3EQRA

Crystal structure of ack1 with compound t74
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
276
structure length
270
Chain Sequence
b'LTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activated CDC42 kinase 1
publication title Identification and optimization of N3,N6-diaryl-1H-pyrazolo[3,4-d]pyrimidine-3,6-diamines as a novel class of ACK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 270
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3eqrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3eqrA01
2CHLA 2XKDA 4OT5A 5AP1A 5CT7A 5LOHA 1GZOA 1P2AA 3QZGA 2HAKA 4RC4A 4S32A 4DCEA 4ANMA 4F4PA 3QU0A 3SD0A 2ITPA 5CI7A 5AV1A 1YWRA 2X4FA 1IA8A 3HLLA 4BF2A 5IH4A 3HV7A 2C6EA 4HVGA 3NUAA 3KXZA 4U45A 2V62A 1KOAA 3C4ZA 5HLNA 2ITXA 4MWIA 4JG8A 3UPXA 4FZDB 1OL2A 3A62A 3BYVA 5AEPA 2Z8CA 4M7IA 3JPVA 4U79A 3CPCA 3UZTA 5JZNA 3BV2A 4EWHA 4ZP5A 5CAOA 4ZJVA 5CAVA 5H9BA 4P4CA 2GS7A 3PZHA 3HA6A 3O51A 2YLFA 1VYWA 2E9NA 3R00A 3OCBA 1PKDA 4QMUA 4RIWB 5T3QA 3HL7A 4NH1A 5E8UA 3ZSIA 3TNQB 4M68A 5AX9A 2IWIA 3A7HA 4FG7A 2CLXA 3JUHA 3EN6A 3F5PA 4H58A 3VUTA 4LL0A 2HCKA 3O71A 1CMKE 2A2AA 4IX5A 3S95A 1YHWA 3FLWA 3UODA 3ZBFA 3D7TB 5A3XA 4EOLA 4GFMA 4BKZA 4DFYA 2V5QA 3I7CA 1GAGA 4R5SA 5L3AA 3FPQA 1H00A 3W55A 4M12A 4E73A 5IDPA 4BDAA 4BCHA 4CMUA 3P7AA 2GFSA 3ZDIA 4DEAA 4S34A 4AAAA 1A06A 4DC2A 2OF2A 3OCGA 4IX4A 3WARA 1UU9A 5M4CA 1PXKA 1J1BA 3BCEA 3OG7A 4IWDA 5F94A 5AUWA 2Y9QA 3ROCA 3BKBA 2CNUA 3AD6A 4OBQA 4RSSA 4W4VA 4XP3A 4DG3E 3G51A 2C3KA 5BQ0A 5HQ0A 1TQIA 2WOTA 3U9NA 5CF6A 3R7OA 3UVPA 2UW3A 2VTOA 2XM8A 5AWMA 1PXNA 2VO3A 2IG7A 5M4IA 3LFSA 2PHKA 3PIXA 3VS5A 3PZEA 4UX9A 4NKAA 4XOZA 4B9DA 5T6KA 4QTBA 2JLDA 4FC0A 5BNJA 4ALVA 2ACXA 3CGFA 4R7BA 2V7AA 4QQCA 4RX7A 3C4EA 4FTCA 4XH6A 4Y95A 2W9FB 3ZXZA 5J9LA 3CEKA 3OHTA 1J91A 3I60A 1XBAA 4FV8A 3VS4A 4TWNA 4IAYA 4J71A 2YERA 3PIZA 4LGHA 2C5NA 3F61A 4YJOA 3RKBA 1EH4A 2ZV2A 5ETFA 3SKCA 5HD4A 4XS2A 1CSNA 3F5XA 3Q4TA 2XIRA 4FR4A 4D4SA 3FQEA 3D5UA 3G0EA 2XCHA 3D5WA 3MIYA 5FD2A 5LMBA 3FUPA 1FMKA 2JEDA 5L6WL 2H34A 3PXRA 4WSYA 4JBVA 4F65A 5HG7A 3RPRA 2Z7QA 2DWBA 3KY2A 1XBCA 3P1AA 5FP5A 3JR1A 4EC8A 1F0QA 4AOJA 3U8WA 3PXZA 2OXYA 2VWUA 5E8TA 1UWJA 3IOPA 2XP2A 5A46A 5J87A 3FL5A 4CNHA 4BCQA 3R9OA 3FZRA 2WB8A 1H07A 1V1KA 5IUIA 4DTBA 4B99A 4ZJJA 2AUHA 3ZMMA 4QP8A 2JKOA 2PUUA 3V5JA 2DS1A 3C4WA 2BALA 3TNWA 3C4CA 2IZRA 4IFCA 4OAVB 3QWJA 3C0HA 3GQLA 1GIIA 2BFYA 3GCVA 3GU7A 5F95A 1MRYA 3LXNA 4G9RA 2UW6A 1RQQA 5HBHA 4Z16A 1LEZA 4FE2A 4Y85A 2C3JA 3MVLA 4MD9E 4YTHA 2PZYA 4MQ1A 1BL6A 4H1JA 4XV9A 3IW8A 4XG4A 3R8VA 4QMWA 2IW8A 2YM8A 2I0HA 4FV4A 5E8SA 2BHEA 5HIEA 2BR1A 2VGOA 3EYHA 1H4LA 4YZMA 2WXVA 4R3CA 2VZ6A 4QMLA 4GKHA 2G2FA 4IWQA 1WBWA 2XK9A 3PSDA 4U41A 4X2KA 3ZEWA 3CTJA 3R7EA 4X3JA 3IK3A 3R7IA 4DH5A 5KUPA 2EB2A 1M2QA 2VTNA 3Q6UA 4QQ5A 3DZQA 4YTFA 4QYHA 4C38A 3Q2JA 4CZYB 5A54A 3CY3A 3FDNA 4J1RA 3EFWA 4YC6A 1K3AA 3FXZA 4V0GA 4CKRA 2YCFA 3QYWA 5KMOA 4E4XA 5KHWA 1UNHA 3QD2B 4CSVA 2EU9A 3BQCA 2B52A 3LXPA 5AM7A 3ORKA 2CJMA 4U44A 2O65A 4HPUE 4DYMA 5BYZA 5LWNA 3UMWA 3MPTA 3DV3A 3NCZA 4LQMA 4X21A 3TNHA 3PY3A 3V5LA 2QO7A 4EH2A 4XHKB 2BUJA 3UO6A 4F0GA 2R3HA 5DT3A 1XH9A 4AU8A 3Q6WA 1GZKA 3ZFYA 2W05A 4AT5A 4DCAA 3QC9A 1NW1A 3VUDA 3F2NA 4UY9A 3ZUVA 4O27B 3V5QA 4YJTA 4ZTNA 4ZZMA 4QPAA 2QONA 3RMFA 1Q3DA 1UU3A 2VWXA 5CEIA 3UJGA 4BVUA 4F6UA 4WIHA 5KNJA 3HA8A 4F1MA 5HORA 1SVEA 4E4LA 4FZFB 4NM7A 3VBQA 5DR2A 4CT1A 3QZIA 3QD4A 4I6FA 3GOPA 4K9YA 3JS2A 4U5JA 3ZCLA 3L8XA 2C4GA 4ZZOA 1YQJA 2OBJA 4TYIA 3ZXTA 4KIPA 5AP5A 3ZM9A 3KA0A 5M51A 4F6WA 4I22A 3IW5A 2PVHA 4E6CA 2VX3A 4QYGA 5CS6A 4LV8A 4BDKA 5TO8A 4HOKA 5TKDA 3WZKA 4IVAA 3FI2A 3QCXA 2R3KA 2VUWA 3LFQA 2XEZA 3KVWA 2IVVA 2WIPA 3O23A 4JBPA 2C5YA 3OUKA 5D7AA 3W1FA 4YO4A 4TYHB 4FYOA 3HZTA 3PUPA 4JDJA 1YXSA 2LAVA 3D94A 3DCVA 5CF8A 2IVSA 4LGGA 5HO8A 1ZY5A 4PV0A 4XLVA 4CMTA 1QPDA 4ZMFA 2O5KA 5HZNA 4L00A 2F7EE 1E9HA 5HTCA 5EYKA 4M66A 3GCPA 4HCUA 1KV1A 1J7IA 4G3GA 3MB7A 2E2BA 2OKRA 3ORTA 3QRKA 2XA4A 4I0TA 4ZTSA 2C6OA 4GUEA 2QCSA 4LRJA 4CFMA 2XMYA 3DJ5A 3VNTA 2YHVA 1PYEA 4YMJA 2YAKA 3F3TA 5E91A 2UW8A 4ASEA 3EQRA 3LPBA 3H10A 3IECA 3FQSA 3NX8A 3UZPA 2PU8A 4UWBA 3FY2A 5CXZA 1A9UA 2FVDA 1WBVA 3QWKA 3FKOA 4B0GA 1P5EA 4BCOA 4F09A 2OSCA 1ERKA 2QOKA 1XKKA 2JDVA 4ZOGA 2JAMA 5EM7A 4UZDA 5FDXA 4TWPA 3EQCA 3B8QA 4ASDA 4DN5A 3IQ7A 3EQFA 2WEVA 3QLGA 4YLJA 3S4QA 3BYSA 2VRXA 5C26A 2ZB0A 1PF8A 2O64A 3DAKA 4BYIA 4XJ0A 3RPSA 5AFVA 4ITHA 3E63A 1R1WA 3POZA 4I6BA 4YR8A 2GU8A 2YDKA 5DRDA 4OBOA 4BZNA 4S30A 1A48A 3TXOA 3FPMA 1HOWA 4EJ7A 2X7OA 5H8BA 5KZIA 2BRHA 4FA2A 3NIZA 2XYNA 2OZAB 5ANIA 5AV2A 4K0YA 4II5A 5DWRA 5HHWA 4CQGA 1XBBA 3CR0A 5JRSA 3LJ1A 4F0FA 2WTKC 4GEOA 2CCIA 1OBGA 5LVPA 3DJ6A 4AN3A 3HAVA 4QQJA 2WU7A 1R0EA 2P0CA 1PKGA 2PMIA 3HP5A 4ZTLA 5AA8A 3ZUUA 4GUBA 1M14A 3ZDUA 2UV2A 3MN3A 4E7WA 3LQ3A 4BDGA 3OZ6A 2JC6A 1KE8A 2AYPA 3AOXA 2BKZA 4QMYA 4ZTHA 3NAXA 3KMWA 4PTEA 5BYYA 1OPJA 4I3ZA 4FV2A 4PL4A 5EW8A 4ASXA 4KRDA 3Q9WA 2YACA 3FLNC 2CKOA 4PY1A 2F49A 5J9YA 4RGJA 1WBNA 3BU5A 4QMTA 2GNIA 4GK4A 4G3CA 1KE5A 4IE9A 5M57A 2C0OA 5C9CA 3COIA 2BTRA 2VV9A 4KBAA 5KBQA 5CX9A 4IADA 3BV3A 4WG3A 4XRJA 3NGAA 1LR4A 1H1QA 4Q2AA 5JEBA 3EN5A 3ZC6A 4FUXA 3QTRA 4APPA 2CNVA 1XH5A 2NNWB 5E8ZA 1Q8TA 4BC6A 1PMUA 3CS9A 4FSMA 4EZ7A 4O7ZA 3U4UA 1U46A 2YAAA 4CZTA 5ETAA 5JKGA 4QMNA 5DHJA 1DS5A 2WMRA 4U0IA 4B8LA 5ANDA 3I5ZA 4KIKB 1W84A 2VWZA 2VU3A 2PVYA 2W06A 2OZOA 4A7CA 4FSWA 3LCSA 4I92A 4FTNA 2XBAA 4JOAA 4NSTA 3WBLA 4ZZNA 5GJDA 4G17A 4R78A 3VWAA 3FL4A 3GU5A 3KCKA 1NA7A 2WMSA 4N6ZA 3UVQA 2VTRA 4W4YA 4IAKA 4L68A 4FSUA 4BICA 4EQCA 5BVKA 4AT4A 3E64A 1WVWA 3DBEA 4JQ8A 5IQIA 2UW0A 2WTDA 3QXPA 4BTMA 3PP0A 3ATTA 4U8ZA 4GK2A 5CAUA 3WF8A 1U54B 2VTAA 3DLSA 4C62A 1L3RE 2CGWA 2OH4A 4G34A 4IWPA 3AMAA 3VBXA 4ZS4A 4J97A 4A4XA 1IRKA 2YDJA 2YN8A 5B0XA 3VBVA 3BBWA 5LCJA 3ALOA 3UZRA 3DOGA 1OIYA 2XB7A 3PP1A 3ID6C 4EK6A 4FG9A 3RWQA 1Y91A 2GNGA 3A7IA 3UNJA 3BU3A 2OJGA 2VX0A 2FO0A 4IM0A 4JDHA 4WD5A 3QX2A 4QQTA 5IQEA 4ANQA 3VBWA 2HWOA 4BGHA 3THBA 3NRMA 1Q4LA 4QRCA 4FZ6A 3R04A 5GZ9A 4EKKA 1JKSA 2B55A 3ETAA 2W5BA 1W82A 3DAJA 3N4VA 4RFZA 4HZSA 4JNWA 4RWKA 3TT0A 3ZLXA 4BI0A 4E20A 5M07A 2YISA 3CQWA 4RFMA 4WUNA 2JKQA 4FTOA 4IZYA 4BFMA 4RPVA 4BDIA 3PJCA 3WOWA 3ENMA 5IH5A 5DOSA 4AOIA 5D7VA 4MXCA 4BYJA 4RIWA 5DT4A 4KNBA 4CV9A 1WBSA 2UZEA 3WZDA 4D0XA 5IMEA 4KBCA 3GC7A 5C8NA 2CGXA 2ZMCA 3OBGA 4A9SA 3GC9A 3OD6X 3QXOA 4PP7A 1DAYA 3BYMA 5FDPA 3RHKA 4RJ6A 1XR1A 2XRWA 3POOA 3ALNA 4FV6A 3T8OA 2YFXA 2GTMA 5BPYA 4G1WA 4U81A 4J52A 3Q32A 4JAJA 3R2BA 3G90X 4LL5A 2X6DA 3VRZA 1LPUA 4YU2A 4ZLOA 4M69A 4AA4A 4KKGA 4I5PA 3VQUA 5A14A 1W7HA 4NTSA 4IAZA 1PW2A 2WQMA 4O2ZA 4RRVA 4O22A 2QU6A 1LUFA 5EFQA 5FEQA 4DFUA 4FKRA 4XRLA 4AFJA 3LLTA 4ALUA 5HU9A 4LM5A 3OW3A 3SW7A 2HIWA 1V0BA 4XG2A 3VHEA 4DEHA 4YHJA 1KOBA 2UZOA 2VWIA 2ZJWA 3OT8A 5ANOA 3GC0A 5J5TA 3QTZA 2FSLX 3D4QA 3MFUA 3GC8A 4GFGA 3BELA 3KCFA 4I4EA 2HY0A 1ZARA 3RINA 4BTJA 4X3FA 2PZ5A 3M1SA 3UOJA 5E7RA 2OLCA 4ID7A 3GP0A 4DEGA 2Y6OA 4V04A 4NFNA 3MFRA 2GQRA 3PRIA 1U5RA 3KU2A 3ULIA 2VTHA 3OWJA 3OWKA 3EQPA 4UB7A 3SW4A 5J5SA 3W2PA 3ZM4A 1V0PA 5JSMA 1H1RA 2ITUA 5CAPA 5I9YA 3AGLA 4QP6A 1OUYA 4FKUA 3VHKA 3BYOA 4IW0A 4F08A 4FOCA 3U9CA 3HVCA 1WZYA 2YCQA 3U54A 2XIYA 1ZOHA 4RWJA 2YWPA 4AGCA 2R3LA 4N57A 2VX1A 4BWXA 3LJ2A 3AMBA 4QMZA 4BKYA 4AE9A 5KMLA 1YDSE 4PQNA 4XV3A 2ZB1A 3QRUA 4EK4A 2R3JA 4S33A 2J5EA 5F9EA 2FSOX 1Q8WA 2DQ7X 3IPHA 5J79A 3R1QA 4WNPA 1F5QA 5I5ZA 4FV0A 3QAME 4NU1A 1XH6A 4RT7A 4O0UA 4ZTQA 3V5TA 1XH8A 4C61A 3ZRLA 2V7OA 4TT7A 2P33A 3SC1A 1SZMA 1O9UA 4N70A 5H8EA 5HO6A 5KBRA 3GOKA 4J8MA 3GNIB 3QQJA 3T3UA 4QMOA 3RGFA 1ZYJA 3H9FA 3R63A 3BWFA 4BI1A 5JQ8A 4FT3A 2X9EA 2XK7A 3E7OA 4XLIA 3UIBA 4Z9LA 5LXMA 4X3FC 3UG2A 4ZSGA 4RVKA 3QUDA 3R6XA 5A4TA 5AAGA 3UO5A 2JBPA 4FK6A 5EHOA 4DH3A 3W2RA 4EH9A 4HYHA 5D1JA 3PA4A 1FVVA 5B7VA 4XG7A 2QNJA 4IAFA 4J53A 3JY9A 3KULA 3NIEA 3O8UA 2R7BA 2X6EA 4I93A 5FXSA 2CN5A 3E8NA 4YP8A 3GVUA 3FMHA 4XG6A 3G9NA 1XQZA 1U4DA 5KE0A 1JAMA 5CSHA 2YEXA 3Q4CA 2R0IA 1ZWSA 3RPOA 4TXCA 2XKFA 2F2UA 4C8BA 3BHUA 3AC2A 2B9JA 4JT3A 3FMNA 3U55A 4DFBA 1OM1A 3IGGA 1NVQA 5I3RA 3IS5A 3DKFA 4QNAA 4FL2A 1H28A 5EQYA 2HK5A 5F1ZA 3TDVA 3NW5A 4DH7A 3O2MA 4YUQA 5HLWA 3PG1A 1Q5KA 3COKA 3OW4A 4OTFA 4D4RA 4FIFA 3P23A 1Q99A 1TQMA 5DPVA 3K54A 4ZSLA 2A19B 4A9YA 1I44A 2J90A 3BEGA 3FV8A 5AUUA 5TF9A 3FZ1A 1VZOA 2UZVA 4D0WA 5JZJA 3PPKA 2W4OA 4PPAA 4L6QA 2R0UA 5AR8A 4O84A 3DZOA 5JQ5A 3CBLA 3MSSA 4G16A 4QMQA 2JDSA 2HW7A 3ORMA 4RMZA 3EB0A 5AR4A 2UZNA 4AZWA 4BN1A 2X4ZA 3F2RA 4CFUA 3NAYA 1QPJA 4FT0A 3W2OA 4UYNA 1JNKA 3TKUA 4F9BA 2UZLA 4L43A 3EOCA 3NCGA 4NJDA 4OTHA 4XV2A 4YO6A 5DEYA 5K9IA 1IAJA 2REIA 4F9AA 5IMXA 4EK5A 3VW6A 4F7LA 4XEYA 1YWVA 4O7LA 2A4LA 1DAWA 4GV1A 3E8DA 3SDJA 3KRXA 5DLSA 1URWA 2W1EA 3NNXA 4HYSA 4EYMA 1VEBA 4LYNA 2QOHA 2ZVAA 4CGAA 1KSWA 1ZZ2A 2QOOA 3W10A 3FZTA 3MA3A 3WILA 1UKIA 1W0XC 4UALA 4BB4A 5CANA 3MY1A 5C8MA 3AC1A 4CZUA 3ORLA 4UMUA 2OFUA 4RVMA 3LW0A 3PJ2A 3DQXA 1BLXA 3NW6A 1NVSA 2R2PA 2ZMDA 3EN4A 1OGUA 3SX9A 4BHNA 2HENA 3HV5A 2FA2A 3F3UA 3VULA 4D2WA 4GSBA 3PWDA 2F7XE 2I0VA 2EWAA 3HMMA 5DRBA 4DH8A 4O2PA 4RQVA 3VW8A 4JBOA 2PVNA 3BGQA 3NUUA 1MRVA 3KXNA 2BTSA 2CGVA 3F9NA 3OVVA 4IZ7A 4FNXA 5HGIA 3C1XA 3JXWA 3H3CA 2WQBA 2R4BA 4PRJA 3I6WA 4FV3A 1JKLA 4GJ3A 5A6NA 1OIRA 3FZOA 1PHKA 4Y5HA 2VTIA 3NSZA 5CQWA 4CMOA 2C6DA 3HV4A 4E6AA 3DKCA 3NZ0A 4BCNA 4V05A 3FAAA 4H3PA 4YJVA 4L45A 2I40A 5HG5A 3LXLA 3TL8A 4FSYA 3R8PA 3RCJA 4BRXA 2X0GA 3AGMA 4CKJA 3AQVA 4GIHA 2QODA 3UQFA 3RK9A 5J7HA 1OECA 1FPUA 4KD1A 2CPKE 2PZIA 5EI8A 5IEYA 3QZFA 4WRSA 4XCUA 3BHYA 1H1PA 1Z9XA 4OAUC 2QR8A 4KS8A 3TN8A 1RE8A 4UMPA 4ZTMA 3TUDA 2RKUA 4LOOA 4WUAA 2VTMA 2PUNA 2UZBA 3BWJA 4MH7A 4O83A 1H24A 4MWHA 2BILB 2O3PA 4V0GB 2W1DA 5EI2A 2X8DA 4ERKA 5G1XA 1Q8ZA 4U3ZA 5JFXA 5E4HA 2XJ0A 4MD7E 3UIMA 2YZLA 2IW6A 4ARKA 1JQHA 2QG7A 3PRFA 3F88A 3D2KA 4FKTA 4JXFA 2HZIA 4FT5A 1JLUE 5HLPA 4DAWA 4EHVA 4NCTA 1KE6A 1K9AA 3Q9XA 4KRCA 4U97A 1J3HA 2G2IA 2CMWA 2EVAA 1Y8YA 3EQDA 1YKRA 4XOYA 1R0PA 2XNOA 3QD3A 3NLBA 5F4NA 5DIAA 4ZIMA 2PUPA 1UWHA 1OB3A 2I0YA 3AG9A 4BCFA 5DFPA 5AP0A 4WBBB 5CYIA 4EC9A 4O82A 2J51A 3LXKA 4OTRA 4BDDA 1YXUA 3CXWA 2X8EA 4AQCA 1HCKA 3QHWA 2BZHB 2NO3A 4JL9A 4Z3VA 2CGUA 1YHSA 4TRLA 5CZIA 3V5PA 5KMIA 4DG0E 3SHEA 5FBNC 4U3YA 5DT0A 2QHMA 2B1PA 3CGOA 2PUIA 4C4FA 4I5HA 4WKQA 2JFLA 3ORIA 2ZV8A 3I7BA 4FVQA 4TYJA 3LFAA 3EWHA 1JWHA 3G2FA 1H27A 3NEWA 3LVPA 2ZV7A 5EOLA 4HNIA 2WPAA 4IC7A 4JBQA 3BI6A 2BZJA 3DPKA 3FYJX 3OCTA 5AP7A 3A99A 5E8WA 4F7SA 1OKWA 3H9RA 2C5VA 3GENA 3OEZA 3QCSA 3ZOSA 3P79A 4RJ5A 3ZUTA 3P0MA 4L3JA 4BWKA 2QOLA 2XRUA 1AQ1A 5TOZA 3JYAA 3FC2A 4YSJA 2VTQA 5GJFA 4CFXA 2WTKB 4JDKA 3LOKA 4ACMA 5HTBA 3UPZA 1O6KA 2YZAA 3IONA 5I0BA 5KMKA 4IX3A 4NCTC 2Y4PA 4K11A 5FLFA 5HCYA 3RHXA 4KKEA 5CEQA 3R7UA 4RJ7A 4YHTA 5IEXA 2BRMA 4FEVA 1PXOA 4O0WA 2GS2A 2IO6A 4MTAA 4F6SA 4JR3A 2WMWA 2EXEA 2W1IA 5CQUA 4EL9A 1R39A 1BI7A 1PMEA 3GFEA 5JGAA 3SAYA 3PVBA 2JDTA 5KKRC 3KC3A 2BZKB 3LFDA 3OTVA 3CTQA 4QMVA 5HE2A 5GIPE 5IQHA 2VO0A 1Q62A 5D41A 1T46A 3IKAA 4WG5A 4X2GA 3DBDA 3TACA 2KTYA 2J50A 2P4IA 4QP3A 3NYVA 2WMAA 2BMCA 5AR2A 1ZYLA 2YIQA 1OITA 4KUJA 1YXTA 2C1AA 5M4FA 2ZM1A 3NUYA 4GJ2A 2W7XA 5D12A 4FKQA 1GZ8A 3L8PA 4FF8A 4NFMA 3RZBA 1S9JA 3RPYA 3OOGA 4RLLA 3ANRA 4R77A 4MX9A 3LAUA 3V04A 2OFVA 2C68A 3AT4A 3KRLA 3PXQA 3QTXA 5GHVA 2RFNA 2OIBA 3TZ9A 2XH5A 3DNEA 1MRUA 4GS6A 3FHIA 1IAHA 2C1BA 2R9SA 4XMOA 5KMJA 4J96A 4IXPA 3TKIA 4EOJA 4D5HA 1JSVA 3O50A 4A9TA 3UBDA 4MEDA 2XZSA 5AUZA 3HRCA 5FRIA 3MJ1A 4C59A 4YJSA 1PMVA 4FKVA 5HG9A 3BGZA 4ITJA 4UBAA 3RPVA 2ITNA 3VO3A 2F57A 5FG8A 5EQEA 3TZ7A 3ZFMA 4J7BA 4TKSA 4IJPA 5HCXA 2O8YA 4EQUA 3Q9ZA 1YXXA 1XO2B 1YI4A 2IVUA 4MNEA 4QD6A 2JITA 2FSTX 4TZRA 3UIXA 5CNOA 4EOMA 5C8KA 4UXQA 4FIIA 2WD1A 4L3LA 5DH3A 4K18A 4HZRA 3QALE 2I1MA 3CIKA 4MXOA 5AUYA 2W1GA 2VNWA 3MI9A 4EOPA 3DTCA 5CSWA 3SG8A 5AP6A 3PXFA 4J99A 3M2WA 2HZNA 3VBYA 5E8YA 1GJOA 1I09A 4ASZA 4OTQA 2RFSA 3FQHA 5HVJA 4CRLA 4E8AA 5IQFA 1URCA 2J7TA 2V22A 1H0VA 3WE8A 4NKSA 2XM9A 5EDRA 3D7TA 3LKMA 2QKWB 5LMAA 5DNRA 4O0TA 1BX6A 2J0JA 3PA3A 4FT7A 4BGGA 3MESA 3KREA 3HX4A 4U6RA 3MFTA 4FKJA 2VNYA 4L44A 4X6RA 4TTHB 5EDQA 4JR7A 4X6QC 3PVWA 4EOOA 5GIOE 5IG1A 4EK8A 5HO7A 4YGAA 4YLLA 4HPTE 5LVLA 4AP7A 4OW8A 2JIUA 5H2UA 3F5UA 3EQBA 4YLKA 3S3IA 4EI4A 4YC8A 3CQEA 3HUBA 3L8SA 2IVTA 2XBJA 4QP4A 3LM5A 3SLSA 4BCPA 4B4LA 4DGMA 5IQDA 3CPBA 2VTLA 4OTIA 5HCZA 2VTSA 2JBOA 3BIZA 4FYNA 5LARA 5AUTA 2KULA 4UWCA 5GZAA 5AM6A 5AADA 4N6YA 3U87A 4DFNA 4GRBA 4BIEA 3KK8A 4QNYA 1SNXA 3LJ0A 1BMKA 2IW9A 1JSTA 1YW2A 3E92A 3NS9A 5ANJA 3RAIA 3BHVA 4PUZA 2JD5A 3L9NA 3A2CA 3A7FA 3DFCB 5FTOA 2X2MA 3F5GA 4JRVA 1MP8A 2VGPA 3GGFA 4HYIA 4O7VA 5J8IA 5AAEA 4U43A 3FSKA 4EHZA 4OTPA 5I4NA 3FLSA 3PJ1A 4P7EA 4TWCA 2IJMA 2R3PA 3DXNA 3PVGA 4L3PA 4IFGA 4GMYA 2HW6A 3FC1X 1YOJA 4FT9A 4A07A 2OGVA 3E87A 3ORZA 5JFSA 3TUCA 2WMBA 3UYSA 4QTAA 4D2PA 3MDYA 4RLKA 3V3VA 4FL1A 2GHLA 2XVDA 3NR9A 3CSVA 3UOKA 3C5UA 4HGSA 4K1BA 2FUMA 3O17A 3H0ZA 5CEKA 3HNGA 3PLAE 2ERKA 4E1ZA 1W8CA 1WBPA 4K77A 3A4OX 2ESMA 2VTJA 2VWBA 2CCHA 2XNNA 1M7NA 3KL8A 3OUNB 4G9CA 4U9AA 4USDA 5L8JA 3R9NA 4BIBA 2ZV9A 2J4ZA 2JIVA 3SXSA 3F82A 4FTIA 4MVFA 2I0EA 3QFVA 2BAQA 4I0RA 3RWPA 4YJQA 4AWIA 3P78A 2YCSA 3QKMA 4IVCA 3P5KA 4HW7A 5HICA 3KQ7A 3G6HA 3QTUA 1RDQE 4A4OA 3FMJA 4D1ZA 4KA3A 4GT4A 4EBWA 1WAKA 4FKIA 4DH1A 5CALA 4R8QA 4MXYA 4FKGA 4LV5A 4FKOA 4OTGA 4MF1A 4UMRA 5BVWA 2EUFB 4LFIA 4XNEA 4PDPA 5BVEA 2W4KA 2J0KA 3ZBXA 4MXXA 2EB3A 4M8TA 5L2IA 3WIGA 2XK4A 4HVHA 3Q4ZA 3E7VA 4O0SA 4X3FB 2WEIA 1JPAA 4UMTA 3BLQA 3KK9A 2C5OA 4FV9A 4D1SA 3Q60A 3TM0A 3TI1A 1G5SA 3DAEA 3KRRA 2J0MB 3D5XA 3FMKA 4CXAA 4DGLC 4E4MA 2XNMA 3AC8A 3EHAA 3QGYA 3VBTA 3FE3A 3HMNA 3ZSGA 5EQPA 4D28A 5ETIA 1H8FA 3PTGA 2CLQA 4EH5A 2WU6A 2UZTA 1YRPA 4AZEA 4PTGA 3ZLSA 4CCBA 3RCDA 1B38A 3W2QA 5L6OA 3ZZEA 4R7HA 4PL3A 3CD3A 3GXLA 4TYGA 3VJNA 5CVGA 4ANLA 3RVGA 3QF9A 4IDTA 5L2TA 2HOGA 4AACA 3BHTA 5DGZA 4JI9A 2YABA 4PPBA 3ZHPC 1OL7A 2H96A 2QQ7A 1OKZA 1ZMUA 3C0IA 2GTNA 4L67A 5TT7A 4AGUA 3QA8A 5JFWA 1JSUA 4HGLA 5A4EA 4LOQA 3PY1A 3ACJA 3DQWA 4DG2E 2VD5A 2ZOQA 1UNLA 1NXKA 2GCDA 4GG5A 4RQKA 4JIAA 4XUFA 2WTWA 3F66A 3FKLA 3RNIA 3ZU7A 1KWPA 2YWVA 2YM6A 3FMMA 3DT1A 3DTWA 2B0QA 3BRBA 4CD0A 5IA3A 3W18A 3N4TA 2QOFA 1SNUA 3GU4A 3R9RA 3KXXA 2C0TA 1H1WA 4AFEA 5I9ZA 3RM6A 5JN2A 1O6LA 3C50A 3EFLA 3C5IA 3UP7A 2Y4IB 3E88A 3NVMB 4QPSA 2WFYA 3C51A 4NT4A 2W1ZA 3LCTA 4UV0A 3WZJA 3E3BX 1Q8YA 3DY7A 2C3IB 1CM8A 3DB6A 3OT3A 3BE9A 4IM2A 5EW9A 1CDKA 2A27A 4BWPA 1PY5A 1M7QA 3Q4UA 4YNEA 3KULB 3ET7A 3DS6A 3FYKX 3MYGA 1PXLA 2ZAZA 3IW6A 3NUNA 5HEZA 3F7ZA 4AW1A 4MXZA 5BUJA 4M14A 1H26A 1CKPA 5JT2A 5LQFA 1L8TA 4C3PA 4OR5A 5LCKA 4O7SA 3FI3A 4CQEA 3PA5A 3I1AA 2GNJA 3QCYA 4H3QA 4M0YA 2WMXA 4EOSA 4C02A 3KFAA 4DGGA 4EH3A 4BDEA 4TL0A 1ZYDA 4FODA 3GUBA 5EK7A 3DA6A 4FEWA 3KN5A 3R7YA 1CTPE 4TYHA 5T68A 4WHZA 3BPRA 1WVXA 2WMUA 4KS7A 2LGCA 2X7FA 3MTLA 4IAAA 3NUSA 2PL0A 2OWBA 5AUXA 2C5XA 2Z7RA 4FIEA 3QYZA 4LMNA 4R7IA 1TVOA 1MQ4A 1P4OA 3G0FA 3QTWA 3R2YA 5L2QA 1R78A 3EL7A 2OJFE 5HU3A 5IQCA 3QZHA 4BDHA 4FSNA 1REKA 3TKHA 5BVOA 3ZTXA 1FGIA 2FB8A 4RIYA 2WKMA 5CT0A 3R8ZA 1UU8A 4TW9A 5CSVA 3ZS5A 4CT2A 4FEUA 3MH3A 5C4KA 3OC1A 4NIFB 1OKVA 4F99A 3EMGA 4B7TA 3A61A 3UC3A 1SYKA 4GU6A 1ZOGA 5L2SA 2ITYA 5EDPA 4CEGA 3LZBA 4C3FA 4IACA 3O7LB 3EN9A 3SV0A 4NUSA 4PDYA 5D11A 4ORKA 4ZS0A 4KSQA 3FMLA 4O7RA 2CKPA 3PY0A 3QQGA 5FM2A 4EH8A 4MXAA 4ZAUA 3TTJA 4JVGA 5CU2A 4FNWA 3RAHA 3MVHA 5EHLA 2ZYBA 3QC4A 4PTCA 5BMMA 3R1NA 5CENA 5BMSA 5FBOA 4TN6A 3WE4A 3CCNA 1ZZLA 1YI6A 3F3ZA 4I20A 1ATPE 3KRJA 4BDFA 2JDOA 2BCJA 3WZUA 4F0IA 1SM2A 4WSQA 3C4XA 3GQIA 4EOQA 3SVVA 4EYJA 3D2IA 4HNFA 2OG8A 4C57A 2UZUE 4D2VA 3NYXA 3QTSA 3EFKA 2OIDA 5CLPA 4BBFA 4AA5A 3TZMA 2B53A 2PE1A 4RVLA 2OZAA 3U6IA 3R28A 3HAMA 5DMZA 4QMSA 3QL8A 5JRQA 3HV3A 4V01A 1UVRA 4NK9A 5CNNA 4JS8A 2G9XA 3EQGA 3HDNA 2WTCA 3E3PA 5KCVA 5L8LA 4C33A 4LRKA 4I5MA 3DXQA 4O7YA 2V55A 2YIRA 4ALWA 3COMA 5CAQA 3WIKA 4AZFA 5LMKA 3VUKA 2ZM3A 5A6OA 4L46A 4J98A 2NRUA 4D1XA 3CQUA 5FTQA 3P4KA 1XH4A 2X2LA 3T9TA 3IOKA 4ZSJA 2C30A 5DR9A 4ZY6A 2EXCX 2XIZA 2JKMA 3KVXA 2YIYA 1P14A 2G01A 2UVYA 3TNIA 5CEMA 5IDNA 3DDQA 4RJ8A 4AGWA 5IF1A 2P55A 5BVFA 3AT2A 3R83A 3R8UA 2XF0A 4BI2A 2Z7LA 5C4LA 2NPQA 2BRGA 3R7VA 1Z57A 1J1CA 4TNBA 4MD8E 1KE7A 3WYYA 2GFCA 4ONAA 2WIHA 3QX4A 2X8IA 1PXPA 2ONLC 3ACKA 3CLYA 3P7CA 3D5VA 5CSPA 5M56A 2XIKA 4E4NA 2QOIA 5KMMA 4BL1A 2BFXA 5EI6A 2C6MA 2ITQA 5B2LA 3LM0A 5F20A 3MH2A 4O0VA 2HWPA 3WF6A 4I4FA 4I94A 4IZAA 4X2FA 2GDOA 4WNOA 2QI8A 5JFVA 3RZFA 2B4SB 1UV5A 4RX8A 3EZRA 5CTPA 3UP2A 3LLAA 4CYIA 2YA9A 3Q2MA 3PXKA 5GJGA 4HGTA 3WI6A 4QP1A 2YDIA 3I6UA 1B6CB 4AS0A 1VYZA 3C7QA 5CASA 3R8MA 2B9FA 3SG9A 2B9IA 3E5AA 4FMQA 5IA2A 5LMKC 5J1VA 1U54A 3SRVA 5BYLA 3FMEA 4YPDA 3MWUA 4ANBA 5G6VA 4WNKA 4O1PA 4EWQA 3V5WA 5K0KA 4N0SA 3U6HA 5HNGA 3DBQA 5IA4A 5CVFA 5AJQA 4X7QA 5M4UA 3II5A 3TCPA 4CRSA 3V8WA 4YURA 2X2KA 5BVNA 1J7UA 4F9WA 5IISA 4F7JA 4HGEA 3OWLA 4EORA 3F3WA 3O8PA 4DGOA 4DFLA 3BEAA 4K8AA 3L8VA 5FUTA 4QMPA 4FGBA 4ACGA 1UKHA 3HGKA 3OBJA 5HVKA 3FMDA 4FEXA 2RSVA 3UQCA 3KB7A 2XNGA 3IG7A 2X7GA 1K2PA 4FKLA 5M55A 4AUAA 2BDFA 4OT6A 2HZ0A 4QT1A 1WMKA 2VWYA 3GFWA 4GT3A 3T9IA 3AXWA 5J1WA 4FV5A 2ETKA 1GNGA 3FLYA 2VAGA 4G31A 3I4BA 3OMVA 5AV0A 3G9LX 3LMGA 2DUVA 5E1EA 4C4IA 4FIGA 5E92A 3RBWA 4Z7HA 5FXRA 1ND4A 3FI8A 4FSRA 3R02A 3LE6A 4IWOA 4DEDA 4Q9ZA 5GZ8A 3E93A 5ICPA 3LFFA 1Q61A 2ETRA 3G5DA 4GCJA 4DLIA 5CEOA 3D9VA 4PMTA 3H4JA 4BDBA 4A9RA 3VF8A 5EYDA 1FOTA 2WGJA 1GZNA 3M42A 3FJQE 4GVJA 4IJ9A 1WFCA 4IBMA 5CZHA 4G5JA 2XIXA 3S1HA 3QHRA 4DINA 2XNBA 5AP2A 3U51A 4MHAA 2X81A 4TWOA 3LCDA 4I6QA 4W4XA 4AF3A 3BZ3A 4I0SA 1ZMVA 2CDZA 3ZSHA 3GCUA 4NTTA 5HNIX 1H25A 1GIJA 1U5QA 1OUKA 2XCKA 3B2TA 5FXQA 4DFXE 4IDVA 4HVIA 4QMXA 3KXHA 5HBJA 4E5BA 5K3YA 4RX9A 2HXLA 3D7ZA 4W9XA 3VRYA 5LVNA 5CXHA 4AZVA 4QTCA 2Q0NA 3FZPA 3HMIA 5EKOA 4RG0A 5DI1A 2YM4A 3C9WA 3K5UA 3PE1A 2XYUA 5C1QB 5IUGA 3NPCA 3DNDA 4CLJA 2JDRA 2XEYA 3A4PA 2W99B 5IQAA 3R22A 3R21A 4NW5A 1FVRA 1H0WA 2PK9A 4OTDA 1GIHA 1ZYCA 4MCVA 5DR6A 3NNVA 4IM3A 5EH0A 4YTCA 2Z02A 4FBXA 4A06A 4K2RA 3DK7A 3FXXA 4AT3A 1BL7A 1QCFA 5CU3A 2YIWA 4BDJA 1NY3A 4O7NA 5HVYA 2C47A 4BHZA 2BROA 2GNLA 3A8XA 2XK6A 1APME 3GEQA 5TR6A 1DI8A 4W4WA 4YZNA 5FQDC 2UVXA 3ZO3A 4DLJA 1MUOA 3HDMA 4ANNA 5LWMA 4DEBA 3OY3A 4FV7A 2UW4A 5JH6A 2BVAA 3W32A 4FVPA 5AP4A 4Y72A 3JVRA 4EHEA 4QTEA 4GKIA 3PYYA 3QTIA 4JG6A 4AOTA 4YC3A 2P2IA 2OJ9A 2QO9A 2PE0A 2WMTA 4F9CA 5HIBA 3FSFA 2W1CA 3CKWA 5EYMA 3FHRA 4IB3A 4XG8A 4M84A 4IEBA 2GMXA 3QKLA 5HTIA 5I9WA 3HV6A 3WZEA 2Q0BA 5J9ZA 1E1VA 4D2SA 4C0TA 3W8LA 3R9HA 5EOBA 2ITVA 4YNOA 2VN9A 3OWPA 3Q53A 4CKIA 2YJRA 2C69A 4MNEB 4UEUA 5AIRA 4E3CA 1T45A 4NM3A 4G3EA 2G2HA 2PZPA 4PL5A 3WF5A 4DEIA 5L2WA 4QYYA 3VUIA 5IH6A 3TG1A 4E6DA 3KMUA 3ZYAA 2UUEA 2X9FA 4DEEA 3DKGA 3AC3A 3AC5A 3ZO2A 3MPAA 4BGQA 2UW9A 4G2FA 3HEGA 3PIYA 3SOAA 5K5NA 4BR3A 2Y0AA 4GK3A 3V8TA 3CY2A 4OLIA 5KX8A 2Y7JA 3F6XA 3WF7A 4O0YA 2I7QA 4QOXA 1G8SA 2QOCA 3QQHA 3RK5A 1ZYSA 4GIIA 4Q5EA 3VUMA 2QHNA 3FBVA 2G1TA 2QO2A 4HJOA 3BBTB 4IB0A 3RP9A 2X39A 1X8BA 2YJSA 4RWLA 4IIRA 2C6IA 4QMMA 3R9DA 1CKJA 1KE9A 4USEA 2J0IA 3UG1A 5CU4A 1YDRE 3R8LA 5LVOA 1JOWB 3ITZA 2YITA 3C0GA 4JJRA 4JDIA 3RTPA 5IU2A 4GT5A 1YXVA 2WQOA 3PWYA 4F7NA 2QOBA 4W8DA 4O86A 4P2KA 2PMNX 4BCJA 4FKSA 1PYXA 3I5NA 1BUHA 1BYGA 2RGPA 4JX7A 3H30A 2WZJA 4RC3A 3NNWA 4Q5HA 2HYYA 4WG4A 4GYGA 2BDJA 2VTTA 3DGKA 1RJBA 3F7WA 5AAFA 4APCA 5K4JA 4BY9E 3GCQA 3K3IA 2SRCA 3QQUA 3LQ5A 3TV7A 5ITAA 3LMHA 5IQBA 4H36A 2GPHA 2BKKA 1FQ1B 3TZ8A 5IA1A 3EIDA 3TEIA 3QCQA 3PFQA 4BCKA 2R3FA 2CN8A 5HKMA 4BDCA 3E8CA 3UOLA 4USFA 3FLZA 4YJUA 4PMSA 5E1SA 2BIYA 1XWSA 3VS7A 4RZVA 1QMZA 4W8EA 3ZH8A 2UW7A 4IB5A 3FKNA 5JGDA 2ETMA 1W83A 3DB8A 4L7FA 2JIIA 1WVYA 5CY3A 2PWLA 5C27A 4RIXA 2PZRA 5AIKA 5DE2A 3UE4A 3EZVA 3LIJA 4G6LA 4YZCA 1KUTA 4CYJA 1Y8GA 3BQRA 4LUDA 5A4CA 3HECA 5BUEA 5HD7A 3TNPC 5EW3A 3QRJA 4YHFA 3ZO1A 2OI4X 4TPTA 1KV2A 1H08A 5ETCA 4BTFA 4C4EA 2BIKB 4C7TA 3PJ8A 3M11A 4JQEA 2GQGA 2PVKA 3OOMA 3KEXA 3MY0A 4FL3A 2XK8A 4EBVA 2BZIB 4KWPA 4KKHA 4EH4A 1Q8UA 3COHA 2QC6A 5EG3A 5I9XA 4IAIA 4HVSA 2E9UA 3R1SA 4C36A 3SGCA 4C37A 3AMYA 4J8NA 3NVKI 2OW3A 4DFZE 3ZONA 2PMOX 4L9IA 4F63A 3MY5A 4EKLA 3MH1A 3ATSA 2P3GX 5DYJA 1PJKA 3F3VA 4I6HA 5FEEA 4DA5A 4AW0A 1G3NA 3L9PA 3VAPA 1ZRZA 3QTQA 3ULZA 4J95A 3IDBA 3VQHA 4BZDA 3NUXA 3OXZA 5EM5A 3BHHA 4D4VA 5IEVA 4GFOA 3P7BA 1OIUA 3TDWA 3JVSA 1LEWA 1Q97A 2UVZA 1Y57A 2J5FA 3MBLA 5FP6A 3UMXA 4E26A 4EOIA 2CKQA 3RALA 4QP2A 2C6TA 2XK3A 3OFMA 2A1AB 2AC5A 4R1YA 1OPKA 3SXRA 2ZDTA 1LP4A 4MQ2A 4S31A 4L7SA 3UVRA 1JKKA 4M97A 4RZWA 2YM7A 4FV1A 4O6LA 4C4JA 1V0OA 1IASA 4ZEGA 3TIZA 2W5AA 3HUCA 3VVHA 2J6MA 1ZOEA 4PPCA 4CV8A 4DE4A 2RFDA 4FZ7A 5IKWA 2R3MA 3UIUA 4BBMA 1TKIA 4FKWA 3FWQA 5B2MA 3PXYA 4LMUA 4KSPA 3MGYA 2Y6MA 4WRGA 2Z60A 4I21A 4IVBA 2OF4A 3WYXA 4EK3A 2WNTA 5DVRA 2Q83A 5I9VA 2J0LA 3O0GA 3I81A 4FTTA 2E9OA 4DT9A 3EN7A 3DK6A 3FXWA 4IVDA 3LFEA 3MIAA 3MB6A 2W5HA 1VR2A 3ZRMA 3Q04A 1M17A 2B54A 3KKVA 3W8QA 3PDTA 2XJ1A 4U40A 1OMWA 4C35A 4ENYA 3MVMA 4I5CA 3L9MA 4QPMA 3P9JA 3I79A 3SQQA 5A9UA 2FGIA 3MFSA 4DITA 3QA0A 4HCTA 3RJCA 4ERWA 4GVAA 4OTWA 2BDWA 4F64A 4PNKA 3UYTA 2PE2A 3GB2A 2UZWE 4EUTA 3ERKA 4DGNA 3ORXA 3R7GA 3DBCA 2R3IA 4FNYA 4ZSAA 3QGWA 4TNDA 3O7LD 5HNBA 3FY0A 5AUVA 3RI1A 4EHGA 1AD5A 3N9XA 4MNFA 3Q3BA 3S00A 1FGKA 3NMUF 1GOLA 3EJ1A 4C2WA 2C6KA 5FEDA 5HX8A 4BKJA 4G6OA 5DEWA 4TY1A 4FIHA 5H8GA 3ORNA 3ELJA 4M15A 2PYWA 2AC3A 3VN9A 2GNFA 4IB1A 2WTVA 3SOCA 5C03A 4AN9A 3LQ8A 5EM8A 3K3JA 3P08A 4D2TA 1IA9A 4DTAA 2J9MA 2O2UA 1QL6A 4KINA 4CFFA 4EQMA 4TYEA 3I0QA 3D0EA 4I24A 3EKKA 4G5PA 3OS3A 5J95A 3N4UA 5HE1A 2NP8A 4FSQA 2YM5A 4Y8DA 4YSMA 2VWWA 3ZLYA 3MTFA 3DXPA 4AG8A 3QKKA 5IA5A 3D14A 1ZXEA 5ACKA 3HMPA 4N4SA 3EQHA 3HKOA 4MKCA 5EYCA 3RAKA 3N51A 1YWNA 4GW8A 4AXAA 3OEFX 3PSCA 4G3FA 2RIOA 4GG7A 5HESA 2H8HA 2JAVA 2G15A 2OO8X 4MBIA 5K4IA 2PVRA 4C4GA 4MBLA 3IW7A 5M44A 2ITOA 5KZ0A 4ANSA 1YDTE 2B7AA 2UZDA 4RIYB 1Z5MA 3MV5A 4JX3A 3R30A 2CKEA 3G6GA 1UU7A 3QUEA 4GH2A 1Y6AA 5I9UA 3ODYX 2C0IA 4C58A 1ZLTA 4HYUA 4MK0A 2BRNA 4O0RA 2IPXA 2PSQA 1XH7A 3R0TA 1U59A 2R3QA 2W96B 2WHBA 3KXMA 3HP2A 3V51A 2XNEA 4M69B 3ENHA 4FIJA 1PXIA 1W98A 4FTAA 4AN2A 2XUUA 1AGWA 2W0JA 3ZRKA 4NM0A 2QLQA 5A4QA 3T3VA 3VJOA 2O0UA 4ENXA 4EONA 5JMSA 2H6DA 1F3MC 3MPMA 4CTBA 4Y5QA 3OROA 5LJJA 2A0CX 1MQBA 4RWIA 5AMNA 2GSFA 4EUUA 2PULA 4P5QA 4LUEA 4GYIA 4RC2A 4WOVA 4AZSA 2OJIA 4FSZA 2W1FA 4L53A 2WAJA 3UNKA 3ZFXA 3OF0A 4P5ZA 4X0MA 5HE0A 3GT8A 4AGDA 4D9UA 1H01A 3Q52A 4R3RA 4ACDA 3BGPA 3BYUA 4NJ3A 3RAWA 3OY1A 2JKKA 3OTUA 4FTQA 4Y83A 1M2RA 2QD9A 4EOKA 3S2PA 3P86A 3IW4A 4P90A 4E6QA 4RX5A 2W9ZB 5BX0A 3FI4A 4ZK5A 2VO6A 3FZSA 3REPA 4IX6A 2OICA 2WQNA 3F2AA 3NNUA 1JBPE 2QOQA 2F2CB 2UW5A 2VWVA 4FVRA 4XYFA 5AR5A 3WF9A 2ERZE 5EM6A 4ZY5A 4R3PA 3S0OA 2WQEA 3PSBA 4FICA 2BRBA 4O21A 4QP7A 2FSMX 4XX9A 3D15A 2YCRA 3TJCA 4FGRA 3EH9A 5C01A 4ZY4A 3V6SA 4K6ZA 3ORPA 5GNKA 1NVRA 3L1SA 1PXJA 4ZXTA 2WELA 3ROYA 1E1XA 4PX6A 2HELA 2PTKA 4YZBA 2F4JA 1Q41A 3ANQA 4EEVA 4PMPA 4CFWA 4G3DA 4GU9A 4PWNA 4BCMA 4D9TA 1IG1A 2X1NA 3I0OA 5CWZA 5AV3A 5HOAA 4QYEA 4ZLZA 1OPLA 2Z2WA 3U6JA 4FK3A 3FEGA 1NT2A 3BX5A 3GBZA 4FSTA 2Z7SA 4H1MA 2HZ4A 5ANKA 3QD0A 4ZLYA 3E62A 4O81A 4CG8A 4G6NA 3DLZA 2QG5A 3Q5ZA 1Q3WA 3NUPA 4EH7A 4QP9A 4KBKA 3EKNA 3QUPA 3C13A 4CCUA 2IN6A 3SA0A 3HRFA 4EZ3A 5KMNA 1FBNA 5CF4A 2WTJA 4PNIA 4MF0A 1GY3A 4FTMA 3PLSA 2H9VA 4MAOA 3ZC5A 4GL9A 4XP2A 5D9HA 3B2WA 4EZ5A 2JFMA 3A7GA 2Y8OA 3AD5A 4BCIA 5A4LA 4PDSA 2GHMA 3UDBA 2IZUA 1JVPP 4XG9A 3BE2A 1OKYA 4Y73A 4Q9SA 4PF4A 5TE0A 1QPCA 5BVDA 2BAKA 2E9PA 4CG9A 2OXDA 1UNGA 3NWWA 3LHJA 3UTOA 1REJA 3AD4A 5CI6A 1SMHA 3TJDA 4OUCA 2GHGA 3W2CA 2R5TA 4YPSA 1G8AA 3DDPA 3SRVB 5E9EA 1YI3A 2RG5A 3O8TA 3BLRA 4Z55A 4O7WA 4ACCA 4E93A 5JGBA 4UN0C 3ODZX 4L52A 4B8MA 1OI9A 4HCVA 4IZ5A 3RNYA 1Q24A 2PVJA 3TTIA 2RL5A 4RA4A 5FWKK 4RJ3A 4FTUA 5ANGA 4YJNA 3Q96A 2W1HA 3EL8A 4FZAB 3LCKA 2R7IA 5CU0A 3QBNA 4U80A 4KIQA 1SVGA 4XP0A 2BAJA 3KMMA 1DM2A 3U4WA 1OIQA 2CSNA 2ZDUA 2BHHA 4I41A 4NEUA 3NW7A 4CFNA 3QRIA 3HYHA 1FINA 4FKPA 4KAOA 1OL6A 2OK1A 2W4JA 3W2SA 4NM5A 5M08A 3GI3A 5K5XA 1B39A 1IR3A 1OL1A 4A4LA 4C3RA 1WBTA 5EKNA 5BUIA 3H9OA 5CF5A 1S9IA 2YM3A 2ITTA 3EYGA 5B2KA 5KO1A 3VS3A 4FOBA 4JAIA 2P2HA 4C34A 4KABA 2R3RA 4R1VA 4H39A 4YJPA 4CFVA 4DTKA 4I23A 4IANA 1M2PA 3MH0A 3V01A 3CKXA 4WBOA 2ONLA 5DA3A 5E90A 5L4QA 4DF3A 5HX6A 2W17A 3EFJA 4BZOA 2HXQA 4C4HA 1BKXA 2ITZA 3W33A 2FH9A 4O96A 2GS6A 4ANOA 4EJNA 3MS9A 5FTGA 3CP9A 3MJ2A 3UQGA 4AW5A 3VC4A 2WO6A 4PP9A 2R3OA 4K33A 4W9WA 5HBEA 2DYLA 3TIYA 1P4FA 3UC4A 5HI2A 1OZ1A 4R5YA 4PMMA 3Q5IA 3VUGA 1RW8A 1YHVA 4XG3A 3VS0A 1ZAOA 5E8XA 4ZJIA 3VUHA 4ACHA 4YZDA 2F9GA 4ZSEA 4BCGA 3GU6A 5AR7A 5FM3A 3UGCA 3DBFA 3GCSA 3PE2A 2BPMA 3AC4A 3HRBA 4LRMA 2PPQA 3QLFA 2E9VA 4BIDA 4X2NA 1YOLA 2O63A 4NZWB 4F1TA 3KF4A 2PY3A 2XKCA 4QTDA 1IEPA 5CEPA 3QQKA 2IZTA 3KGAA 4IQ6A 2QVSE 4I1ZA 2PVFA 2RG6A 3KXGA 3NDMA 3IO7A 4WO5A 2WMQA 4BBEA 4F9YA 4KIOA 4D58A 5CSXA 5IZFA 4WNMA 3QRTA 4RVTA 1WCCA 5M53A 1XHAA 1PRYA 4M3QA 5ACBC 4JG7A 3D83A 5AA9A 3G15A 3DK3A 4M0ZA 3LCOA 3LFCA 2GQSA 3ZZWA 4IH8A 4CLIA 2B9HA 2HY81 4FI1A 4ZTRA 5HG8A 4YTIA 3VS1A 4D5KA 3K2LA 3IGOA 4JQ7A 3V8SA 1PMNA 4RJ4A 4M67A 2C6LA 4FG8A 5HIDA 3TV6A 1OBDA 3VF9A 4UYAA 2FYSA 2ITWA 3NYNA 3ZO4A 3ZEPA 3CJGA 1DI9A 2R3NA 2R3GA 2XNPA 3L9LA 3DFAA 4NW6A 4U7ZA 4KIKA 4WA9A 4XV1A 2YLEA 1H1SA 4O91A 3PG3A 3OXIA 4ITIA 4FTLA 4MYGA 5JK3A 4LG4A 3V6RA 5LVMA 2F7ZE 2IZSA 3A7JA 3CC6A 3IDPA 4B6LA 4O7TA 1XJDA 2V0DA 3MVJA 3QQFA 3VIDA 3LMIA 4NYEA 5AP3A 3VS2A 5DBXA 2GNHA 2NRYA 2QU5A 5AR3A 4O6EA 2JGZA 4UZHA 3DU8A 4QO9A 5D10A 3UNZA 3H0YA 2OXXA 4JLCA 4LGDA 2WMVA 1R3CA 4DBNA 3LFNA 2QLUA 4JRNA 4AW2A 2PVLA 4MBJA 2EXMA 3PPJA 3HMOA 4Z7GA 4D4YA 4HVDA 1QPEA 4FNZA 1OVEA 3BU6A 4AA0A 5J7BA 3TV4A 1BI8A 4AE6A 3B8RA 4BTKA 3NYOA 4L01A 5KKRB 4FTJA 1WBOA 1YOMA 2YIXA 4NL0A 2R64A 5E8VA 3QQLA 5IA0A 3R71A 5EHYA 1M52A 1SVHA 5H3QA 4WT6A 4H3BA 1FVTA 1YVJA 4L8MA 2RF9A 5L6PA 2RFEA 1TQPA 2WOUA 3OXTA 5CU6A 5L8KA 4D2RA 4PDOA 2OJJA 4YBKA 4RIOA 1OL5A 3A60A 4OGRA 4O0XA 3BLHA 4F1OA 2OIQA 5HE3A 1STCE 3KF7A 3R01A 4CTCA 3OCSA 5DG5A 2CNQA 5M06A 5IUHA 4JIKA 4UMQA 4OBPA 4O1OA 3R73A 3G33A 4O38A 3DJ7A 4NIFA 4E5WA 2XKEA 4XBRA 4FUYA 1UA2A 3JY0A 1ZMWA 4NWMA 3ZLWA 4DHFA 2Y4IC 3TUBA 2ZM4A 2C3LA 3VS6A 3LFBA 4ZMEA 1VJYA 1PXMA 5M09A 4KB8A 3CE3A 4XBUA 2PVMA 4DT8A 1CKIA 2QURA 4RBLA 5IQGA 3GU8A 2OU7A 4YBJA 3A8WA 1HCLA 2PMLX 4S2ZA 2XJ2A 4FX3A 5KHXA 5IPJA 4LOPA 3F69A 4FTKA 4FTRA 3C4FA 4CVAA 2VTPA 4QYFA 4RA5A 3RK7A 5AX3A 2VO7A 2WTIA 4F70A 2J2IB 1O6YA 4X2JA 1FMOE 5FGKA 2OH0E 3CD8A 3KN6A 2XS0A 2QKRA 3KRWA 4LI5A 4R6VA 4RIXB 4A9UA 3PVUA 3UOHA 4YJRA 4E5AX 3DKOA 3PPZA 1Y6BA 2I6LA 4AZTA 3PJ3A 4C2VA 3O96A 3CJFA 1ZY4A 2QR7A 4IC8A 3E8EA 4UWYA 3SXFA 1J7LA 5GINE 4FEQA 4UXLA 3EQIA 3W16A 3R1YA 4U42A 4YZ9A 5K0XA 3CTHA 3RM7A 3TWJA 4IHPA 3OP5A 4M13A 5AV4A 5ANEA 4H05A 3UO4A 3MA6A 4RFYA 4Y46A 5I3OA 3K5VA 4DBXA 5DN3A 3MW1A 3AT3A 4IMYA 4L42A 4AX8A 3IDCA 3Q9YA 1JKTA 3FLQA 5CVHA 4D55A 4EH6A
chains in the Genus database with same CATH superfamily
4FJVA 2CHLA 2XKDA 4OT5A 5AP1A 5CT7A 5LOHA 1GZOA 1P2AA 3QZGA 2HAKA 4RC4A 1XMMA 4S32A 2AEGA 4DCEA 4ANMA 4F4PA 3QU0A 3SD0A 2ITPA 5CI7A 5AV1A 1YWRA 2X4FA 1IA8A 3HLLA 4BF2A 5IH4A 3HV7A 2C6EA 4HVGA 3NUAA 3KXZA 4U45A 2V62A 1KOAA 3C4ZA 5HLNA 2ITXA 4MWIA 4JG8A 3UPXA 4FZDB 1OL2A 3A62A 3BYVA 5AEPA 2Z8CA 4M7IA 3JPVA 4U79A 3CPCA 3UZTA 5JZNA 3BV2A 4EWHA 4ZP5A 5CAOA 4ZJVA 5CAVA 5H9BA 4P4CA 2GS7A 3PZHA 3HA6A 3O51A 2YLFA 1VYWA 2E9NA 3R00A 3OCBA 1PKDA 4QMUA 4RIWB 5T3QA 3HL7A 4NH1A 5E8UA 3ZSIA 3TNQB 4M68A 5AX9A 2IWIA 3A7HA 4FG7A 2CLXA 3JUHA 3EN6A 3F5PA 4H58A 3VUTA 4LL0A 2HCKA 3O71A 1CMKE 2A2AA 4IX5A 3S95A 1YHWA 3FLWA 3UODA 3ZBFA 3D7TB 5A3XA 4EOLA 4GFMA 4BKZA 4DFYA 2V5QA 3I7CA 1GAGA 4R5SA 5L3AA 3FPQA 1H00A 3W55A 4M12A 4E73A 5IDPA 4BDAA 4BCHA 4CMUA 3P7AA 2GFSA 3ZDIA 4DEAA 4S34A 4AAAA 1A06A 4DC2A 2OF2A 3OCGA 4IX4A 3WARA 1UU9A 5M4CA 1PXKA 1J1BA 3BCEA 3OG7A 4IWDA 5F94A 5AUWA 2Y9QA 3ROCA 3BKBA 2CNUA 3AD6A 4OBQA 4RSSA 4W4VA 4XP3A 4DG3E 3G51A 2C3KA 5BQ0A 5HQ0A 1TQIA 2WOTA 3U9NA 5CF6A 3R7OA 3UVPA 2UW3A 2VTOA 2XM8A 5AWMA 1PXNA 2VO3A 2IG7A 5M4IA 3LFSA 2PHKA 3PIXA 3VS5A 3PZEA 4UX9A 4NKAA 4XOZA 4B9DA 5T6KA 4QTBA 2JLDA 4FC0A 5BNJA 4ALVA 2ACXA 3CGFA 4R7BA 2V7AA 4QQCA 4RX7A 3C4EA 4FTCA 4XH6A 4Y95A 2W9FB 3ZXZA 5J9LA 3CEKA 3OHTA 1J91A 3I60A 1XBAA 4FV8A 3VS4A 4TWNA 4IAYA 4J71A 2YERA 3PIZA 4LGHA 2C5NA 3F61A 4YJOA 3RKBA 1EH4A 2ZV2A 5ETFA 3SKCA 5HD4A 4XS2A 3W0PA 1CSNA 3F5XA 3Q4TA 2XIRA 4FR4A 4D4SA 3FQEA 3D5UA 3G0EA 2XCHA 3D5WA 3MIYA 5FD2A 5LMBA 3FUPA 1FMKA 2JEDA 5L6WL 2H34A 3PXRA 4WSYA 4JBVA 4F65A 5HG7A 3RPRA 2Z7QA 2DWBA 3KY2A 1XBCA 3P1AA 5FP5A 3JR1A 4EC8A 1F0QA 4AOJA 3U8WA 3PXZA 2OXYA 2VWUA 5E8TA 1UWJA 3IOPA 2XP2A 5A46A 5J87A 3FL5A 4CNHA 4BCQA 3R9OA 3FZRA 2WB8A 1H07A 1V1KA 5IUIA 4DTBA 1G8KA 4B99A 4ZJJA 2AUHA 3ZMMA 4QP8A 2JKOA 2PUUA 3V5JA 2DS1A 3C4WA 2BALA 3TNWA 3C4CA 2IZRA 4IFCA 4OAVB 3QWJA 3C0HA 3GQLA 1GIIA 3W0SA 2BFYA 3GCVA 3GU7A 5F95A 1MRYA 3LXNA 4G9RA 2UW6A 1RQQA 5HBHA 4Z16A 1LEZA 4FE2A 4Y85A 2C3JA 3MVLA 4MD9E 4YTHA 2PZYA 4MQ1A 1BL6A 4H1JA 1W2CA 1W2FA 3IW8A 4XV9A 4XG4A 3R8VA 4QMWA 2IW8A 2YM8A 2I0HA 4FV4A 5E8SA 2BHEA 5HIEA 2BR1A 2VGOA 3EYHA 1H4LA 4YZMA 2WXVA 4R3CA 2VZ6A 4QMLA 4GKHA 2G2FA 4IWQA 1WBWA 2XK9A 3PSDA 4U41A 4X2KA 3ZEWA 3CTJA 3R7EA 4X3JA 3IK3A 3R7IA 4DH5A 5KUPA 2EB2A 1M2QA 2VTNA 3Q6UA 4QQ5A 3DZQA 4YTFA 4QYHA 4C38A 3Q2JA 4CZYB 5A54A 3CY3A 3FDNA 4J1RA 3EFWA 4YC6A 1K3AA 3FXZA 4V0GA 4CKRA 2YCFA 3QYWA 5KMOA 4E4XA 5KHWA 1UNHA 3QD2B 4CSVA 2EU9A 3BQCA 2B52A 3LXPA 5AM7A 3ORKA 2CJMA 4U44A 2O65A 4HPUE 4DYMA 5BYZA 5LWNA 3UMWA 3MPTA 3DV3A 3NCZA 4LQMA 4X21A 3TNHA 3PY3A 3V5LA 2QO7A 4EH2A 4XHKB 2BUJA 3UO6A 4F0GA 2R3HA 5DT3A 1XH9A 4AU8A 3Q6WA 1GZKA 3ZFYA 2W05A 4AT5A 4DCAA 3QC9A 1NW1A 3VUDA 3F2NA 4UY9A 3ZUVA 4O27B 3V5QA 4YJTA 4ZTNA 4ZZMA 4QPAA 2QONA 3RMFA 1Q3DA 1UU3A 2VWXA 5CEIA 3UJGA 4BVUA 4F6UA 4WIHA 5KNJA 3HA8A 4F1MA 5HORA 1SVEA 4E4LA 4FZFB 4NM7A 3VBQA 5DR2A 4CT1A 3QZIA 3QD4A 4I6FA 3GOPA 4K9YA 1TZDA 3JS2A 4U5JA 3ZCLA 3L8XA 2C4GA 4ZZOA 1YQJA 2OBJA 4TYIA 3ZXTA 4KIPA 5AP5A 3ZM9A 4O4EA 3KA0A 5M51A 4F6WA 4I22A 3IW5A 2PVHA 4E6CA 2AQXA 2VX3A 4QYGA 5CS6A 4LV8A 4BDKA 5TO8A 4HOKA 5TKDA 3WZKA 4IVAA 3FI2A 3QCXA 2R3KA 2VUWA 3LFQA 2XEZA 3KVWA 2IVVA 2WIPA 3O23A 4JBPA 2C5YA 3OUKA 5D7AA 3W1FA 4YO4A 4TYHB 4FYOA 3HZTA 3PUPA 4JDJA 1YXSA 2LAVA 3D94A 3DCVA 5CF8A 2IVSA 4LGGA 5HO8A 1ZY5A 4PV0A 4XLVA 4CMTA 1QPDA 4ZMFA 2O5KA 5HZNA 4L00A 2F7EE 1E9HA 5HTCA 5EYKA 4M66A 3GCPA 4HCUA 1KV1A 1J7IA 4G3GA 3MB7A 2E2BA 2OKRA 3ORTA 3QRKA 2XA4A 4I0TA 4ZTSA 2C6OA 4GUEA 2QCSA 4LRJA 4CFMA 2XMYA 3DJ5A 3VNTA 2YHVA 1PYEA 4YMJA 2YAKA 3F3TA 5E91A 2UW8A 4ASEA 3EQRA 3LPBA 3H10A 3IECA 3FQSA 3NX8A 3UZPA 2PU8A 4UWBA 3FY2A 5CXZA 1A9UA 2FVDA 1WBVA 3QWKA 3FKOA 4B0GA 1P5EA 4BCOA 4F09A 2OSCA 1ERKA 2QOKA 1XKKA 2JDVA 4ZOGA 2JAMA 5EM7A 4UZDA 5FDXA 4TWPA 3EQCA 3B8QA 4ASDA 4DN5A 3IQ7A 3EQFA 2WEVA 3QLGA 4YLJA 3S4QA 3BYSA 2VRXA 5C26A 2ZB0A 1PF8A 2O64A 3DAKA 4BYIA 4XJ0A 3RPSA 5AFVA 4ITHA 3E63A 1R1WA 3POZA 4I6BA 4YR8A 2GU8A 2YDKA 5DRDA 4OBOA 4BZNA 4S30A 1A48A 3TXOA 3FPMA 1HOWA 4EJ7A 2X7OA 5H8BA 5KZIA 2BRHA 4FA2A 3NIZA 2XYNA 2OZAB 5ANIA 5AV2A 4K0YA 4II5A 5DWRA 5HHWA 4CQGA 1XBBA 3CR0A 5JRSA 3LJ1A 4F0FA 2WTKC 4GEOA 2CCIA 1OBGA 5LVPA 3DJ6A 4AN3A 3HAVA 4QQJA 2WU7A 1R0EA 2P0CA 1PKGA 2PMIA 3HP5A 4ZTLA 5AA8A 3ZUUA 4GUBA 1M14A 3ZDUA 2UV2A 3MN3A 4E7WA 3LQ3A 4BDGA 3OZ6A 2JC6A 1KE8A 2AYPA 3AOXA 2BKZA 4QMYA 4ZTHA 3NAXA 3KMWA 4PTEA 5BYYA 1OPJA 4I3ZA 4FV2A 4PL4A 5EW8A 4ASXA 1OGYA 4KRDA 3Q9WA 2YACA 3FLNC 2CKOA 4PY1A 2F49A 5J9YA 4RGJA 1WBNA 3BU5A 4QMTA 2GNIA 4GK4A 4G3CA 1KE5A 4IE9A 5M57A 2C0OA 5C9CA 3COIA 2BTRA 2VV9A 4KBAA 5KBQA 5CX9A 4IADA 3BV3A 4WG3A 4XRJA 3NGAA 1LR4A 1H1QA 4Q2AA 5JEBA 3EN5A 3ZC6A 4FUXA 3QTRA 4APPA 2CNVA 1XH5A 2NNWB 5E8ZA 1Q8TA 4BC6A 1PMUA 3CS9A 4FSMA 4EZ7A 4O7ZA 3U4UA 1U46A 2YAAA 4CZTA 5ETAA 5JKGA 4QMNA 5DHJA 1DS5A 2WMRA 4U0IA 4B8LA 5ANDA 3I5ZA 4KIKB 3UDSA 1W84A 2VWZA 2VU3A 2PVYA 2W06A 2OZOA 4A7CA 4FSWA 3LCSA 4I92A 4FTNA 2XBAA 4JOAA 4NSTA 3WBLA 4ZZNA 5GJDA 4G17A 4R78A 3VWAA 3FL4A 3GU5A 3KCKA 1NA7A 2WMSA 4N6ZA 3UVQA 2VTRA 4W4YA 4IAKA 4L68A 4FSUA 4BICA 4EQCA 5BVKA 4AT4A 3E64A 1WVWA 3DBEA 4JQ8A 5IQIA 2UW0A 2WTDA 3QXPA 4BTMA 3PP0A 3ATTA 4U8ZA 2X0QA 4GK2A 5CAUA 3WF8A 1U54B 2VTAA 3DLSA 4C62A 1L3RE 2CGWA 2OH4A 4G34A 4IWPA 3AMAA 3VBXA 4ZS4A 4J97A 4A4XA 1IRKA 2YDJA 2YN8A 5B0XA 3VBVA 3BBWA 5LCJA 3ALOA 3UZRA 3DOGA 1OIYA 2XB7A 3PP1A 3ID6C 4EK6A 4FG9A 3RWQA 1Y91A 2GNGA 3A7IA 3UNJA 3BU3A 2OJGA 2VX0A 2FO0A 4IM0A 4JDHA 4WD5A 3QX2A 4QQTA 5IQEA 4ANQA 3VBWA 2HWOA 4BGHA 3THBA 3NRMA 1Q4LA 4QRCA 4FZ6A 3R04A 5GZ9A 4EKKA 1JKSA 2B55A 3BL7A 3ETAA 2W5BA 1W82A 3DAJA 3N4VA 4RFZA 4HZSA 4JNWA 4RWKA 3TT0A 3ZLXA 4BI0A 4E20A 5M07A 2YISA 3CQWA 4RFMA 4WUNA 2JKQA 4FTOA 4IZYA 4BFMA 4RPVA 4BDIA 3PJCA 3WOWA 3ENMA 5IH5A 5DOSA 4LDTA 4AOIA 5D7VA 4MXCA 4BYJA 4RIWA 5DT4A 4KNBA 4CV9A 1WBSA 2UZEA 3WZDA 4D0XA 5IMEA 4KBCA 3GC7A 5C8NA 2CGXA 2ZMCA 3OBGA 4A9SA 3GC9A 3OD6X 3QXOA 4PP7A 1DAYA 3BYMA 5FDPA 3RHKA 4RJ6A 1XR1A 2XRWA 3POOA 3ALNA 4FV6A 3T8OA 2YFXA 2GTMA 5BPYA 4G1WA 4U81A 4J52A 3Q32A 4JAJA 3R2BA 3G90X 4LL5A 2X6DA 3VRZA 1LPUA 4YU2A 4ZLOA 4M69A 4AA4A 4KKGA 4I5PA 3VQUA 5A14A 1W7HA 4NTSA 4IAZA 1PW2A 2WQMA 4O2ZA 4RRVA 4O22A 2QU6A 1LUFA 5EFQA 5FEQA 4DFUA 4FKRA 4XRLA 4AFJA 3LLTA 4ALUA 5HU9A 4LM5A 3OW3A 3SW7A 2HIWA 1V0BA 4XG2A 3VHEA 4DEHA 4YHJA 1KOBA 2UZOA 2VWIA 2ZJWA 3OT8A 5ANOA 3GC0A 5J5TA 3QTZA 2FSLX 3D4QA 3MFUA 3GC8A 4GFGA 3BELA 3KCFA 4I4EA 2HY0A 1ZARA 3RINA 4BTJA 4X3FA 2PZ5A 3M1SA 3UOJA 5E7RA 2OLCA 4ID7A 3GP0A 4DEGA 2Y6OA 4V04A 4NFNA 3MFRA 2GQRA 3PRIA 1U5RA 3KU2A 3ULIA 2VTHA 3OWJA 3OWKA 3EQPA 4UB7A 3SW4A 5J5SA 3W2PA 3ZM4A 1V0PA 5JSMA 1H1RA 2ITUA 5CAPA 5I9YA 3AGLA 4QP6A 1OUYA 4FKUA 3VHKA 3BYOA 4IW0A 4F08A 4FOCA 3U9CA 3HVCA 1WZYA 2YCQA 3U54A 2XIYA 1ZOHA 4RWJA 2YWPA 4AGCA 2R3LA 4N57A 2VX1A 4BWXA 3LJ2A 3AMBA 4QMZA 4BKYA 4AE9A 5KMLA 1YDSE 4PQNA 4XV3A 2ZB1A 3QRUA 4EK4A 2R3JA 4S33A 2J5EA 5F9EA 2FSOX 1Q8WA 2DQ7X 3IPHA 5J79A 3R1QA 4WNPA 1F5QA 5I5ZA 4FV0A 3QAME 4NU1A 1XH6A 4RT7A 4O0UA 4ZTQA 3V5TA 1XH8A 4C61A 3ZRLA 2V7OA 4TT7A 3AKLA 2P33A 3SC1A 3UDZA 1SZMA 1O9UA 4N70A 5H8EA 5HO6A 5KBRA 3GOKA 4J8MA 3GNIB 3QQJA 3T3UA 4QMOA 3RGFA 1ZYJA 3H9FA 3R63A 3BWFA 4BI1A 5JQ8A 4FT3A 2X9EA 2XK7A 3E7OA 4XLIA 3UIBA 4Z9LA 5LXMA 4X3FC 3UG2A 4ZSGA 4RVKA 3QUDA 3R6XA 5A4TA 5AAGA 3UO5A 2JBPA 4FK6A 5EHOA 4DH3A 3W2RA 4EH9A 4HYHA 5D1JA 3PA4A 1FVVA 5B7VA 4XG7A 2QNJA 4IAFA 4J53A 3JY9A 3KULA 3NIEA 3O8UA 2R7BA 2X6EA 4I93A 5FXSA 2CN5A 3E8NA 4YP8A 3GVUA 3FMHA 4XG6A 3G9NA 1XQZA 1U4DA 5KE0A 1JAMA 5CSHA 2YEXA 3Q4CA 2R0IA 1ZWSA 3RPOA 4TXCA 2XKFA 2F2UA 4C8BA 3BHUA 3AC2A 2B9JA 4JT3A 3FMNA 3U55A 4DFBA 1OM1A 3IGGA 1NVQA 5I3RA 3IS5A 3DKFA 4QNAA 4FL2A 1H28A 5EQYA 2HK5A 5F1ZA 3TDVA 3NW5A 4DH7A 3O2MA 4YUQA 5HLWA 3PG1A 1Q5KA 3COKA 3OW4A 4OTFA 4D4RA 4FIFA 3P23A 1Q99A 1TQMA 5DPVA 3K54A 4ZSLA 2A19B 4A9YA 1I44A 2J90A 3BEGA 3FV8A 5AUUA 5TF9A 3FZ1A 1VZOA 2UZVA 4D0WA 5JZJA 3PPKA 2W4OA 4PPAA 4L6QA 2R0UA 5AR8A 4O84A 3DZOA 5JQ5A 4F78A 3CBLA 3MSSA 4G16A 4QMQA 2JDSA 2HW7A 3ORMA 4RMZA 3EB0A 5AR4A 2UZNA 4AZWA 4BN1A 2X4ZA 5EQPA 3F2RA 4CFUA 3NAYA 1QPJA 4FT0A 2IEWA 3W2OA 4UYNA 1JNKA 3TKUA 4F9BA 2UZLA 4L43A 3EOCA 3NCGA 4NJDA 4OTHA 4XV2A 4YO6A 5DEYA 5K9IA 1IAJA 2REIA 4F9AA 5IMXA 4EK5A 3VW6A 4F7LA 4XEYA 1YWVA 4O7LA 3W0QA 2A4LA 1DAWA 4GV1A 3E8DA 3SDJA 3KRXA 5DLSA 1URWA 2W1EA 3NNXA 4HYSA 4EYMA 1VEBA 4LYNA 2QOHA 2ZVAA 4CGAA 1KSWA 1ZZ2A 2QOOA 3W10A 3FZTA 3MA3A 3WILA 1UKIA 1W0XC 4UALA 4BB4A 5CANA 2XAOA 3MY1A 5C8MA 3AC1A 4CZUA 3ORLA 4UMUA 2OFUA 4RVMA 3LW0A 3PJ2A 3DQXA 1BLXA 3NW6A 1NVSA 2R2PA 2ZMDA 3EN4A 1OGUA 3SX9A 4BHNA 2HENA 3HV5A 2FA2A 3F3UA 3VULA 4D2WA 4O4BB 4GSBA 3PWDA 2F7XE 2I0VA 2EWAA 3HMMA 5DRBA 4DH8A 4O2PA 4RQVA 3VW8A 4JBOA 2PVNA 3BGQA 3NUUA 1MRVA 3KXNA 2BTSA 2CGVA 3F9NA 3OVVA 4IZ7A 4FNXA 5HGIA 3C1XA 3JXWA 3H3CA 2WQBA 2R4BA 4PRJA 3I6WA 4FV3A 1JKLA 4GJ3A 5A6NA 1OIRA 3FZOA 1PHKA 4Y5HA 2VTIA 3NSZA 5CQWA 4CMOA 2C6DA 3HV4A 4E6AA 3DKCA 3NZ0A 4BCNA 4V05A 3FAAA 4H3PA 4YJVA 4L45A 2I40A 3VONA 5HG5A 3LXLA 3TL8A 4FSYA 3R8PA 3RCJA 4BRXA 2X0GA 3AGMA 4CKJA 3AQVA 4GIHA 2QODA 3UQFA 3RK9A 5J7HA 1OECA 1FPUA 4KD1A 2CPKE 2PZIA 5EI8A 5IEYA 3QZFA 4WRSA 4XCUA 3BHYA 1H1PA 1Z9XA 4OAUC 2QR8A 4KS8A 3TN8A 1RE8A 4UMPA 4ZTMA 3TUDA 2RKUA 4LOOA 4WUAA 1W2DA 2VTMA 2UZBA 3BWJA 2PUNA 4MH7A 4O83A 1H24A 4MWHA 2BILB 2O3PA 4V0GB 2W1DA 5EI2A 2X8DA 4ERKA 5G1XA 1Q8ZA 4U3ZA 5JFXA 5E4HA 2XJ0A 4MD7E 3UIMA 2YZLA 2IW6A 4ARKA 1JQHA 2QG7A 3PRFA 3F88A 3D2KA 4FKTA 4JXFA 2HZIA 4FT5A 1JLUE 5HLPA 4DAWA 4EHVA 4NCTA 1KE6A 1K9AA 3Q9XA 4KRCA 4U97A 1J3HA 2G2IA 2CMWA 2EVAA 1Y8YA 3EQDA 1YKRA 4XOYA 1R0PA 2XNOA 3QD3A 3NLBA 5F4NA 5DIAA 4ZIMA 2PUPA 1UWHA 1OB3A 2I0YA 3AG9A 4BCFA 5DFPA 5AP0A 4WBBB 5CYIA 4EC9A 4O82A 2J51A 3LXKA 4OTRA 4BDDA 1YXUA 3CXWA 2X8EA 4AQCA 1HCKA 3QHWA 2BZHB 2NO3A 2X0PA 4JL9A 2CGUA 4Z3VA 1YHSA 4TRLA 5CZIA 3V5PA 5KMIA 4DG0E 3SHEA 5FBNC 4U3YA 5DT0A 2QHMA 2B1PA 3CGOA 2PUIA 4C4FA 4I5HA 4WKQA 2JFLA 3ORIA 2ZV8A 3I7BA 4FVQA 4TYJA 3LFAA 3EWHA 1JWHA 3G2FA 4AXEA 1H27A 3NEWA 3LVPA 2ZV7A 5EOLA 4HNIA 2WPAA 4IC7A 4JBQA 3BI6A 2BZJA 3DPKA 3FYJX 3OCTA 5AP7A 3A99A 5E8WA 4F7SA 1OKWA 3H9RA 2C5VA 3GENA 3OEZA 3QCSA 3ZOSA 3P79A 4RJ5A 3ZUTA 3P0MA 4L3JA 4BWKA 2QOLA 2XRUA 1AQ1A 5TOZA 3JYAA 3FC2A 4YSJA 2VTQA 5GJFA 4CFXA 2WTKB 4JDKA 3LOKA 4ACMA 5HTBA 3UPZA 1O6KA 2YZAA 3IONA 5I0BA 5KMKA 4IX3A 4NCTC 2Y4PA 4K11A 5FLFA 5HCYA 3RHXA 4KKEA 5CEQA 3R7UA 4RJ7A 4YHTA 5IEXA 2BRMA 3BLAA 4FEVA 1PXOA 4O0WA 2GS2A 2IO6A 4MTAA 4F6SA 4JR3A 2WMWA 2EXEA 2W1IA 5CQUA 4EL9A 1R39A 1BI7A 1PMEA 3GFEA 5JGAA 3SAYA 3PVBA 2JDTA 5KKRC 3KC3A 2BZKB 3LFDA 3OTVA 3CTQA 4QMVA 5HE2A 5GIPE 5IQHA 2VO0A 1Q62A 5D41A 1T46A 3IKAA 4WG5A 4X2GA 3DBDA 3TACA 2KTYA 2J50A 2P4IA 4QP3A 3NYVA 2WMAA 2BMCA 5AR2A 1ZYLA 2YIQA 1OITA 4KUJA 1YXTA 2C1AA 5M4FA 2ZM1A 3NUYA 4GJ2A 2W7XA 5D12A 4FKQA 1GZ8A 3L8PA 4FF8A 4NFMA 3RZBA 1S9JA 3RPYA 3OOGA 4RLLA 3ANRA 4R77A 4MX9A 3LAUA 3V04A 2OFVA 2C68A 3AT4A 3KRLA 3PXQA 3QTXA 5GHVA 2RFNA 2OIBA 3TZ9A 2XH5A 3DNEA 1MRUA 4GS6A 3FHIA 1IAHA 2C1BA 2R9SA 4XMOA 5KMJA 4J96A 4IXPA 3TKIA 4EOJA 4D5HA 1JSVA 3O50A 4A9TA 3UBDA 4MEDA 2XZSA 5AUZA 3HRCA 5FRIA 3MJ1A 4C59A 4YJSA 1PMVA 4FKVA 5HG9A 3BGZA 4ITJA 4UBAA 3RPVA 2ITNA 2X0OA 3VO3A 2F57A 5FG8A 5EQEA 3TZ7A 3ZFMA 4J7BA 4TKSA 4IJPA 5HCXA 2O8YA 4EQUA 3Q9ZA 3W0OA 4DHIB 1YXXA 1XO2B 1YI4A 2IVUA 4MNEA 4QD6A 2JITA 2FSTX 4TZRA 3UIXA 5CNOA 4EOMA 5C8KA 4UXQA 4FIIA 2WD1A 4L3LA 5DH3A 4K18A 4HZRA 3QALE 2I1MA 3CIKA 4MXOA 5AUYA 2W1GA 2VNWA 3MI9A 1VLRA 4EOPA 3DTCA 5CSWA 3SG8A 5AP6A 3PXFA 4J99A 3M2WA 2HZNA 3VBYA 5E8YA 1GJOA 1I09A 4ASZA 4OTQA 2RFSA 3FQHA 5HVJA 4CRLA 4E8AA 5IQFA 1URCA 2J7TA 2V22A 1H0VA 3WE8A 4NKSA 2XM9A 5EDRA 3D7TA 3LKMA 2QKWB 5LMAA 5DNRA 4O0TA 1BX6A 2J0JA 3PA3A 4FT7A 4BGGA 3MESA 3KREA 3HX4A 4U6RA 3MFTA 4FKJA 2VNYA 4L44A 4X6RA 4TTHB 5EDQA 4JR7A 4X6QC 3PVWA 4EOOA 5GIOE 5IG1A 4EK8A 5HO7A 4YGAA 4YLLA 4HPTE 5LVLA 4AP7A 4OW8A 2JIUA 5H2UA 3F5UA 3EQBA 4YLKA 3S3IA 4EI4A 4YC8A 3CQEA 3HUBA 3L8SA 2IVTA 2XBJA 4QP4A 3LM5A 3SLSA 4BCPA 4B4LA 4DGMA 5IQDA 3CPBA 2VTLA 4OTIA 5HCZA 2VTSA 2JBOA 3BIZA 4FYNA 5LARA 5AUTA 2KULA 4UWCA 5GZAA 5AM6A 5AADA 1ST0A 4N6YA 3U87A 4DFNA 4GRBA 4BIEA 3KK8A 4QNYA 1SNXA 3LJ0A 1BMKA 2IW9A 1JSTA 1YW2A 3E92A 3NS9A 5ANJA 3RAIA 3BHVA 4PUZA 2JD5A 3L9NA 3A2CA 3A7FA 3DFCB 5FTOA 2X2MA 3F5GA 4JRVA 1MP8A 2VGPA 3GGFA 4HYIA 4O7VA 5J8IA 5AAEA 4U43A 3FSKA 4EHZA 4OTPA 5I4NA 3FLSA 3PJ1A 4P7EA 4TWCA 2IJMA 2R3PA 3DXNA 3PVGA 4L3PA 4IFGA 4GMYA 2HW6A 3FC1X 1YOJA 4FT9A 4A07A 2OGVA 3E87A 3ORZA 5JFSA 3TUCA 2WMBA 3UYSA 4QTAA 4D2PA 3MDYA 4RLKA 3V3VA 4FL1A 4JMQA 2GHLA 2XVDA 3NR9A 3CSVA 3UOKA 3C5UA 4HGSA 4K1BA 2FUMA 3O17A 3H0ZA 5CEKA 3HNGA 3PLAE 2ERKA 4E1ZA 1W8CA 1WBPA 4K77A 3A4OX 2ESMA 2VTJA 2VWBA 2CCHA 2XNNA 1M7NA 3KL8A 3OUNB 4G9CA 4U9AA 4USDA 5L8JA 3R9NA 4BIBA 2ZV9A 2J4ZA 2JIVA 3SXSA 3F82A 4FTIA 4MVFA 2I0EA 3QFVA 2BAQA 4I0RA 3RWPA 4YJQA 4AWIA 3P78A 2YCSA 3QKMA 4IVCA 3P5KA 4HW7A 5HICA 3KQ7A 3G6HA 3QTUA 1RDQE 4A4OA 3FMJA 4D1ZA 4KA3A 4GT4A 4EBWA 1WAKA 4FKIA 4DH1A 5CALA 4R8QA 4MXYA 3AKKA 4FKGA 4LV5A 4FKOA 4OTGA 4MF1A 4UMRA 5BVWA 2EUFB 4LFIA 4XNEA 4PDPA 5BVEA 2W4KA 2J0KA 3ZBXA 4MXXA 2EB3A 4M8TA 5L2IA 3WIGA 2XK4A 4HVHA 3Q4ZA 3E7VA 4O0SA 4X3FB 2WEIA 1JPAA 4UMTA 3BLQA 3KK9A 2C5OA 4FV9A 4D1SA 3Q60A 3TM0A 3TI1A 1G5SA 3DAEA 3KRRA 2J0MB 3D5XA 3FMKA 4CXAA 4DGLC 4E4MA 2XNMA 3AC8A 3EHAA 3QGYA 3VBTA 3FE3A 3HMNA 3ZSGA 2ZFYA 4D28A 5ETIA 1H8FA 3PTGA 2CLQA 4EH5A 2WU6A 2UZTA 1YRPA 4AZEA 4PTGA 3ZLSA 4CCBA 3RCDA 1B38A 3W2QA 5L6OA 3ZZEA 4R7HA 4PL3A 3CD3A 3GXLA 4TYGA 3VJNA 5CVGA 4ANLA 3RVGA 3QF9A 4IDTA 5L2TA 2HOGA 4AACA 3BHTA 5DGZA 4JI9A 2YABA 4PPBA 3ZHPC 1OL7A 2H96A 2QQ7A 1OKZA 1ZMUA 3C0IA 2GTNA 4L67A 5TT7A 4AGUA 3QA8A 5JFWA