX 3GC7A 1JSUA 4W8EA 3Q32A 3R8LA 4BWPA 4X6RA 3F69A 1YOJA 4J95A 1SYKA 4ZSLA 3U54A 4KIKB 3IKAA 5IQFA 4AGWA 5HX8A 4JBPA 2VD5A 4ITHA 3N51A 4Q9SA 2ZJWA 4FTUA 4FTNA 4I41A 4WNPA 3PSCA 4DH7A 3C7QA 4BYIA 4DTBA 3L8SA 3SAYA 3HX4A 4BDGA 3PXFA 1OECA 5J5SA 1REJA 3D2IA 3ORXA 4FSQA 5HG7A 3SG9A 3EZVA 5M44A 3P1AA 5LARA 3U6HA 1WVXA 2OZOA 2WOUA 3LM5A 1H1SA 2PWLA 4C4HA 4DEHA 1WMKA 5IA4A 2QODA 3BHHA 3UPZA 3DGKA 3KVWA 4MHAA 4FT9A 4CLJA 3HMMA 4FKOA 2CLXA 3FQHA 3H4JA 4IB5A 4QRCA 4OTPA 4UXLA 4C61A 5EI6A 4RT7A 4HVIA 2BMCA 3DCVA 3W16A 4BZDA 5AUVA 3C5IA 2IWIA 2VTQA 4FV7A 4BICA 3W2QA 3LXPA 4IMYA 4RA4A 4F9WA 3A62A 1V0PA 2F7ZE 2QLQA 4U40A 4FV4A 5LOHA 3R9DA 3C4FA 4WUAA 3E3BX 2B9HA 3QGWA 5GZAA 2J9MA 1W98A 2HZIA 3NZ0A 3FI8A 3A99A 4UB7A 3PP0A 1FPUA 3NEWA 3MS9A 4ZTSA 3M42A 2UZBA 5J1WA 3ID6C 4AW2A 5KBRA 2X7GA 1LR4A 2BHHA 3ORTA 3ZOSA 2W5BA 3CY3A 2GNLA 3RPSA 2XK7A 3FMKA 2QU5A 4P90A 4IVAA 2DS1A 5DT4A 2QOCA 5FEEA 2XMYA 2BDJA 3KB7A 2IZUA 3KRWA 4E3CA 4YC8A 4C4FA 4MK0A 5M09A 4TYGA 3GUBA 2YAAA 3C51A 4EH5A 3DKCA 2PMNX 4GL9A 4AZWA 3CQEA 3AMBA 5G6VA 2PVMA 4YC6A 3IW4A 3FWQA 3PLSA 3KXNA 4ENYA 5CZHA 3VS7A 1Z57A 3PSDA 1H25A 4IBMA 5BPYA 2R3IA 3CIKA 4JOAA 5FBOA 3QTIA 1U59A 2IVUA 4YZBA 3SGCA 4MXAA 4QTDA 4FSWA 2RFNA 4FKPA 3B2WA 1PXMA 4FG8A 4RJ4A 3D7TB 3LAUA 2XP2A 3MI9A 4FR4A 4MVFA 4OBPA 4FTAA 4RIWB 3LFBA 4DFYA 1KE6A 4DH5A 2Q0BA 4BGHA 2EWAA 1S9IA 4PPAA 4PNIA 4H3QA 5EYMA 2NRYA 2XIZA 4BL1A 1ZMUA 3U4WA 4FSTA 4KS7A 1EH4A 2JIIA 3QZHA 4WBOA 3M1SA 3S2PA 2P4IA 3QA8A 4QMOA 5KHWA 1WVYA 4YC3A 5FDXA 4FZ6A 5CY3A 4ZEGA 4E6QA 3ULIA 3NGAA 1GOLA 5HLPA 4FL2A 4FVPA 4WSQA 5KX8A 1QPDA 4ACMA 3BE2A 4G3DA 3CSVA 4XP3A 3OWKA 4AW5A 3CTJA 4EI4A 4D2RA 4S32A 4IC8A 2ITYA 1Q3DA 2HXLA 3PJCA 4O22A 3UYTA 4FKUA 2GFCA 5J7HA 4XH6A 5HE2A 3G2FA 5GJGA 3C0GA 5FEQA 4I5PA 3VF8A 1H8FA 4NJDA 4YNEA 2OLCA 3BV3A 4D4VA 4PMPA 3ZDIA 5CZIA 3UOJA 5A4EA 2QO7A 3RCJA 3BBWA 4CEGA 4Z9LA 4AT4A 3N9XA 5KMOA 4O27B 1PXPA 3E8NA 2WGJA 5LVLA 3FMDA 3RAKA 4TWNA 2HIWA 4FGBA 1IA8A 5IUHA 2AC3A 2A27A 4RFZA 2QLUA 4X2KA 4F0GA 3JPVA 4LGGA 4I3ZA 3KGAA 3ALOA 2JDVA 2VTTA 3U4UA 4YGAA 3SD0A 3OZ6A 2EUFB 4JL9A 3BI6A 3PE2A 2J0IA 4FEQA 5AP2A 4O86A 4CXAA 4UWYA 5JN2A 1OZ1A 2DYLA 2QOHA 2V55A 4KSPA 5AP4A 4RC4A 4EYMA 3HVCA 3JVRA 1TKIA 3UIMA 2FH9A 2PMIA 5HIDA 4NUSA 3RJCA 2WMBA 3QTSA 5FP6A 5IA5A 4ASDA 4BCNA 1PXLA 3L9LA 3UO5A 4FSNA 2J0KA 5GIOE 1R39A 2J0JA 4M14A 3DPKA 3NUYA 4TN6A 2C5VA 4B7TA 3ZUUA 5ANJA 4ASEA 2WTVA 3BYSA 3FSFA 3BEAA 3VUGA 1HCLA 2OICA 3LCDA 3ZZWA 2YLFA 3OS3A 4QQTA 2X7FA 3FDNA 3LKMA 4QPSA 4IVBA 2W99B 3R2YA 5EKOA 3VJNA 1H00A 4IACA 5HI2A 3VVHA 3WZJA 5IUGA 3L1SA 4HCTA 4HVSA 4BDIA 4MXCA 2OJJA 1YDSE 3KK9A 2F4JA 4WKQA 2X9EA 5ETAA 3VNTA 3Q9WA 5HKMA 2QHNA 1Y91A 4TYEA 4DC2A 3EQHA 3P08A 2ERZE 3LXNA 3UODA 3ZO4A 4LGDA 5IPJA 1Q3WA 4ZMEA 3MY0A 1XWSA 4FIEA 1H1WA 3IONA 3OTUA 1G5SA 4KBKA 3PVUA 2OIBA 3JS2A 2GNGA 2R0UA 1OB3A 5FM3A 4F6UA 3JY0A 2GS7A 4R5SA 1REKA 2C6KA 4NCTC 3EKKA 2F2CB 3LJ2A 3TZ7A 3KMUA 3OVVA 3QTZA 2HZ4A 4UN0C 2QG5A 3CR0A 3LE6A 3NYNA 5H3QA 4W4YA 1JSVA 3QX4A 4TPTA 4EH6A 1PMUA 4Z55A 3QTQA 3UDBA 4XCUA 3KREA 3NLBA 4FZDB 4PMSA 4AF3A 5JRSA 5AP7A 4IZ5A 4PMMA 3K2LA 5CXHA 3G5DA 2BVAA 3DBEA 1CMKE 2CLQA 2VNWA 4BB4A 4D2PA 3ZFXA 3ZM4A 3HMPA 3OOGA 4I6BA 2QURA 2R3JA 2OIQA 2QR7A 3ANRA 4U44A 4ANLA 3GBZA 4H3BA 3HV3A 3QZIA 2BUJA 4OGRA 4TNDA 4D28A 2C47A 3OMVA 4PWNA 5BYZA 2QHMA 4E93A 4F1MA 2YN8A 4H05A 1PMEA 2RFSA 3LFQA 5CEOA 5DR6A 5DNRA 2W0JA 5FXSA 2XKCA 4EWHA 3LFCA 2PMOX 4TWCA 4XP0A 4TW9A 5EYCA 4OBOA 2JDOA 2PVLA 2W4OA 4IDVA 4X7QA 2WPAA 4FBXA 3PTGA 4NIFA 3PJ3A 3C4ZA 2YDJA 3I1AA 4AOIA 4RVMA 3TI1A 3FUPA 3O51A 3ETAA 5CAPA 4O7ZA 4F7NA 4YURA 3R7UA 4X3FC 2XNEA 2FSOX 3EKNA 3TM0A 2G2HA 4M12A 2BFYA 3FI3A 2GS2A 2QR8A 1FVRA 4WSYA 5AV3A 1CDKA 3BLHA 4G5JA 1UKIA 3KMMA 4L8MA 1M2PA 4JIKA 2ZVAA 2J51A 5EK7A 5IEVA 4CQGA 5IH5A 4F1TA 4A9YA 4DH3A 3PXYA 3G33A 4OAUC 4O21A 4NM7A 3SXFA 1YOLA 3KL8A 4DE4A 2LAVA 1APME 3ZS5A 2PE2A 5CU3A 4IANA 1NA7A 4AGUA 4GFMA 3U87A 4FK3A 1TQIA 4BF2A 3GU8A 3QQKA 4DITA 5EDRA 5KKRC 4C2WA 4M7IA 1RW8A 4RQKA 2VTPA 4R6VA 3IDBA 4UYNA 4EK5A 4II5A 3SLSA 4DLIA 2ESMA 5HE1A 4CSVA 3FMHA 5IQAA 1FMOE 3DZOA 4YBKA 4D2WA 5DYJA 1YXXA 3B8QA 2YJRA 4UMTA 4U41A 3DFCB 1U4DA 4HYHA 1WVWA 1J1BA 2RFDA 3FV8A 3PJ8A 2YCQA 3UO4A 5J1VA 2GQRA 4ITJA 3SOAA 3DK6A 4FICA 5JFSA 3LQ3A 3IPHA 3LVPA 1WBSA 2QG7A 3KF4A 2HOGA 3ZLWA 5LJJA 2C3LA 2R3OA 3D5UA 5D1JA 3VS2A 4A4LA 3A4PA 4O7LA 1GZNA 3F7WA 3U55A 4NTSA 5E90A 2OSCA 3E88A 4TT7A 3QBNA 5EYKA 4DEGA 4YJPA 2EU9A 2VGPA 3EQBA 4QMPA 4R78A 4YTHA 1OITA 3GU6A 5LCJA 2R3PA 3NR9A 1WBNA 3NNVA 2R3HA 3QWJA 2E9UA 2X9FA 3GC9A 4DG3E 2BR1A 4EQCA 1E9HA 2A4LA 2VUWA 5FTGA 3GP0A 2OXXA 4AE9A 4EK6A 2ITPA 3MFUA 5HG5A 3QQJA 5K5NA 2C6LA 4PNKA 3KQ7A 1JSTA 3IGGA 4Q5EA 1JVPP 3LFEA 3CLYA 2OZAB 5TKDA 2IVVA 1H08A 3FLZA 4R7HA 2DQ7X 2UZDA 3RP9A 1XH4A 3VUIA 5M56A 4CYIA 4I4EA 3F2AA 2ITUA 2W4KA 2XNBA 3COIA 4JT3A 2NRUA 3TN8A 3QTWA 1QMZA 2ZAZA 4MNFA 1SNXA 1U54B 5DGZA 3TNQB 4A9UA 4C36A 2XKDA 3MPTA 2WTDA 4IWOA 4ZLZA 5IDPA 2ZV7A 4XG3A 5D10A 3I6UA 2Y4IC 2QKRA 4C3RA 3UNZA 5FM2A 3W32A 3MV5A 3PIXA 5IA1A 1ZZ2A 4JR7A 5I9VA 4GJ2A 1XBCA 3NUSA 3DK7A 4RIYB 5ACBC 5M4UA 2J5FA 2XBJA 2UW6A 1OPKA 3GFWA 1M2RA 2HYYA 4LOOA 4DG2E 4BIDA 3ZZEA 5EKNA 2IW6A 4CFNA 2FO0A 4APCA 4O7NA 1YI3A 2E9OA 5ANGA 4AGCA 1NW1A 3DLZA 4IVDA 1JKLA 3MSSA 4G3GA 4BY9E 2ONLA 2JAVA 4FC0A 3Q4TA 5T6KA 4CFMA 3C9WA 2B7AA 4M68A 3OCBA 4KWPA 4XNEA 2VZ6A 1IEPA 1F5QA 3KEXA 1PJKA 4Y72A 2XEZA 1OUKA 1E1VA 3MGYA 3VF9A 2PVYA 3G9LX 5LVMA 4DEAA 5GZ9A 5KO1A 2Y7JA 3H3CA 3UC3A 4F4PA 5BVNA 4ENXA 3RKBA 1PKDA 3ZO1A 4L53A 3EQRA 4IWPA 3EN4A 4UMUA 3LCOA 3CD3A 3LZBA 3NIEA 3R1YA 4JIAA 3W55A 3PIYA 5JGAA 5E8YA 3DY7A 3V6RA 3VUDA 1XBBA 2IW9A 4EK4A 5HNGA 5GHVA 2BRGA 2WAJA 2YLEA 4RWKA 4KIQA 2UW7A 2ZM3A 5FXQA 3UOKA 2B9IA 4Y8DA 5E8ZA 4O7VA 1Q8UA 3OF0A 2I0HA 2WQBA 5AMNA 4JG8A 2C6DA 2OZAA 4CD0A 4RMZA 4M8TA 3V3VA 4FA2A 2W4JA 1IR3A 3N4UA 4BCKA 5J9ZA 5JGDA 4FMQA 5FDPA 2B52A 4O81A 3RMFA 3S00A 2VTOA 2UV2A 4RX5A 1MQ4A 4K1BA 3QUEA 3VW6A 5AV1A 5JMSA 3KC3A 3LXLA 3OWLA 4PUZA 5L8KA 3A61A 3RVGA 2CGUA 3BHVA 2PVHA 4YO4A 3NW7A 3Q9YA 2YM6A 5J87A 4NKSA 3WOWA 3MH1A 3V8SA 2X8DA 3FC2A 1QL6A 3NSZA 2XJ0A 2C3IB 3FLYA 4RGJA 2BALA 3OBGA 4RLLA 2C6EA 3NUPA 2O0UA 4RWIA 4I4FA 4FF8A 4JQ7A 2HENA 3ELJA 3NRMA 4XV3A 4XYFA 3QRJA 2GU8A 3VUTA 3PXQA 3D5XA 3ZRKA 4U9AA 5HTIA 2GCDA 2BRBA 3Q5ZA 4HZRA 5DR9A 2XIXA 3R1SA 4EOOA 1SM2A 5A9UA 1ERKA 3EFJA 3PA5A 4YTIA 3QLFA 4DFLA 5BMMA 3DXQA 3TV7A 3FPQA 3DV3A 4TYHA 3UOHA 4KKEA 2PK9A 2R3KA 4FTTA 4C4GA 4GK2A 1P2AA 4FSRA 4JG7A 4MD9E 3VW8A 5IA2A 3ZCLA 2BDWA 2Y9QA 3F3VA 5AX3A 3Q9ZA 2UW8A 2QD9A 2Y8OA 3OHTA 4NFNA 3QCXA 5JRQA 3ZSHA 3QRTA 3V51A 3NNXA 4L45A 1V1KA 3RWPA 1YOMA 3POOA 2VAGA 4L44A 4CMTA 4LI5A 3DKGA 3VHKA 3ZLYA 2R4BA 2RKUA 3QKMA 3D5VA 3E3PA 4XG4A 3KULA 5M4IA 5JFXA 4TZRA 2WMSA 2XYUA 1BL6A 3JXWA 4ALUA 2RG5A 2UZWE 3UG1A 4IX4A 5IA3A 2B9FA 3G51A 1Y8YA 4ANBA 2OF4A 1AD5A 1J91A 2BKZA 3DTWA 4QMYA 2WQEA 3TKIA 2WMQA 3EL7A 3MVHA 2QOQA 4G5PA 1VEBA 3CC6A 2YJSA 3WZEA 2PVFA 5M53A 4F08A 4O7SA 3ZBFA 4JLCA 2AYPA 4CG9A 3WYXA 3PPKA 4TY1A 4GU9A 4UALA 2C6TA 3CPBA 4IE9A 3FAAA 5AUWA 2ERKA 4EH2A 4ASXA 3GCUA 4NT4A 4B6LA 5FD2A 1NVRA 4EHZA 1H28A 2PZPA 3BKBA 4F7SA 2FVDA 3RALA 2VO3A 4FSYA 1XH5A 4FKSA 3D2KA 4ZOGA 5GJFA 5HEZA 3WZUA 5AV4A 5FGKA 1O6YA 3MW1A 4XRLA 1YKRA 5KMNA 4FEVA 4X21A 2R3RA 5IF1A 4RX7A 4DYMA 2PUIA 4FG7A 4L43A 4I0TA 3E5AA 3RPRA 1AQ1A 1H4LA 5D41A 3KU2A 4O0RA 5K0KA 2XCKA 3UE4A 4B0GA 4M97A 3A7IA 4MYGA 4EOJA 1Q61A 1OIRA 2WFYA 4RVKA 4HGSA 4USFA 2PUPA 4AU8A 4JQEA 4DGGA 3BGPA 5ANEA 3FPMA 3SV0A 5HIEA 4F99A 1ZOEA 1W8CA 2YFXA 1F3MC 3RI1A 3DKFA 3QQGA 2OXYA 2X81A 3JY9A 4XJ0A 2ZV8A 2OGVA 4M0ZA 2V7AA 3G15A 3UZRA 5FBNC 4EJNA 2GNFA 3QUPA 2BRNA 3MFTA 4FTIA 5E92A 3V5LA 4CFVA 1ZOHA 3TKHA 4EH8A 4FV1A 3IOKA 1OBGA 3R02A 5IQEA 3EJ1A 4GK4A 3RPOA 1YW2A 2O5KA 3P7AA 4BHNA 5GJDA 1H07A 5HESA 4FNWA 2XK3A 1H0VA 3WF6A 1OPLA 2AUHA 3DXNA 3FZPA 4MD8E 5FTQA 5HCZA 4YMJA 5JQ5A 3HA8A 2J2IB 4LOPA 3ATTA 3U8WA 4NKAA 3UQGA 1LPUA 4NEUA 2VN9A 2WMRA 4FUYA 2NP8A 5ANOA 3C4XA 5DE2A 2VX0A 3QYZA 4F64A 4BGGA 3FY2A 4MCVA 3DAJA 3CJFA 2V22A 4DFUA 3DJ7A 5IKWA 4IB1A 2LGCA 2PVNA 3MJ2A 1H1RA 3QC9A 4FTQA 4UZHA 3DB6A 4U7ZA 3G9NA 5EI2A 1H1QA 4C02A 2GNHA 2J50A 4LV5A 4FT3A 3JVSA 3A7JA 1IRKA 2BRMA 5IQCA 2Y6OA 3NYXA 4E73A 2Y4PA 3CGOA 3BGQA 3OEZA 2C0OA 3I7CA 3B8RA 3KRRA 2WKMA 1OKZA 3DDPA 3Q6WA 4E4XA 4ZTMA 2UZUE 4QYGA 2VTHA 3UP7A 3IECA 3UZPA 3ET7A 3ZH8A 1CKPA 4AN2A 3MIAA 3ZFYA 2ITVA 3DDQA 2C5NA 4AE6A 2DWBA 5HVKA 4U45A 5E8VA 5AADA 3OW3A 3W8LA 4EEVA 3EB0A 3NCZA 3R1NA 5H9BA 5CYIA 5L4QA 2QI8A 3KRLA 5HX6A 4I92A 4G31A 4OAVB 3KCKA 2HZ0A 2KTYA 2WTIA 4J98A 1QPEA 3CCNA 3EQFA 4MF0A 3EQIA 2XVDA 4FIHA 4O7YA 3FLNC 2BROA 4U79A 4ZJVA 4MXYA 4RQVA 4R8QA 4F7JA 3QHWA 5DLSA 5HU9A 2R3GA 5AM6A 3COMA 3G0EA 1NVQA 1SNUA 3H9FA 3IW8A 4M66A 4JQ8A 3RAIA 5IH6A 4CCBA 3O71A 4BCMA 5HHWA 3RTPA 2OJIA 5E8SA 3ZYAA 4R1YA 3R9RA 2OJ9A 3I5ZA 2ITNA 3OY1A 2VTNA 3PWYA 4KAOA 4QPAA 3ZMMA 3EMGA 3ZO3A 5AWMA 2F57A 5TE0A 5DRDA 2WQOA 3UVPA 4QMQA 4WA9A 2E9NA 3GXLA 3OUNB 3GCPA 3FKLA 2X1NA 3KN5A 3PXRA 4BC6A 4DH8A 4DHFA 1Q97A 5KMMA 5AR5A 2DUVA 3UG2A 4JVGA 4FV8A 4BTJA 1SVEA 1WBOA 2XNPA 4IX6A 3I6WA 5FWKK 4QNYA 2C5XA 3FXXA 4R7IA 4WNKA 3RBWA 3HGKA 1H26A 2BCJA 2XK9A 1GIHA 4E4LA 1J3HA 5LCKA 4YSMA 2WIPA 2WQMA 4MF1A 3WIKA 5BVOA 4TWPA 5F1ZA 3WF5A 3AXWA 4LUEA 4QMZA 4X2NA 4E6CA 4CVAA 2E9PA 4W4WA 4XV2A 3TJCA 4F09A 3IW5A 3GU5A 4L01A 2RG6A 5B2MA 4JR3A 4DGMA 4KINA 4R3CA 2RGPA 4GYIA 3LHJA 4BCQA 4F6SA 5T3QA 2WTWA 3HMIA 1I09A 5EW8A 4CV9A 4WBBB 3AT3A 2PMLX 1ZY5A 4DA5A 4KIKA 5ETFA 3RWQA 2SRCA 1UA2A 1V0OA 4V0GB 3R83A 5GZ8A 4GU6A 4KUJA 2Z02A 4NM3A 3BE9A 3DFAA 2C3KA 5ETCA 4O7WA 3OT8A 4HGLA 4U81A 3W10A 1B6CB 4C57A 5IEXA 3ATSA 2ITXA 2V62A 4BDDA 4FEXA 3TIZA 2EB3A 3MDYA 2JIUA 4FUXA 2X2KA 3CGFA 2YM8A 3LMGA 5CX9A 5JZJA 2OF2A 3QQHA 4EWQA 4EQMA 4FKWA 2CGXA 5M08A 2OH0E 1QPCA 4PTEA 1YI6A 3P0MA 2WD1A 2VWUA 5BUEA 3NWWA 5I4NA 2E9VA 4GSBA 4QT1A 5B7VA 3GC0A 4QP9A 1AGWA 3ACJA 3F5UA 3R73A 4WRGA 3UPXA 4XV9A 4L7SA 3ROCA 4AZFA 3EFKA 5D7AA 2QONA 3GU4A 2VTIA 4FODA 2BKKA 3RM7A 2HZNA 2O8YA 2Z2WA 4QP8A 4C62A 4X3FB 4O6LA 4KS8A 3E8DA 5EM7A 4IHPA 3GQLA 2G1TA 3PA3A 3R8ZA 3IO7A 4NSTA 5EG3A 2YIRA 3RPVA 5CNNA 4FX3A 5TO8A 2YITA 5IQGA 4I0RA 4GT3A 3WE8A 1PXIA 1ZWSA 3A7GA 4EHGA 4EBVA 4O0UA 2CGVA 5IMEA 4UV0A 3C4EA 4JS8A 3UNKA 3FZSA 3VBWA 5LMBA 4FTRA 2X8EA 4M0YA 4JX7A 5E8XA 5IUIA 3O2MA 4IZYA 5DH3A 3VBTA 5JGBA 2XJ2A 4QP4A 3R9HA 5AP6A 4CKIA 1IASA 4EUTA 5LVPA 5KMIA 3COHA 3HUCA 4BCHA 2QOIA 4OR5A 5JEBA 5KKRB 1XR1A 3AT2A 3TZ9A 2CKEA 2JFLA 2H34A 4M84A 3V5QA 4ACGA 4MNEB 4FTCA 4RX8A 2R7IA 3RK9A 4ZSJA 4YZMA 1ATPE 3WF7A 4J1RA 3R7OA 4KKGA 3SW4A 4D2VA 3MA3A 3VBYA 2C5OA 3R04A 1FOTA 3D7TA 3WZDA 4L52A 1TQMA 3FKNA 3FMMA 4FVRA 1ZXEA 3F5GA 3FMNA 4JAIA 4RIWA 5DR2A 2WNTA 4D4RA 3MYGA 3DAEA 3R28A 3QD4A 4K6ZA 4WG5A 2JAMA 3F7ZA 5EDPA 4D58A 2WTJA 5E1EA 2Z60A 5CI7A 5I9UA 1K9AA 3QC4A 1BKXA 5CVGA 5HBEA 4YP8A 4MWIA 3UVQA 3OC1A 2FB8A 5J9YA 4EK8A 5CEPA 3QD3A 5JK3A 4ZZNA 4DEDA 4QYYA 4J99A 3SA0A 3MIYA 2X6DA 4HYIA 2O64A 2XK8A 4GT5A 4N6ZA 4BZNA 4C3PA 2XEYA 2RSVA 4H1MA 4X2FA 3GC8A 3MWUA 4FGRA 4HJOA 2C1BA 3VQHA 3M2WA 4G9RA 2EB2A 2V0DA 3CTHA 4QMLA 1V0BA 2I1MA 3BWJA 3GT8A 3LFDA 3PPJA 3HV4A 4L7FA 5C27A 5CAUA 2B54A 1J7LA 4E7WA 3W2RA 4FNYA 5IISA 1Y57A 1DS5A 3BBTB 3R9OA 4E8AA 4EORA 5HO6A 3GFEA 1JKTA 4QMWA 4IAFA 5AX9A 4DEBA 1OL2A 3BU3A 5EM8A 2QOKA 3O96A 4YHJA 4Y83A 4EUUA 5HNBA 1T46A 4CFWA 4FL1A 3RNIA 2PY3A 4A4OA 3EN7A 1NVSA 4XV1A 3T3VA 3MESA 3KF7A 2W1DA 4N6YA 4A06A 3BQCA 1YWNA 3OOMA 4F1OA 3O8TA 4XUFA 5C26A 3T3UA 3KRJA 2HXQA 3GOPA 3NW5A 3H30A 4RIXB 2WMXA 5HORA 2I0YA 4OTGA 1KE8A 2XNNA 3BYUA 3EHAA 4FTOA 4D9UA 4EOLA 3DNEA 4R7BA 4E5BA 1J7IA 2XM9A 3K5VA 4DEIA 1XH7A 2Y0AA 4C37A 2VWIA 5AUTA 3KVXA 4L3LA 4XG6A 3TUDA 3E8CA 2XA4A 3W2OA 4F9CA 3Q4ZA 2OBJA 4DINA 2W1CA 2ITQA 2WU7A 2YCSA 4RA5A 4ZSEA 3LFSA 4E20A 4ZZMA 3TIYA 3DK3A 3NNUA 3W18A 4E6AA 3S1HA 2BTRA 2XJ1A 4PDYA 1ZMWA 2QNJA 2XK6A 4H3PA 4IC7A 4HYUA 2B1PA 1M14A 5KMJA 4AA4A 4HVDA 4YHFA 4RZVA 3LJ1A 4RPVA 4U80A 2GTMA 3D0EA 1ZY4A 5E1SA 5HBJA 4EHEA 1VYWA 3HRFA 3AMAA 4PTCA 3SQQA 3LLTA 3BHYA 1JAMA 3A8XA 2WTKB 4YLKA 4IM0A 3ORPA 1B38A 2W1GA 3QCSA 1XH6A 1CTPE 4I5MA 4EJ7A 3CJGA 3ORNA 4BDFA 3AGMA 3K5UA 4BTMA 3FY0A 4X3JA 5JT2A 4AGDA 2UVZA 3QRUA 5I3OA 3HECA 3OTVA 4TRLA 3HV7A 2FYSA 4IJPA 3S0OA 5AR2A 5IH4A 5DG5A 3VS6A 2JDRA 4LL0A 5AIKA 2C6IA 4PF4A 5LMAA 2H8HA 5FP5A 4HGTA 5HO8A 3TEIA 5C4LA 3Q9XA 4GYGA 4AFEA 4HVGA 4O0TA 3LXKA 4IQ6A 3ZEPA 1W82A 5IU2A 4RLKA 2ZDTA 5HICA 1KV1A 4CT2A 1RE8A 2X39A 3E63A 3ZBXA 2OXDA 3Q6UA 3DA6A 3Q96A 5AUZA 3FSKA 4IDTA 3RINA 3HDNA 3V5JA 1FGIA 4XG8A 3DOGA 5CAVA 2R3QA 3WF9A 3L8PA 4AP7A 3BLRA 4E5WA 3U6IA 2YERA 4RG0A 3MVJA 3PLAE 3D94A 5DPVA 5C03A 1JNKA 1OL1A 3D7ZA 5ITAA 4FZ7A 1YQJA 1BLXA 3TG1A 5DVRA 5DOSA 4GVAA 4U42A 1E1XA 2BZKB 2R3FA 3WILA 5CS6A 4WD5A 3BQRA 3OROA 4PL3A 3W2SA 5E91A 3RNYA 4O96A 2WMVA 4FV6A 4DLJA 5CSHA 3SXRA 3T8OA 3RHXA 3T9IA 2VWWA 3OY3A 3RM6A 3DS6A 4C35A 5L2QA 4TYJA 3FKOA 5HE0A 3FQEA 3OT3A 4QMUA 1ZAOA 4TKSA 5CF5A 1MQBA 4O83A 5HLWA 3EQDA 2V7OA 5EW3A 3U9CA 2FA2A 4NFMA 4AZVA 4DN5A 2E2BA 3PE1A 4YPDA 4FYOA 4CT1A 1O6KA 4FVQA 3BIZA 5EQPA 4C58A 5JQ8A 2JDTA 4H39A 4CZYB 3MTFA 1M17A 3TT0A 3CD8A 3VS4A 2GFSA 3NUNA 3PUPA 3QYWA 4GUEA 1PXOA 3LMHA 2QU6A 3ZO2A 1XQZA 3QGYA 4CG8A 3LCSA 4KD1A 3HRBA 4QQCA 4BR3A 3PDTA 4G6NA 5AR3A 5GINE 1QCFA 3E62A 2BDFA 3EWHA 3FZRA 5L6PA 4R5YA 2J6MA 3L8XA 4FV2A 5EQYA 4DBXA 3PRIA 1PXKA 1OKYA 3QTRA 2EXCX 4ERWA 4I24A 3QXOA 2JKKA 3LJ0A 4I23A 4QMNA 4G3FA 1KV2A 4QQJA 2CNQA 5BYLA 1UWHA 3ANQA 4OTFA 3AC2A 2ZM1A 2J90A 3PYYA 3BYMA 5CU0A 3D14A 1STCE 1YHSA 4ZMFA 4G17A 3F3UA 4F9YA 3ODYX 5K3YA 3MB6A 4B4LA 3V5WA 4BKJA 4KA3A 5CENA 2JLDA 3HUBA 4IH8A 3HV5A 4PDPA 5M07A 4QYEA 4LMNA 4F9AA 4FT7A 4D0WA 3II5A 5CAQA 4RBLA 2I7QA 1PY5A 3HZTA 4FEUA 5I5ZA 4A07A 4APPA 2F2UA 4RJ5A 4D4YA 3DBDA 5HVYA 4UMPA 3QKLA 4EOIA 4PQNA 3P4KA 4QMMA 3NDMA 4YPSA 3MB7A 4K18A 5EW9A 4U6RA 4ALWA 3IOPA 2W1FA 2C0TA 2IPXA 4L00A 4MXOA 4YJVA 3E7VA 3PRFA 3LQ5A 4PX6A 4CFUA 4BTFA 2OFVA 3R30A 3GNIB 2WOTA 2X7OA 3I0OA 4BIEA 5CEKA 4O2ZA 4C34A 1OL5A 3DBQA 2YCRA 4BIBA 2OW3A 2WHBA 3FC1X 5AP1A 5CQWA 3HP5A 5HG8A 4BBFA 5L2TA 3UTOA 4XOYA 4DBNA 4F9BA 1Q8TA 2YIQA 5EI8A 4BDKA 4J71A 3TNHA 5IMXA 3DAKA 3HRCA 1JOWB 2FSMX 3L9PA 2JKOA 1Q24A 2VO6A 2X2LA 3E7OA 3F9NA 4F6WA 4O82A 3T9TA 4EOSA 2BAKA 4TL0A 4YHTA 3QWKA 1B39A 3O7LD 2QOBA 1U54A 3AMYA 2GS6A 1G8AA 3P86A 5BMSA 5D11A 3FMEA 5A14A 4MBLA 3QQFA 4D1SA 5LWNA 3FMJA 4C3FA 1GY3A 1YWRA 3KA0A 2UVXA 4LV8A 5EHOA 4RJ8A 3S4QA 4BI2A 5EHYA 2BHEA 3QD0A 3MH2A 3N4VA 2GNIA 4RIYA 3FLSA 2VX3A 5IEYA 4QNAA 1LP4A 3F61A 5CEMA 2YABA 4FV0A 4O1OA 2WB8A 3BZ3A 3NUXA 3A2CA 2VTRA 3MFRA 2I0VA 4UEUA 3CQUA 4ZY5A 2XRUA 4UMRA 3A7HA 4FKGA 4JDKA 3VUMA 5E8TA 2UW9A 5M51A 1OM1A 5IQIA 5H8BA 3SRVB 3AC3A 5AUYA 5AA8A 5L3AA 2P2IA 2WQNA 5I9WA 5IQHA 1R1WA 2W17A 2PVJA 4IWDA 4EQUA 4Z7GA 2X2MA 3I4BA 2VTMA 5C01A 3UGCA 2A19B 3DBFA 2GHGA 2A0CX 4NW6A 1BX6A 2R0IA 2ETKA 2RIOA 1U5RA 4ANNA 5BVKA 3IQ7A 2OFUA 3QX2A 2PZYA 1NXKA 5HIBA 3UNJA 4CZUA 3C50A 4G2FA 3AQVA 3V04A 3ZXTA 4ACHA 5J9LA 3O8UA 1ZRZA 2XZSA 3AC1A 4M13A 5CTPA 2G15A 4QP7A 3DQWA 2JC6A 3P7CA 4LRKA 4Q5HA 3SDJA 4CRLA 5DEYA 4AX8A 2ITZA 3F5XA 4O1PA 4DAWA 4NYEA 3OW4A 4P2KA 1WCCA 4IAYA 5CF8A 3BLQA 5L8LA 4UX9A 4I5HA 1YRPA 2BAJA 2F7EE 4QO9A 4JDJA 3L9MA 2FSTX 2UW4A 2WU6A 4JBVA 3D15A 4RJ6A 1T45A 3I0QA 1Q8WA 5HO7A 4FNXA 3QALE 5IQBA 5TF9A 3DB8A 4GEOA 5CI6A 2P3GX 2XK4A 1Y6BA 4IM2A 4BRXA 4O7TA 1DM2A 2AC5A 5DFPA 2ONLC 4WO5A 4BDAA 2C5YA 4WG3A 5M4FA 5F4NA 2IVTA 4YUQA 2HW7A 4FKLA 4EOMA 5L2SA 1GZ8A 5AFVA 3UBDA 5AM7A 2X8IA 2Q83A 4D5HA 1OIYA 3LMIA 3OP5A 1UU9A 5A54A 4YJUA 3JR1A 2WZJA 3VN9A 4Q9ZA 3K54A 4PDOA 4PP9A 3BV2A 4CGAA 4ZK5A 3I81A 2CKPA 4UZDA 5ANDA 4IB3A 5CSPA 5C4KA 1HOWA 4ZLOA 4GIHA 3Q3BA 1FVVA 4FTLA 3ORIA 4H1JA 1DI9A 3NAYA 3R71A 5AP0A 5EQEA 4ZY6A 2OJGA 3CKXA 3H0YA 3FE3A 4J8NA 4JXFA 4YJSA 3KXGA 1KWPA 5GIPE 4U3YA 5CSXA 3MY5A 5CF4A 2QCSA 1K2PA 4W9WA 3CE3A 1A48A 4S30A 2PE0A 3QFVA 4FKVA 1OVEA 4LYNA 2XIRA 4HYSA 3PP1A 3PPZA 3ZM9A 2JITA 3R21A 3ZSGA 4KRCA 2XIYA 5A4QA 1ZMVA 3K3JA 3LLAA 3UP2A 4XS2A 2XKFA 5BVFA 3W1FA 3OD6X 3PFQA 4FKIA 5IDNA 4ZIMA 1ND4A 3SHEA 1ZZLA 3OG7A 3QRKA 2W7XA 1ZLTA 3UIBA 4J97A 4BKYA 2HW6A 3AC8A 5JFWA 2OJFE 2XNMA 3CTQA 4KB8A 4V04A 4ZSGA 4DTAA 4MXZA 4J8MA 3HL7A 1FBNA 4P5QA 2G2IA 5AR8A 1CKJA 2PVKA 4E4NA 3P23A 3UYSA 1BUHA 2PUNA 4JDIA 4ACCA 4I6FA 2W06A 1XH9A 2ZMCA 5F20A 3G90X 4FZFB 4YU2A 4FG9A 4AFJA 2BTSA 3BYOA 4ORKA 2YM3A 3NUAA 4OLIA 2XM8A 3ZXZA 2PVRA 1UNLA 2C69A 3H10A 5DT3A 4Z16A 4WNMA 4EKLA 2F9GA 4DEEA 4B8MA 2XIKA 3NUUA 1WBPA 3OCTA 3PY3A 1JLUE 1Q62A 2R7BA 3EQCA 1WFCA 3O8PA 4XHKB 4UWBA 3LFFA 4OTQA 2UUEA 5EOBA 3H0ZA 3OFMA 5EM6A 5K5XA 2C1AA 4DGNA 5CXZA 1Q4LA 2VX1A 2CDZA 4ZTRA 3ZC5A 5CEIA 3ZHPC 3SG8A 4YTCA 2Q0NA 3GENA 5AJQA 1J7UA 4GCJA 4JG6A 1P4OA 5CASA 4XX9A 4GUBA 3EH9A 5CU2A 5AAEA 3IG7A 1YXTA 2YZAA 2X0GA 4ANSA 1IAJA 1BI8A 2YCFA 4YZDA 2UZEA 5CVFA 4IM3A 1YDTE 2PYWA 4QTEA 4BWKA 3AGLA 2C3JA 3ZDUA 1O6LA 3SOCA 2QVSE 2W96B 5HGIA 4EBWA 2B53A 5AAFA 3NS9A 4XBRA 3V6SA 5KHXA 3MBLA 1PHKA 3I60A 4GK3A 4ZY4A 5B2LA 3AC4A 4JBQA 4LGHA 4EZ3A 4RJ3A 3BGZA 4AA0A 4YO6A 3Q60A 5E9EA 1YVJA 4IFGA 4O7RA 3F2NA 2CMWA 2R3MA 3FZ1A 4CRSA 2VO7A 4EHVA 1IA9A 5CNOA 1IG1A 3NW6A 1W7HA 4IZAA 2XYNA 4Y5QA 4GG7A 2R3NA 4XMOA 3IW6A 1P14A 3QLGA 5DN3A 3RZBA 5AV0A 3TJDA 3TNIA 4ANOA 4LMUA 2CCIA 1PYXA 5D7VA 4N57A 4Y85A 4AW1A 3DNDA 2PPQA 1W83A 1GNGA 4PRJA 4N4SA 4WG4A 3RHKA 4MQ1A 3ZRLA 4O38A 5AAGA 2PZRA 1KSWA 2BZIB 3ORZA 4ZTQA 1JBPE 3CP9A 4O2PA 4AT5A 3CXWA 4IJ9A 4RC2A 3HYHA 3TZMA 2VV9A 4BCIA 5D12A 3I79A 3JUHA 5HD4A 3C4WA 2YM4A 3G6GA 4XLIA 4ARKA 4L6QA 2IO6A 4I94A 4LOQA 5J5TA 5JSMA 4L3PA 4G3EA 5AR7A 3PSBA 5BQ0A 4K33A 3VC4A 1PMNA 1U5QA 2XNOA 4EC8A 4IAIA 2GQGA 4R3PA 2A1AB 4O91A 1GIIA 3AC5A 3MFSA 3DBCA 4GV1A 3VQUA 3R63A 3BU6A 3MVMA 1J1CA 2VU3A 5DT0A 3WZKA 3Q4UA 4MKCA 4FKRA 4AAAA 4XRJA 1GZKA 3AD4A 4BZOA 4E5AX 4FE2A 4EH7A 3R01A 4QTCA 2CN8A 3O23A 1Q41A 3OXIA 1XH8A 1PF8A 2OH4A 5AA9A 1UV5A 3VULA 1K3AA 2CNUA 1TVOA 4U8ZA 2QO9A 1Q5KA 3BRBA 5EOLA 3F3WA 2YIXA 4USDA 4WNOA 4QPMA 4YZ9A 1CM8A 5IA0A 4C38A 2QOOA 1WBVA 3BEGA 2W1EA 4LQMA 3W2CA 3KXZA 4PDSA 4V01A 4NM0A 3D9VA 3HA6A 4RWLA 2O3PA 4U3ZA 4FKQA 3UMWA 4EZ5A 4IB0A 4BCPA 4YNOA 3HMOA 3E87A 5T68A 4BBEA 4OUCA 3AT4A 4AZTA 3UMXA 5HNIX 2WMUA 4QP3A 4W4XA 4GRBA 4YLJA 1M2QA 3HAMA 3QCYA 1XKKA 4ZXTA 4AN9A 1OUYA 5B2KA 3HLLA 1VZOA 1H1PA 5BVWA 2W5AA 3MY1A 4ONAA 5H2UA 4HPTE 3A4OX 4EOKA 4XEYA 3FL4A 3G0FA 1H0WA 4IWQA 4AG8A 3D4QA 3QAME 2YAKA 4IX5A 4AOTA 4KBCA 3ACKA 3W2PA 5HTCA 4W9XA 2EXMA 3EQGA 3ORMA 3GCQA 2XNGA 3R8MA 5A6NA 5AP3A 2YDKA 4XOZA 4NK9A 1TQPA 3R22A 3R0TA 2CN5A 2EVAA 1S9JA 3SKCA 4UWCA 2OWBA 5HVJA 5KZ0A 4IX3A 2I0EA 2G2FA 4NWMA 4UBAA 2CHLA 3CEKA 5CAOA 2B0QA 3R8VA 4NCTA 3IDCA 5CSVA 3C0HA 4LUDA 4QYFA 5EHLA 2WIHA 1ZOGA 2X6EA 4ZS0A 1UU8A 4ZP5A 1R3CA 3OWJA 4AW0A 1OIUA 4FSUA 5J8IA 1FQ1B 3GB2A 4M15A 1OL6A 3C13A 2X4FA 2IZSA 4CZTA 2J5EA 2PE1A 4K2RA 3P79A 4C4JA 4HCUA 1GAGA 3VUHA 5H8GA 2B9JA 2JBOA 3PVGA 3BU5A 4V0GA 2ZB0A 3D5WA 3H9RA 1YI4A 3ITZA 4EYJA 4ZJJA 3ZUTA 4ZSAA 3QZGA 4MX9A 5IQDA 3LCKA 5F9EA 4PPCA 4I5CA 3IS5A 1R0PA 3P9JA 1OI9A 2R64A 2ZYBA 3GGFA 4GS6A 4HCVA 3IW7A 4Q2AA 5DBXA 2EXEA 3TACA 2GDOA 4BCFA 5BNJA 1BL7A 5ANIA 1YXVA 2YM7A 3F3ZA 5HTBA 5LWMA 1M7QA 3UOLA 4UXQA 1CKIA 2JBPA 4V05A 2JIVA 2PU8A 1JWHA 5JFVA 3NYVA 5L2WA 2WMWA 2UW5A 3LFAA 4ID7A 5DA3A 4B99A 3VAPA 5CT0A 3H9OA 4I1ZA 2O63A 1PMVA 1X8BA 1FMKA 3R7GA 2A2AA 2VTJA 3SVVA 4MQ2A 2YM5A 3VIDA 2FGIA 5FRIA 3DXPA 3PJ2A 5C8KA 3AOXA 5HCYA 2YA9A 5D9HA 4CNHA 3RGFA 3KY2A 3BX5A 3PXZA 5CLPA 3REPA 1MRYA 4IEBA 3ENHA 3HNGA 4X3FA 5M57A 4R77A 4CQEA 4U97A 4CKRA 3NX8A 3FLWA 4BN1A 2PTKA 2REIA 5AUXA 4ZTLA 1GZOA 3FQSA 4YLLA 3EFLA 4K11A 3LW0A 5HCXA 4K0YA 4ZZOA 3HDMA 4DGOA 3ZLXA 4EC9A 2Z7SA 2ITTA 4KSQA 3BHTA 2CGWA 2ETRA 2QO2A 2VRXA 4MTAA 3VS0A 3C5UA 1ZYDA 4IADA 4L46A 4DGLC 3E64A 3KN6A 2BILB 5KBQA 2OKRA 4MBJA 3R2BA 5I9XA 4M3QA 5DIAA 4FTKA 3C4CA 4QMVA 5TR6A 5ICPA 3V01A 1YHVA 2H9VA 5E8WA 4YTFA 3PA4A 1G8SA 4YJNA 4P4CA 2VWXA 2P33A 4CMUA 4DCAA 2JGZA 4XP2A 4CMOA 4PL5A 4H36A 2J0LA 2PSQA 3KXHA 4MNEA 2VWVA 4S33A 4Z3VA 1OIQA 2Y4IB 4EL9A 3R7EA 2CPKE 3PWDA 4R1VA 3V5TA 4RSSA 4JX3A 4TTHB 3O50A 1P4FA 5HU3A 4NIFB 3QF9A 4MWHA 3TNWA 5CEQA 4GW8A 4PPBA 3ZU7A 4AT3A 3MH3A 4NZWB 4AWIA 2JKMA 3EZRA 1YXSA 1WBTA 3DQXA 4ZJIA 5J7BA 4X6QC 3P7BA 5KZIA 3IDPA 1RQQA 4RRVA 2YDIA 4TXCA 5EM5A 3V8TA 1OKWA 2Y6MA 3FL5A 3GQIA 3HV6A 1Q8ZA 4QP6A 2WMAA 4RVLA 5B0XA 2Z7QA 4HW7A 3PJ1A 3ZEWA 3ENMA 3VS5A 5CANA 4OT6A 4R3RA 4WIHA 2J7TA 3BELA 3QL8A 3R6XA 2CJMA 4PL4A 1UKHA 3KXMA 3OWPA 2RL5A 4NTTA 1KE9A 3UC4A 3ZSIA 1I44A 2XH5A 4BCJA 2BIKB 3PVWA 4DFZE 3RCDA 3PVBA 1PXNA 4USEA 4Y95A 3RZFA 2XBAA 4C4IA 3SW7A 3QRIA 4FYNA 1LUFA 3QUDA 4D2TA 3A7FA 2W9FB 2BZJA 1FINA 2WEIA 2YEXA 4BWXA 1G3NA 4CTBA 2QC6A 1SVHA 4A7CA 4CLIA 2G9XA 1UNGA 2JDSA 3EFWA 3R7YA 2F49A 4P7EA 3HAVA 5M06A 2FUMA 3PG1A 5GNKA 1PRYA 2ZMDA 5F94A 1KOAA 1YHWA 4FV5A 3MPMA 3KXXA 4DT9A 4JDHA 2ZV9A 1W84A 3FYKX 3G6HA 4GVJA 4OTDA 4C33A 4I22A 2ACXA 3DZQA 2C4GA 2BIYA 2IVSA 3C1XA 4M69B 4MD7E 4W4VA 5C8NA 4QMXA 2V5QA 2XCHA 3QA0A 4WOVA 1H01A 4WUNA 4B9DA 5TT7A 3S95A 4ZTNA 2VWYA 3EN9A 4OT5A 4QMSA 3TUBA 2YIYA 4RIXA 5I3RA 5CQUA 1SVGA 5HQ0A 4S34A 1YXUA 3GCVA 3IGOA 3LFNA 2OO8X 4C59A 4BDCA 3D83A 3EYGA 4DT8A 4YZNA 1RJBA 4FT5A 3BWFA 4BDHA 4W8DA 3LQ8A 3R00A 1UNHA 4DG0E 4JRNA 2VWZA 4U0IA 4DH1A 3ZLSA 1SMHA 3ORLA 2W1HA 4O0VA 4BDJA
chains in the Genus database with same CATH superfamily
2CSNA 2UZVA 2UZLA 2VTAA 2PUUA 5K0XA 2H96A 1DAWA 4G1WA 3HEGA 2JFMA 4MAOA 2IZTA 4JNWA 4CFFA 4F63A 5H8EA 2YHVA 3FJQE 2BZHB 3OCSA 4CCUA 4ITIA 2HWOA 4X2GA 4AXAA 4DTKA 3BCEA 2UVYA 1Z5MA 3Q04A 4PV0A 2HWPA 3UJGA 2IN6A 5M55A 3P5JC 3MN3A 4FI1A 4RC3A 3BYVA 4XBUA 5IG1A 4DFBA 3DT1A 5CALA 4YJRA 3JYAA 3S3IA 2PULA 1VJYA 3M11A 2KULA 4EKKA 2W1ZA 1URWA 3POZA 2VO0A 3MJ1A 5A4LA 3GCSA 5E4HA 2G01A 3UQCA 3WYYA 1Q99A 4G16A 2UW0A 5CT7A 3TL8A 4AA5A 1XBAA 3U6JA 4FEWA 4D5KA 2WMTA 2GSFA 1JPAA 2X0QA 4LRJA 2YWVA 2BPMA 3R7IA 4QD6A 4CFXA 3VBQA 3MH0A 4O0YA 4TNBA 5A6OA 2NNWB 1XO2B 1A9UA 1P5EA 5KMKA 4YJQA 5DEWA 4L3JA 2BRHA 4C7TA 3ERKA 5LMKA 3TMOA 4M69A 4FNZA 5JZNA 3CY2A 3UVRA 2PHKA 4U43A 3CQWA 4OBQA 4AZEA 1CSNA 4PY1A 5LXMA 4DFNA 2RFEA 3NNWA 4KIOA 3QTXA 4O0SA 4UMQA 5C9CA 4AOJA 5BYYA 5HOAA 5LVNA 2JEDA 5FUTA 1JKSA 3LCTA 4AS0A 4NW5A 5A3XA 2JD5A 2VNYA 3GU7A 2OK1A 3O17A 4JBOA 2GHMA 5DHJA 5FEDA 3FI2A 2Z8CA 3CKWA 4FIGA 5CU4A 3DTCA 1ZYCA 2C6MA 2J4ZA 4IAAA 4TWOA 3W33A 4D4SA 1LEWA 4F7LA 3R8PA 4BKZA 3Q2JA 4HGEA 1RDQE 4L68A 4J96A 3PY0A 2ZOQA 2W05A 3FI4A 4G34A 3LM0A 1MP8A 4OTHA 4BCOA 4L9IA 4MBIA 3A60A 4N0SA 4CYJA 3E93A 3UIUA 4YBJA 4EK3A 4AZSA 1OMWA 3F66A 3FZOA 4S2ZA 5AUUA 4G6OA 3TDWA 4NH1A 5G1XA 5TOZA 5K9IA 5E7RA 1UVRA 4TYIA 3FBVA 4OW8A 4WT6A 4F0IA 2CKQA 4XLVA 1H27A 2Z7LA 3U9NA 4D1ZA 4EH9A 1H24A 2B55A 3PIZA 3ZONA 4YZCA 2O2UA 2W9ZB 5ETIA 4ERKA 1U46A 3F82A 1XHAA 3O7LB 4MXXA 3UDTA 3FZTA 3PZHA 4B8LA 4LL5A 3PG3A 3TCPA 1PW2A 4XG9A 4IAKA 3FHIA 3ZRMA 5EH0A 4ALVA 2BAQA 1ZYSA 3EIDA 3KRXA 2R9SA 1FVTA 3LOKA 3NAXA 4L42A 5A4TA 5BUIA 4FV9A 5KNJA 5IZFA 1MRUA 1MRVA 4HOKA 4HZSA 2UW3A 4O84A 2YZLA 2OIDA 4BHZA 3MA6A 3TV4A 5HLNA 2HY0A 4BYJA 5C8MA 2WO6A 5L6OA 4BDEA 5AIRA 3DLSA 3FYJX 4QP1A 4ZLYA 4LM5A 1OPJA 4FV3A 3RK7A 3FHRA 4C2VA 3A8WA 3UIXA 3N4TA 2WELA 4CTCA 1KUTA 2QKWB 3VWAA 2I40A 2GPHA 3RK5A 4LRMA 4ZAUA 2HK5A 4FIFA 4NM5A 2P0CA 4TYHB 5AP5A 3R9NA 4NL0A 3NPCA 5BV3A 3KK8A 4GJ3A 4BVUA 3W0RA 4JRVA 2X4ZA 4M67A 2XF0A 4I20A 2GNJA 1Z9XA 4JAJA 5ACKA 3TV6A 3TDVA 2QOLA 4QMTA 4S31A 3VJOA 4FSMA 1JQHA 5FG8A 5AEPA 4X0MA 4YJOA 4K77A 4HPUE 2WTKC 4FL3A 4AQCA 1PYEA 1Q8YA 1M7NA 4AXEA 2BFXA 2YACA 3WBLA 3FXWA 3HP2A 4OTRA 4OTWA 4PMTA 4DHIB 4MH7A 4D2SA 4RX9A 1HCKA 5ANKA 5HG9A 2F7XE 5BVDA 5HD7A 5CU6A 4D9TA 5CWZA 3W8QA 4LFIA 2IG7A 4JI9A 3WARA 4XG7A 3KULB 2WEVA 4HVHA 5LMKC 4KNBA 3FMLA 1PXJA 5M4CA 2XUUA 4U5JA 4AACA 4BDBA 1BYGA 4GH2A 3NVKI 3QQLA 4MEDA 4D0XA 1NT2A 4F0FA 1W0XC 2ITOA 3U51A 4C8BA 4IFCA 1GIJA 2PZIA 3O0GA 1WBWA 4I93A 4QP2A 4CV8A 5I9ZA 3Q53A 4JJRA 1YWVA 4QOXA 1JKKA 4X2JA 4K8AA 3F2RA 2QOFA 2ZB1A 4AQKA 2XB7A 3LIJA 3SXSA 5EDQA 1F0QA 2C0IA 1VR2A 2P55A 4I6QA 5KUPA 3OBJA 4DFXE 4AAYA 5HZNA 4O0XA 3NMUF 3OXTA 3KMWA 2GQSA 3QHRA 5BUJA 2VGOA 3DJ6A 4FZAB 3E92A 3TXOA 3ML1A 2UZNA 4ACDA 4KABA 4GG5A 3VS3A 4RFYA 3QD2B 3MTLA 3MVLA 4IW0A 3BHUA 3F5PA 5E8UA 4RJ7A 4WHZA 5A46A 2HELA 3KFAA 5EYDA 1WAKA 5FXRA 4A4XA 5JKGA 1WZYA 3VBXA 4ASZA 2IJMA 5CVHA 4F65A 3IK3A 4FIJA 4GKHA 4RWJA 3R8UA 4EZ7A 2VTLA 4Y5HA 4ZTHA 4EH4A 3F88A 3DKOA 3NCGA 3L9NA 4FKJA 3VUKA 2CKOA 4D55A 5K4JA 3FEGA 4GIIA 4KBAA 4FIIA 2YWPA 5EFQA 3P5KA 5C1QB 1ZYJA 4AN3A 3P78A 4IXPA 2GHLA 2IW8A 4E4MA 4J52A 1MUOA 5BX0A 4HNIA 3CS9A 3ROYA 4XG2A 3AD5A 1YDRE 4FKTA 3TTIA 5L6WL 3EL8A 4A9RA 5CSWA 2GMXA 2W5HA 4UYAA 4EH3A 3DU8A 2R2PA 1OBDA 1NY3A 1URCA 1SZMA 4RFMA 4FTMA 4C0TA 5BVEA 3QQUA 5LQFA 5L8JA 4BI1A 5LVOA 4Y46A 1XJDA 2UZTA 4YR8A 2P2HA 1Y8GA 3SRVA 3WIGA 4DDIA 3LPBA 3WE4A 1L3RE 5HE3A 3VRZA 4BBMA 4Y73A 4CKJA 1VYZA 1DAYA 3EN5A 1L8TA 3CPCA 2ETMA 4QTAA 2RF9A 2O65A 4QTBA 3TTJA 3Q5IA 1BI7A 4GKIA 4A9TA 3MPAA 4LV7A 4O0WA 2IZRA 5DI1A 3TNPC 3UQFA 3O5AA 1PKGA 1KE7A 2NO3A 2PZ5A 1UU7A 5KMLA 3C0IA 2ITWA 3V8WA 2PL0A 4DCEA 3AD6A 3K3IA 5FTOA 3EOCA 3TUCA 2C6OA 3GI3A 2W1IA 4FT0A 2GTNA 4G3CA 3VBVA 3F6XA 3ZFMA 4BCGA 2WTCA 3DJ5A 3Q4CA 5HBHA 2H6DA 1KOBA 4J53A 3RAHA 4E26A 3R7VA 2C68A 4NJ3A 3EQPA 4DF3A 3QZFA 3VO3A 1R0EA 3F3TA 2VTSA 3ORKA 5DRBA 5K4IA 2XS0A 3NVMB 4NU1A 2R5TA 1GJOA 3QTUA 4G6LA 2OU7A 2CCHA 4FTJA 1OGUA 4K9YA 1A06A 3UZTA 3OUKA 3ALNA 4BFMA 2OI4X 3GVUA 4IVCA 3ZC6A 3GOKA 3EN6A 3PXKA 4H58A 3GEQA 5I9YA 4KKHA 3TZ8A 4UY9A 3RPYA 5A4CA 5DWRA 3THBA 3PY1A 2XKEA 4YJTA 4C4EA 3WI6A 4Z7HA 3OXZA 2HCKA 2Z7RA 2UZOA 5F95A 5JH6A 4J7BA 1Y6AA 3B2TA 4BTKA 2R3LA 4FSZA 1QPJA 3BPRA 4QQ5A 5CF6A 3UO6A 4ANMA 4P5ZA 2B4SB 4YSJA 2J0MB 4RIOA 3V5PA 3NIZA 3AG9A 3ODZX 5AV2A 3VS1A 4RVTA 3QCQA 1DI8A 3TKUA 3L8VA 5KE0A 3ULZA 4BGQA 4FOBA 3WF8A 3I7BA 3R1QA 5J95A 4I0SA 2XRWA 5L2IA 5I0BA 2FSLX 4IZ7A 3I5NA 4E6DA 4GT4A 2CNVA 4QYHA 2ZDUA 4AUAA 4QDVA 3VRYA 3QKKA 3NYOA 5FLFA 3FXZA 2NPQA 4GFGA 4PP7A 3PZEA 2YIWA 3COKA 1UWJA 4FK6A 3OCGA 4GFOA 4KIPA 4A9SA 3QXPA 1KE5A 3HMNA 1M52A 2QQ7A 3KCFA 5J79A 4PTGA 2VWBA 4GMYA 3KKVA 4I6HA 4EOQA 1UU3A 3SX9A 4F70A 1O9UA 4L67A 4IIRA 1VLRA 2ZM4A 3PUFC 1ST4A 4E1ZA 2C30A 3RAWA 4G9CA 4BI0A 5DMZA 1OL7A 1ZARA 4HNFA 1FGKA 1OKVA 4KRDA 5KCVA 1ZYLA 3HKOA 4WRSA 2JKQA 2YISA 1IAHA 3E8EA 1R78A 3TWJA 4EONA 4N70A 2HY81 4O6EA 5FQDC 1LEZA 4RZWA 3CBLA 5AR4A 4IAZA 3EYHA 4I21A 2HAKA 1BMKA 4LG4A 4OTIA 4ZS4A 3ZTXA 3SC1A 3Q52A 4ANQA 2I6LA 3VHEA 2OG8A 4EOPA 3ZUVA 3QU0A 2ZV2A 3Q2MA 4FOCA 2WXVA 4D1XA 3FLQA 3OEFX 3GC7A 1JSUA 4W8EA 3Q32A 3R8LA 4BWPA 4X6RA 3F69A 1YOJA 4J95A 1SYKA 4ZSLA 3U54A 4KIKB 3IKAA 5IQFA 4AGWA 5HX8A 4JBPA 2VD5A 4ITHA 3N51A 4Q9SA 2ZJWA 4FTUA 4FTNA 4I41A 4WNPA 3PSCA 4DH7A 3C7QA 4BYIA 4DTBA 3L8SA 3SAYA 3HX4A 4BDGA 3PXFA 1OECA 5J5SA 1REJA 3D2IA 3ORXA 4FSQA 5HG7A 3SG9A 3EZVA 5M44A 3P1AA 5LARA 3U6HA 1WVXA 2OZOA 2WOUA 3LM5A 1H1SA 2PWLA 4C4HA 4DEHA 1WMKA 5IA4A 2QODA 3BHHA 3UPZA 3DGKA 3KVWA 4MHAA 4FT9A 4CLJA 3HMMA 4FKOA 2CLXA 3FQHA 3H4JA 4IB5A 4QRCA 4OTPA 4UXLA 4C61A 5EI6A 4RT7A 4HVIA 2BMCA 3DCVA 3W16A 4BZDA 5AUVA 3C5IA 2IWIA 2VTQA 4FV7A 4BICA 3W0MA 3W2QA 3LXPA 4IMYA 4RA4A 4F9WA 3A62A 4FJVA 1V0PA 2F7ZE 2QLQA 4U40A 4FV4A 5LOHA 3R9DA 3C4FA 4WUAA 3E3BX 2B9HA 3QGWA 5GZAA 2J9MA 1W98A 2HZIA 3NZ0A 3FI8A 3A99A 4UB7A 3PP0A 1FPUA 3NEWA 3MS9A 4ZTSA 3M42A 2UZBA 5J1WA 3ID6C 4AW2A 5KBRA 2X7GA 1LR4A 1W2CA 2BHHA 3ORTA 3ZOSA 2W5BA 3CY3A 2GNLA 3RPSA 2XK7A 3FMKA 2QU5A 4P90A 4IVAA 2DS1A 5DT4A 2QOCA 5FEEA 2XMYA 2BDJA 3KB7A 2IZUA 3KRWA 4E3CA 4YC8A 4C4FA 4MK0A 5M09A 4TYGA 3GUBA 2YAAA 3C51A 4EH5A 3DKCA 2PMNX 4GL9A 4AZWA 3CQEA 3AMBA 5G6VA 2PVMA 4YC6A 3IW4A 3FWQA 3PLSA 3KXNA 4ENYA 5CZHA 3VS7A 1Z57A 3PSDA 1H25A 4IBMA 5BPYA 2R3IA 4O4EA 3CIKA 4JOAA 5FBOA 3QTIA 1U59A 2IVUA 4YZBA 3SGCA 4MXAA 4QTDA 4FSWA 2RFNA 4FKPA 3B2WA 1PXMA 4FG8A 4RJ4A 3D7TB 3LAUA 2XP2A 3MI9A 4FR4A 4MVFA 4OBPA 4FTAA 4RIWB 3LFBA 4DFYA 1KE6A 4DH5A 2Q0BA 4BGHA 2EWAA 1S9IA 4PPAA 4PNIA 4H3QA 5EYMA 2NRYA 2XIZA 4BL1A 1ZMUA 3U4WA 4FSTA 2ZFYA 4KS7A 1EH4A 2JIIA 3QZHA 4WBOA 3M1SA 3S2PA 2P4IA 3QA8A 4QMOA 5KHWA 1WVYA 4YC3A 5FDXA 4FZ6A 5CY3A 4ZEGA 4E6QA 3ULIA 3NGAA 1GOLA 5HLPA 4FL2A 4FVPA 4WSQA 5KX8A 1QPDA 4ACMA 3BE2A 4G3DA 3CSVA 4XP3A 3OWKA 4AW5A 3CTJA 4EI4A 2XANA 4D2RA 4S32A 4IC8A 2ITYA 1Q3DA 2HXLA 3PJCA 4O22A 3UYTA 4FKUA 2GFCA 5J7HA 4XH6A 5HE2A 3G2FA 5GJGA 3C0GA 5FEQA 4I5PA 4O4BB 3VF8A 1H8FA 4NJDA 4YNEA 2OLCA 3BV3A 4D4VA 4PMPA 3ZDIA 5CZIA 3UOJA 5A4EA 2QO7A 3RCJA 3BBWA 4CEGA 4Z9LA 4AT4A 3N9XA 5KMOA 4O27B 1PXPA 3E8NA 2WGJA 5LVLA 3FMDA 3RAKA 4TWNA 2HIWA 4FGBA 1IA8A 5IUHA 2AC3A 2A27A 4RFZA 2QLUA 4X2KA 4F0GA 3JPVA 4LGGA 4I3ZA 3KGAA 3ALOA 2JDVA 2VTTA 3U4UA 4YGAA 3SD0A 3OZ6A 2EUFB 4JL9A 3BI6A 3PE2A 2J0IA 4FEQA 5AP2A 4O86A 4CXAA 4UWYA 5JN2A 1OZ1A 2DYLA 2QOHA 2V55A 4KSPA 5AP4A 4RC4A 4EYMA 3HVCA 3JVRA 1TKIA 3UIMA 2FH9A 2PMIA 5HIDA 4NUSA 3RJCA 2WMBA 3QTSA 5FP6A 5IA5A 4ASDA 4BCNA 1PXLA 3L9LA 3UO5A 4FSNA 2J0KA 5GIOE 1R39A 2J0JA 4M14A 3DPKA 3NUYA 4TN6A 2C5VA 4B7TA 3ZUUA 5ANJA 4ASEA 2WTVA 3BYSA 3FSFA 3KIOC 3BEAA 3VUGA 1HCLA 2OICA 3LCDA 3ZZWA 2YLFA 3OS3A 4QQTA 2X7FA 3FDNA 3LKMA 4QPSA 4IVBA 2W99B 3R2YA 5EKOA 3VJNA 1H00A 4IACA 5HI2A 3VVHA 3WZJA 5IUGA 3L1SA 4HCTA 4HVSA 4BDIA 4MXCA 2OJJA 4O4FA 1YDSE 3KK9A 2F4JA 4WKQA 2X9EA 5ETAA 3VNTA 3Q9WA 5HKMA 2QHNA 1Y91A 4TYEA 4DC2A 3EQHA 3P08A 2ERZE 3LXNA 3UODA 3ZO4A 4LGDA 5IPJA 1Q3WA 4DHJA 4ZMEA 3MY0A 1XWSA 4FIEA 1H1WA 3IONA 3OTUA 1G5SA 4KBKA 3PVUA 2OIBA 3JS2A 2GNGA 2R0UA 1OB3A 5FM3A 4F6UA 3JY0A 2GS7A 4R5SA 1REKA 2C6KA 4NCTC 3EKKA 2F2CB 3LJ2A 3TZ7A 3KMUA 3OVVA 3QTZA 2HZ4A 4UN0C 2QG5A 3CR0A 3LE6A 3NYNA 5H3QA 4W4YA 1JSVA 3QX4A 4TPTA 4EH6A 1PMUA 4Z55A 3QTQA 3UDBA 4XCUA 3KREA 3NLBA 4FZDB 4PMSA 4AF3A 5JRSA 5AP7A 4IZ5A 4PMMA 3K2LA 5CXHA 3G5DA 2BVAA 3DBEA 1CMKE 2CLQA 2VNWA 4BB4A 4D2PA 3ZFXA 3ZM4A 3HMPA 4AXDA 2XAOA 3OOGA 4I6BA 2QURA 2R3JA 2OIQA 2QR7A 3ANRA 4U44A 4ANLA 3GBZA 4H3BA 3HV3A 3QZIA 2BUJA 4OGRA 4TNDA 4D28A 2C47A 3OMVA 4PWNA 5BYZA 2QHMA 4E93A 4F1MA 2YN8A 4H05A 1PMEA 2RFSA 3LFQA 5CEOA 5DR6A 5DNRA 2W0JA 5FXSA 2XKCA 4EWHA 3LFCA 2PMOX 4TWCA 4XP0A 4TW9A 5EYCA 4OBOA 2JDOA 2PVLA 2W4OA 4IDVA 4X7QA 2WPAA 3W0PA 4FBXA 3PTGA 4NIFA 3PJ3A 3C4ZA 2YDJA 3I1AA 4AOIA 4RVMA 3TI1A 3FUPA 3O51A 3ETAA 5CAPA 4O7ZA 4F7NA 4YURA 3R7UA 4X3FC 2XNEA 2FSOX 3EKNA 3TM0A 2G2HA 4M12A 2BFYA 3FI3A 2GS2A 2QR8A 1FVRA 4WSYA 5AV3A 1CDKA 3BLHA 4G5JA 1UKIA 1XMMA 3KMMA 4L8MA 1M2PA 4JIKA 2ZVAA 2J51A 5EK7A 5IEVA 4CQGA 5IH5A 4F1TA 4A9YA 1TZDA 4DH3A 3PXYA 3G33A 4OAUC 4O21A 4NM7A 3SXFA 1YOLA 3KL8A 4DE4A 2LAVA 1APME 3ZS5A 2PE2A 5CU3A 4IANA 1NA7A 4AGUA 4GFMA 3U87A 4FK3A 1TQIA 4BF2A 3GU8A 3QQKA 4DITA 5EDRA 5KKRC 4C2WA 4M7IA 1RW8A 4RQKA 2VTPA 4R6VA 3IDBA 4UYNA 4EK5A 4II5A 3SLSA 4DLIA 2ESMA 5HE1A 4CSVA 3FMHA 5IQAA 1FMOE 3DZOA 4YBKA 4D2WA 5DYJA 1YXXA 3B8QA 2YJRA 4UMTA 4U41A 3DFCB 1U4DA 4HYHA 1WVWA 1J1BA 2RFDA 3FV8A 3PJ8A 2YCQA 3UO4A 5J1VA 2GQRA 4ITJA 3SOAA 3DK6A 4FICA 5JFSA 3LQ3A 3IPHA 3LVPA 1WBSA 2QG7A 3KF4A 2HOGA 3ZLWA 5LJJA 2C3LA 2R3OA 3D5UA 5D1JA 3VS2A 4A4LA 3A4PA 4O7LA 1GZNA 3F7WA 3U55A 4NTSA 5E90A 2OSCA 3E88A 4TT7A 3QBNA 5EYKA 4DEGA 4YJPA 2EU9A 2VGPA 3EQBA 4QMPA 4R78A 4YTHA 1OITA 3VONA 3GU6A 5LCJA 2R3PA 3NR9A 1WBNA 3NNVA 2R3HA 3QWJA 2E9UA 2X9FA 3GC9A 4DG3E 2BR1A 4EQCA 1E9HA 2A4LA 2VUWA 5FTGA 3GP0A 2OXXA 4AE9A 4EK6A 2ITPA 3MFUA 5HG5A 3QQJA 5K5NA 2C6LA 4PNKA 3KQ7A 1JSTA 3IGGA 4Q5EA 1JVPP 3LFEA 3CLYA 2OZAB 5TKDA 2IVVA 1H08A 3FLZA 4R7HA 2DQ7X 2UZDA 3RP9A 1XH4A 3VUIA 5M56A 4CYIA 4I4EA 3F2AA 2ITUA 2W4KA 2XNBA 3COIA 4JT3A 2NRUA 3TN8A 3QTWA 1QMZA 2ZAZA 4MNFA 1SNXA 1U54B 5DGZA 3TNQB 4A9UA 4C36A 2XKDA 3MPTA 2WTDA 4IWOA 4ZLZA 5IDPA 2ZV7A 4XG3A 5D10A 3I6UA 2Y4IC 2QKRA 4C3RA 3UNZA 5FM2A 3W32A 3MV5A 3PIXA 5IA1A 1ZZ2A 4JR7A 5I9VA 4GJ2A 1XBCA 3NUSA 3DK7A 4RIYB 5ACBC 5M4UA 2J5FA 2XBJA 2UW6A 1OPKA 3GFWA 1M2RA 2HYYA 4LOOA 4DG2E 4BIDA 3ZZEA 5EKNA 2IW6A 4CFNA 2FO0A 4APCA 4O7NA 1YI3A 2E9OA 5ANGA 4AGCA 1NW1A 3DLZA 4IVDA 1JKLA 3MSSA 4G3GA 4BY9E 2ONLA 2JAVA 4FC0A 3Q4TA 5T6KA 4CFMA 3C9WA 2B7AA 4M68A 3OCBA 4KWPA 4XNEA 2VZ6A 1IEPA 1F5QA 3KEXA 1PJKA 4Y72A 2XEZA 1OUKA 1E1VA 3MGYA 3VF9A 2PVYA 3G9LX 5LVMA 4BJJB 4DEAA 5GZ9A 5KO1A 2Y7JA 3H3CA 3UC3A 4F4PA 5BVNA 4ENXA 3RKBA 1PKDA 3ZO1A 4L53A 3EQRA 4IWPA 3EN4A 4UMUA 3LCOA 3CD3A 3LZBA 3NIEA 3R1YA 4JIAA 3W55A 3PIYA 5JGAA 5E8YA 3DY7A 3V6RA 3VUDA 3UDSA 1XBBA 2IW9A 4EK4A 5HNGA 5GHVA 2BRGA 2WAJA 2YLEA 4RWKA 4KIQA 2UW7A 2ZM3A 5FXQA 3UOKA 2B9IA 4Y8DA 5E8ZA 4O7VA 1Q8UA 3OF0A 4DHZA 2I0HA 2WQBA 5AMNA 4JG8A 2C6DA 2OZAA 4CD0A 4RMZA 4QDEA 4M8TA 3V3VA 4FA2A 2W4JA 1IR3A 3N4UA 4BCKA 5J9ZA 5JGDA 4FMQA 5FDPA 2B52A 4O81A 3RMFA 3S00A 2VTOA 2UV2A 4RX5A 1MQ4A 4K1BA 3QUEA 3VW6A 5AV1A 5JMSA 3KC3A 3LXLA 3OWLA 4PUZA 5L8KA 3A61A 3RVGA 4MUQA 2CGUA 3BHVA 2PVHA 4YO4A 3NW7A 3Q9YA 2YM6A 5J87A 4NKSA 3WOWA 3MH1A 3V8SA 2X8DA 3FC2A 1QL6A 3NSZA 2XJ0A 2C3IB 3FLYA 4RGJA 2BALA 3OBGA 4RLLA 2C6EA 3NUPA 2O0UA 4RWIA 4I4FA 4FF8A 4JQ7A 2HENA 3ELJA 3NRMA 4XV3A 4XYFA 3QRJA 2GU8A 3VUTA 3PXQA 3D5XA 3ZRKA 4U9AA 5HTIA 2GCDA 2BRBA 3Q5ZA 4HZRA 5DR9A 2XIXA 3R1SA 4EOOA 1SM2A 5A9UA 1ERKA 3EFJA 3PA5A 1G8KA 4YTIA 3QLFA 4DFLA 5BMMA 3DXQA 3TV7A 3FPQA 3DV3A 4TYHA 3UOHA 4KKEA 2PK9A 2R3KA 4FTTA 4C4GA 4GK2A 1P2AA 4FSRA 4JG7A 4MD9E 3VW8A 5IA2A 3ZCLA 2BDWA 2Y9QA 3F3VA 5AX3A 3Q9ZA 2UW8A 2QD9A 2Y8OA 3OHTA 4NFNA 3QCXA 5JRQA 3ZSHA 4AXFA 3QRTA 3V51A 3NNXA 4L45A 1V1KA 3RWPA 1YOMA 3POOA 2VAGA 4L44A 4CMTA 4LI5A 3DKGA 3VHKA 3ZLYA 2R4BA 2RKUA 3QKMA 2AEGA 3D5VA 3E3PA 4XG4A 3KULA 5M4IA 5JFXA 4TZRA 2WMSA 2XYUA 1BL6A 3JXWA 4ALUA 2RG5A 2UZWE 1XMLA 3UG1A 4IX4A 5IA3A 3NFFB 2B9FA 3G51A 1Y8YA 4ANBA 2OF4A 1AD5A 1J91A 2BKZA 3DTWA 4QMYA 2WQEA 3TKIA 2WMQA 3EL7A 3MVHA 2QOQA 4G5PA 1VEBA 3CC6A 2YJSA 3WZEA 2PVFA 5M53A 4F08A 4O7SA 3ZBFA 4JLCA 2AYPA 4CG9A 3WYXA 3PPKA 4TY1A 4GU9A 4UALA 2C6TA 3CPBA 4IE9A 3FAAA 5AUWA 2ERKA 4EH2A 4ASXA 3GCUA 4NT4A 4B6LA 5FD2A 1NVRA 4EHZA 1H28A 2PZPA 3BKBA 4F7SA 2FVDA 3RALA 2VO3A 4FSYA 1XH5A 4FKSA 3D2KA 4ZOGA 5GJFA 5HEZA 3WZUA 5AV4A 5FGKA 1O6YA 3MW1A 4XRLA 1YKRA 5KMNA 4FEVA 4X21A 2R3RA 5IF1A 4RX7A 4DYMA 2PUIA 4FG7A 4L43A 4I0TA 3E5AA 3RPRA 1AQ1A 1H4LA 5D41A 3KU2A 4O0RA 5K0KA 2XCKA 3UE4A 4B0GA 4M97A 3A7IA 4MYGA 4EOJA 1Q61A 1OIRA 2WFYA 4RVKA 4HGSA 4USFA 2PUPA 4AU8A 4JQEA 4DGGA 3BGPA 5ANEA 3FPMA 3SV0A 5HIEA 4F99A 1ZOEA 1W8CA 2YFXA 1F3MC 3RI1A 3DKFA 3QQGA 2OXYA 2X81A 3JY9A 4XJ0A 2ZV8A 2OGVA 4M0ZA 2V7AA 3G15A 3UZRA 5FBNC 4EJNA 2GNFA 3QUPA 2BRNA 3MFTA 4FTIA 5E92A 3V5LA 4CFVA 1ZOHA 3TKHA 4EH8A 4FV1A 3IOKA 1OBGA 3R02A 5IQEA 3EJ1A 4GK4A 3RPOA 1YW2A 2O5KA 3P7AA 4BHNA 1W2DA 5GJDA 1H07A 5HESA 4FNWA 2XK3A 1H0VA 3WF6A 3BL9A 1OPLA 2AUHA 3DXNA 3FZPA 4MD8E 5FTQA 5HCZA 4YMJA 5JQ5A 3HA8A 2XAMA 2J2IB 4LOPA 3ATTA 3U8WA 4NKAA 3UQGA 1LPUA 4NEUA 2VN9A 2WMRA 4FUYA 2NP8A 5ANOA 3C4XA 5DE2A 2VX0A 3QYZA 4F64A 4BGGA 3FY2A 4MCVA 3DAJA 3CJFA 2V22A 4DFUA 3DJ7A 5IKWA 4IB1A 2LGCA 2PVNA 3MJ2A 1H1RA 3QC9A 4FTQA 4UZHA 3DB6A 4U7ZA 3G9NA 5EI2A 1H1QA 4C02A 2GNHA 2J50A 4LV5A 4FT3A 3JVSA 3A7JA 1IRKA 2BRMA 5IQCA 2Y6OA 3NYXA 4E73A 2Y4PA 3CGOA 3BGQA 3OEZA 2C0OA 3I7CA 3B8RA 3KRRA 2WKMA 1OKZA 3DDPA 3Q6WA 4E4XA 4ZTMA 2UZUE 4QYGA 2VTHA 2IEWA 3UP7A 3IECA 3UZPA 3ET7A 3ZH8A 1CKPA 4AN2A 3MIAA 3ZFYA 2ITVA 3DDQA 2C5NA 4AE6A 2DWBA