3EQRA

Crystal structure of ack1 with compound t74
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
276
structure length
270
Chain Sequence
LTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Activated CDC42 kinase 1
publication title Identification and optimization of N3,N6-diaryl-1H-pyrazolo[3,4-d]pyrimidine-3,6-diamines as a novel class of ACK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 270
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3eqrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3eqrA01
1PKGA 4H1MA 4C4FA 4F9CA 5CAOA 2OG8A 4PY1A 3CEKA 5E1EA 3EN6A 5J79A 2GS7A 2VTLA 3C0HA 4D5HA 2OZAA 4HGEA 4FZ7A 4BZDA 3OWJA 3PVGA 2C0IA 2BTRA 4JDKA 4IE9A 3C9WA 3AT2A 4RQKA 5DBXA 2Z7RA 4FSMA 4X3FC 4BDCA 2A2AA 5EYCA 4G5PA 5EOLA 4BDAA 3GFEA 5KHWA 2JFLA 5KMLA 4QMVA 2PZPA 3OW3A 2W9ZB 1W0XC 5AAFA 3R7IA 1H1QA 1SZMA 3MH2A 4I41A 4P5QA 3TNWA 3NCGA 3V8SA 3FKOA 2BILB 4E20A 4UZHA 4FNXA 1X8BA 3KXGA 5DG5A 3S4QA 4BIEA 5AA9A 4C61A 2YIRA 3K3JA 3GVUA 3KB7A 2F4JA 3LQ5A 3O7LD 4ZS0A 4DH8A 5A9UA 3GU7A 5J1VA 2NRUA 2G01A 1NXKA 4D5KA 3U54A 3O8UA 5EM7A 3ZC5A 4R3RA 4O0SA 4BDHA 4DLIA 2IO6A 3ALOA 2BKKA 2QR7A 1LR4A 5M09A 2QG5A 4V05A 1BKXA 5CSXA 1NVQA 5F1ZA 3VUGA 4B99A 3VS6A 3HV4A 5EM5A 5BVOA 1P4FA 2Z8CA 4BGGA 3PY0A 2VTJA 1OUKA 3EQCA 3QTRA 2RKUA 4F0FA 3V5WA 4PPAA 4K9YA 3OG7A 2BZIB 2HZIA 3PXFA 4QMLA 2YHVA 3ZXZA 4EUUA 3SG8A 3BZ3A 3MY5A 5L6OA 3MYGA 2C6MA 4HYHA 3RCDA 3C4WA 5A14A 2BROA 2R3NA 3RALA 2J0LA 5HLNA 3EZRA 3ZC6A 3DB8A 4R78A 2GNGA 2X9FA 4XG3A 1JSTA 3VHKA 3UTOA 4ANNA 1OKVA 4R5SA 2VUWA 2VGPA 5LMBA 2E2BA 3BHHA 4M66A 3CQEA 3SOAA 4JAJA 4TRLA 4IAYA 3ZLXA 5GINE 5HO7A 2OIQA 3LE6A 4W4XA 1YWVA 2XK8A 4DFYA 5CAVA 3R2BA 1ZARA 2UW8A 3R1QA 4HCTA 3HYHA 3MN3A 3POZA 4WBBB 5M4FA 4BTMA 3C4ZA 1YXXA 4NM0A 2F2UA 2RF9A 4R5YA 4U0IA 4UV0A 3LMGA 4DEBA 3AC8A 1XBCA 2WTIA 2X8DA 3SW4A 1YHVA 3R1YA 4YZ9A 4I6QA 3PA3A 3K5VA 2FH9A 3OEFX 4FSZA 1ZOEA 1R0PA 3R30A 3T3VA 2CNVA 4CFVA 3UQCA 5KBRA 3ZLSA 3FPQA 2VTPA 4YJTA 2XNNA 3AG9A 2P2IA 4RC4A 4FG9A 4WA9A 5CI7A 3RPSA 4FUYA 5JFSA 3FWQA 4IDVA 2PMNX 5IEVA 5T6KA 1O9UA 2EVAA 5L2IA 4X2NA 2R7BA 2ITVA 3L8XA 5DFPA 3UG1A 4FVRA 4PNIA 4ACGA 3DY7A 2GPHA 5TKDA 5JFWA 2BVAA 5GJGA 2WZJA 5IMEA 3VRZA 4IH8A 4FKWA 3C51A 4XV1A 4TXCA 3RK5A 1BX6A 2ZV7A 3C4EA 5IEXA 4ZSLA 4GW8A 4ZY4A 3MY0A 2IW9A 4ANSA 5B7VA 1ZAOA 2XYNA 3FZOA 3W18A 5JMSA 2Y4IB 4MAOA 4FV2A 4XP3A 4OTDA 3VBQA 3RKBA 3SXSA 3GCUA 2PUUA 1GY3A 3KK8A 4P4CA 5J95A 3VQHA 4CLIA 1MP8A 2I0HA 4QMUA 2GCDA 2YDIA 3FLWA 4JG8A 3Q96A 5I0BA 4EJNA 4YR8A 3KXNA 3RMFA 4U8ZA 4O1PA 4K18A 3TUCA 4Z16A 2OJ9A 1R0EA 4PV0A 3F88A 4F6SA 4XV3A 5AAGA 4QQ5A 2O63A 2YFXA 1P5EA 3DK3A 3FZTA 4FSNA 2XJ1A 1ZY5A 4FVPA 4K6ZA 3MVMA 4CFWA 4DT9A 4WG4A 3KK9A 3ZZWA 3EFJA 3IK3A 1OGUA 4AT5A 5CU6A 3PPZA 3OCBA 4PTGA 4YZMA 5HQ0A 2WNTA 4PPCA 3PE1A 5J8IA 4EH8A 2ITNA 4G9RA 4IZYA 5ETCA 2YZLA 2HZ0A 5DRBA 3HRFA 3ZDUA 3ORZA 2VTIA 5ETFA 2B0QA 3GGFA 4KBAA 3UNKA 4M68A 4UY9A 2C5YA 3GQLA 2WMWA 4FT9A 4FVQA 2XBJA 4TYGA 3OOGA 5HCYA 4IB1A 2H34A 4XG9A 5FBOA 3QHWA 4IWOA 4PMSA 3R7UA 3RNIA 3WZUA 4J99A 2JKKA 3R9NA 4F99A 2UW0A 4FE2A 5ANDA 3GCSA 5AV1A 4GVAA 4KUJA 1F5QA 4CV8A 5IMXA 5IUGA 2V7OA 4EUTA 1H27A 3MWUA 4RJ7A 5IKWA 3V3VA 5AV2A 4FOBA 3Q2MA 4FKUA 4XP0A 4A07A 5DIAA 2QOQA 2R3KA 5TOZA 1XH9A 3R71A 2X2MA 1XHAA 2NO3A 3N4TA 2CGUA 3PIXA 5C9CA 3R8LA 2ETRA 4O0RA 3D15A 2PUIA 4QRCA 3W2QA 3T8OA 4F6WA 4YSJA 3VUIA 3FMNA 1UU7A 4Q2AA 5IEYA 4DFXE 3QRIA 2UZTA 2WMBA 4P5ZA 4C36A 4DFLA 4EKKA 2HCKA 3OD6X 4P7EA 4WUNA 1OIYA 2RL5A 2XKDA 3DV3A 3QD0A 4YLJA 4TWCA 3TNHA 3ZU7A 3LAUA 4YLLA 3WIGA 4FTIA 1BI8A 1OPKA 3DU8A 3HMMA 3A7HA 2BUJA 4FSUA 1CDKA 3FXZA 3CTJA 3UG2A 3ZXTA 3TL8A 4YO4A 2R9SA 2J4ZA 4ZS4A 4G6NA 4X0MA 4EONA 2WEIA 3COHA 3F66A 3AGLA 3MB7A 3S3IA 2ZJWA 3UO6A 1T45A 5L8LA 1GIHA 3HDNA 2R3MA 3H9FA 4DINA 5HTIA 4M12A 5AJQA 1IEPA 1J7IA 4CCBA 3MDYA 5HNBA 4RSSA 1M17A 3RZFA 3ZFMA 4CYIA 3GCPA 4FC0A 3KXZA 1YOLA 3Q9WA 2J5EA 5EKNA 4H58A 3WYXA 3KQ7A 4Q9ZA 4JNWA 3ERKA 2YA9A 4YHJA 3P4KA 5AEPA 2J0MB 4X2KA 2WAJA 3FY0A 5M4IA 4I92A 4I5MA 3P7AA 5ACBC 2G1TA 5KKRC 4XG6A 3AC2A 4GKHA 3F2NA 3CBLA 1IAHA 2HOGA 2WTJA 3UYTA 5JZJA 3DTWA 3NW5A 5D12A 4J71A 3QQGA 4M13A 3LW0A 2QC6A 1OKWA 1MRYA 3BGQA 3CXWA 2B9HA 3O8TA 2PE2A 2C6KA 5H8EA 3QRTA 2ITTA 4W4YA 2W1HA 5IU2A 4FIHA 3N4UA 4EH2A 4G1WA 4FL2A 3GCQA 4QYYA 2VTQA 3IS5A 1M52A 4M15A 2GTMA 4CT1A 4FBXA 1YWNA 1OKZA 2IWIA 2JKMA 3Q9ZA 4JR7A 4B8MA 2HY0A 3MW1A 3FLNC 3MPAA 3HVCA 2UW5A 5IPJA 3QCSA 5FDPA 3V01A 3QZHA 3PIZA 4UX9A 5JZNA 4LRMA 3NUAA 4AGCA 3ALNA 2LGCA 4DH1A 5AAEA 4XH6A 5GZ9A 1GZKA 4EOQA 2CLQA 3TKHA 4AZEA 5HX8A 1MQ4A 5EYDA 3SG9A 4GT3A 1L3RE 2WB8A 3GC9A 3RHKA 4Y73A 1YWRA 5ANOA 3ULIA 3GOPA 3FKLA 3BEAA 3QTUA 1PMEA 2OU7A 4HVIA 4YP8A 5DT4A 2W5AA 3A60A 5AR4A 3KN6A 4IX3A 4EORA 1K9AA 2UW7A 5DR9A 3TZ7A 4CFFA 4O91A 1J3HA 4Z3VA 2B1PA 1ZWSA 4DITA 5AR3A 5EYKA 2FSOX 2Z7LA 3EMGA 1JAMA 3LFEA 4YHFA 3BWJA 5HCZA 1CM8A 3K2LA 4PL4A 4WNOA 3SXFA 3D7TA 2PMLX 3FL4A 4AS0A 4UWYA 4G3GA 1UNLA 4RX9A 1GIJA 3FMHA 4FG8A 4EOPA 5J9ZA 2OW3A 3CTQA 3HL7A 3SHEA 3ZHPC 3AT4A 3ZLWA 3GENA 5EQPA 2OJGA 1J7UA 2G2IA 4U79A 5AP4A 2R3LA 1UKIA 3FMLA 1FGIA 2QKRA 4TW9A 2CGVA 4C2WA 3U9NA 1LEZA 4QTDA 1H0WA 3VUMA 1PXNA 2BDJA 1H00A 2R3GA 5KUPA 2AYPA 4ZXTA 1W84A 3EWHA 3PYYA 2HXQA 1YI6A 2YIXA 4BWKA 2J6MA 4DA5A 1CKIA 3RI1A 2YM3A 1R3CA 2JIIA 3D94A 5DR6A 4ITJA 2CKQA 2I40A 3KCKA 2C1BA 5BMSA 2C3JA 5H3QA 5HZNA 2QODA 5FRIA 2J5FA 4HNFA 3RPOA 4M7IA 1OBDA 2HIWA 3BV2A 5ANJA 3D5WA 1FMOE 4FKPA 3F7WA 4O6EA 2W1CA 4KIPA 2ONLC 5C8KA 2CNUA 2R0IA 3IONA 3UOKA 5DMZA 2PK9A 5LJJA 2JIVA 3GC0A 1ND4A 1CKJA 3N51A 3R01A 3HUBA 4W8DA 3CGOA 4TL0A 3NZ0A 3P7BA 3TZ9A 5FXRA 3PXYA 4NM7A 2XBAA 4S2ZA 3NYOA 3DAJA 1P14A 4MXYA 5HU3A 2KULA 3PRIA 4GG7A 4K1BA 4N70A 1TQPA 3D2IA 3MH0A 4OBOA 3GNIB 5E8WA 4O7RA 3E8NA 4BBMA 1F3MC 5CF5A 3L9MA 2NP8A 4IAIA 4MWIA 1OIRA 3QUEA 4WNMA 5AIRA 4M8TA 4Y5QA 3UIMA 3SA0A 5LXMA 4GUEA 2SRCA 3CE3A 4O0TA 3Q4UA 4AUAA 1KE9A 4CQGA 1F0QA 1WZYA 2C6OA 3TCPA 4CT2A 5KMOA 2ITQA 1PYEA 4FTMA 4DGOA 4ANOA 4KKGA 2BRNA 2I0YA 5ACKA 5L2SA 3KF4A 2PU8A 3LVPA 5CU0A 4IQ6A 4GK3A 4OR5A 2JEDA 5E1SA 4FKRA 4XBRA 5KCVA 1JQHA 4E3CA 4O38A 2O5KA 2O8YA 4O7YA 2GMXA 2Y9QA 3AMYA 3LOKA 2OICA 4JBOA 4WRGA 1UV5A 4QP7A 4X2JA 3UQFA 2CJMA 4FTKA 4LQMA 4ZY5A 3UZPA 4LM5A 4WSYA 3AGMA 2WHBA 1L8TA 4YGAA 4RBLA 2B9IA 2YM5A 3HV3A 3ZBFA 3KC3A 1QPDA 4GG5A 3P5KA 5DVRA 2OXYA 5CEIA 4I1ZA 5EHYA 4KA3A 4ACHA 3ZEWA 1Y8YA 4L8MA 1GNGA 3LXLA 4OTGA 4DEGA 4YNOA 5IQGA 2XK6A 3DXNA 3MV5A 2Z7QA 3MBLA 4ZTHA 2XA4A 4FSYA 4ZSAA 3TDWA 3OUNB 3ZFYA 3EN4A 4IW0A 3G9LX 4QP8A 3GEQA 4BVUA 2XH5A 2C5XA 3SW7A 2PMOX 4OTRA 4PTEA 5DPVA 2FSMX 3ENHA 4JBVA 3HV5A 2WMAA 3HUCA 4FIEA 4QP1A 3EFWA 3D7ZA 5C8MA 1YXUA 5HE0A 1YHSA 1AGWA 1JPAA 4D4SA 5GNKA 4R3PA 4ENXA 2PE1A 2OXDA 3A2CA 4JQ8A 4O96A 4S31A 1Z5MA 4GSBA 4DG0E 3AC5A 1H0VA 2C6TA 4X3FB 3HV7A 4N0SA 3GU8A 2WMXA 5ITAA 2PPQA 5HNGA 2A1AB 2C30A 4JOAA 2YDJA 2XZSA 5AR7A 4FIFA 4F4PA 3G15A 4FEQA 4IHPA 4NL0A 1LP4A 1H1SA 4I93A 2P55A 4MX9A 2PSQA 3MJ2A 3I7CA 4OTPA 1OL5A 3GC8A 3VRYA 4BKZA 4YJSA 3JYAA 2WTVA 2X9EA 3LHJA 4HYIA 3VQUA 4HVHA 2WMTA 2VWZA 3KXXA 4O27B 5JK3A 4YPSA 1AD5A 5D1JA 2V7AA 3BGZA 5F94A 1YI3A 3QGWA 4IJ9A 4K8AA 4UMRA 1NT2A 3VJNA 2B9JA 2JDVA 2ZB1A 4MVFA 3ORXA 3Q5ZA 3R8VA 2UZLA 3SAYA 4Z7HA 4YJRA 2GDOA 2O64A 1U54A 3QF9A 4BDDA 3QLFA 2W1IA 5DRDA 2FYSA 2W5BA 1GZ8A 4AT3A 1XQZA 1NA7A 2J0JA 4PUZA 3F2RA 3UQGA 1Q99A 3PVUA 4IEBA 2JBPA 4IAKA 4D4VA 4JLCA 2R5TA 3ZRKA 4AE9A 4YJVA 3FHRA 2B4SB 5I3OA 2UZBA 1WAKA 4I23A 4A4OA 1JNKA 4X6RA 1WBOA 3P08A 5KMNA 4CKIA 4GCJA 5LQFA 5CAQA 3QQJA 1H1RA 4C35A 4CRLA 2HK5A 4X7QA 2C47A 3WF5A 5EI6A 4AF3A 5IQEA 4C4JA 3E92A 3UMXA 4ARKA 3GCVA 4FT7A 5CT0A 2W1ZA 4NW6A 2O0UA 3MIAA 3OT3A 4UYNA 4FIGA 5I9ZA 3TNIA 1APME 5FP5A 1UKHA 2O2UA 1IA9A 1OB3A 3C4FA 3DS6A 4GK4A 4ALVA 4E93A 3W33A 4JVGA 4N6ZA 1CSNA 3GT8A 2VX3A 5AP2A 5L2QA 4IXPA 3JVRA 4WUAA 3ZSHA 3BPRA 2JIUA 1K2PA 4XLVA 3EQGA 5CS6A 4OLIA 3ACJA 3IW8A 3O8PA 2HELA 4OW8A 3HMIA 3KRRA 2W9FB 3KKVA 5KMMA 1PJKA 4EJ7A 2OJJA 4S32A 1KOBA 2BRHA 4F9BA 2FSTX 2WMUA 4FNYA 4CZUA 4DH3A 4TWOA 3NWWA 3HP2A 3N9XA 4NTTA 3GOKA 4KWPA 3PJ3A 3WILA 4I21A 3VW6A 2YLEA 4J7BA 1Q8TA 4KSQA 2IW8A 3E5AA 4C34A 5HICA 4M0YA 2WU6A 5L8KA 3F9NA 2O65A 2BIKB 2WQOA 3Q9YA 5CQWA 4EH9A 2YZAA 3DJ6A 1JWHA 2PYWA 3VS3A 4X3JA 4GU9A 2XRUA 4QP6A 3DK6A 5EK7A 4OTHA 4B8LA 4MWHA 4AWIA 3QQUA 1RW8A 3AD6A 3PIYA 3U55A 5DH3A 1JSVA 4WT6A 2X7GA 3ZM4A 4BF2A 2QOLA 5T3QA 4AP7A 3WIKA 1XH4A 3QBNA 2JAMA 4BBFA 4DBNA 3D4QA 2ERKA 3QD2B 3LCDA 3ORTA 3QL8A 3QZIA 3CJGA 4CKJA 2B53A 3FLZA 3HNGA 3NIEA 3PP1A 4HOKA 4NT4A 3SRVB 1J1CA 1PXKA 3WOWA 2XK3A 4R1YA 5F20A 4A9SA 3G2FA 2CDZA 4EH7A 4EQUA 3RAKA 3TT0A 4OAVB 5LARA 4EZ3A 2PVMA 3COIA 5BVDA 5M4CA 4NIFA 4WD5A 4EK5A 3E8CA 3MFTA 3KXMA 3LCTA 2FGIA 2R3FA 3WYYA 3HRBA 5CNNA 5TO8A 3MB6A 3BWFA 4NWMA 3QCXA 3ZLYA 2OH4A 4R7HA 4IX4A 3OOMA 3O96A 4TYJA 3NIZA 4YZNA 3ID6C 4YU2A 1GOLA 1GIIA 4UYAA 4O6LA 5HE3A 1JBPE 3U9CA 3VS2A 3CJFA 4EZ5A 3WF8A 1ZOHA 1OM1A 1YXSA 2J90A 3KRWA 1B39A 5CTPA 4AQCA 5IQCA 4CQEA 3NVKI 3UDBA 4F9YA 4UWBA 5L4QA 3COMA 4IVDA 4Y72A 4RJ8A 5D11A 4D2VA 4CVAA 1Z9XA 3THBA 2WMQA 3G51A 4AZSA 2NNWB 3QUDA 4NZWB 4A4XA 4GV1A 1Q3DA 1AQ1A 4BCHA 2WTDA 1R78A 4IZ5A 4M69A 3RWPA 5HU9A 1Y91A 3OW4A 2XK4A 3R83A 4UMUA 4C38A 5LVMA 1WVXA 3A7JA 3CKWA 4KIKB 4ZEGA 2ETKA 3KULB 3RM6A 4CFUA 1OZ1A 4DH7A 3VS7A 4QYGA 4AA5A 1QPEA 3F3TA 1WMKA 5HVJA 4DGGA 2YWVA 3PG3A 2IZUA 3DTCA 4UZDA 4Y95A 1UVRA 1V1KA 2QCSA 4FL1A 4PWNA 3G90X 2XK9A 3E3PA 4FKLA 2R3PA 3NUPA 3LIJA 4BDKA 4C58A 5AADA 2UZOA 3R00A 3GP0A 4L67A 5K5NA 3R7YA 2A4LA 4WG3A 2X4FA 4J97A 4BIDA 1H4LA 4C8BA 1YVJA 3MESA 2ZYBA 5C8NA 3U51A 4FT0A 3PA4A 2QD9A 3ZEPA 2BRBA 4YJQA 5BVEA 4EQCA 3ROYA 3L8VA 5GJDA 4DG3E 4D4RA 4J8MA 2ZB0A 4ZJJA 2IZTA 1PHKA 3A61A 3DK7A 4GJ3A 4DTBA 3UVPA 3CIKA 4IC8A 4ASEA 3ZBXA 4BDJA 3H4JA 5CF8A 2JDOA 3OZ6A 4PDPA 4RWLA 3I79A 2J2IB 3EQDA 4DEDA 3S00A 5KKRB 4ANQA 4U5JA 1FQ1B 1JKSA 3KXHA 5DEWA 4B6LA 4PDOA 2PVJA 5CSWA 2W05A 2AC5A 3OY1A 3MFSA 2WOTA 4ASZA 3DZOA 3PZEA 4L46A 3ITZA 4II5A 1OMWA 4RFYA 3WZKA 4GRBA 1BLXA 2QO9A 3BYMA 2Q0NA 3VBVA 1JVPP 3NCZA 4AZTA 4R6VA 2ITYA 2QVSE 1TVOA 4KBCA 4FX3A 4MBIA 3FI8A 3I81A 1REKA 3OC1A 4F1TA 5BVFA 2BZJA 4RJ6A 4RRVA 2EB2A 3UIUA 4AZWA 1J1BA 1H01A 1YDRE 3AD5A 3QRKA 1PXIA 4PQNA 1LEWA 3SC1A 4BCFA 1MQBA 2BZHB 3GFWA 4RIOA 4F0GA 4FIJA 3C1XA 3RAHA 2E9VA 5CVFA 4APPA 5KZ0A 5FP6A 2XK7A 4QPSA 5K5XA 2VAGA 3QRJA 1PXLA 3REPA 4JL9A 3ZS5A 2XJ2A 2UVZA 5E8XA 3ZO4A 5FGKA 3BBWA 3NUNA 4K0YA 4KAOA 2YDKA 4USDA 3LM0A 5AP0A 5HO8A 2UW4A 2Z7SA 3GXLA 3PLSA 2F49A 4L53A 3BHVA 1U54B 4WSQA 4ID7A 3HGKA 3VUHA 2GNJA 3EJ1A 5FM3A 3KREA 3G5DA 5E91A 2WKMA 4FNWA 4M3QA 3NYVA 4DFZE 5HVKA 3OTVA 4TWPA 4IB5A 5JT2A 4IFGA 2FUMA 5J1WA 4O7NA 2HW6A 3QCYA 1YXTA 5G6VA 2V0DA 4FSQA 2OH0E 4DFBA 1QL6A 4XS2A 2UZNA 2IVTA 3FSFA 3MTLA 1K3AA 1ZOGA 3R04A 4LGDA 4DN5A 1PXJA 2X2KA 3H10A 4QTBA 2AC3A 3LJ0A 2QQ7A 3HMOA 5AX9A 3SV0A 3W10A 3DXPA 1YDTE 2C0OA 4U80A 5HGIA 1IR3A 3WF7A 3R02A 4RC3A 2C3LA 3TZMA 5D10A 1SVEA 3I0OA 3CD3A 3G0EA 4UWCA 5AM6A 2OKRA 5TT7A 4FKTA 5E8ZA 3EN9A 4C4EA 1WCCA 2XNMA 2BFXA 2IN6A 4CRSA 4EHVA 2I7QA 4NEUA 5E92A 2PUNA 4QMSA 2WMSA 3ROCA 2OBJA 2Y8OA 3P9JA 3JR1A 2ETMA 4QP9A 4MHAA 4RIXA 5CQUA 4OTIA 4EH5A 2Q83A 1Q3WA 3UOJA 1B6CB 1TQMA 1ZYSA 2ERZE 2JAVA 3W1FA 3DT1A 2ITUA 4H3BA 5T68A 5FTQA 4HGTA 2OSCA 1Y57A 2XIKA 3CGFA 1URWA 2W1FA 2WPAA 5FBNC 4KIQA 4FTQA 4EOKA 3RGFA 5JGDA 5C4LA 1DI9A 2OZOA 4ZZNA 4YHTA 3MFRA 3QALE 2PVFA 3H0ZA 4IB3A 3ATTA 2GNHA 4GU6A 4RC2A 3QTSA 3R1NA 3FQHA 2A27A 3G9NA 4MK0A 2BAQA 1SVGA 4NJDA 4ANLA 3QZFA 5FD2A 4FTAA 3CPCA 4HYUA 3MSSA 1SM2A 4FR4A 3UJGA 2YLFA 4J1RA 4CV9A 5JQ8A 2W4KA 3MVJA 3KFAA 4AFEA 2HY81 4FF8A 2BAKA 3EQBA 3RWQA 5A46A 3HZTA 3QQLA 3DB6A 4FTLA 4IM3A 3LFCA 1PMNA 4QMOA 2UZWE 5I9WA 4FEVA 1RQQA 3NNWA 2X7OA 3UOLA 2BHEA 2PY3A 3I1AA 4HYSA 1FOTA 5L8JA 3UPZA 5E8UA 3G0FA 5LVOA 2CLXA 3K3IA 1ZZ2A 2YM4A 4A9YA 4BTKA 3DOGA 4RIYA 3GU4A 3RPVA 3P78A 4FGRA 3Q53A 3WBLA 3TJCA 5BVNA 2C5OA 2WMVA 4FK6A 4YJOA 5J7HA 4AN2A 3A8XA 2VWBA 2X81A 2ZM3A 1KWPA 4X3FA 2BCJA 3EYHA 1ZYDA 3K54A 5H8BA 4CZTA 5GZ8A 5ANEA 5JN2A 5J5SA 3ZM9A 5HTCA 1GJOA 3QX2A 1WBPA 2VD5A 3M2WA 5AUYA 3SOCA 5BUJA 4NIFB 5LWNA 3Q2JA 1U5RA 4FV7A 5IZFA 1PXOA 3TTIA 3GC7A 3R9DA 3KN5A 1WBVA 5I9YA 1PYXA 4WNPA 3CLYA 4PDSA 4E6QA 4GKIA 3DFAA 3F3WA 3ZUVA 3HDMA 4TN6A 4NJ3A 2GNLA 2OO8X 3C5UA 4FKSA 2BR1A 4KRCA 4FODA 3HA8A 4FV0A 2PZ5A 4QMWA 2DS1A 2ESMA 4YPDA 2J7TA 4DC2A 3D0EA 5HEZA 4F08A 2WD1A 1V0BA 3ETAA 3I0QA 3QQHA 4FG7A 3RINA 3ZUUA 2QURA 3EN7A 5G1XA 3EQIA 1HCLA 3S95A 1FPUA 3FSKA 4D4YA 5ICPA 3SX9A 3VUDA 3DJ5A 5HHWA 2X8EA 2OK1A 2PZIA 4CYJA 3FBVA 3OCSA 2P3GX 2VU3A 5M55A 4FZDB 4CCUA 3PXZA 2WQMA 5BUIA 2J51A 4IWPA 3LCOA 4D2RA 3E8DA 3CCNA 4M69B 5BX0A 1JKTA 3RM7A 4USFA 5FG8A 1VEBA 2B7AA 4O1OA 4R1VA 5IQAA 5AX3A 5HG5A 3F6XA 5D7VA 4I5HA 2VGOA 5HG8A 4G5JA 2ZVAA 1O6LA 4M67A 2X2LA 2DYLA 3PXRA 4E6CA 3EIDA 4GK2A 3BLRA 2Y0AA 3I7BA 3PJ1A 1YW2A 2G2HA 3VWAA 4BHNA 2QOIA 2C6EA 2FVDA 2C4GA 3HECA 3L9PA 2QO7A 4BB4A 3VBYA 3WARA 5A6OA 3DLZA 4AW0A 4V04A 4UXQA 2BRGA 1NY3A 1S9JA 2UV2A 3ZO1A 2WEVA 2QLUA 4ALWA 4CG8A 3PLAE 1XH8A 2HYYA 4C4GA 3PUPA 4IVCA 2QOOA 5CEOA 2C5NA 2ZMDA 4FNZA 3LFBA 3F7ZA 3NUUA 5CXZA 5HORA 4ZZOA 3CS9A 4BR3A 2EXMA 3ZTXA 4E5AX 3RK9A 1M7QA 4BKYA 2GQGA 1PMVA 4F7LA 4C3PA 5TF9A 5CANA 5EM6A 4BDIA 3OCGA 2VTOA 3BRBA 5EFQA 4H05A 2ZMCA 4KS7A 5CALA 2GSFA 1PRYA 4FKVA 3PWYA 2VWYA 4CTBA 4O82A 5FWKK 4IMYA 3TIYA 5JGAA 4QQTA 3MFUA 4QOXA 2XF0A 4JT3A 2YCRA 1PXPA 3OVVA 3DQWA 3UO5A 1DM2A 2EUFB 5K9IA 2G2FA 2V62A 4X2FA 4NCTC 3H30A 1G3NA 3Q3BA 3VHEA 5HLWA 2OF4A 3P86A 4USEA 4EYMA 3FZPA 4MD8E 2P33A 3M11A 5EQYA 4ZMEA 2JITA 4CXAA 2W4JA 3KMUA 3TKUA 4BI1A 4MXAA 4MD9E 4BDGA 4O22A 3CY3A 2YERA 2GNIA 5FEDA 5D9HA 5ANGA 2PVRA 4BN1A 2P2HA 1M2RA 5IUHA 4EC8A 4V0GA 2H6DA 2BAJA 4JG6A 1OI9A 3BYVA 2FO0A 1STCE 4C02A 3LMIA 3MJ1A 4AXAA 3KCFA 3UC3A 2J0KA 4QTEA 4JDHA 4KB8A 2XEYA 4OGRA 3T3UA 3IOKA 2I0VA 3GU6A 4XBUA 2YAKA 4MD7E 5JFXA 3CQUA 4HPUE 4GVJA 4LUEA 3IG7A 2E9NA 3IDBA 3K5UA 3SRVA 3VULA 3H0YA 3EL8A 5DOSA 3F3ZA 4WOVA 2R4BA 3R7OA 4N6YA 4BDFA 3R22A 4ACCA 5IA0A 3PXKA 5AR2A 3FV8A 5LVNA 2PWLA 5CEQA 2ZDTA 4ZZMA 1WVWA 1DS5A 2Y6MA 3OTUA 4QTAA 4C3FA 3SGCA 3NVMB 3LCKA 3Q4TA 3RPYA 2IVSA 4DT8A 5LCJA 5ETAA 4ZJIA 1M14A 4H3QA 3WF9A 3PY3A 1UNGA 3R2YA 2HZ4A 2X4ZA 4WKQA 5HD4A 4RX7A 4JRVA 5HESA 4FKJA 1OBGA 3UP7A 4YTCA 4S34A 5KMIA 1OIQA 4YJPA 3R9RA 3E62A 4G34A 2YN8A 4HCVA 2YJSA 3C13A 5HO6A 5KE0A 4YC6A 4YLKA 2BHHA 4ZOGA 3OXIA 4AGUA 2OI4X 3FDNA 4E1ZA 4JJRA 2C6IA 2OWBA 4KIKA 1VYWA 4WRSA 4QNYA 4C59A 3KULA 5KBQA 5M06A 3T9TA 1WVYA 5M4UA 1EH4A 2ITZA 3UNZA 3CR0A 2I1MA 1Q8UA 1JSUA 2XIRA 3E3BX 4JX7A 3PJ8A 4MNEA 4RIXB 2E9PA 4DLJA 4QP2A 2YABA 3MA3A 4XRJA 4RVLA 4YNEA 1G8SA 3U8WA 4OTQA 5AFVA 3CTHA 3QWJA 4WIHA 4U6RA 4MQ1A 4WO5A 2QU6A 1TKIA 4YURA 3QD4A 4JIKA 1KE6A 4JDIA 3NNVA 4TTHB 4U9AA 2C1AA 4FEXA 5J5TA 4O81A 4GH2A 5A4QA 3IW5A 2OXXA 5H8GA 2YJRA 4IWDA 5LVLA 2V55A 5B2KA 5LMAA 5BMMA 4WBOA 2PUPA 2W06A 2B9FA 3FC1X 4I3ZA 1Q4LA 1SMHA 3GUBA 3AOXA 3FXXA 5IQFA 3MIYA 1S9IA 4BCMA 3HMNA 3PTGA 4YC3A 4ITIA 4YJNA 3DFCB 4L3JA 5ETIA 5KO1A 3NW7A 4EBVA 1VJYA 5HCXA 2IJMA 2WTKC 5K0KA 2VO6A 3QD3A 3NDMA 5E8SA 2BDFA 4NM3A 2ZV2A 2H9VA 4MXXA 4FTCA 4FKOA 1ZMWA 3QC4A 5I9UA 2CHLA 3AMBA 3D5UA 3FUPA 3EN5A 3GU5A 3KRXA 3TUDA 5IA5A 3ORNA 1JOWB 4NFNA 4XUFA 4RIYB 4K2RA 4CFNA 4RFZA 3UIXA 4EHGA 1V0PA 3R1SA 3LQ8A 2JFMA 4U81A 4E5BA 3R63A 3TV7A 2PVKA 4ANBA 2W96B 3E64A 4OT5A 2XCHA 1W8CA 3HAMA 3CQWA 3E8EA 2IZRA 2RFSA 5LMKC 3ZH8A 2JC6A 4DGMA 4ACMA 3O7LB 3KRLA 3U4UA 4IJPA 3MY1A 3PG1A 3U6IA 4D1ZA 5KMKA 2VTRA 3RK7A 1YKRA 3M1SA 3G6GA 3VC4A 1BUHA 2GU8A 3FXWA 3QA0A 4QMTA 5CEMA 5AM7A 2XM9A 2BIYA 1BL7A 2VRXA 3O17A 1CKPA 3OF0A 2QONA 4V01A 4XYFA 3ACKA 4R7IA 4X2GA 3WZDA 2BALA 3ZCLA 3IPHA 4NK9A 4L52A 4U45A 2P0CA 1ERKA 2PZRA 3QAME 4W9XA 1ZZLA 3LCSA 4I4EA 5GIOE 4E4LA 3PWDA 5CX9A 4BBEA 4LMNA 4FZAB 5IISA 4ENYA 1QPJA 3ODYX 3RAWA 4JQ7A 3TIZA 4C7TA 3BYUA 5BYLA 1W82A 2JDSA 4GIHA 2WU7A 3MPTA 2UVXA 1YOMA 3EYGA 1XH5A 2VWXA 2WELA 3R28A 4FOCA 4A7CA 2QOKA 3P23A 4EWQA 4MYGA 3U4WA 1KE5A 2OJFE 3PZHA 3VF8A 5DEYA 4UXLA 2RFEA 3UO4A 3Q9XA 4NCTA 2ZM1A 4QMMA 1V0OA 3AD4A 5JH6A 3CC6A 2ZV9A 4UMQA 1P2AA 5GIPE 3W55A 3QTIA 4EH4A 4ZP5A 2QOHA 3R8UA 5D41A 4I4FA 4B7TA 3VNTA 5K4IA 4QYEA 4YBJA 4EZ7A 2AUHA 4FK3A 1H24A 4JQEA 4R3CA 1Q62A 2R3OA 5DR2A 2R3HA 4IZAA 3C4XA 3UC4A 4ZJVA 2C5VA 3OHTA 4BGHA 4AA0A 2GS2A 3ET7A 3FL5A 2P4IA 3IECA 4IX5A 2Z60A 3NAYA 4F64A 2NPQA 3M42A 4YSMA 5AV3A 1DI8A 4RLKA 3PPKA 3FPMA 3NMUF 2PL0A 5E90A 2XKFA 4H1JA 4CGAA 4AX8A 5CF6A 3PE2A 3FZRA 4FV1A 2EXCX 4TPTA 4JS8A 3FJQE 4XNEA 4D0WA 4HJOA 1XH6A 2I6LA 3O2MA 4W9WA 3NNUA 5CEPA 3RAIA 3F5XA 3DAEA 3RPRA 1PXMA 2OFVA 3B2TA 3Q5IA 2YAAA 2J0IA 5JRQA 3D14A 3DJ7A 4U42A 2XVDA 3NLBA 3QUPA 3RZBA 4ZLZA 4FTUA 3I60A 2YEXA 4OAUC 3Q4ZA 5DI1A 5EDPA 4E4XA 4AOTA 3BBTB 5FTOA 4Y85A 2ONLA 3ANQA 3FMKA 3HMPA 5IH6A 2VV9A 3FHIA 3F3UA 3N4VA 4DEIA 2G15A 2BKZA 5A4LA 4XCUA 4GJ2A 5AA8A 2F2CB 4D2WA 2CPKE 3OBGA 2X39A 3POOA 1Q41A 4QYFA 3A8WA 2XEZA 4O7SA 4WG5A 4XOZA 2R7IA 2Q0BA 1Q8YA 4F7NA 3QQKA 2GHGA 2VO0A 3QKMA 3OS3A 3HP5A 3V5TA 4LV5A 3H9OA 4EK6A 3ENMA 4FV4A 4MBJA 4EK3A 3OROA 1H07A 2WQNA 3UVQA 5CNOA 5CVHA 4DFUA 5DGZA 3QRUA 1ZRZA 5BUEA 2VWUA 1XJDA 2ITWA 2RFNA 3FI2A 4V0GB 1Y6AA 1UU3A 5B2LA 4DBXA 4JAIA 2YM8A 2WO6A 3L1SA 4CSVA 1T46A 2R2PA 3JUHA 2WIPA 4FMQA 4RLLA 4TT7A 2UZEA 2R3QA 3CPBA 5LVPA 2JDTA 3O23A 4WHZA 5IA2A 3SDJA 3FC2A 4AGDA 5CZIA 4RX5A 4PL3A 4FTRA 5HVYA 3V51A 4R7BA 3ORMA 4U41A 2VZ6A 4F6UA 2QOCA 4CKRA 1FINA 3OMVA 3UVRA 3DNDA 3BYOA 1YHWA 4ZTMA 1WBTA 3MI9A 4I0SA 4ANMA 3DBDA 3ELJA 1W83A 2QOBA 2XYUA 4IBMA 2F7EE 4MCVA 1VR2A 1XR1A 3LJ2A 1Q8WA 5AP6A 5C01A 3U87A 4A4LA 4FSTA 4ERKA 3QFVA 2YWPA 3Q6WA 5AUWA 2OFUA 3BGPA 2VN9A 3KMWA 4IVBA 4K33A 4NW5A 3RBWA 5CVGA 3TM0A 4HZSA 5C27A 4XG7A 2W17A 4BFMA 3FE3A 5BNJA 1Y6BA 4E8AA 5KHXA 4AW2A 4DAWA 2GQSA 2UZUE 3LLTA 1FGKA 4C57A 3AQVA 1J7LA 4H39A 2VX1A 3EQRA 3ORPA 4XV9A 1M2QA 2OGVA 4AE6A 2JKOA 3R9HA 4DE4A 3LXPA 4U7ZA 5IQDA 4L3PA 3VS4A 5IDPA 3JY0A 3I5ZA 4DCAA 1BI7A 3IGOA 5CLPA 2QG7A 1SVHA 4XHKB 5HG7A 3VBWA 4RZWA 3TUBA 4MBLA 1A9UA 3FMMA 4RIWA 1Z57A 4MNEB 1BL6A 2F9GA 2WOUA 4RVKA 5JQ5A 3VUKA 3QXOA 3UPXA 4AAAA 4MKCA 4C37A 3QLGA 4APCA 2XKCA 4LG4A 4I94A 4DCEA 4TWNA 5A4TA 5EW9A 3LLAA 4A9RA 4TNBA 1XKKA 5I9VA 4IAAA 3V5QA 2IW6A 3KU2A 4IANA 4L45A 3ZRLA 4BRXA 3VN9A 4F70A 2VWWA 1Q61A 5BQ0A 2R3RA 4GMYA 4FV8A 4LRJA 4ZY6A 5CF4A 1H25A 1M7NA 4YC8A 2WIHA 3MGYA 4F0IA 3IO7A 5AV4A 2EXEA 5DYJA 4ITHA 4F65A 1YRPA 3AC4A 3A7GA 2JKQA 5DN3A 5JKGA 4I20A 2HW7A 3L9NA 4TZRA 4XRLA 5FEEA 4EOMA 5L2TA 4W4VA 3NX8A 3ANRA 1H1WA 1ZYCA 3II5A 4BTFA 5E7RA 4YMJA 2XNBA 5C26A 3NNXA 3V5JA 4H3PA 4L7SA 4IB0A 4O0WA 1WBWA 4ASDA 1IG1A 4KKEA 1XH7A 3UNJA 4IIRA 3EFLA 5CZHA 5GZAA 5M56A 4RWKA 2REIA 2WFYA 2QLQA 3QKKA 3ORLA 3QWKA 4LOOA 3SKCA 4G2FA 2VTAA 3MH3A 3DDPA 3C4CA 5JFVA 4JDJA 3KF7A 2UUEA 3C50A 3UBDA 1U4DA 3RNYA 3WF6A 4D1XA 2IVUA 3NYNA 4U43A 4AN3A 3NYXA 1O6KA 5AR8A 3TWJA 4YUQA 3Q04A 4L44A 4AN9A 3FZ1A 5A6NA 2PHKA 1XBAA 4NUSA 1UNHA 3WZEA 4UMTA 4LGHA 3QTZA 4PMPA 3DZQA 1REJA 4O7WA 2VX0A 3FQSA 4RVTA 3R7EA 3FEGA 4N57A 5KX8A 2HAKA 5CU2A 3V5LA 3IGGA 1Q5KA 3H3CA 4MEDA 4AU8A 4XP2A 3QTQA 3O0GA 5I4NA 3UE4A 4LOQA 3NR9A 1J91A 1OVEA 3I4BA 3Q6UA 1P4OA 4NU1A 2UZDA 2RFDA 4NM5A 4J98A 5CU3A 3IKAA 1FVVA 4MF0A 3TXOA 3SVVA 1CMKE 3CD8A 5M53A 1QMZA 3BE9A 3VO3A 3CSVA 3EKNA 4GIIA 4NFMA 4O0XA 4BC6A 4IVAA 3EL7A 1W7HA 4YZBA 5LCKA 3E7VA 2QKWB 3BHTA 1VZOA 4CMUA 1SNUA 2DQ7X 5IUIA 4BCGA 5GJFA 3QZGA 3FYKX 2WQEA 4AA4A 4I6HA 4AFJA 4PP9A 4EOLA 4BDEA 4GL9A 1IA8A 2CKOA 4LRKA 2UZVA 5AP1A 2H8HA 3LXNA 4PMTA 3VAPA 1Y8GA 4ZK5A 3ZYAA 3QX4A 3ATSA 5EDRA 1O6YA 4O83A 4KBKA 3F5GA 3BELA 3W2SA 5IA1A 3P1AA 4MNFA 4ZLOA 4DH5A 2X0GA 3H9RA 4XX9A 2C69A 4YTIA 4QNAA 3PFQA 2ACXA 1KV1A 2UW9A 2VTTA 3DCVA 3LMHA 4ZSJA 3R0TA 3AMAA 4BDBA 2WMRA 1E1VA 5B2MA 4FT3A 3PA5A 4AOIA 5FUTA 4E6AA 3EB0A 3E93A 4Z7GA 3PXQA 1U59A 3HA6A 2CSNA 5TR6A 4BCNA 3O71A 1A48A 5BYZA 4YZCA 4G3CA 5HBEA 4RT7A 5J9LA 4RJ5A 4MXCA 5DT3A 4DG2E 3CKXA 4ZAUA 3BU5A 4FTTA 2VWVA 3QQFA 4IACA 5HIDA 2W1EA 4IX6A 3DA6A 3DAKA 2VO3A 3BHYA 4HCUA 2WTCA 3KL8A 3EOCA 4PTCA 4QO9A 5EW8A 4BYIA 4E26A 3UP2A 5E4HA 1KE7A 3V8TA 4BY9E 4TYIA 4CMOA 5AP5A 1DAWA 1PF8A 4QPMA 4I6FA 3VS1A 4DFNA 3HAVA 4TYHB 5FM2A 2GHLA 2YACA 5AUXA 3FKNA 3NEWA 2X1NA 5GHVA 5CT7A 5A4EA 1KV2A 2VNWA 5J7BA 3EHAA 3PJ2A 2DWBA 4B4LA 2CGXA 5HIBA 2GQRA 5ANIA 2IG7A 2GFSA 2PE0A 4NKSA 3RVGA 3VS0A 1Q24A 3CP9A 4G3DA 1URCA 4CFMA 3TNPC 4EOJA 4AT4A 5A3XA 5EH0A 2JDRA 2VTHA 1HOWA 5H2UA 4E73A 4KS8A 4ZSGA 5HX6A 4HVDA 2XIXA 4J53A 4X6QC 4ZSEA 4BICA 2QHMA 3VJOA 2XKEA 1UWJA 4QTCA 4OUCA 2X6EA 3DBFA 4O7VA 3W8QA 4FT5A 4YBKA 1ZY4A 2F7XE 4O7LA 5IA3A 1UWHA 3TI1A 4B9DA 4GYIA 2QU5A 4CG9A 5EM8A 5HOAA 4TNDA 4GUBA 2QO2A 2W4OA 3ORIA 3V5PA 4RZVA 5A54A 5CU4A 3V6RA 3NUYA 3QGYA 5DHJA 3OT8A 4JRNA 1WBNA 4FV3A 4RA4A 2JD5A 4OBQA 1ZMVA 3DBCA 3MS9A 3G6HA 3OBJA 3OWLA 1OL1A 4JI9A 5B0XA 4AW1A 3EQHA 4EL9A 4UMPA 4HNIA 4S33A 3UODA 2YM7A 4EOOA 3OWPA 4F1MA 4L00A 4E6DA 5CXHA 4MQ2A 1H08A 2BZKB 3FMDA 3HRCA 1JKKA 3O50A 3LXKA 4I0TA 4NH1A 4JXFA 1JLUE 4E7WA 2OF2A 4HGLA 4BGQA 5A4CA 5JSMA 5E8TA 2WTKB 3ZMMA 3PY1A 4W4WA 3MA6A 4FEWA 3FY2A 4GFMA 2XNGA 4BHZA 4DF3A 2ZOQA 4O2PA 5E8YA 4OT6A 2QR8A 1XBBA 4K77A 5CI6A 3MTFA 3UYSA 3C5IA 5AUVA 4D1SA 5IQIA 2ITOA 2R0UA 4AACA 2CCIA 5BVWA 1U5QA 2HWOA 2GS6A 3A4OX 4DTAA 2OIBA 3VVHA 5BVKA 4GT4A 5I5ZA 1I09A 4FV5A 1PKDA 1A06A 3A4PA 4LUDA 4G9CA 3IDPA 3JS2A 4RPVA 4Y83A 4C62A 3RHXA 3NRMA 3PDTA 4RIWB 4FGBA 5AIKA 4R8QA 1ZLTA 3R73A 5K4JA 2VTSA 3DBQA 1KE8A 3LFDA 4DTKA 1W98A 2EU9A 3E63A 3C7QA 3W2CA 5HIEA 2CN8A 4L01A 5E8VA 4AZFA 4I22A 3OEZA 5CAUA 4QQJA 4G6LA 2RIOA 1M2PA 4FSWA 4N4SA 2YITA 4HW7A 4C0TA 1JKLA 5AUZA 3W2OA 3R7GA 4HZRA 2XJ0A 3GB2A 2YCSA 4X21A 3RP9A 4IDTA 4L68A 2OZAB 5EI8A 5HD7A 4EBWA 4NSTA 2CGWA 2RSVA 2QNJA 4LYNA 2X8IA 4QP3A 3QKLA 4RFMA 5EI2A 4QD6A 5HBHA 3ZSIA 4RJ4A 1IRKA 4RMZA 2ZV8A 3BYSA 3JXWA 5AP3A 5I9XA 1KUTA 3AC3A 3R6XA 3NUSA 4FTJA 5D7AA 1UA2A 3LFFA 5L3AA 4WNKA 1H26A 3EKKA 2YM6A 3JPVA 3L8SA 4U40A 4FZ6A 3P7CA 3VS5A 3IW6A 4D2TA 5IA4A 3OWKA 5AWMA 4FA2A 5IQBA 4EK4A 4FKQA 2C0TA 4D2PA 3F2AA 5ANKA 4FL3A 2CN5A 3D2KA 5TE0A 1BMKA 4JBQA 3W2PA 4AGWA 5DE2A 3EQPA 5FTGA 3NS9A 3D5VA 1U46A 3PPJA 3BHUA 4C33A 2Z2WA 4L42A 2YIWA 5CSHA 5CY3A 3WZJA 5IH5A 4PMMA 3FI4A 4JG7A 2C6LA 3GI3A 1GZNA 4XG8A 5DWRA 1OPJA 2QHNA 2Y7JA 3PSDA 4ZIMA 3VUTA 3BU3A 2IPXA 4O84A 2BRMA 3JVSA 4QPAA 5CWZA 2VNYA 4QMYA 4OBPA 4Y5HA 3C0IA 2PULA 4IZ7A 2C3KA 3VBXA 3NPCA 4OTFA 3TV6A 4KINA 5FEQA 3DDQA 5EOBA 2HXLA 3FAAA 4UEUA 5DT0A 3QTXA 4EWHA 4KD1A 4I0RA 3QCQA 4IC7A 4D28A 1RJBA 2WXVA 3BCEA 3MPMA 1GAGA 4HPTE 4IAZA 4RQVA 5HLPA 4QMZA 4C3RA 3IW7A 2YISA 3OUKA 4FKGA 3BQCA 4C4HA 3NSZA 4EYJA 1NW1A 5BYYA 3BI6A 2VWIA 4BIBA 4EH3A 4LI5A 4O0UA 5EYMA 3HKOA 3SQQA 4L7FA 3L9LA 3PRFA 3F5UA 4Y46A 4QP4A 2IZSA 3Q52A 2XNEA 4MH7A 1FVTA 1YI4A 2O3PA 3HV6A 4O0YA 4XJ0A 2GTNA 1MRVA 3QC9A 4J96A 3FZSA 3TKIA 2PMIA 4Y8DA 3LQ3A 2XM8A 1OL6A 4KKHA 5HNIX 2JGZA 2Y4IC 3KVXA 4BKJA 1FVRA 3W8LA 3S2PA 5M07A 3TV4A 3Q60A 2HENA 1E1XA 4CD0A 4EHZA 3DQXA 2UVYA 2G9XA 4TKSA 4PRJA 1FBNA 2OJIA 2XB7A 1OIUA 4ZTQA 3DLSA 3BQRA 2WTWA 3COKA 1LPUA 4FTOA 4S30A 3SD0A 4W8EA 3MVLA 3R21A 2F57A 3AT3A 4BWXA 3PJCA 2W99B 4PL5A 3SXRA 2E9UA 4L43A 5FLFA 3R8ZA 4P2KA 1ZYLA 2A19B 3TNQB 4JIAA 3TZ8A 2XCKA 4TY1A 1UU8A 3BIZA 5I3RA 3Q32A 3UIBA 3BU6A 3ZRMA 1VYZA 2QOFA 3NW6A 4G3EA 3C0GA 4PPBA 5CENA 3FI3A 2CNQA 2CKPA 4FV9A 2BMCA 2RG6A 4HVSA 4JX3A 4OTWA 4ZMFA 3RTPA 4D9UA 4EEVA 3KA0A 3D5XA 4XV2A 4BTJA 1Q8ZA 2FA2A 4FYOA 2VTMA 3E88A 3TJDA 4E4NA 5LOHA 3DKCA 3WE8A 4BCPA 4ONAA 3LKMA 3P79A 1KSWA 2UW3A 3NAXA 5EG3A 1RE8A 5H9BA 3G33A 2BFYA 2A0CX 2RGPA 3HLLA 3LFNA 3BLHA 4AOJA 4D55A 3TDVA 5AUUA 3R9OA 5C1QB 3OFMA 4BCQA 3KVWA 3NUXA 1OL2A 4D9TA 3IDCA 4D58A 4DGLC 2Y4PA 4O2ZA 2GFCA 1DAYA 4FSRA 2R3IA 4BI0A 5CAPA 3QU0A 4IM0A 1Q97A 2EWAA 2X7FA 3GBZA 3OXZA 3QHRA 3TN8A 4RVMA 1KOAA 4GS6A 5IQHA 2W1DA 3DKOA 1WFCA 3FQEA 3QTWA 4XEYA 1R1WA 4RGJA 5JRSA 4D2SA 5CSVA 3UGCA 5L6WL 1TQIA 4AG8A 4QMNA 3CY2A 4O86A 5M08A 4KNBA 4D0XA 1NVSA 5HE2A 3TTJA 1R39A 5LWMA 1H8FA 5AMNA 3DXQA 4AZVA 4RA5A 3NGAA 5FXQA 4EH6A 2BDWA 3OY3A 4L6QA 3TEIA 4Z55A 1YXVA 4O0VA 3E87A 3QYWA 4A06A 4GYGA 2PVHA 4QT1A 4UN0C 4M84A 4BWPA 4EC9A 1QCFA 5M51A 1H28A 3LPBA 1SNXA 4KIOA 2CMWA 3BKBA 2WGJA 3E7OA 4PP7A 4F7JA 5F4NA 3DBEA 3HEGA 4DEAA 5AR5A 4C2VA 5CASA 3V04A 4ORKA 4EOIA 1GZOA 3OXTA 2I0EA 2V5QA 3UOHA 2XS0A 3ZDIA 4BZNA 5L6PA 3V6SA 4MXOA 4LOPA 4RWIA 4XOYA 4IFCA 3ZUTA 1WBSA 4FV6A 4J95A 4U97A 3BX5A 3A7IA 2ZM4A 3FMEA 4YZDA 4JBPA 2DUVA 3I6WA 3HX4A 4AW5A 5KMJA 2J9MA 2VTNA 4I24A 2YCFA 5HE1A 4CFXA 4O7TA 3FLYA 2GHMA 5AP7A 3IW4A 1PMUA 5FDXA 5F95A 3ORKA 1RDQE 5C4KA 4XMOA 3R8PA 4BYJA 2C6DA 2F7ZE 2XRWA 3BLQA 3F61A 4GFOA 4E5WA 4YTHA 3VIDA 3BEGA 4ALUA 4Q5EA 4B0GA 5L2WA 3KMMA 3O51A 4QYHA 2BTSA 4L9IA 3ZO2A 3LZBA 4G31A 4LMUA 3KEXA 4M14A 4IWQA 3DGKA 3W32A 3UZTA 2Z02A 5J87A 4FTNA 4C4IA 1MRUA 4ASXA 2XNOA 3DNEA 4G3FA 2KTYA 3JY9A 4PDYA 1H1PA 2ZDUA 2OLCA 2XMYA 2HWPA 4ZTNA 5J9YA 3P0MA 1OUYA 1LUFA 2BPMA 2UW6A 4CLJA 4E4MA 1I44A 4FICA 2B55A 3AXWA 2B52A 4JR3A 5EHLA 1CTPE 2E9OA 4FI1A 2VO7A 4I6BA 4MXZA 2PVNA 4H36A 2RG5A 4PF4A 1QPCA 2CCHA 4J52A 3IQ7A 4G6OA 4NTSA 4QQCA 5DA3A 4BCIA 5IG1A 1OPLA 1SYKA 2GNFA 3KRJA 4HGSA 3LJ1A 4LL5A 4XG2A 2W7XA 3FLSA 3QA8A 4XLIA 4A9TA 4QMQA 4EQMA 2WQBA 2PVYA 3D9VA 4FKIA 4YJUA 3PSCA 5HKMA 2LAVA 3L8PA 5JGBA 2W5HA 2FB8A 4P90A 4BCJA 4F9WA 5DNRA 5IDNA 3IOPA 4YTFA 2OIDA 3PSBA 1PW2A 2YCQA 3PP0A 1ZXEA 3DKFA 3I6UA 2YIQA 1ATPE 3EFKA 4GT5A 4U3YA 5K3YA 4ERWA 3S1HA 3ULZA 3R8MA 3ZOSA 4MTAA 1ZMUA 4KSPA 2J50A 3MVHA 5K0XA 4Z9LA 3ZONA 1XWSA 4EOSA 4RJ3A 3SLSA 4UB7A 2Y6OA 4BL1A 3A99A 4DYMA 5EHOA 3ZSGA 3R7VA 4DEEA 4BI2A 5F9EA 4KRDA 5BPYA 4FIIA 1OKYA 3VW8A 5EDQA 4BCKA 4LFIA 4NKAA 4RX8A 3RCJA 4CZYB 3KY2A 3ZFXA 2HZNA 3AC1A 3LM5A 4TYHA 5C03A 4K11A 4IAFA 4CTCA 5KNJA 2ZAZA 5KZIA 4BCOA 4A9UA 2NRYA 3FYJX 4XG4A 2ITPA 2JLDA 3ZO3A 3KGAA 3I5NA 4ZTSA 3RJCA 1NVRA 4FZFB 3Q4CA 4QMXA 4F9AA 4YO6A 1ZYJA 1XO2B 3EZVA 4LV8A 5JEBA 4RWJA 4RG0A 3UZRA 1FMKA 5DLSA 5HI2A 2V22A 3U6HA 4CNHA 4TYEA 3V8WA 4EKLA 2C3IB 2XIYA 3QXPA 2YIYA 1YDSE 2PZYA 4IM2A 3FLQA 3F69A 4FEUA 1YQJA 1BYGA 3F82A 3VBTA 3D7TB 1HCKA 5AUTA 3WI6A 5HTBA 3TG1A 1OECA 3B8RA 3ZZEA 3BE2A 3TACA 4L3LA 4PNKA 5M44A 3LFSA 2PVLA 3LFAA 4IADA 2B54A 2H96A 4ACDA 3U6JA 3DPKA 5FXSA 3A62A 5IF1A 4HVGA 4NYEA 2EB3A 3ODZX 1G5SA 2CKEA 4DHFA 4FUXA 2W0JA 5E9EA 3VF9A 5HBJA 4CEGA 5AV0A 3F5PA 4I5CA 4Q5HA 2JBOA 4U44A 4PX6A 4KABA 3W2RA 4M0ZA 5EKOA 4FYNA 4EHEA 1PY5A 1G8AA 1E9HA 1OITA 2C68A 5CSPA 2IVVA 4ZTLA 4I5PA 4F63A 2XNPA 4UBAA 2PTKA 4Q9SA 5IH4A 4ZTRA 3MH1A 3QYZA 1YOJA 4GFGA 4QMPA 3T9IA 3PVWA 3A7FA 2QI8A 3B8QA 2XP2A 4GEOA 3LFQA 3UMWA 3WE4A 4F09A 4EI4A 5CEKA 4DGNA 4G17A 1IAJA 4O21A 4ZLYA 4DEHA 1IASA 4M97A 5CYIA 3PVBA 1UU9A 2XUUA 3B2WA 5EW3A 2XIZA 3OP5A 4G16A 4MF1A 3W16A 4U3ZA 2W1GA 2X6DA 3BV3A 3OCTA 3GQIA 4BZOA 3EH9A 1OL7A 4CMTA 2R64A 4LL0A 4UALA 5HG9A 3S0OA 3D83A 3EQFA 3F3VA 4F7SA 2ITXA 4O7ZA 5M57A 4R77A 4EK8A 1B38A 2R3JA 2FSLX 5EQEA 5FQDC 3FMJA 5LMKA 3DKGA 4LGGA 1MUOA 4J8NA 4F1OA
chains in the Genus database with same CATH superfamily
1PKGA 4H1MA 4C4FA 4F9CA 5CAOA 2OG8A 4PY1A 3CEKA 5E1EA 3EN6A 5J79A 2GS7A 2VTLA 3C0HA 4D5HA 2OZAA 4HGEA 4FZ7A 4BZDA 3OWJA 3PVGA 2C0IA 2BTRA 4JDKA 4IE9A 2XANA 3C9WA 3AT2A 4RQKA 5DBXA 2Z7RA 4FSMA 4X3FC 4BDCA 2A2AA 5EYCA 4G5PA 5EOLA 4BDAA 3GFEA 5KHWA 2JFLA 5KMLA 4QMVA 2PZPA 3OW3A 2W9ZB 1W0XC 5AAFA 3R7IA 1H1QA 1SZMA 3MH2A 4I41A 4P5QA 3TNWA 3NCGA 3V8SA 3FKOA 2BILB 4E20A 4UZHA 4FNXA 1X8BA 3KXGA 5DG5A 3S4QA 4BIEA 5AA9A 4C61A 2YIRA 3K3JA 3GVUA 3KB7A 2F4JA 3LQ5A 3O7LD 4ZS0A 4DH8A 5A9UA 3GU7A 5J1VA 2NRUA 2G01A 1NXKA 4D5KA 3U54A 3O8UA 5EM7A 3ZC5A 4R3RA 4O0SA 4BDHA 4DLIA 2IO6A 3ALOA 2BKKA 2QR7A 1LR4A 5M09A 2QG5A 4V05A 1BKXA 5CSXA 1NVQA 5F1ZA 3VUGA 4B99A 3VS6A 3HV4A 5EM5A 5BVOA 1P4FA 2Z8CA 4BGGA 3PY0A 2VTJA 1OUKA 3EQCA 3QTRA 2RKUA 4F0FA 3V5WA 4PPAA 4K9YA 3OG7A 2BZIB 2HZIA 3PXFA 4QMLA 2YHVA 3ZXZA 4EUUA 3SG8A 3BZ3A 3MY5A 5L6OA 3MYGA 2C6MA 4HYHA 3RCDA 3C4WA 5A14A 2BROA 2R3NA 3RALA 2J0LA 5HLNA 3EZRA 3ZC6A 3DB8A 4R78A 2GNGA 2X9FA 4XG3A 1JSTA 3VHKA 3UTOA 4ANNA 1OKVA 4R5SA 2VUWA 2VGPA 5LMBA 1XMLA 2E2BA 3BHHA 4M66A 3CQEA 3SOAA 4JAJA 4TRLA 4IAYA 3ZLXA 5GINE 5HO7A 2OIQA 3LE6A 4W4XA 1YWVA 2XK8A 4DFYA 5CAVA 3R2BA 1ZARA 2UW8A 3R1QA 4HCTA 3HYHA 3MN3A 3POZA 4WBBB 5M4FA 4BTMA 3C4ZA 1YXXA 4NM0A 2F2UA 2RF9A 4R5YA 4U0IA 4UV0A 3LMGA 4DEBA 3AC8A 1XBCA 2WTIA 2X8DA 3SW4A 1YHVA 3R1YA 4YZ9A 4I6QA 3PA3A 3K5VA 2FH9A 3OEFX 4FSZA 1ZOEA 1R0PA 3R30A 3T3VA 2CNVA 4CFVA 3UQCA 5KBRA 3ZLSA 3FPQA 2VTPA 4YJTA 2XNNA 3AG9A 2P2IA 4RC4A 4FG9A 4WA9A 5CI7A 3RPSA 4FUYA 5JFSA 3FWQA 4IDVA 2PMNX 5IEVA 5T6KA 1O9UA 2EVAA 5L2IA 4X2NA 2R7BA 2ITVA 3L8XA 5DFPA 3UG1A 4FVRA 4PNIA 4ACGA 3DY7A 2GPHA 5TKDA 5JFWA 2BVAA 5GJGA 2WZJA 5IMEA 4BJJB 3VRZA 4IH8A 4FKWA 3C51A 4XV1A 4TXCA 3RK5A 1BX6A 2ZV7A 3C4EA 5IEXA 4ZSLA 4GW8A 4ZY4A 3MY0A 2IW9A 4ANSA 5B7VA 1ZAOA 2XYNA 3FZOA 3W18A 5JMSA 2Y4IB 4MAOA 4FV2A 4XP3A 4OTDA 3VBQA 3RKBA 3SXSA 3GCUA 2PUUA 1GY3A 3KK8A 4P4CA 5J95A 3VQHA 4CLIA 1MP8A 2I0HA 4QMUA 2GCDA 2YDIA 3FLWA 4JG8A 3Q96A 5I0BA 4EJNA 4YR8A 3KXNA 3RMFA 4U8ZA 4O1PA 4K18A 3TUCA 4Z16A 2OJ9A 1R0EA 4PV0A 3F88A 4F6SA 4XV3A 5AAGA 4QQ5A 2O63A 2YFXA 1P5EA 3DK3A 3FZTA 4FSNA 2XJ1A 1ZY5A 4FVPA 4K6ZA 3MVMA 4CFWA 4DT9A 4WG4A 3KK9A 3ZZWA 3EFJA 3IK3A 4DDGA 1OGUA 4AT5A 5CU6A 3PPZA 3OCBA 4PTGA 4YZMA 5HQ0A 2WNTA 4PPCA 3PE1A 5J8IA 4EH8A 2ITNA 4G9RA 4IZYA 5ETCA 2YZLA 2HZ0A 5DRBA 3HRFA 3ZDUA 3ORZA 2VTIA 5ETFA 2B0QA 3GGFA 4KBAA 3UNKA 4M68A 4UY9A 2C5YA 3GQLA 2WMWA 4FT9A 4FVQA 2XBJA 4TYGA 3OOGA 5HCYA 4IB1A 2H34A 4XG9A 5FBOA 3QHWA 4IWOA 4PMSA 3R7UA 3RNIA 3WZUA 4J99A 2JKKA 3R9NA 4F99A 2UW0A 4FE2A 5ANDA 3GCSA 5AV1A 4GVAA 3AKLA 4KUJA 1F5QA 4CV8A 5IMXA 5IUGA 2V7OA 4EUTA 1H27A 3MWUA 4RJ7A 5IKWA 3V3VA 5AV2A 4FOBA 3Q2MA 4FKUA 4XP0A 4A07A 5DIAA 2QOQA 4DHZA 2R3KA 5TOZA 1XH9A 3R71A 2X2MA 1XHAA 2NO3A 3N4TA 2CGUA 3PIXA 5C9CA 3R8LA 2ETRA 4O0RA 3D15A 2PUIA 4QRCA 3W2QA 3T8OA 4F6WA 4YSJA 3VUIA 3FMNA 1UU7A 4Q2AA 5IEYA 4DFXE 3QRIA 2UZTA 2WMBA 4P5ZA 4C36A 4DFLA 4EKKA 2HCKA 3OD6X 4P7EA 4WUNA 1OIYA 2RL5A 2XKDA 3DV3A 3QD0A 4YLJA 4TWCA 3TNHA 3ZU7A 3LAUA 4YLLA 3WIGA 4FTIA 4I6LA 1BI8A 1OPKA 3DU8A 3HMMA 3A7HA 2BUJA 4FSUA 1CDKA 3FXZA 3CTJA 3UG2A 3ZXTA 3TL8A 4YO4A 2R9SA 4AXEA 2J4ZA 4ZS4A 4G6NA 4X0MA 4EONA 2WEIA 3COHA 3F66A 3AGLA 3MB7A 3S3IA 2ZJWA 3UO6A 1T45A 5L8LA 1GIHA 3HDNA 2R3MA 3H9FA 4DINA 5HTIA 4M12A 5AJQA 1IEPA 1J7IA 4CCBA 3MDYA 5HNBA 4RSSA 1M17A 3RZFA 3ZFMA 4CYIA 3GCPA 4FC0A 3KXZA 1YOLA 3Q9WA 2J5EA 5EKNA 4H58A 3WYXA 3KQ7A 4Q9ZA 4JNWA 3ERKA 2YA9A 4YHJA 3P4KA 5AEPA 2J0MB 4X2KA 2WAJA 3FY0A 5M4IA 4I92A 4I5MA 3P7AA 5ACBC 2G1TA 5KKRC 4XG6A 3AC2A 4GKHA 3F2NA 3CBLA 1IAHA 2HOGA 2WTJA 3UYTA 5JZJA 3DTWA 3NW5A 5D12A 4J71A 1W2CA 3QQGA 3LW0A 4M13A 2QC6A 1OKWA 1MRYA 3BGQA 3CXWA 2B9HA 3W0RA 3O8TA 2PE2A 2C6KA 5H8EA 3QRTA 2ITTA 4W4YA 2W1HA 5IU2A 4FIHA 3N4UA 4EH2A 4G1WA 4FL2A 3GCQA 4QYYA 2VTQA 3IS5A 1M52A 4M15A 2GTMA 4CT1A 4FBXA 1YWNA 1OKZA 2IWIA 2JKMA 3Q9ZA 4JR7A 4B8MA 2HY0A 3MW1A 3FLNC 3MPAA 3HVCA 2UW5A 5IPJA 3QCSA 5FDPA 3V01A 3QZHA 3PIZA 4UX9A 5JZNA 4LRMA 3NUAA 4AGCA 3ALNA 2LGCA 4DH1A 5AAEA 4XH6A 5GZ9A 1GZKA 4EOQA 2CLQA 3TKHA 4AZEA 5HX8A 1MQ4A 5EYDA 3SG9A 4GT3A 1L3RE 2WB8A 3GC9A 3RHKA 4Y73A 1YWRA 5ANOA 3ULIA 3GOPA 3FKLA 3BEAA 3ML1A 3QTUA 1PMEA 2OU7A 4HVIA 4YP8A 5DT4A 4QEBA 2W5AA 3A60A 5AR4A 3KN6A 4IX3A 4EORA 1K9AA 2UW7A 5DR9A 3TZ7A 4CFFA 4O91A 1J3HA 4Z3VA 2B1PA 1ZWSA 4DITA 4JMQA 5AR3A 3O5AA 5EYKA 2FSOX 2Z7LA 3EMGA 1JAMA 3LFEA 4YHFA 3BWJA 5HCZA 1CM8A 3K2LA 4PL4A 4WNOA 3SXFA 3D7TA 2PMLX 3FL4A 4AS0A 4UWYA 4G3GA 1UNLA 3W0PA 4RX9A 1GIJA 3FMHA 4FG8A 4EOPA 5J9ZA 2OW3A 3CTQA 3HL7A 3SHEA 3ZHPC 3AT4A 3ZLWA 3GENA 5EQPA 2OJGA 1J7UA 2G2IA 4U79A 5AP4A 2R3LA 1UKIA 3FMLA 1FGIA 2QKRA 4TW9A 2CGVA 4C2WA 3U9NA 1LEZA 4QTDA 1H0WA 3VUMA 1PXNA 2BDJA 1H00A 2R3GA 5KUPA 2AYPA 4ZXTA 1W84A 3EWHA 3PYYA 2HXQA 1YI6A 2YIXA 4BWKA 2J6MA 4DA5A 1CKIA 3RI1A 2YM3A 1R3CA 2JIIA 3D94A 5DR6A 4ITJA 2CKQA 2I40A 3KCKA 2C1BA 5BMSA 2C3JA 5H3QA 5HZNA 2QODA 5FRIA 2J5FA 4HNFA 3RPOA 4M7IA 1OBDA 2HIWA 3BV2A 5ANJA 3D5WA 1FMOE 4FKPA 3F7WA 4O6EA 2W1CA 4KIPA 2ONLC 5C8KA 2CNUA 2R0IA 3IONA 3UOKA 5DMZA 2PK9A 5LJJA 2JIVA 3GC0A 1ND4A 1CKJA 3N51A 3R01A 3HUBA 4W8DA 3CGOA 4TL0A 3NZ0A 3P7BA 3TZ9A 5FXRA 3PXYA 4NM7A 2XBAA 4S2ZA 3NYOA 3DAJA 1P14A 4MXYA 5HU3A 2KULA 3PRIA 4GG7A 4K1BA 4N70A 1TQPA 3D2IA 3MH0A 4OBOA 3GNIB 5E8WA 4O7RA 3E8NA 4BBMA 1F3MC 5CF5A 3L9MA 2NP8A 4IAIA 4MWIA 1OIRA 3QUEA 4WNMA 5AIRA 4M8TA 4Y5QA 3UIMA 3SA0A 4F78A 5LXMA 4GUEA 2SRCA 3CE3A 4O0TA 3Q4UA 4AUAA 1KE9A 4CQGA 1F0QA 1WZYA 2C6OA 3TCPA 4CT2A 5KMOA 2ITQA 1PYEA 4FTMA 4DGOA 4ANOA 4KKGA 2BRNA 2I0YA 5ACKA 5L2SA 3KF4A 2PU8A 3LVPA 5CU0A 4IQ6A 4GK3A 4OR5A 2JEDA 5E1SA 4FKRA 4XBRA 5KCVA 1JQHA 4E3CA 4O38A 2O5KA 2O8YA 2NYAA 4O7YA 2GMXA 2Y9QA 3AMYA 3LOKA 2OICA 4JBOA 4WRGA 1UV5A 4QP7A 4X2JA 3UQFA 2CJMA 4FTKA 4LQMA 4ZY5A 3UZPA 4LM5A 4WSYA 3AGMA 2WHBA 1L8TA 4YGAA 4RBLA 2B9IA 2YM5A 3HV3A 3ZBFA 3KC3A 1QPDA 4GG5A 3P5KA 5DVRA 2OXYA 5CEIA 4I1ZA 5EHYA 4KA3A 4ACHA 3ZEWA 4O4BB 1Y8YA 4L8MA 1GNGA 3LXLA 4OTGA 4DEGA 4YNOA 5IQGA 2XK6A 3DXNA 3MV5A 2Z7QA 3MBLA 4ZTHA 2XA4A 4FSYA 4ZSAA 3TDWA 3OUNB 3ZFYA 3EN4A 4IW0A 3G9LX 4QP8A 3GEQA 4BVUA 2XH5A 2C5XA 3SW7A 2PMOX 4OTRA 4PTEA 5DPVA 2FSMX 3ENHA 4JBVA 3HV5A 2WMAA 3HUCA 4FIEA 4QP1A 3EFWA 3D7ZA 5C8MA 1YXUA 5HE0A 1YHSA 1AGWA 1JPAA 4D4SA 5GNKA 4R3PA 4ENXA 2PE1A 2OXDA 3A2CA 4JQ8A 4O96A 4S31A 1Z5MA 4GSBA 4DG0E 3AC5A 1H0VA 2C6TA 4X3FB 3HV7A 4N0SA 3GU8A 2WMXA 5ITAA 2PPQA 5HNGA 2A1AB 2C30A 4JOAA 2YDJA 2XZSA 5AR7A 4FIFA 4F4PA 3G15A 4FEQA 4IHPA 4NL0A 1LP4A 1H1SA 4I93A 2P55A 4MX9A 2PSQA 3MJ2A 3I7CA 4OTPA 1OL5A 3GC8A 3VRYA 4BKZA 4YJSA 3JYAA 2WTVA 2X9EA 3LHJA 4HYIA 3VQUA 4HVHA 2WMTA 2VWZA 3KXXA 4O27B 5JK3A 4YPSA 1AD5A 5D1JA 2V7AA 3BGZA 5F94A 1YI3A 3QGWA 4IJ9A 4K8AA 4UMRA 1NT2A 3VJNA 2B9JA 2JDVA 2ZB1A 4MVFA 3ORXA 3Q5ZA 3R8VA 2UZLA 3SAYA 4Z7HA 4YJRA 2GDOA 2O64A 1U54A 3QF9A 4BDDA 3QLFA 2W1IA 5DRDA 2FYSA 2W5BA 1GZ8A 4AT3A 1XQZA 1NA7A 2J0JA 4PUZA 3F2RA 3UQGA 1Q99A 3PVUA 4IEBA 2JBPA 4IAKA 4D4VA 4JLCA 2R5TA 3ZRKA 4AE9A 4YJVA 3FHRA 2B4SB 5I3OA 2UZBA 1WAKA 4I23A 4A4OA 1JNKA 4X6RA 1WBOA 3P08A 5KMNA 4CKIA 4GCJA 5LQFA 5CAQA 3QQJA 1H1RA 4C35A 4CRLA 2HK5A 4X7QA 2C47A 3WF5A 5EI6A 4AF3A 5IQEA 4C4JA 3E92A 3UMXA 4ARKA 3GCVA 4FT7A 5CT0A 2W1ZA 4NW6A 2O0UA 3MIAA 3OT3A 4UYNA 4FIGA 5I9ZA 3TNIA 1APME 5FP5A 1UKHA 1ST0A 2O2UA 1IA9A 1OB3A 3C4FA 3DS6A 4GK4A 4ALVA 4E93A 3W33A 4JVGA 4N6ZA 1CSNA 3GT8A 2VX3A 5AP2A 5L2QA 4IXPA 3JVRA 4WUAA 3ZSHA 3BPRA 2JIUA 1K2PA 4XLVA 3PUFC 3EQGA 5CS6A 4OLIA 3ACJA 3IW8A 3O8PA 2HELA 4OW8A 3HMIA 3KRRA 2W9FB 3KKVA 5KMMA 1PJKA 4EJ7A 2OJJA 4S32A 1KOBA 2BRHA 4F9BA 2FSTX 2WMUA 4FNYA 4CZUA 4DH3A 4TWOA 3NWWA 3HP2A 3N9XA 4NTTA 3GOKA 4KWPA 3PJ3A 3WILA 4I21A 3VW6A 2YLEA 2XAMA 4J7BA 1Q8TA 4KSQA 2IW8A 3E5AA 4C34A 5HICA 4M0YA 2WU6A 5L8KA 3F9NA 2O65A 2BIKB 2WQOA 3Q9YA 5CQWA 4EH9A 2YZAA 3DJ6A 1JWHA 2PYWA 3VS3A 4X3JA 4GU9A 2XRUA 3BL9A 4QP6A 3DK6A 5EK7A 4OTHA 4B8LA 4MWHA 4AWIA 3QQUA 1RW8A 3AD6A 3PIYA 3U55A 5DH3A 1JSVA 4WT6A 2X7GA 3ZM4A 4BF2A 2QOLA 5T3QA 4AP7A 3WIKA 1XH4A 3QBNA 2JAMA 4BBFA 3BL7A 4DBNA 3D4QA 2ERKA 3QD2B 3LCDA 3ORTA 3QL8A 3QZIA 3CJGA 4CKJA 2B53A 3FLZA 3HNGA 3NIEA 3PP1A 4HOKA 4NT4A 3SRVB 1J1CA 1PXKA 3WOWA 2XK3A 4R1YA 5F20A 4A9SA 3G2FA 2CDZA 4EH7A 4EQUA 3RAKA 3TT0A 4OAVB 5LARA 4EZ3A 2PVMA 3COIA 5BVDA 5M4CA 4NIFA 4WD5A 4EK5A 3E8CA 3MFTA 3KXMA 3LCTA 2FGIA 2R3FA 3WYYA 3HRBA 5CNNA 5TO8A 3MB6A 3BWFA 4NWMA 3QCXA 3ZLYA 2OH4A 4R7HA 4IX4A 3OOMA 3O96A 4TYJA 3NIZA 4YZNA 3ID6C 4YU2A 1GOLA 1GIIA 4UYAA 4O6LA 5HE3A 1JBPE 3U9CA 3VS2A 3CJFA 4EZ5A 3WF8A 1ZOHA 1OM1A 1YXSA 2J90A 3KRWA 1B39A 5CTPA 4AQCA 5IQCA 4CQEA 3NVKI 3UDBA 4F9YA 4UWBA 5L4QA 3COMA 4IVDA 4Y72A 4RJ8A 5D11A 4D2VA 4CVAA 1Z9XA 3THBA 2WMQA 3G51A 4AZSA 2NNWB 3QUDA 4NZWB 4A4XA 4GV1A 1Q3DA 1AQ1A 4BCHA 2WTDA 1R78A 4IZ5A 4M69A 3RWPA 5HU9A 1Y91A 3OW4A 2XK4A 3R83A 4UMUA 4C38A 5LVMA 1WVXA 3A7JA 3CKWA 4KIKB 4ZEGA 2ETKA 3KULB 3RM6A 4CFUA 1OZ1A 4DH7A 3VS7A 4QYGA 4AA5A 1QPEA 3F3TA 1WMKA 5HVJA 4DGGA 2YWVA 3PG3A 2IZUA 3DTCA 4UZDA 4Y95A 1UVRA 1V1KA 2QCSA 4FL1A 4PWNA 3G90X 2XK9A 3E3PA 4FKLA 2R3PA 3NUPA 3LIJA 4BDKA 4C58A 5AADA 2UZOA 3R00A 3GP0A 4L67A 5K5NA 3R7YA 2A4LA 4WG3A 2X4FA 4J97A 4BIDA 1H4LA 4C8BA 1YVJA 3MESA 2ZYBA 5C8NA 3U51A 4FT0A 3PA4A 2QD9A 3ZEPA 2BRBA 4YJQA 5BVEA 4EQCA 3ROYA 3L8VA 5GJDA 2X0QA 4DG3E 4D4RA 4J8MA 2ZB0A 4ZJJA 2IZTA 1PHKA 3A61A 3DK7A 4GJ3A 3VONA 4DTBA 3UVPA 3CIKA 4IC8A 4ASEA 3ZBXA 4BDJA 3H4JA 5CF8A 2JDOA 3OZ6A 4PDPA 4RWLA 3I79A 2J2IB 3EQDA 4DEDA 3S00A 5KKRB 4ANQA 4U5JA 1FQ1B 1JKSA 3KXHA 5DEWA 4B6LA 4PDOA 2PVJA 5CSWA 2W05A 2AC5A 3OY1A 3MFSA 2WOTA 4ASZA 3DZOA 3PZEA 4L46A 3ITZA 4II5A 1OMWA 4RFYA 3WZKA 4GRBA 1BLXA 2QO9A 3BYMA 2Q0NA 3VBVA 1JVPP 3NCZA 4AZTA 4R6VA 2ITYA 2QVSE 1TVOA 4KBCA 4FX3A 4MBIA 3FI8A 3I81A 1REKA 3OC1A 4F1TA 5BVFA 2BZJA 4RJ6A 4RRVA 2EB2A 3UIUA 4AZWA 1J1BA 1H01A 1YDRE 3AD5A 3QRKA 1PXIA 4PQNA 1LEWA 3SC1A 4BCFA 1MQBA 2BZHB 3GFWA 4RIOA 4F0GA 4FIJA 3C1XA 3RAHA 2E9VA 5CVFA 4APPA 5KZ0A 5FP6A 2XK7A 4QPSA 5K5XA 2VAGA 3QRJA 1PXLA 3REPA 4JL9A 3ZS5A 2XJ2A 2UVZA 5E8XA 3ZO4A 5FGKA 3BBWA 3NUNA 4K0YA 4KAOA 2YDKA 4USDA 3LM0A 5AP0A 5HO8A 2UW4A 2Z7SA 3GXLA 3PLSA 2F49A 4L53A 3BHVA 1U54B 4WSQA 4ID7A 3HGKA 3VUHA 2GNJA 3EJ1A 5FM3A 3KREA 3G5DA 5E91A 2WKMA 4FNWA 4M3QA 3NYVA 4DFZE 5HVKA 3OTVA 4TWPA 4IB5A 5JT2A 4IFGA 2FUMA 5J1WA 4O7NA 2HW6A 3QCYA 1YXTA 5G6VA 2V0DA 4FSQA 2OH0E 4DFBA 1QL6A 4XS2A 2UZNA 2IVTA 3FSFA 3MTLA 1K3AA 1ZOGA 3R04A 4LGDA 4DN5A 1PXJA 4DDIA 2X2KA 3H10A 4QTBA 2AC3A 3LJ0A 2QQ7A 3HMOA 5AX9A 3SV0A 3W10A 3DXPA 1YDTE 2C0OA 4U80A 5HGIA 1IR3A 3WF7A 3R02A 4RC3A 2C3LA 3TZMA 5D10A 1SVEA 3I0OA 3CD3A 3G0EA 4UWCA 5AM6A 2OKRA 5TT7A 4FKTA 5E8ZA 3EN9A 4C4EA 1WCCA 2XNMA 2BFXA 2IN6A 4CRSA 4EHVA 2I7QA 4NEUA 5E92A 2PUNA 4QMSA 2WMSA 3ROCA 2OBJA 2Y8OA 3P9JA 3JR1A 3W0OA 2ETMA 4QP9A 4MHAA 4RIXA 5CQUA 4OTIA 4EH5A 2Q83A 1Q3WA 3UOJA 1B6CB 1TQMA 1ZYSA 2ERZE 2JAVA 3W1FA 3DT1A 2ITUA 4H3BA 5T68A 5FTQA 4HGTA 2OSCA 1Y57A 2XIKA 3CGFA 1URWA 2W1FA 2WPAA 5FBNC 4KIQA 4FTQA 4EOKA 3RGFA 5JGDA 5C4LA 1DI9A 2OZOA 4ZZNA 4YHTA 3MFRA 3QALE 2PVFA 3H0ZA 4IB3A 3ATTA 2GNHA 4GU6A 4RC2A 3QTSA 5BV3A 3R1NA 3FQHA 2A27A 3G9NA 4MK0A 2BAQA 1SVGA 4NJDA 4AAYA 4ANLA 3QZFA 5FD2A 4FTAA 3CPCA 4HYUA 3MSSA 1SM2A 4FR4A 3UJGA 2YLFA 4J1RA 4CV9A 5JQ8A 2W4KA 3MVJA 3KFAA 4AFEA 2HY81 4FF8A 2BAKA 3EQBA 3RWQA 5A46A 3HZTA 3QQLA 3DB6A 4FTLA 2AEGA 4IM3A 3LFCA 1PMNA 4QMOA 2UZWE 5I9WA 4FEVA 1RQQA 3NNWA 2X7OA 3UOLA 2BHEA 2PY3A 3I1AA 4HYSA 1FOTA 5L8JA 3UPZA 5E8UA 3G0FA 5LVOA 1W2FA 2CLXA 1ZZ2A 2YM4A 3K3IA 4A9YA 4BTKA 3DOGA 4RIYA 3GU4A 3RPVA 3P78A 4FGRA 3Q53A 3WBLA 3TJCA 5BVNA 2C5OA 2WMVA 4FK6A 4YJOA 5J7HA 4AN2A 3A8XA 2VWBA 2X81A 2ZM3A 1KWPA 4X3FA 2BCJA 3EYHA 1ZYDA 3K54A 5H8BA 4CZTA 4QDEA 5GZ8A 5ANEA 5JN2A 5J5SA 3ZM9A 5HTCA 1GJOA 3QX2A 1WBPA 2VD5A 3M2WA 5AUYA 3SOCA 5BUJA 4NIFB 5LWNA 3Q2JA 1U5RA 4FV7A 5IZFA 1PXOA 4O4EA 3GC7A 3R9DA 3KN5A 1WBVA 3TTIA 5I9YA 1PYXA 4WNPA 3CLYA 4PDSA 4E6QA 4GKIA 3DFAA 3F3WA 3ZUVA 3HDMA 4TN6A 4NJ3A 2GNLA 2OO8X 3C5UA 4FKSA 2BR1A 4KRCA 4FODA 3HA8A 4FV0A 2PZ5A 4QMWA 2DS1A 2ESMA 4YPDA 2J7TA 4DC2A 3D0EA 5HEZA 4F08A 2WD1A 1V0BA 3ETAA 3I0QA 3QQHA 4FG7A 3RINA 3ZUUA 2QURA 3EN7A 5G1XA 3EQIA 1HCLA 3S95A 1FPUA 3FSKA 4D4YA 4LV7A 5ICPA 3SX9A 3VUDA 3DJ5A 5HHWA 2X8EA 2OK1A 2PZIA 4CYJA 4DHIB 3FBVA 3OCSA 2P3GX 2VU3A 5M55A 4FZDB 4CCUA 3PXZA 2WQMA 5BUIA 2J51A 4IWPA 3LCOA 4D2RA 3E8DA 3CCNA 4M69B 5BX0A 1JKTA 3UDZA 3RM7A 4USFA 5FG8A 1VEBA 2B7AA 4O1OA 4R1VA 5IQAA 5AX3A 5HG5A 3F6XA 5D7VA 4I5HA 2VGOA 5HG8A 4G5JA 2ZVAA 1O6LA 4M67A 2XARA 2X2LA 2DYLA 1OGYA 3PXRA 4E6CA 3EIDA 4GK2A 3BLRA 2Y0AA 3I7BA 3PJ1A 1YW2A 2G2HA 3VWAA 4BHNA 2QOIA 1W2DA 2C6EA 2FVDA 2C4GA 3HECA 3L9PA 2QO7A 4BB4A 3VBYA 3WARA 5A6OA 3DLZA 4AW0A 4V04A 4UXQA 2BRGA 1NY3A 1S9JA 2UV2A 3ZO1A 2WEVA 2QLUA 4ALWA 4CG8A 3PLAE 1XH8A 2HYYA 4C4GA 3PUPA 4IVCA 2QOOA 5CEOA 2C5NA 2ZMDA 4FNZA 3LFBA 3F7ZA 3NUUA 5CXZA 5HORA 4ZZOA 3CS9A 4BR3A 2EXMA 3ZTXA 4E5AX 3RK9A 1M7QA 4BKYA 3W0MA 2GQGA 1PMVA 4F7LA 4C3PA 5TF9A 5CANA 5EM6A 4BDIA 3OCGA 2A98A 2VTOA 3BRBA 5EFQA 4H05A 2ZMCA 4KS7A 5CALA 2GSFA 1PRYA 4FKVA 3PWYA 2VWYA 4CTBA 2X0OA 4O82A 5FWKK 4IMYA 3TIYA 5JGAA 4QQTA 3MFUA 4QOXA 2XF0A 4JT3A 2YCRA 1PXPA 3OVVA 3DQWA 3UO5A 1DM2A 2EUFB 5K9IA 2G2FA 2V62A 4X2FA 4NCTC 3H30A 1G3NA 3Q3BA 3VHEA 5HLWA 2OF4A 3P86A 4USEA 4FJVA 4EYMA 3FZPA 4MD8E 2P33A 3M11A 5EQYA 3TYKA 4ZMEA 2JITA 4CXAA 2W4JA 3KMUA 3TKUA 4BI1A 4MXAA 4MD9E 4BDGA 4O22A 3CY3A 2YERA 2GNIA 5FEDA 5D9HA 5ANGA 2PVRA 4BN1A 2P2HA 1M2RA 5IUHA 4EC8A 4V0GA 2H6DA 2BAJA 4JG6A 1OI9A 3BYVA 2FO0A 1STCE 4C02A 3LMIA 3MJ1A 4AXAA 3KCFA 3UC3A 2J0KA 4QTEA 4JDHA 4KB8A 2XEYA 4OGRA 3T3UA 3IOKA 2I0VA 3GU6A 4XBUA 2YAKA 4MD7E 5JFXA 3CQUA 4HPUE 4GVJA 4LUEA 3IG7A 2E9NA 3IDBA 3K5UA 3SRVA 3VULA 3H0YA 3EL8A 5DOSA