3EQRA

Crystal structure of ack1 with compound t74
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
276
structure length
270
Chain Sequence
LTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERLPRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Activated CDC42 kinase 1
publication title Identification and optimization of N3,N6-diaryl-1H-pyrazolo[3,4-d]pyrimidine-3,6-diamines as a novel class of ACK1 inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 270
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3eqrA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3eqrA01
4B4LA 3EOCA 3FAAA 1FINA 4RQKA 4NL0A 3VUKA 2BPMA 4PTEA 4UYAA 4UWBA 3LVPA 3QD3A 2IVTA 3VUMA 4BCKA 5M4UA 3FLYA 5ANGA 3GOPA 3GCPA 2BTRA 3RHXA 3QYWA 4I5PA 4IAFA 4MEDA 5ACBC 3G6GA 1GZKA 3VS6A 4MD9E 4IFCA 4TKSA 3CQWA 3HRBA 4FV2A 3IDCA 1O6LA 2QVSE 2QURA 4JS8A 3ACJA 3FY2A 3NPCA 4GJ2A 3RAWA 5JH6A 2J6MA 5GJFA 2X4ZA 3ALOA 2C1AA 2GPHA 4WRSA 3NUPA 3ORMA 3KK8A 2R0UA 4BBEA 3MYGA 4NIFA 4XOZA 1OZ1A 5EQEA 3AD5A 1PYEA 2XB7A 4GSBA 1Y57A 2OJGA 2WEIA 3FMLA 4QO9A 3TIYA 2R7BA 4Y72A 4UN0C 3E8NA 4FKLA 4ASDA 2UW5A 4BDFA 4FKJA 2QC6A 4AU8A 4JJRA 4BCPA 3LJ0A 4XP2A 2XUUA 4GW8A 5IISA 3NYVA 5IDPA 3L8XA 1MQ4A 4PDOA 3NVMB 3MY5A 4LRJA 5EH0A 2YWPA 1LP4A 3KULB 5CU6A 2PZ5A 3Q9ZA 5ANEA 3U6JA 4C61A 3E8DA 2A27A 5LMAA 1YOMA 3BHTA 3IW8A 3KQ7A 4BCIA 3PVBA 3MPTA 2YDIA 4MNFA 5CSWA 3UG2A 2UZTA 4FTQA 4AFEA 3MVJA 3P9JA 3GCQA 4L45A 3A7GA 1UV5A 5HEZA 5AEPA 1PKDA 4P5QA 3RCJA 5FDPA 1R0EA 4B8LA 2GHLA 5E8UA 2BZKB 3NZ0A 3O51A 5HNBA 1H0WA 3CY2A 3LMIA 4I0TA 5LARA 3D7ZA 3LM5A 3LE6A 2VO7A 4WKQA 2OXDA 4C62A 3C13A 5ICPA 5M06A 4AZWA 3RCDA 3OEZA 4M12A 1JOWB 5B0XA 3W16A 4BIDA 4ZLOA 4ZLYA 1NW1A 3V5LA 4LOOA 4PRJA 2VTSA 4YTFA 4I41A 5EYDA 4MXOA 3L9MA 1ZAOA 4M7IA 4IZYA 4YNOA 1UU7A 4TN6A 4GUEA 2XP2A 1QPEA 4D2RA 3H4JA 5DFPA 3L8SA 2EUFB 4R78A 5EHYA 3UE4A 3UC4A 3MIAA 3GC0A 1QPJA 5E8ZA 5EOBA 4XLVA 3I7BA 5AV2A 1XR1A 4J71A 3RHKA 3VHEA 3NCZA 4V04A 3QU0A 4HVDA 3BKBA 2RFEA 4OTDA 4FKRA 4G3FA 3OY1A 5CU2A 2O3PA 4M97A 2H6DA 5CZIA 4DBNA 4EH4A 2R3PA 5IQBA 4NSTA 2VGOA 3MJ2A 4AZVA 3L9NA 4FL1A 3HA6A 3KU2A 5I5ZA 5GNKA 5KMJA 4AGWA 3ZFMA 2BIKB 4UWYA 2CN8A 2XS0A 2P0CA 2YJRA 4F7NA 3BHUA 4EK4A 1PHKA 1H1PA 5D41A 3FKNA 1VEBA 4HYIA 5AP5A 2CGWA 4JT3A 2XK7A 3CPBA 4TTHB 2BKKA 4AQCA 2FSLX 2BRGA 4JRNA 4BN1A 1Q4LA 3KXZA 3F3ZA 4LL5A 4IH8A 3TEIA 3CJFA 4CCUA 5HNIX 4L3PA 4MBIA 4DGMA 5GZ8A 4TYIA 5I9VA 2BROA 4DAWA 3MVLA 5LVPA 3VQHA 5AR2A 4KAOA 4BDDA 4ZTMA 1VYZA 2ZM3A 4GG7A 2JDRA 4XG8A 1U5QA 5IA5A 3UOHA 2WOUA 2OFVA 3R2YA 5IH4A 3EL7A 2QODA 2QKWB 1KV1A 2BALA 2X7GA 5C01A 4GK4A 3ATTA 5AIKA 4Q2AA 3EYHA 3R00A 3QHWA 2HY81 3KY2A 5L8LA 1H8FA 3LXPA 5J9LA 4C59A 3DKOA 4FVPA 2PVJA 3KEXA 2IO6A 3W2PA 4AW0A 4U81A 1HCKA 3OS3A 4ANQA 3GP0A 3OVVA 4KIKB 3V5QA 3W55A 4F09A 1BX6A 4LRMA 5M53A 3N51A 4EEVA 3T8OA 3CQUA 3O7LD 4BWKA 5H3QA 3V5WA 3RINA 4DGGA 5AAEA 2YIYA 1PXMA 3JPVA 3UVQA 4DEBA 1L3RE 2IVVA 3FXWA 5DRDA 4O22A 3BELA 4WG5A 1IR3A 3WE8A 2G2FA 1H1SA 3QQHA 4BKJA 4JBQA 4JAIA 1MRVA 3EQCA 5CYIA 2E9VA 4C4FA 1H0VA 1ZLTA 4ONAA 3ZLWA 2VTAA 4YZMA 1REJA 2VUWA 2W5HA 4FV8A 4D2TA 3KREA 5CZHA 4HYSA 2J0KA 5B2LA 5IQCA 2XNNA 4I22A 4OW8A 4N70A 4LG4A 5A3XA 4XRLA 1YDTE 5JRQA 3E92A 2OXYA 4X3FA 4PY1A 5FM2A 1WCCA 3FLQA 5FTGA 3QRUA 4BR3A 4EJ7A 2VTLA 2IW8A 3F2NA 3ZLSA 4WRGA 4X6RA 3H0ZA 5E8VA 5CU0A 3VBYA 5CEOA 4EOOA 5CT7A 4XG9A 2FYSA 3Q04A 5DEWA 4LMUA 3WF8A 2X1NA 4J1RA 4A4XA 5HZNA 1IAHA 5CXZA 2Z60A 4YO4A 3CBLA 3CKXA 3OCGA 4Z16A 3FMKA 3KC3A 3WF6A 4QTEA 1KOAA 5K4IA 5HO8A 5IA3A 5KMNA 4IFGA 1RE8A 3L1SA 2O64A 5CNNA 2FH9A 4NM5A 2PUIA 4ZSJA 4BBFA 4M69A 4RG0A 5DBXA 5I9WA 4FKOA 4M69B 4GCJA 2RL5A 5E8WA 4D58A 4ACMA 4YZCA 4NFMA 5M08A 2X7OA 5ITAA 3PRFA 4K8AA 4O1OA 3QWJA 3WF9A 1OITA 1WVWA 2GS2A 2OWBA 1YI3A 4X2KA 5D12A 4ZJIA 3F3WA 3E3BX 4YJOA 4GUBA 3O8TA 4E6AA 3FHRA 1XH4A 2WMQA 3RM6A 3BI6A 4BDGA 1BL6A 3ZDIA 4CT2A 4DINA 3MW1A 4NW6A 4OAVB 5DPVA 4PTGA 4GIIA 5BQ0A 1BI7A 2C3LA 4O7YA 5IG1A 2CMWA 4L7SA 5DHJA 5JGAA 4IM0A 3DA6A 5H8EA 4FSNA 4YJVA 2YM7A 5ANIA 5CAVA 2PVNA 4BYJA 2IW9A 1STCE 2RG6A 5FUTA 4O0UA 3NLBA 1E1XA 3QD4A 1KE8A 4GT4A 4E6QA 5IEYA 5M57A 4E6DA 1FGIA 2QLQA 2UVZA 3H3CA 3PA3A 4WG4A 3ZLYA 5EI6A 1PMEA 4E4XA 3NYXA 4JBOA 5AUVA 5FM3A 3BYVA 5HIDA 3V8TA 4GVAA 3ETAA 2RG5A 3O8PA 4IX5A 3OUNB 2YWVA 3TDWA 5DWRA 3HP5A 3S1HA 4C3FA 2ESMA 2XNGA 2I1MA 4FKGA 2UZNA 4I92A 4WOVA 3ATSA 4I1ZA 1A06A 2WQNA 4AX8A 4S33A 4NU1A 2NRYA 1GAGA 3FWQA 4IMYA 5TOZA 3ZEWA 5AJQA 2ZV9A 4YTIA 5E8XA 3GFEA 1R3CA 2P4IA 5M09A 3R9HA 3CLYA 4U3YA 3BLRA 3ANQA 2QD9A 4EJNA 1YXVA 4U3ZA 4Z55A 2C3KA 5KMLA 3DV3A 2UVYA 3NIZA 2XCKA 4QMLA 4CTBA 1H24A 3ZLXA 5AM7A 2XIXA 3FZOA 5AR3A 4CFWA 2I7QA 5DR9A 3HMIA 4UMPA 4ZP5A 3LMHA 5IEVA 4ZAUA 3MWUA 3E88A 3NW7A 3SKCA 3DQWA 4O6EA 3F6XA 3BYSA 4JDIA 2IZSA 3R30A 5BYZA 2OJFE 2E9OA 4JBPA 5T3QA 1W8CA 2XJ1A 2BKZA 3WOWA 5IQGA 4FTCA 3A4PA 3DK6A 2BHEA 1W98A 2XKFA 3EWHA 1U54A 2VTRA 2W1EA 3NR9A 4L43A 4UMTA 4IHPA 4UXQA 4YLLA 5CSPA 4BTKA 2R3KA 4ZZNA 3MDYA 2XJ2A 3DJ7A 4JOAA 1Q99A 3IGOA 2W1FA 3LCDA 3R22A 4UXLA 1H1RA 4C2WA 5C8NA 1DAYA 1I09A 1OKVA 2XNMA 2VTIA 4GIHA 4WHZA 4E4LA 3F9NA 4K6ZA 3E5AA 4FEVA 3P5KA 3OT3A 4YJUA 4CFUA 3NAXA 1Q3DA 2UZBA 2YCQA 4FTUA 2CHLA 3QHRA 3IOKA 3MSSA 5BVEA 2CKPA 2QO2A 5CANA 4ACHA 5FEEA 1ZARA 2GQSA 3C5IA 2WB8A 4MHAA 3QKLA 3U4WA 4HNFA 5HOAA 1Y6AA 3O7LB 3ORIA 3ET7A 2ITNA 3FMDA 4X0MA 3ZUTA 2LAVA 5IH6A 2WTWA 3DZQA 2UW9A 3FL5A 3PWDA 3Q6UA 3ZTXA 3VULA 3JXWA 4IJ9A 4BGQA 4P2KA 3LFDA 4QNYA 4MQ2A 4R3CA 5DR6A 4CMTA 5IA4A 1XQZA 4JDHA 4ITJA 4BDKA 3LFAA 2O5KA 3F3VA 2AC3A 4PWNA 4QP9A 4XP0A 3SD0A 1REKA 4FL3A 1CKIA 5IUIA 3F7ZA 4L46A 3R9DA 1BI8A 3D0EA 3DQXA 5GZAA 4YURA 4O7NA 2JDVA 1JVPP 1PJKA 2UZOA 3H9RA 1T45A 4ZSGA 3U9NA 4JX7A 4MBJA 4X3FC 4O86A 1AGWA 3A2CA 3E3PA 3G5DA 5IA2A 4BRXA 3GU7A 2JKKA 4F70A 3IG7A 3QUEA 4N6YA 3HVCA 4IM3A 4MWHA 3FZTA 2QCSA 5JT2A 4FSRA 4U43A 4F1MA 4XG4A 3PFQA 3E62A 1OGUA 5BYLA 3ZM9A 3MPAA 1H26A 3DFCB 4UB7A 3QTWA 4DEEA 4YBJA 4K2RA 2IZRA 4JVGA 3Q53A 5AR8A 3B2TA 3BZ3A 3U51A 3HDMA 5IU2A 1Y8YA 3ENHA 3QCYA 5HBHA 2Z2WA 3COIA 3EQIA 2PMLX 2J4ZA 3ZSGA 3FMHA 3TG1A 3FJQE 5LMBA 5BNJA 5C26A 4F6WA 3CTJA 4AE9A 2ONLA 4G16A 2ACXA 1P4FA 2GTMA 1MRYA 3FQSA 3KCKA 4JQEA 4RJ5A 4JNWA 5JFVA 4HOKA 4NCTA 4IE9A 5TO8A 2VO3A 3SLSA 2XZSA 5CAUA 4O91A 2PVRA 4PPCA 2PE0A 2C0OA 3GNIB 3O8UA 1O9UA 1ZY5A 2R3FA 2NRUA 3QZIA 4FX3A 2ITUA 2VO0A 4D2VA 5BVFA 2VWUA 2QU5A 4PF4A 1QMZA 5FP6A 4O7ZA 4PMTA 4FTRA 4QP1A 4K77A 4BZOA 4QT1A 4BZDA 5HO6A 4FTJA 5M4FA 2X6EA 4PDYA 3PIZA 4F65A 3ODZX 1WBVA 4TYGA 5AUZA 1VJYA 2ZJWA 5EW8A 3ZEPA 5FG8A 1LPUA 4RC3A 2ETRA 3S2PA 2QLUA 2YZLA 4AA5A 2GU8A 3F3TA 5AM6A 3DKCA 2GHMA 3GC8A 2BRBA 2C5VA 3LQ5A 3WILA 5EDQA 3ZXTA 4FZ6A 2YLFA 3HV3A 3DCVA 4HGEA 5K4JA 4QMXA 2QI8A 3RBWA 3B8QA 4QTDA 3PJ2A 4XJ0A 5LXMA 4EH3A 3LFQA 3NDMA 2ETMA 4BCFA 2C3JA 1OL6A 4EK8A 4ANBA 4FV4A 3TV6A 4FSQA 3IPHA 3IDBA 5D7AA 3DK7A 4U97A 4ORKA 3R1QA 4C33A 2Y4IB 3ROCA 4DG3E 2WO6A 1UU3A 4AA0A 5LMKA 3RZFA 1TVOA 5HO7A 4LYNA 2GS6A 4RIXB 1IA9A 3ROYA 3NW6A 2B53A 4D28A 3BBTB 4RA4A 5IA0A 3B8RA 3C4ZA 4FT5A 3A4OX 3BBWA 3Q4TA 4MVFA 1QPCA 4F0FA 3I79A 4FL2A 5DA3A 4KKGA 4PL4A 2PZRA 5D9HA 3EQGA 4EQMA 4NK9A 4DEIA 2RF9A 4LQMA 2PVHA 3WYYA 2CKOA 4C4GA 4TYEA 4IWOA 4IX4A 2WTDA 3O17A 4BCQA 1YQJA 3COHA 3F88A 3QGWA 4RJ4A 1M2RA 4W8EA 1DI9A 2C68A 3NUSA 4R7BA 3UTOA 4N0SA 5I3OA 5DOSA 1TQPA 4JQ7A 2PK9A 5E1EA 2VD5A 3SW4A 4FV9A 4YNEA 5BX0A 2B9FA 1SVGA 3VS1A 3A7JA 4NYEA 3MJ1A 5AIRA 4E7WA 3FZSA 4J98A 3R8LA 5JKGA 3G6HA 3PZEA 1VZOA 2XIKA 1UA2A 2J51A 3VUTA 3NUAA 5EFQA 4EBVA 3DS6A 3I60A 3MH3A 2J90A 4QPMA 5KMKA 3MFTA 2X4FA 5L2WA 2CKQA 4RFMA 4G6OA 4F9WA 2OBJA 3O0GA 4L01A 4BCNA 4JL9A 4Y85A 3FSFA 3FZ1A 3QQGA 2F57A 1JKKA 1YXSA 1OMWA 3ZM4A 4EUTA 5AR5A 1KSWA 4QQTA 2YDKA 4H3QA 1SM2A 3EQRA 3K3JA 1R1WA 3ORLA 3NUXA 5JGBA 1SZMA 2ITXA 3EL8A 3UYSA 2YA9A 1Q8UA 1XJDA 3KGAA 3F82A 3PJCA 2PZYA 3TI1A 4CQGA 3MI9A 3ORPA 5CEQA 4FG9A 2W1IA 4E1ZA 3KRXA 4FSTA 3PJ1A 3REPA 2GFSA 2HWPA 2X39A 2YM6A 3TTJA 4RFYA 5I9YA 2PMNX 5HTBA 5DN3A 1PXIA 1GIHA 4IAKA 2H34A 3CCNA 1GZOA 2OF2A 2XNOA 4XOYA 2WMBA 4FBXA 5EI2A 3RWQA 2IW6A 4W4XA 2PL0A 1JLUE 2QNJA 5I9XA 1XH5A 3V5PA 4TY1A 3HRCA 2OW3A 4RJ6A 3OP5A 4U41A 3OBGA 4IVAA 3EQFA 3FQEA 4TYJA 1OIRA 4K11A 3RWPA 3OWKA 4AF3A 3TIZA 4L52A 2EVAA 5M4CA 4QP8A 1GJOA 3PVGA 4GFOA 5LJJA 1UWJA 3LXKA 2R3RA 3PRIA 4LUEA 2ONLC 3PPZA 3SRVA 4W9WA 2OFUA 5HG9A 1WFCA 4HNIA 2R3OA 3V8WA 3C50A 4AW2A 3RK9A 2VTNA 4HYUA 4UBAA 2R3LA 4QMTA 4FMQA 4D4SA 4OTPA 5BUJA 3LFEA 4H58A 5IEXA 4MD8E 4AAAA 5AV4A 2X2LA 5TF9A 5LCKA 3ZC5A 4ERKA 2XIRA 3AC5A 3SQQA 3JY9A 2CSNA 4A06A 2CPKE 5LCJA 4O7RA 4EWHA 3BHHA 4KIPA 3KL8A 1YWNA 4MH7A 3C0GA 4F9AA 2XEZA 4FIHA 1H00A 1CSNA 3LKMA 1IG1A 1Z57A 3KCFA 5H2UA 3PPJA 4OTWA 4FEWA 3DB8A 4GK2A 4U79A 3VWAA 3MPMA 1M14A 5EKNA 4O0YA 3O2MA 1L8TA 1UKHA 3U4UA 2OXXA 3QZFA 3OW4A 3R6XA 3RNYA 4B8MA 4AOTA 3R28A 5HHWA 3ENMA 3LHJA 3COKA 4ZOGA 5BUIA 4S30A 4I5MA 4LUDA 2V7AA 5EYKA 4WD5A 5F20A 4ALVA 2Z02A 4DEDA 5HESA 4RSSA 5H8GA 3COMA 3UYTA 3Q9XA 5A46A 5JEBA 3THBA 3IGGA 4CT1A 2A19B 3NEWA 3M1SA 5HVYA 5D10A 3RI1A 2Y4IC 4DH7A 3OTVA 4O0WA 4FTKA 3PSBA 2Z7QA 3F5PA 2PSQA 4G5JA 5LMKC 4ZTSA 4GKHA 3G9NA 3TCPA 3FLZA 1NVQA 3DAJA 3R8UA 3VJNA 3Q4UA 2EB2A 4MXAA 5EM6A 3UOKA 3VS4A 3GCVA 5FTQA 1CKJA 3LXNA 4QMVA 2VAGA 4JDJA 2CGXA 4KS8A 5GJDA 4HVGA 3HKOA 3RAHA 4G5PA 4I0RA 4N6ZA 2Y9QA 2WTIA 3Q60A 4RQVA 4XG2A 2UW3A 3AD6A 4XBRA 5LVNA 4DBXA 3RPOA 2BTSA 4XNEA 4D9TA 1S9IA 2ZB1A 3OMVA 1DI8A 5DGZA 1Q41A 4FKUA 4W8DA 4R7HA 2JDTA 2J0IA 4BF2A 2I6LA 4TPTA 4AT5A 2XK3A 4GK3A 5KCVA 2XF0A 2DS1A 4ANSA 4BWPA 4DEAA 4DGNA 3P23A 3GU6A 2W1ZA 2W9ZB 3W32A 3POOA 2ITVA 2WEVA 3C0IA 3KULA 3ZSHA 3BE2A 3Q32A 1ZYSA 4D5KA 4KBCA 1W84A 4CZUA 2XK9A 3H10A 1NA7A 3ANRA 4YZDA 4KSQA 4ANMA 3QQUA 4C37A 3RPVA 4FNYA 1ZOGA 4EKKA 2WQOA 3QYZA 3UQCA 4TWCA 1OB3A 2IN6A 2C5NA 4YHFA 5AP0A 3V51A 3HV7A 5HE1A 1LEZA 4C35A 2VN9A 4W9XA 4WIHA 5F4NA 4LL0A 5DI1A 1M2QA 4ITHA 4EH5A 5CVHA 2J0JA 5JQ8A 4QTCA 1WBSA 3Q52A 4AZFA 2R5TA 3LQ8A 3MY1A 3A61A 2PVFA 5K0XA 1O6YA 2WKMA 3ULZA 4J99A 1QPDA 3IW7A 3D2IA 4X6QC 4O7VA 1A48A 2WNTA 1XBBA 2ETKA 2NO3A 3DJ5A 3E87A 3R8MA 4U9AA 2G01A 5I9UA 1E9HA 5BMMA 5G1XA 2HAKA 4OTRA 4AZEA 4DCAA 2EU9A 2X9FA 4L44A 3WZKA 4CFVA 2YM3A 3OCTA 3SG8A 3G15A 3SV0A 2BZIB 4DFLA 4OT6A 4EOJA 4A4LA 4PL3A 2J0MB 4QP6A 4K1BA 4Y5HA 4YZ9A 3MBLA 4CMOA 1Q8WA 2W17A 5G6VA 4DGOA 4FZAB 3FSKA 3MVMA 2QO7A 3IONA 4EI4A 4CGAA 4XYFA 1BL7A 3TUBA 1XWSA 4HYHA 4KSPA 4ZXTA 3U6HA 2CCIA 5GINE 2C6MA 2ZDUA 3EN5A 3EQBA 5ETFA 1Q24A 4D2SA 3D5VA 2CN5A 3UDBA 3W8LA 3V8SA 3ODYX 1BKXA 4O81A 3VS5A 2JAMA 2OIBA 3AMAA 4I3ZA 3SXRA 4BIBA 4IADA 4H1MA 1JPAA 4DF3A 3F7WA 4FUYA 1Y8GA 2B7AA 4QMQA 5JFWA 1UNGA 2NP8A 2RFDA 2ITQA 2VTHA 2HWOA 3GU5A 3KRWA 5CF6A 2R4BA 3F61A 4FICA 3PXQA 4XH6A 4YLJA 3VBWA 3ZO3A 3P0MA 4AT4A 3D83A 4C02A 4L67A 5L2SA 4H3BA 3ERKA 2OZOA 2X8DA 2WMWA 3EZVA 1YHWA 4YJPA 3UZTA 3GEQA 4BWXA 5HI2A 4ANLA 5CS6A 1SVEA 4QMYA 1P4OA 4C0TA 4F0IA 3UQFA 4BIEA 1H08A 1UNLA 5AFVA 4O38A 4XX9A 4ZSLA 2Z7RA 3DBDA 2ITOA 3Q9YA 3QAME 4K18A 2WXVA 4Z9LA 4PDPA 1WBTA 2B0QA 3DNEA 2PVLA 3KXMA 3ZSIA 2WMUA 5HU9A 3VUHA 4CEGA 2HZ4A 4F9YA 2VGPA 4QMOA 5HD4A 1K3AA 5DE2A 2J2IB 4K0YA 4F7LA 3CGOA 3QTZA 2BUJA 1MQBA 3D2KA 2C6DA 2UZDA 2GQRA 4R1VA 4FT7A 3OUKA 1PXJA 4E20A 2R3MA 2YJSA 5AR7A 2FB8A 4MCVA 4R5YA 3EQPA 4H3PA 3H9FA 2BMCA 4ENYA 3QRKA 1FVTA 5EW9A 3MA3A 1ZY4A 3BIZA 4I6HA 2BAQA 3PDTA 5J7BA 1YVJA 2R3HA 3E8CA 4GV1A 4KIKA 1KV2A 3L9LA 4RIYA 4RIYB 4F9BA 3H9OA 3PP0A 5F94A 2C0IA 3BE9A 4LV5A 4J7BA 5JRSA 3Q2MA 5L8JA 5HU3A 3VQUA 4D4RA 4P90A 3UQGA 1UWHA 4Q5EA 3DBCA 2OICA 5AUWA 4AW5A 3LLTA 3TJDA 4O21A 2J9MA 4QYYA 4WNMA 4HVHA 5J79A 2R3IA 1YXTA 3RPYA 2H8HA 5HX6A 4IB0A 5FLFA 4AGCA 1P14A 3P7BA 1ZOHA 2JBPA 1J3HA 1SMHA 2CCHA 2UW7A 3AGMA 5T68A 3TKUA 3D15A 4M14A 5KBRA 1K2PA 4CKRA 4KKHA 4EH9A 4CMUA 3F5UA 4C4HA 4L8MA 2YABA 3QD2B 4BKZA 5CF4A 4BYIA 5EQYA 2A4LA 3NRMA 2DUVA 4PDSA 4ACDA 2ZV2A 3R9OA 3E64A 2XRUA 4B99A 4H05A 2QO9A 3LAUA 4ARKA 4YP8A 4K9YA 3I5ZA 3CKWA 4MF1A 2W06A 3G33A 5CVFA 4FTLA 3R7YA 3IW5A 5J5TA 4TT7A 1MP8A 1Q8TA 3G0FA 4CQEA 1ZMWA 2YEXA 2EXEA 3FQHA 5HCYA 3GC7A 1PRYA 4IZ7A 1Y91A 3R73A 2IJMA 4DG0E 5C4LA 4EZ7A 2HY0A 4OLIA 4CKIA 2XBAA 2XEYA 4MXZA 3R1YA 2V55A 1S9JA 3MFSA 4WUNA 5K9IA 3Q4CA 4WUAA 2PPQA 5HIEA 3D94A 4FOCA 4EC8A 3EN6A 4MAOA 4BHNA 1P2AA 4DFNA 1F3MC 3IW4A 3FHIA 4U45A 2XK6A 2Z7SA 4FSZA 3E63A 3A60A 5HIBA 4J8MA 5FEQA 2XMYA 2ZDTA 4AS0A 4L3LA 5DYJA 3NAYA 3NUNA 5ANJA 3SXFA 3RK7A 1FVRA 5DIAA 4YJQA 3PIXA 4JLCA 3Q2JA 4CG8A 2ZV7A 2G2IA 4O83A 4JR7A 4LGDA 2J0LA 3EIDA 4Y5QA 4G17A 3C51A 3WF7A 4BHZA 2Z8CA 3OW3A 4MYGA 3N4TA 4BDIA 2GCDA 5CEIA 1GOLA 3PJ3A 5AV1A 3C9WA 3TNWA 4FNZA 3C4FA 2JITA 2FUMA 3FY0A 3A7IA 4D4VA 1JSUA 1RQQA 3VAPA 3F69A 2QKRA 3R1NA 4ASEA 5A4EA 3UIMA 2J7TA 4G9RA 3BLQA 5DH3A 4QTBA 5HG8A 3HAMA 3R7EA 2YM5A 2IVSA 4FV5A 5LVMA 2FVDA 3WIKA 2RSVA 4DFBA 2C6OA 2W99B 2C0TA 3GVUA 2KULA 1URCA 2W1CA 3OROA 3HX4A 4YHJA 3IK3A 2VX3A 3MB7A 4IDVA 1JKTA 2H96A 3NUYA 3PYYA 3DKFA 2JIVA 2ZM4A 4C57A 3C0HA 3SGCA 3QX4A 4NH1A 5IUHA 4DC2A 4RX8A 5A6NA 4MQ1A 4FV1A 4M84A 4EHVA 3N4UA 5ACKA 5FBOA 2GNHA 4RLLA 3WIGA 3ID6C 2YHVA 2QR8A 4JG6A 4YU2A 1M17A 3IDPA 1DS5A 2JAVA 4FNWA 3PXFA 2YCFA 3LMGA 4FV7A 2AUHA 4R3RA 4D1XA 4H36A 1YI4A 2QOHA 3P1AA 4A9YA 1U4DA 3TDVA 4BI1A 5TE0A 2B9JA 2WFYA 4WSQA 1WBNA 3BX5A 3C4CA 4GVJA 3MVHA 4D4YA 4EH8A 3MN3A 3OZ6A 3LCOA 5CXHA 4FE2A 4LOQA 1R39A 4CG9A 5A6OA 5J7HA 4N4SA 4O2PA 2XRWA 3FMNA 2QG5A 2C3IB 1ZMVA 2WMXA 5I0BA 3NW5A 3BYOA 2VX0A 3E8EA 4H39A 2PVYA 4PPAA 4ITIA 4OR5A 4RFZA 3CD8A 4FOBA 3GCUA 2F2UA 2XM9A 2PU8A 3NNXA 3LXLA 1Q62A 3T9TA 1TKIA 2Y4PA 3MTFA 4FGBA 4UMUA 3PSDA 4WSYA 3QLGA 4E26A 4D9UA 4MK0A 3DLSA 4AZTA 4OTIA 4DCEA 5HG7A 4FI1A 3VNTA 4ZSAA 3GFWA 3KN6A 1YXUA 3DGKA 5HNGA 4IB1A 4IDTA 3RMFA 4UX9A 2JEDA 2NNWB 3BGZA 4GEOA 4YR8A 3TM0A 2IZTA 2O8YA 2Y7JA 3FI2A 5AMNA 1Q5KA 5K3YA 3NNUA 3CIKA 1XH6A 4IX6A 4IW0A 2VRXA 5JGDA 4RGJA 2UZEA 4M67A 3IOPA 4WNOA 4WG3A 2GS7A 3WBLA 3AC1A 2XIZA 3KVXA 3AC2A 3ZO1A 4W4VA 3TJCA 3KA0A 3WF5A 2JIIA 4JG7A 4FIIA 4B7TA 3GENA 4EQUA 2HZ0A 2C1BA 2JFMA 3GCSA 3Q6WA 4J53A 4USDA 4IJPA 3ZOSA 3PXYA 3HAVA 4FEXA 5HVJA 3ZFXA 1PXOA 4HCUA 2B1PA 3N4VA 4DFYA 4U40A 3LFNA 2PZIA 2XK4A 1U46A 1FQ1B 3BV3A 3HNGA 4PTCA 2FSTX 5CQWA 5C9CA 2G15A 2HYYA 4FNXA 4IVBA 5M51A 3LFBA 4WT6A 5DVRA 1G8SA 5E4HA 3NYNA 4QMPA 3WZDA 4O0TA 2BZHB 3DY7A 3BHYA 3BPRA 3VF8A 5GJGA 3UO5A 2XBJA 1YI6A 3DAEA 3MS9A 3UIXA 4G3EA 2F4JA 4BCMA 3GT8A 3W2QA 5CWZA 4YHTA 4L00A 4TL0A 2PVMA 4S32A 4KNBA 5CLPA 3SXSA 4F4PA 2BVAA 4G3DA 4I4FA 2RIOA 5KE0A 2XKCA 5I9ZA 3UMWA 3F5XA 3I5NA 2FGIA 2ZMCA 3SOAA 5IMXA 5LWMA 2VZ6A 5CY3A 1QL6A 1MUOA 3G9LX 4O7LA 2EWAA 4FF8A 4CCBA 2YIXA 4E3CA 4GL9A 2GMXA 1ZWSA 4YMJA 5IH5A 1PXNA 3L8PA 3U54A 3KF4A 5HLWA 1FPUA 4QMZA 1JSVA 2BR1A 3AQVA 3PPKA 4F7JA 3FUPA 2I40A 1P5EA 4GH2A 4YZNA 5AP6A 3FI8A 4C58A 2QOCA 3FZRA 2QHNA 3DKGA 3PIYA 3AMBA 3ALNA 3AD4A 3PTGA 3AC4A 4GYIA 4J52A 4BDBA 3F5GA 2ZV8A 4HPTE 4OTQA 2HK5A 5CI7A 4BDEA 4ERWA 4R5SA 5DLSA 1FMOE 3GC9A 3HMMA 3OTUA 1W0XC 3EYGA 4WA9A 1FBNA 5FXQA 5K0KA 2F9GA 4GG5A 4FVQA 4F63A 3DBFA 4G31A 1XBAA 4ZTHA 3UZPA 4USFA 2BRMA 2BCJA 4RRVA 3PE2A 4PUZA 4LV8A 3TTIA 1KE7A 3VUDA 4DT9A 3WZUA 3ZRMA 3VS2A 4QMNA 3II5A 4LOPA 4FTAA 4DITA 3V5JA 1WBWA 4M66A 4QMUA 2R2PA 4AN3A 4RVTA 3LFFA 3EB0A 2QU6A 3W1FA 1OECA 4IB5A 3OOMA 3Q9WA 4O1PA 4PV0A 5BPYA 4ZTQA 2YIRA 5AUXA 2BILB 2YACA 4YSMA 3QRIA 3OG7A 4A9UA 2GNGA 3PP1A 3MB6A 5EW3A 3PWYA 3VN9A 4MWIA 2A1AB 2Y8OA 5DT0A 3QKKA 5AV0A 2CGUA 4A9TA 1ATPE 3I6WA 3MFRA 4QYEA 3QX2A 3FL4A 2UW6A 2Q0NA 1OUKA 3QTIA 4DH8A 5EG3A 3LQ3A 5KKRB 5AP2A 3VJOA 2XA4A 4RC2A 4I4EA 1IA8A 2OKRA 5BVOA 2G9XA 2PVKA 3OT8A 4O0XA 3VRZA 3KXGA 3D5WA 2GFCA 5IKWA 1OL2A 1OIYA 4IIRA 4D2WA 4LRKA 3PVWA 4C7TA 4JI9A 4RT7A 5IQFA 4RIXA 4NJDA 4YC3A 3G51A 3SC1A 3AMYA 4UZDA 5HE2A 4IZAA 5JFSA 3ZS5A 3M11A 3D4QA 4KA3A 4EOKA 5HD7A 4I21A 3TZ8A 2GTNA 3CJGA 3DT1A 4LGGA 4DHFA 3EFLA 3Q5IA 4JXFA 4AP7A 2WMTA 1V0BA 1WAKA 5FBNC 2YM8A 2PMIA 1OKWA 4JX3A 5E8TA 1K9AA 1GIIA 4YSJA 3BU3A 2JDSA 5KZIA 3LIJA 3T3VA 3EN9A 2VWWA 2X7FA 5D1JA 2XCHA 3DPKA 4PPBA 4PP7A 3TWJA 5JK3A 3QKMA 5HGIA 2C6IA 2VTOA 5C27A 3VBTA 2P2IA 3DB6A 4HPUE 3VUGA 4F1OA 3UGCA 4B6LA 4N57A 4MD7E 4FEQA 4V01A 4X3JA 4CFNA 4BI2A 4F08A 2AC5A 4CFXA 1GZ8A 5CAPA 4F7SA 3OWLA 4FTMA 2VNYA 2ITTA 3KRJA 2DQ7X 4FTNA 2GSFA 3DAKA 4RX7A 5AA9A 3ZZWA 2PWLA 4ZS0A 2ZYBA 2J5EA 2X8EA 2PHKA 3C1XA 1HCLA 4PL5A 5HX8A 4HZSA 3P79A 3SA0A 3I4BA 3NS9A 3ZO4A 4OTHA 4KINA 1OBDA 4ANOA 3QQLA 2WMAA 5DEYA 2BDFA 4G9CA 4U0IA 2WIHA 1QCFA 2VTJA 1PKGA 1Q8YA 1ZZ2A 1V1KA 3MH2A 5EHLA 1KE6A 3IS5A 4MXYA 3ZUUA 3R9RA 5FXRA 5FRIA 3QUDA 5H8BA 3DLZA 4F9CA 4RWIA 5BVNA 4DFUA 3QBNA 4XV9A 3TV4A 5BYYA 3OOGA 4D0XA 4C8BA 3R21A 4TW9A 3ZBFA 4D5HA 4EOQA 2R3GA 3RJCA 2GNLA 5LQFA 5AWMA 5B2KA 2UW8A 3OWJA 1GZNA 1PMVA 2C6KA 3CSVA 5EYCA 5E7RA 3N9XA 2RFNA 2F7XE 5AP1A 4NTSA 5CSVA 3GQLA 4EZ3A 3UJGA 3QXPA 5J95A 2CLXA 2QOQA 3BEAA 4P5ZA 2O63A 2CJMA 3G90X 1J1BA 4FSWA 5AAFA 4IX3A 3VUIA 4DLJA 2BIYA 2G1TA 2RFSA 3HMPA 4FKTA 4U8ZA 1E1VA 4G34A 3QCXA 4U6RA 3UIUA 1ZXEA 3EQDA 4CFFA 1APME 2BAKA 4BICA 4O0SA 4IXPA 4M0YA 5CQUA 2CGVA 5CSXA 5AX3A 3C5UA 5I4NA 4R1YA 4NT4A 2VWXA 4XUFA 1SVHA 2R3NA 1JNKA 3SAYA 4FZ7A 2XNPA 4NM7A 2JDOA 2V62A 4YPSA 3GUBA 2P2HA 2WOTA 4FT3A 5AP4A 5GIOE 3KF7A 3TNIA 3ZONA 5CVGA 2YCRA 1XHAA 3S4QA 2XJ0A 3RKBA 1XH7A 3NNWA 5IZFA 4FKVA 3ZBXA 3OFMA 4FC0A 2X2KA 5F9EA 3ACKA 4I6BA 1ZYCA 3PE1A 1CKPA 4Z7GA 2F2CB 2YN8A 3KVWA 1H28A 4O84A 5JSMA 1YHSA 1DAWA 3ZC6A 2XIYA 5CF8A 5L6PA 2W1GA 5EM5A 4OT5A 3DXPA 2A0CX 4BGHA 3NNVA 3VBQA 3VIDA 4G3CA 3AOXA 4QQ5A 1MRUA 2J5FA 3CQEA 4M8TA 4HJOA 1WVYA 4NKSA 4RX9A 1M7NA 5EDRA 4AE6A 4G3GA 4U7ZA 4V0GA 3MH1A 3ELJA 3FV8A 4V0GB 3BWJA 4B9DA 3QCQA 4ZZOA 4QQJA 3HRFA 4CXAA 2REIA 3CXWA 4EOMA 1KUTA 4U42A 3ORXA 4LM5A 3EKKA 2OH0E 4NEUA 4RLKA 4X2FA 2PUPA 2PTKA 3QQKA 4CVAA 2RGPA 5LOHA 3QL8A 3EN4A 5DNRA 4IAYA 5ANKA 4BL1A 4FV0A 3QC4A 5CNOA 5A54A 1WVXA 2I0EA 4GT3A 4CZTA 4FTTA 3TZ9A 4XS2A 3UIBA 4EHGA 3UOJA 3V6RA 2R64A 4RBLA 2W5AA 1H1WA 4UY9A 3VHKA 3LPBA 4CRLA 4EUUA 5JN2A 4UWCA 4IVCA 3QZGA 2UUEA 5KKRC 3QALE 1OKZA 2BFYA 2UV2A 1T46A 2BDWA 3V01A 4MF0A 2ERZE 3QA0A 1J7UA 4BCGA 1Y6BA 4IQ6A 3QFVA 3I1AA 4XV3A 4A9SA 1KOBA 4A9RA 2YLEA 4PX6A 3D9VA 4E5AX 5EOLA 2OLCA 2UZVA 4YPDA 3NUUA 2WU7A 3KKVA 1M7QA 2JKMA 4GFMA 4YGAA 2C6EA 4CTCA 1RJBA 4APPA 5A4CA 1YXXA 2OG8A 5DG5A 2P3GX 3QXOA 4FSMA 4UV0A 3VW8A 4R77A 4U5JA 3QTUA 2Y6MA 4J97A 2WD1A 3KRRA 4DYMA 3GB2A 3FEGA 4KRCA 5FXSA 3VRYA 4FK6A 1FOTA 1IASA 1XBCA 5EDPA 4AA4A 4CV8A 4EH6A 3AXWA 4CZYB 4BB4A 4J95A 2VTMA 4FG8A 2C4GA 2GNIA 4MNEA 3ZXZA 4BCOA 4D1ZA 4MNEB 4EC9A 4AT3A 3SVVA 3TUCA 3T3UA 3QCSA 2VX1A 3ORKA 4J8NA 3UVPA 4DFZE 1PY5A 3EFWA 2YISA 4RX5A 1OL5A 4NWMA 4EBWA 3OXZA 3R04A 4NJ3A 3HUCA 3RALA 1JQHA 3RNIA 1OM1A 4CLIA 4NW5A 2HZIA 2GNFA 3CGFA 2WAJA 1GY3A 4NIFB 2QOBA 4PP9A 3W2OA 5GIPE 4AFJA 4X7QA 5CI6A 4DFXE 3FE3A 3HMNA 4M68A 4Y95A 4G1WA 4GS6A 5EKOA 4GJ3A 3W2CA 3JS2A 3OY3A 3DBQA 1SNUA 3QQFA 3FC2A 4YO6A 4HVSA 3U55A 3QRTA 1BLXA 1YWVA 4G2FA 3UO4A 2PY3A 3ZU7A 3GBZA 1ERKA 3EH9A 4OBOA 3TKHA 3CS9A 3HLLA 4FVRA 3U9CA 4DH5A 4FYOA 2XH5A 3PLAE 5AP3A 1UVRA 4ZIMA 4A7CA 3R7IA 4X21A 1OL1A 3RK5A 4BDHA 3MIYA 5CASA 2B4SB 1A9UA 3CPCA 5F1ZA 4AZSA 1OPJA 2CLQA 4ZZMA 1OKYA 4E73A 4O96A 4UMQA 5KZ0A 4TZRA 4C2VA 1OIQA 4YC8A 3UNKA 3AT3A 3DDQA 3AG9A 4O0VA 5D11A 5HE0A 2RKUA 4FV6A 3ORNA 2IWIA 1CDKA 2NPQA 4NZWB 1G8AA 4LFIA 5L8KA 4YTCA 3HP2A 3A62A 4JR3A 4C4JA 3IECA 4JRVA 3FDNA 5ETAA 3PA4A 3LJ2A 3VVHA 4Q5HA 3WI6A 4IC8A 2Y0AA 3FLWA 2B9HA 2PUNA 4I23A 2YIWA 4IVDA 2YITA 2W4JA 1O6KA 3BGQA 3UPXA 3HGKA 3UPZA 1H27A 2BAJA 2I0VA 5A4LA 2W1DA 2R0IA 2VU3A 3FMMA 4II5A 5ETIA 5FEDA 3LOKA 3R7UA 4D55A 5DT4A 3RVGA 3ZZEA 1M2PA 5K5XA 4RWLA 4IANA 5M56A 2X6DA 5F95A 2DYLA 3FYJX 4KBAA 4IACA 2F7ZE 5HKMA 3R7VA 2VWYA 3GU8A 5TR6A 3C4WA 2W7XA 3M2WA 3UODA 3RZBA 4AGDA 4BDCA 3CTQA 5A9UA 5KUPA 3I6UA 4PMPA 4W4YA 1WBPA 4QQCA 4M15A 4BDAA 4APCA 3BEGA 5EI8A 4AOJA 4C38A 2W4KA 2YAKA 3WZJA 2DWBA 3R1SA 1BMKA 3RP9A 5HCXA 3S3IA 4IB3A 4D2PA 5CF5A 3A7FA 4HW7A 5TT7A 2IVUA 4QMMA 3DTWA 1BUHA 5E8SA 2C30A 4EK3A 3FYKX 3KFAA 4F6SA 3CE3A 4NM0A 3BU6A 5KHXA 2Z7LA 1UNHA 2FSMX 4Y8DA 5CSHA 4TNBA 3CD3A 2BRHA 3JY0A 5GHVA 4CLJA 1G5SA 3O96A 4TXCA 4CKJA 4YJNA 2E9UA 3RGFA 3ULIA 1RDQE 4QPAA 1Z5MA 2GNJA 4XMOA 4Q9ZA 4TNDA 4YZBA 4ZY6A 4ZSEA 1IAJA 3PVUA 1GNGA 1IEPA 4BCHA 4IM2A 5L6WL 4QYFA 2G2HA 3TZMA 3ZH8A 5AUUA 5K5NA 5JZNA 5KMMA 1G3NA 1NVRA 3CP9A 3BQRA 1WZYA 3DK3A 2UW4A 4X2JA 3PJ8A 3AGLA 5EYMA 4ALWA 2V5QA 2OH4A 5LVOA 1IRKA 2ZOQA 3JVRA 4EOIA 3R9NA 2C47A 4USEA 3A99A 2OZAA 2WTKB 4EYJA 4JBVA 4Z3VA 4FA2A 2OZAB 3DJ6A 4HGSA 5B2MA 4K33A 5JFXA 4BBMA 2C6LA 3BU5A 3FZPA 3GI3A 4WBOA 4O7SA 3ORTA 5J9ZA 3DU8A 4O0RA 5AADA 2X81A 5CENA 2WPAA 3TACA 1PXKA 1J91A 1AD5A 1H01A 3U87A 1NVSA 1Z9XA 4U44A 2JLDA 1YKRA 3MY0A 4TWNA 4C34A 2YDJA 4A07A 4ASZA 4OTGA 5AAGA 2ZM1A 4EHEA 4QP2A 5FWKK 4FG7A 5IDNA 1PXLA 4DTBA 2P33A 3TZ7A 5DMZA 4S31A 1YHVA 4KWPA 3DZOA 3KMWA 3R83A 4XCUA 3PG1A 4L7FA 3R71A 4YBKA 4CYIA 3H30A 3PXZA 1W83A 2JBOA 4RVLA 2QOKA 3R8VA 3SHEA 3BYUA 4ALUA 3ZO2A 3FXXA 4ZY4A 1ZOEA 4OBPA 4QNAA 2CNVA 3E93A 3SDJA 4M3QA 2WQEA 4BKYA 3OWPA 3QD0A 4ZLZA 4XG6A 4BFMA 2LGCA 3ORZA 4HCVA 3DTCA 3NCGA 4OUCA 4X3FB 4RMZA 5EM7A 4KBKA 2F49A 2VWBA 4IBMA 4Y73A 5A4QA 3HV5A 2I0YA 5L2TA 4I24A 4JIAA 5C1QB 4YLKA 2ITZA 4GMYA 3IW6A 3W8QA 3M42A 3FI3A 3DXQA 3ZHPC 4KIOA 3ZRLA 3R7GA 3UNZA 4XV1A 3WYXA 3E7OA 3KXXA 1BYGA 3QTXA 4PNIA 3OCBA 3TL8A 4XEYA 2HZNA 5HCZA 1Q61A 3TN8A 3S0OA 4CFMA 4EL9A 4RJ3A 4ACGA 2GDOA 3KMUA 3EJ1A 5EHOA 3JYAA 4XBUA 4O27B 4DEHA 2X2MA 3CTHA 4EQCA 4F1TA 3P86A 2PULA 2UZLA 3G2FA 4P4CA 2HENA 3PZHA 2VWZA 4HCTA 4XG7A 4GT5A 3VS3A 4BGGA 4TWOA 3DNDA 5L2IA 3UNJA 4QTAA 2CNQA 1NT2A 4EOLA 5DRBA 3PSCA 4NTTA 3FLSA 2YFXA 1U59A 1OUYA 3EQHA 4QMSA 2EXMA 1J1CA 3UG1A 3FMEA 2PYWA 2I0HA 4DTKA 4ENXA 4I6QA 3U8WA 1PW2A 1KE9A 2W9FB 3HL7A 1EH4A 5E90A 2ERKA 5HLNA 4QMWA 3WZEA 3KXHA 3S00A 4DA5A 1ZMUA 5AX9A 3MESA 4W4WA 1OVEA 4HGTA 3AC8A 4OGRA 5C8KA 2YAAA 2OK1A 1ZYJA 1W7HA 4PQNA 4UYNA 4JDKA 4L3JA 2HIWA 3TNQB 5C8MA 4IAAA 2QG7A 4E6CA 5JMSA 3EMGA 4IWQA 2ZAZA 2B54A 3BQCA 3OHTA 1NXKA 3QTSA 4QP7A 5AP7A 4ZJJA 4FGRA 4G6NA 2JD5A 4EKLA 5IUGA 4ZK5A 4AXAA 1YW2A 4BZNA 3F3UA 4QYGA 5FGKA 4E5WA 5LWNA 2VWIA 2HW6A 2X0GA 4LGHA 2YIQA 4ZS4A 2VV9A 2WQMA 2Y6OA 2R3QA 3KRLA 4IEBA 4RVMA 3NMUF 4FV3A 5CAOA 3W2SA 4YC6A 4WNPA 3OCSA 5FP5A 1HOWA 2XK8A 4CNHA 5I3RA 2WMVA 1CM8A 4E4NA 3L9PA 3FXZA 4FKPA 3D5XA 1FGKA 4RWJA 4E8AA 2BZJA 4Y46A 5M07A 2HOGA 3FLNC 4I93A 2ITPA 1B38A 1WMKA 3HMOA 4GFGA 3QWKA 5LVLA 3VBVA 4BTMA 3UP2A 2OJJA 2XM8A 4FIGA 4FT9A 2VTQA 2QOOA 3Q5ZA 4XV2A 3SW7A 5HBJA 2XKEA 5KMIA 2WTJA 4RJ8A 4F0GA 4DH1A 4FODA 1B39A 2PUUA 4R6VA 3R0TA 4QOXA 4TRLA 2XVDA 4BY9E 3LJ1A 2JGZA 3W2RA 4MTAA 1YWRA 2JKOA 3EZRA 4R7IA 2OSCA 2P55A 4M13A 3V04A 1ZYLA 3Q4ZA 4X2NA 4IC7A 2GHGA 2BDJA 4DG2E 4O7TA 4MXXA 4FIFA 4RA5A 5BUEA 5JQ5A 1TQIA 2JFLA 5HG5A 1H25A 4LI5A 3R2BA 4ID7A 3EN7A 4PMSA 5TKDA 4F6UA 3U6IA 3OC1A 3IO7A 3QTQA 5L2QA 4KB8A 3GGFA 1DM2A 3LZBA 4A4OA 5IPJA 5KHWA 3TT0A 3BGPA 1U54B 2XNBA 2BFXA 2WHBA 1H07A 4C4EA 2CDZA 5KBQA 4IWDA 5AUYA 2YZAA 4LMNA 3OXIA 2WTKC 3QTRA 4YTHA 3KN5A 2KTYA 4QYHA 2R3JA 3I81A 5E8YA 4ZTNA 4DTAA 3HV4A 2JC6A 1UKIA 3FI4A 2X9EA 3PXRA 4P7EA 5J87A 4UMRA 3TUDA 1OI9A 3MH0A 4RIOA 2YCSA 5HLPA 3HYHA 4ZEGA 2C5XA 5CALA 1W82A 1YDSE 5CEPA 1ZRZA 5KO1A 2HXQA 4QPSA 4FR4A 4WBBB 2BRNA 3ZDUA 3ZMMA 5A14A 3VS7A 4PMMA 1LR4A 4ASXA 3RTPA 5AA8A 1GIJA 3UZRA 2W05A 2E9PA 4D1SA 4PNKA 4AW1A 4E5BA 1V0OA 3D5UA 3I0OA 1JAMA 1OBGA 2XYUA 1Q3WA 1XO2B 3PLSA 4F99A 3NGAA 3MGYA 5CX9A 4GKIA 3LCSA 2ZVAA 3GQIA 3MFUA 5E9EA 2IZUA 3P78A 4TWPA 3PUPA 3TKIA 3UVRA 3ZYAA 1YOJA 4RJ7A 3FPMA 3QLFA 4O82A 3TV7A 3C4XA 5L6OA 2FSOX 2ZB0A 4JAJA 4RIWA 4RIWB 4EK6A 1CMKE 1JWHA 3F2AA 4IWPA 4QP3A 2ITYA 4FUXA 5IQAA 3FKLA 3GOKA 3O23A 3POZA 5A4TA 2WZJA 5J1VA 4Y83A 3KB7A 5EK7A 5BVWA 5HBEA 3OEFX 5M4IA 1OPLA 2O65A 4KS7A 4EORA 4NM3A 2O0UA 4AN2A 2OIDA 5IQHA 2GQGA 3EFJA 3OXTA 4HGLA 4EONA 4CRSA 3P08A 3RAKA 4I0SA 4EOSA 1H4LA 1FMKA 3DBEA 1JSTA 3ZUVA 5DT3A 2OF4A 4KUJA 4J96A 1AQ1A 1FVVA 3DDPA 3PG3A 4DGLC 2QOFA 3SOCA 4GU6A 4CYJA 3NSZA 5B7VA 2WMRA 3AT2A 1R0PA 2WELA 3R63A 3Q96A 3T9IA 4AOIA 5M55A 4WO5A 4XLIA 1ZYDA 1RW8A 4FKIA 5BVKA 3AC3A 4FTOA 3LLAA 4V05A 5C03A 1F5QA 3LFCA 3R8PA 3HV6A 3FC1X 4WNKA 2Q0BA 3V5TA 2OU7A 5E91A 2W5BA 1B6CB 4ZJVA 4EK5A 5IQIA 4D0WA 1VR2A 4C36A 3RPRA 3W18A 5HE3A 4YJRA 2IPXA 2OIQA 4IAZA 2OJIA 2BHHA 4ZTLA 5HICA 3V3VA 1PMUA 2VNWA 4E93A 4ZMEA 5IQEA 2FA2A 3D7TA 2UZUE 2A2AA 4R3PA 2PE1A 2QHMA 3D7TB 3TNHA 4AACA 3GU4A 2HXLA 4GRBA 4I6FA 3HECA 3TXOA 1UU8A 2HCKA 3I7CA 2XYNA 1TQMA 2WTVA 4EWQA 4UALA 4CD0A 3SG9A 2EB3A 4AUAA 4R8QA 2OI4X 1J7LA 3H0YA 2WQBA 4KABA 2VTTA 3HEGA 5IA1A 3K5VA 3BHVA 3W10A 4DE4A 4RC4A 4DN5A 3D14A 4RZVA 3R02A 3UMXA 5J8IA 3RAIA 4FSYA 3VBXA 5IQDA 2W4OA 4EHZA 4I5HA 1I44A 3PXKA 3A8WA 1JKLA 1X8BA 4BTJA 3NYOA 4MX9A 2C69A 3CEKA 4XRJA 2CKEA 4UZHA 3UP7A 2E2BA 3VW6A 1JKSA 1H1QA 2R7IA 2V7OA 4BDJA 5J9YA 3B2WA 3BYMA 3PA5A 4MBLA 2WTCA 2PZPA 4OBQA 4Z7HA 5CEKA 3QGYA 2UZWE 3ITZA 1WBOA 3QRJA 4RVKA 4H1JA 4L68A 4ZY5A 5KX8A 4U80A 5AV3A 3HZTA 2JKQA 3LM0A 3O50A 5FQDC 1UU9A 4FSUA 3HUBA 3LW0A 5DR2A 4HVIA 5J1WA 4RZWA 3WARA 2B9IA 3VF9A 4C4IA 4OAUC 3PY1A 5CAQA 4TYHA 4YUQA 2C6TA 4L9IA 2ITWA 4TYHB 5ETCA 1M52A 4I94A 3CR0A 2C5OA 4KKEA 3TNPC 3MV5A 3K5UA 3HDNA 5FD2A 3R8ZA 2PE2A 2YM4A 4Q9SA 3S95A 3V6SA 4O2ZA 3UC3A 3WE4A 4BI0A 3FKOA 3NIEA 3QUPA 2WGJA 3BWFA 5L4QA 4KRDA 3LCTA 3K3IA 3C7QA 5D7VA 3OF0A 1LUFA 4AGUA 4C3PA 2OO8X 3NVKI 4FT0A 3BRBA 2V0DA 4FTIA 5EQPA 3QA8A 4AG8A 4UEUA 5CEMA 1OPKA 4HZRA 3HA8A 3MA6A 2H9VA 4I5CA 1SNXA 3LCKA 4E4MA 2OGVA 4NFNA 4L53A 3RPSA 3A8XA 1J7IA 2F7EE 1PMNA 2JIUA 2WIPA 3DOGA 3ZFYA 3FPQA 4FZFB 2WU6A 5CU4A 4MKCA 2B55A 2C5YA 2QR7A 3NX8A 4JIKA 4XP3A 3IQ7A 4BTFA 5AR4A 1LEWA 1PF8A 4NKAA 4FZDB 4L6QA 2AYPA 5FTOA 5EM8A 2UW0A 3UOLA 4KIQA 4ANNA 3F66A 1Q8ZA 2R9SA 4MXCA 2X8IA 1PXPA 3QF9A 3BV2A 5HVKA 5T6KA 2W0JA 4O6LA 2VO6A 3PY0A 3UBDA 3ZRKA 4BVUA 5M44A 2J50A 3C4EA 4RWKA 3L8VA 1KWPA 3VS0A 3MTLA 4XHKB 3RM7A 4ZTRA 5HORA 4FKSA 4B0GA 2W1HA 3DFAA 5FDXA 4CV9A 4DEGA 4IZ5A 4FEUA 1OIUA 3Q3BA 4S2ZA 4ZMFA 3P4KA 4X2GA 3NWWA 3R7OA 3SX9A 4C3RA 3O71A 4O7WA 5HQ0A 3JUHA 3UO6A 4EZ5A 1XH9A 5BMSA 3ZCLA 3EFKA 3IKAA 3JVSA 4QP4A 3R01A 2FO0A 3OBJA 2OJ9A 4M0ZA 1R78A 4FK3A 3VO3A 2CNUA 3FBVA 4FKWA 5E1SA 1VYWA 2HW7A 1URWA 2E9NA 4S34A 3EKNA 5ANOA 1YOLA 4FIJA 5H9BA 3W33A 1SYKA 3DXNA 4EYMA 5L3AA 3BLHA 4RPVA 2EXCX 2Q83A 4BCJA 3KXNA 1PYXA 4DT8A 3E7VA 2VTPA 2ZMDA 4QD6A 3EHAA 4EH7A 3QZHA 4EH2A 3QC9A 3SRVB 4G6LA 3JR1A 1ND4A 3CY3A 4GU9A 3AT4A 3VC4A 5JZJA 5KMOA 2SRCA 3P7AA 4I20A 4NCTC 5C4KA 3KMMA 2VWVA 5KNJA 4AWIA 2O2UA 2YERA 4BC6A 2QQ7A 3G0EA 4GYGA 4OTFA 2IG7A 2XKDA 5BVDA 3LFSA 1U5RA 3KK9A 2QOIA 2WMSA 4NUSA 4DLIA 2HELA 4XG3A 5GZ9A 3FMJA 2V22A 4IAIA 1JBPE 1Q97A 2W96B 3BCEA 1YDRE 4L42A 4F64A 4YJSA 1CTPE 4JG8A 1F0QA 4AN9A 5J5SA 3A7HA 4QRCA 1KE5A 3GXLA 2PMOX 4FYNA 5ANDA 4DH3A 5CU3A 3OD6X 5AUTA 3QQJA 4KD1A 5E92A 3I0QA 3K2LA 1YRPA 3K54A 4CSVA 5IF1A 4FIEA 4FKQA 5HTIA 1NY3A 2B52A 4EOPA 1OL7A 5CTPA 5HTCA 3F2RA 2UVXA 2QOLA 1ZZLA 3CC6A 3P7CA 4JQ8A 5CT0A 3PY3A 1XH8A 1XKKA 4YJTA 4ACCA 2QONA 5IMEA 2XNEA 1V0PA
chains in the Genus database with same CATH superfamily
4B4LA 3EOCA 3FAAA 1FINA 4RQKA 4NL0A 3VUKA 2BPMA 4PTEA 4UYAA 4UWBA 3LVPA 3QD3A 2IVTA 3VUMA 4BCKA 5M4UA 3FLYA 5ANGA 3GOPA 3GCPA 2BTRA 3RHXA 3QYWA 4I5PA 4IAFA 4MEDA 5ACBC 3G6GA 1GZKA 3VS6A 4MD9E 4IFCA 4TKSA 3CQWA 3HRBA 4FV2A 3IDCA 1O6LA 2QVSE 2QURA 4JS8A 3ACJA 3FY2A 3NPCA 4GJ2A 3RAWA 5JH6A 2J6MA 5GJFA 2X4ZA 3ALOA 2C1AA 4FRFA 2GPHA 4WRSA 3NUPA 3ORMA 3KK8A 2R0UA 4BBEA 3MYGA 4NIFA 4XOZA 1OZ1A 5EQEA 3AD5A 1PYEA 2XB7A 4GSBA 1Y57A 2OJGA 2WEIA 3FMLA 4QO9A 3TIYA 2R7BA 4Y72A 4UN0C 3E8NA 4FKLA 4ASDA 2UW5A 4BDFA 4FKJA 2QC6A 4AU8A 4JJRA 4BCPA 3LJ0A 4XP2A 2XUUA 4GW8A 5IISA 3NYVA 5IDPA 3L8XA 1MQ4A 4PDOA 3NVMB 3MY5A 4LRJA 5EH0A 2YWPA 1LP4A 3KULB 5CU6A 2PZ5A 3Q9ZA 5ANEA 3U6JA 4C61A 3E8DA 2A27A 5LMAA 1YOMA 3BHTA 3IW8A 3KQ7A 4BCIA 3PVBA 3MPTA 2YDIA 4MNFA 5CSWA 3UG2A 2UZTA 4FTQA 4AFEA 3MVJA 3P9JA 3GCQA 4L45A 3A7GA 1UV5A 5HEZA 5AEPA 1PKDA 4P5QA 3RCJA 5FDPA 1R0EA 4B8LA 2GHLA 5E8UA 2BZKB 3NZ0A 3O51A 5HNBA 1H0WA 3CY2A 3LMIA 4I0TA 5LARA 3D7ZA 3LM5A 3LE6A 2VO7A 4WKQA 2OXDA 4C62A 3C13A 5ICPA 5M06A 4AZWA 3RCDA 3OEZA 4M12A 1JOWB 5B0XA 3W16A 4BIDA 4ZLOA 4ZLYA 1NW1A 3V5LA 4LOOA 4PRJA 2VTSA 4YTFA 4I41A 5EYDA 4MXOA 3L9MA 1ZAOA 4M7IA 4IZYA 4YNOA 1UU7A 4TN6A 4GUEA 2XP2A 1QPEA 4D2RA 3H4JA 5DFPA 3L8SA 2EUFB 4R78A 5EHYA 3UE4A 3UC4A 3MIAA 3GC0A 1QPJA 5E8ZA 5EOBA 4XLVA 3I7BA 5AV2A 1XR1A 4J71A 3RHKA 3VHEA 3NCZA 4V04A 3QU0A 4HVDA 3BKBA 2RFEA 4OTDA 4FKRA 4G3FA 3OY1A 4O4BB 2O3PA 4M97A 2H6DA 5CU2A 5CZIA 4DBNA 2R3PA 4EH4A 5IQBA 4NSTA 2VGOA 3MJ2A 4AZVA 3L9NA 4FL1A 1VLRA 3HA6A 3KU2A 5I5ZA 5GNKA 5KMJA 4AGWA 3ZFMA 2BIKB 4UWYA 2CN8A 2XS0A 2P0CA 2YJRA 4F7NA 3BHUA 4EK4A 1PHKA 1H1PA 5D41A 3FKNA 1VEBA 4HYIA 5AP5A 2CGWA 4JT3A 2XK7A 3CPBA 4TTHB 2BKKA 4AQCA 2FSLX 2BRGA 4JRNA 4BN1A 1Q4LA 3KXZA 3F3ZA 4LL5A 4IH8A 3TEIA 3CJFA 4CCUA 5HNIX 4L3PA 4MBIA 4DGMA 5GZ8A 4TYIA 5I9VA 2BROA 4DAWA 3MVLA 5LVPA 3VQHA 5AR2A 4KAOA 4BDDA 4ZTMA 1VYZA 2ZM3A 4GG7A 2JDRA 4XG8A 1U5QA 5IA5A 3AKJA 3UOHA 2WOUA 2OFVA 3R2YA 5IH4A 3EL7A 2QODA 2QKWB 1KV1A 2BALA 2X7GA 5C01A 4GK4A 3ATTA 5AIKA 4Q2AA 3EYHA 3R00A 3QHWA 2HY81 3KY2A 5L8LA 1H8FA 3LXPA 5J9LA 4C59A 3DKOA 4FVPA 1W2CA 2PVJA 2IO6A 3KEXA 3W2PA 4AW0A 4U81A 1HCKA 3OS3A 4ANQA 3GP0A 3OVVA 4KIKB 3V5QA 3W55A 4F09A 1BX6A 4LRMA 5M53A 3N51A 4EEVA 3T8OA 3CQUA 3O7LD 4BWKA 5H3QA 5BV3A 3V5WA 3RINA 4DGGA 5AAEA 2YIYA 1PXMA 3JPVA 3UVQA 4DEBA 1L3RE 2IVVA 3FXWA 5DRDA 4O22A 3BELA 4WG5A 1IR3A 3WE8A 2G2FA 1H1SA 3QQHA 4BKJA 4JBQA 4JAIA 1MRVA 3EQCA 5CYIA 2E9VA 4C4FA 3P5JC 1H0VA 1ZLTA 4ONAA 3ZLWA 2VTAA 4YZMA 1REJA 2VUWA 2W5HA 4FV8A 4D2TA 3KREA 5CZHA 4HYSA 2J0KA 5B2LA 5IQCA 2XNNA 4I22A 4OW8A 4N70A 4LG4A 5A3XA 4XRLA 1YDTE 4LV7A 5JRQA 3E92A 2OXYA 4X3FA 4PY1A 5FM2A 1WCCA 3FLQA 5FTGA 3QRUA 4BR3A 4EJ7A 2VTLA 2IW8A 3F2NA 3ZLSA 4WRGA 4X6RA 3H0ZA 5E8VA 5CU0A 3VBYA 5CEOA 4EOOA 5CT7A 4XG9A 2FYSA 3Q04A 5DEWA 4LMUA 3WF8A 2X1NA 4J1RA 4A4XA 5HZNA 1IAHA 5CXZA 2Z60A 4YO4A 3CBLA 3CKXA 3OCGA 4Z16A 3FMKA 3KC3A 3WF6A 4QTEA 3ML1A 1KOAA 5K4IA 5HO8A 5IA3A 5KMNA 4IFGA 1RE8A 3L1SA 2O64A 5CNNA 2FH9A 4NM5A 2PUIA 4ZSJA 4BBFA 4M69A 4RG0A 5DBXA 5I9WA 4FKOA 4M69B 4GCJA 2RL5A 5E8WA 4D58A 4ACMA 4YZCA 4NFMA 5M08A 2X7OA 5ITAA 3PRFA 4K8AA 4O1OA 3QWJA 3WF9A 1OITA 1WVWA 2GS2A 2OWBA 1YI3A 4X2KA 5D12A 4ZJIA 3F3WA 3E3BX 4YJOA 4GUBA 3NFGB 3O8TA 4E6AA 3FHRA 1XH4A 2WMQA 3RM6A 3BI6A 4BDGA 1BL6A 3ZDIA 4CT2A 4DINA 3MW1A 4NW6A 4OAVB 5DPVA 4PTGA 4GIIA 5BQ0A 1BI7A 2C3LA 4O7YA 5IG1A 2CMWA 4L7SA 5DHJA 5JGAA 4IM0A 3DA6A 5H8EA 4FSNA 4YJVA 2YM7A 5ANIA 5CAVA 2PVNA 4BYJA 2IW9A 1STCE 2RG6A 5FUTA 4O0UA 3NLBA 1E1XA 3QD4A 1KE8A 4GT4A 4E6QA 5IEYA 5M57A 4E6DA 1FGIA 2QLQA 2UVZA 3H3CA 3PA3A 4WG4A 3ZLYA 5EI6A 1PMEA 4E4XA 3NYXA 4JBOA 5AUVA 5FM3A 3BYVA 5HIDA 3V8TA 4GVAA 3ETAA 2RG5A 3O8PA 4IX5A 3OUNB 2YWVA 3TDWA 5DWRA 3HP5A 3S1HA 4C3FA 2ESMA 2XNGA 2I1MA 4FKGA 2UZNA 4I92A 4WOVA 3ATSA 4I1ZA 1A06A 2WQNA 4AX8A 4S33A 4NU1A 2NRYA 1GAGA 3FWQA 4IMYA 5TOZA 3ZEWA 5AJQA 2ZV9A 4YTIA 5E8XA 3GFEA 1R3CA 2P4IA 5M09A 3R9HA 3CLYA 4U3YA 3BLRA 3ANQA 2QD9A 4EJNA 1YXVA 4U3ZA 4Z55A 2C3KA 5KMLA 3DV3A 2UVYA 3NIZA 2XCKA 4QMLA 4CTBA 1H24A 3ZLXA 5AM7A 2XIXA 3FZOA 2NYAA 5AR3A 4CFWA 2I7QA 5DR9A 3HMIA 4UMPA 4ZP5A 4MUQA 3LMHA 5IEVA 4ZAUA 3MWUA 3BL9A 3TMOA 3E88A 3NW7A 3SKCA 3DQWA 4O6EA 3F6XA 3BYSA 4JDIA 2IZSA 3R30A 5BYZA 2OJFE 2E9OA 1ST0A 4JBPA 5T3QA 1W8CA 2XJ1A 2BKZA 3WOWA 5IQGA 4FTCA 3A4PA 3DK6A 2BHEA 1W98A 2XKFA 3EWHA 1U54A 2VTRA 2W1EA 3NR9A 4L43A 4UMTA 4IHPA 4UXQA 4YLLA 5CSPA 4BTKA 2R3KA 4ZZNA 3MDYA 2XJ2A 3DJ7A 4JOAA 1Q99A 3IGOA 2W1FA 3LCDA 3R22A 4UXLA 1H1RA 4C2WA 5C8NA 1DAYA 1I09A 1OKVA 2XNMA 2VTIA 4GIHA 4WHZA 4E4LA 4AXDA 3F9NA 4K6ZA 2XALA 3E5AA 4FEVA 3P5KA 3OT3A 4YJUA 4CFUA 3NAXA 1Q3DA 2UZBA 2YCQA 4FTUA 2CHLA 3QHRA 3IOKA 3MSSA 5BVEA 2CKPA 1W2DA 2QO2A 4O4FA 4ACHA 5CANA 5FEEA 1ZARA 2GQSA 3C5IA 2WB8A 4MHAA 1XMMA 3QKLA 3U4WA 4HNFA 5HOAA 1Y6AA 3O7LB 3ORIA 3ET7A 2ITNA 3FMDA 4X0MA 3ZUTA 2LAVA 5IH6A 2WTWA 3DZQA 2UW9A 3FL5A 3PWDA 3Q6UA 3ZTXA 3VULA 3JXWA 4IJ9A 4BGQA 4P2KA 2AQXA 3LFDA 4MQ2A 4QNYA 4R3CA 5DR6A 4CMTA 5IA4A 1XQZA 4JDHA 4ITJA 4BDKA 3LFAA 2O5KA 3F3VA 2AC3A 4PWNA 4QP9A 4XP0A 3SD0A 1REKA 4FL3A 1CKIA 5IUIA 3F7ZA 4L46A 3R9DA 1BI8A 3D0EA 3DQXA 5GZAA 4YURA 4O7NA 2JDVA 1JVPP 1PJKA 2UZOA 3H9RA 1T45A 4ZSGA 3U9NA 4JX7A 4MBJA 4X3FC 4O86A 1AGWA 3A2CA 3E3PA 3G5DA 5IA2A 4BRXA 1TFFA 3GU7A 2JKKA 4F70A 3IG7A 3QUEA 4N6YA 3HVCA 4IM3A 4MWHA 3FZTA 2QCSA 5JT2A 4FSRA 4U43A 4F1MA 4XG4A 3PFQA 3E62A 1OGUA 5BYLA 3ZM9A 3MPAA 1H26A 3DFCB 4UB7A 3QTWA 4DEEA 4YBJA 4K2RA 2IZRA 4JVGA 3Q53A 5AR8A 3B2TA 3BZ3A 3U51A 3HDMA 5IU2A 1Y8YA 3ENHA 3QCYA 5HBHA 2Z2WA 3COIA 3EQIA 2PMLX 2J4ZA 3ZSGA 3FMHA 3TG1A 3FJQE 5LMBA 5BNJA 5C26A 4F6WA 3BL7A 3CTJA 4AE9A 2ONLA 4G16A 2ACXA 1P4FA 2GTMA 1MRYA 3FQSA 3KCKA 4JQEA 4RJ5A 4JNWA 5JFVA 4HOKA 4NCTA 4IE9A 5TO8A 2VO3A 3SLSA 2XZSA 5CAUA 4O91A 2PVRA 4PPCA 2PE0A 2C0OA 3GNIB 3O8UA 1O9UA 1ZY5A 3UDSA 2R3FA 2NRUA 3QZIA 4FX3A 2ITUA 2VO0A 4D2VA 5BVFA 2VWUA 2QU5A 4PF4A 1QMZA 5FP6A 4O7ZA 4PMTA 4FTRA 4QP1A 4K77A 4BZOA 4QT1A 4BZDA 5HO6A 4FTJA 5M4FA 2X6EA 4PDYA 3PIZA 4F65A 3ODZX 1WBVA 4TYGA 5AUZA 1VJYA 2ZJWA 5EW8A 3ZEPA 5FG8A 1LPUA 4RC3A 2ETRA 3S2PA 2QLUA 2YZLA 2XANA 4AA5A 2GU8A 3F3TA 5AM6A 3DKCA 2GHMA 3GC8A 2BRBA 2C5VA 3LQ5A 3WILA 5EDQA 3ZXTA 4FZ6A 2YLFA 3HV3A 3DCVA 4HGEA 5K4JA 4QMXA 2QI8A 3RBWA 3B8QA 4QTDA 3PJ2A 4XJ0A 5LXMA 4EH3A 3LFQA 3NDMA 2ETMA 4BCFA 2C3JA 1OL6A 4EK8A 4ANBA 4FV4A 3TV6A 4FSQA 3IPHA 3IDBA 5D7AA 3DK7A 4U97A 4ORKA 3R1QA 4C33A 2Y4IB 3ROCA 4DG3E 2WO6A 1UU3A 4AA0A 5LMKA 3RZFA 1TVOA 5HO7A 4LYNA 2GS6A 4RIXB 1IA9A 3ROYA 3NW6A 2B53A 4D28A 3BBTB 4RA4A 5IA0A 3B8RA 3C4ZA 4FT5A 3A4OX 3BBWA 3Q4TA 4MVFA 1QPCA 4F0FA 3I79A 4FL2A 5DA3A 4KKGA 4PL4A 2PZRA 5D9HA 3EQGA 4EQMA 4NK9A 4DEIA 2RF9A 4LQMA 2PVHA 4QDVA 3WYYA 2CKOA 4C4GA 4TYEA 4IWOA 4IX4A 2WTDA 3O17A 4BCQA 1YQJA 3COHA 3F88A 3QGWA 4RJ4A 1M2RA 4W8EA 1DI9A 2C68A 3NUSA 4R7BA 3UTOA 4N0SA 5I3OA 5DOSA 1TQPA 4JQ7A 2PK9A 5E1EA 2VD5A 3SW4A 4FV9A 4YNEA 5BX0A 2B9FA 1SVGA 3VS1A 3A7JA 4NYEA 4BJJA 3MJ1A 5AIRA 4E7WA 3FZSA 4J98A 3R8LA 5JKGA 3G6HA 3PZEA 1VZOA 2XIKA 1UA2A 2J51A 3VUTA 3NUAA 5EFQA 4EBVA 3DS6A 3I60A 3MH3A 2J90A 4QPMA 5KMKA 3MFTA 2X4FA 5L2WA 2CKQA 4RFMA 4G6OA 4F9WA 2OBJA 3O0GA 4L01A 4BCNA 4JL9A 4Y85A 3FSFA 3FZ1A 3PUFC 3QQGA 2F57A 1JKKA 1YXSA 1OMWA 3ZM4A 4EUTA 5AR5A 1KSWA 4QQTA 2YDKA 4H3QA 1SM2A 3EQRA 3K3JA 1R1WA 3ORLA 3NUXA 5JGBA 1SZMA 2ITXA 3EL8A 3UYSA 2YA9A 1Q8UA 1XJDA 3KGAA 3F82A 3PJCA 2PZYA 3TI1A 4CQGA 3MI9A 3ORPA 5CEQA 4FG9A 2W1IA 4E1ZA 3KRXA 4FSTA 3PJ1A 3REPA 2GFSA 2HWPA 2X39A 2YM6A 3TTJA 4RFYA 5I9YA 2PMNX 5HTBA 5DN3A 1PXIA 1GIHA 4IAKA 2H34A 3CCNA 1GZOA 2OF2A 2XNOA 4XOYA 2WMBA 4FBXA 5EI2A 3RWQA 2IW6A 4W4XA 2PL0A 2ZFYA 1JLUE 2QNJA 5I9XA 1XH5A 3V5PA 4TY1A 3HRCA 2OW3A 4RJ6A 3OP5A 4U41A 3OBGA 4IVAA 3EQFA 3FQEA 4TYJA 1OIRA 4K11A 3RWPA 3OWKA 4AF3A 3TIZA 4L52A 2EVAA 5M4CA 4QP8A 1GJOA 3PVGA 4GFOA 5LJJA 1UWJA 4AXEA 3LXKA 2R3RA 3PRIA 4LUEA 2ONLC 3PPZA 3SRVA 4W9WA 2OFUA 5HG9A 1WFCA 4HNIA 2R3OA 3V8WA 3C50A 4AW2A 3RK9A 2VTNA 4HYUA 4UBAA 2R3LA 4QMTA 4FMQA 4D4SA 4OTPA 5BUJA 3LFEA 4H58A 5IEXA 4MD8E 4AAAA 5AV4A 2X2LA 5TF9A 5LCKA 3ZC5A 4ERKA 2XIRA 3AC5A 3SQQA 3JY9A 2CSNA 4A06A 2CPKE 5LCJA 4O7RA 4EWHA 3BHHA 4KIPA 3KL8A 1YWNA 4MH7A 3C0GA 4F9AA 2XEZA 4FIHA 1H00A 1CSNA 3LKMA 1IG1A 1Z57A 3KCFA 5H2UA 3PPJA 4OTWA 4FEWA 3DB8A 4GK2A 4U79A 3VWAA 3MPMA 1M14A 5EKNA 4O0YA 3O2MA 1L8TA 1UKHA 3U4UA 2OXXA 3QZFA 3OW4A 3R6XA 3RNYA 4B8MA 4AOTA 3R28A 5HHWA 3ENMA 3LHJA 3COKA 4ZOGA 5BUIA 4S30A 4I5MA 4LUDA 2V7AA 5EYKA 4WD5A 5F20A 4ALVA 2Z02A 4DEDA 5HESA 4RSSA 5H8GA 3COMA 3UYTA 3Q9XA 5A46A 5JEBA 3THBA 3IGGA 4CT1A 2A19B 3NEWA 3M1SA 5HVYA 5D10A 3RI1A 2Y4IC 4DH7A 3OTVA 4O0WA 4FTKA 3PSBA 2Z7QA 3F5PA 2PSQA 4G5JA 5LMKC 4ZTSA 4GKHA 3G9NA 3TCPA 3FLZA 1NVQA 3DAJA 3R8UA 3VJNA 3Q4UA 2EB2A 4MXAA 5EM6A 3UOKA 3VS4A 3GCVA 5FTQA 1CKJA 3LXNA 4QMVA 2VAGA 4JDJA 2CGXA 4KS8A 5GJDA 4HVGA 3HKOA 3RAHA 4G5PA 4I0RA 4N6ZA 2Y9QA 2WTIA 3Q60A 4RQVA 4XG2A 2UW3A 3AD6A 4XBRA 5LVNA 4DBXA 3RPOA 2BTSA 4XNEA 3BLAA 4D9TA 1S9IA 2ZB1A 3OMVA 1DI8A 5DGZA 1Q41A 4FKUA 4W8DA 1TZDA 4R7HA 2JDTA 2J0IA 4BF2A 2I6LA 4TPTA 4AT5A 2XK3A 4GK3A 5KCVA 2XF0A 2DS1A 4ANSA 4BWPA 4DEAA 4DGNA 3P23A 3GU6A 2W1ZA 2W9ZB 3W32A 3POOA 2ITVA 2WEVA 3C0IA 3KULA 3ZSHA 3BE2A 3Q32A 1ZYSA 4D5KA 4KBCA 1W84A 4CZUA 2XK9A 3H10A 1NA7A 3ANRA 4YZDA 4KSQA 4ANMA 3QQUA 4C37A 3RPVA 4FNYA 1ZOGA 4EKKA 2WQOA 3QYZA 3UQCA 4TWCA 1OB3A 2IN6A 2C5NA 2A98A 4YHFA 5AP0A 3HV7A 3V51A 5HE1A 1LEZA 4C35A 2VN9A 4W9XA 4WIHA 5F4NA 4LL0A 5DI1A 1M2QA 4ITHA 4EH5A 5CVHA 2J0JA 5JQ8A 4QTCA 1WBSA 3Q52A 4AZFA 2R5TA 3LQ8A 3MY1A 3A61A 2PVFA 5K0XA 1O6YA 2WKMA 3ULZA 4J99A 1QPDA 3IW7A 3D2IA 4X6QC 4O7VA 1A48A 2WNTA 1XBBA 2ETKA 2NO3A 3DJ5A 3E87A 3R8MA 2X0PA 2G01A 4U9AA 5I9UA 1E9HA 5BMMA 5G1XA 2HAKA 4OTRA 4AZEA 4DCAA 2EU9A 2X9FA 4L44A 3WZKA 4CFVA 2YM3A 3OCTA 3SG8A 3G15A 3SV0A 2BZIB 4DFLA 4OT6A 4EOJA 4A4LA 4PL3A 2J0MB 4QP6A 4K1BA 4Y5HA 4YZ9A 3MBLA 4CMOA 1Q8WA 2W17A 5G6VA 4DGOA 4FZAB 3FSKA 3MVMA 2QO7A 3IONA 4EI4A 4CGAA 4XYFA 1BL7A 3TUBA 1XWSA 4HYHA 4KSPA 4ZXTA 3U6HA 2CCIA 5GINE 2C6MA 2ZDUA 3EN5A 3EQBA 5ETFA 1Q24A 4D2SA 3D5VA 2CN5A 3UDBA 3W8LA 3V8SA 3ODYX 1BKXA 4O81A 3VS5A 2JAMA 2OIBA 3AMAA 4I3ZA 3SXRA 4BIBA 4IADA 4H1MA 1JPAA 4DF3A 3F7WA 4FUYA 1Y8GA 2B7AA 4QMQA 5JFWA 1UNGA 2NP8A 2RFDA 2ITQA 2VTHA 2HWOA 3GU5A 3KRWA 5CF6A 2R4BA 3F61A 4FICA 3PXQA 4XH6A 4YLJA 3VBWA 3ZO3A 3P0MA 4AT4A 3D83A 4C02A 4L67A 5L2SA 4H3BA 3ERKA 2OZOA 2X8DA 2WMWA 3EZVA 1YHWA 4YJPA 3UZTA 3GEQA 4BWXA 5HI2A 4ANLA 5CS6A 1SVEA 4QMYA 1P4OA 4C0TA 4F0IA 3UQFA 4BIEA 1H08A 1UNLA 5AFVA 4O38A 4XX9A 3VONA 4ZSLA 2Z7RA 3DBDA 2ITOA 3Q9YA 3QAME 4K18A 2WXVA 4Z9LA 4PDPA 1WBTA 2B0QA 3DNEA 2PVLA 3KXMA 3ZSIA 2WMUA 5HU9A 3VUHA 4CEGA 2HZ4A 4F9YA 2VGPA 4QMOA 5HD4A 1K3AA 5DE2A 2J2IB 4K0YA 4F7LA 3CGOA 3QTZA 2BUJA 1MQBA 3D2KA 2C6DA 2UZDA 2GQRA 4R1VA 4FT7A 3OUKA 1PXJA 4E20A 2R3MA 2YJSA 5AR7A 2FB8A 4MCVA 4R5YA 3EQPA 4H3PA 3H9FA 2BMCA 4ENYA 3QRKA 1FVTA 5EW9A 3MA3A 1ZY4A 3BIZA 4I6HA 2BAQA 3PDTA 5J7BA 1YVJA 2R3HA 3E8CA 4GV1A 4KIKA 1KV2A 3L9LA 4RIYA 4RIYB 4F9BA 3H9OA 3PP0A 5F94A 2C0IA 3BE9A 4LV5A 4J7BA 5JRSA 3Q2MA 5L8JA 5HU3A 3VQUA 4D4RA 4P90A 3UQGA 4AQKA 1UWHA 4Q5EA 3DBCA 2OICA 5AUWA 4AW5A 3LLTA 3TJDA 4O21A 2J9MA 4QYYA 4WNMA 4HVHA 5J79A 2R3IA 1YXTA 4QEBA 3RPYA 2H8HA 5HX6A 4IB0A 5FLFA 4AGCA 1P14A 3P7BA 1ZOHA 2JBPA 1J3HA 1SMHA 2CCHA 2UW7A 3AGMA 5T68A 3TKUA 3D15A 4M14A 5KBRA 1K2PA 4CKRA 4KKHA 4EH9A 4CMUA 3F5UA 4C4HA 4JMQA 4L8MA 2YABA 3QD2B 4BKZA 5CF4A 4BYIA 5EQYA 2A4LA 3NRMA 2DUVA 4PDSA 4DDGA 4ACDA 2ZV2A 3R9OA 3E64A 2XRUA 4B99A 4H05A 2QO9A 3LAUA 4ARKA 4YP8A 4K9YA 3I5ZA 3CKWA 4MF1A 2W06A 3G33A 5CVFA 4FTLA 3R7YA 3IW5A 5J5TA 4TT7A 1MP8A 1Q8TA 3G0FA 4CQEA 1ZMWA 2YEXA 2EXEA 3FQHA 5HCYA 3GC7A 1PRYA 4IZ7A 1Y91A 3R73A 2IJMA 4DG0E 5C4LA 4EZ7A 2HY0A 4OLIA 4CKIA 2XBAA 2XEYA 4MXZA 3R1YA 2V55A 1S9JA 3MFSA 4WUNA 5K9IA 3Q4CA 4WUAA 2PPQA 5HIEA 3D94A 4FOCA 4EC8A 3EN6A 4MAOA 4BHNA 1P2AA 4DFNA 1F3MC 3IW4A 3FHIA 4U45A 2XK6A 2Z7SA 4FSZA 3E63A 3A60A 5HIBA 4J8MA 5FEQA 3W0NA 2XMYA 2ZDTA 4AS0A 4L3LA 5DYJA 3NAYA 3NUNA 5ANJA 3SXFA 3RK7A 1FVRA 5DIAA 4YJQA 3PIXA 4JLCA 3Q2JA 4CG8A 2ZV7A 2G2IA 4O83A 4JR7A 4LGDA 2J0LA 3EIDA 4Y5QA 4G17A 3C51A 3WF7A 4BHZA 2Z8CA 3OW3A 4MYGA 3N4TA 4BDIA 2GCDA 5CEIA 1GOLA 3PJ3A 5AV1A 3C9WA 3TNWA 4FNZA 3C4FA 2JITA 2FUMA 3FY0A 3A7IA 4D4VA 1JSUA 1RQQA 3VAPA 3F69A 2QKRA 3R1NA 4ASEA 5A4EA 3UIMA 2J7TA 4G9RA 3BLQA 5DH3A 4QTBA 5HG8A 3HAMA 3R7EA 2YM5A 2IVSA 4FV5A 5LVMA 2FVDA 3WIKA 2RSVA 4DFBA 2C6OA 2W99B 2C0TA 3GVUA 2KULA 1URCA 2W1CA 3OROA 3HX4A 4YHJA 3IK3A 2VX3A 3MB7A 4IDVA 1JKTA 2H96A 3NUYA 3PYYA 4I6LA 3DKFA 2JIVA 2ZM4A 4C57A 3C0HA 3SGCA 3QX4A 4NH1A 5IUHA 4DC2A 4RX8A 5A6NA 4MQ1A 4FV1A 4M84A 4EHVA 3N4UA 5ACKA 5FBOA 2GNHA 4RLLA 3WIGA 3ID6C 2YHVA 2QR8A 4JG6A 4YU2A 1M17A 3IDPA 1DS5A 2JAVA 4FNWA 3PXFA 2YCFA 3LMGA 4FV7A 2AUHA 4R3RA 4D1XA 4H36A 1YI4A 2QOHA 3P1AA 4A9YA 1U4DA 3TDVA 4BI1A 5TE0A 2B9JA 2WFYA 4WSQA 1WBNA 3BX5A 3C4CA 4GVJA 3MVHA 4D4YA 4EH8A 3MN3A 3OZ6A 3LCOA 5CXHA 4FE2A 4LOQA 1R39A 4CG9A 5A6OA 5J7HA 4N4SA 1OGYA 4O2PA 4LDTA 2XRWA 3FMNA 2QG5A 2X0OA 2C3IB 1ZMVA 2WMXA 5I0BA 3NW5A 3BYOA 2VX0A 3E8EA 4H39A 2PVYA 4PPAA 4ITIA 4OR5A 4RFZA 3CD8A 4FOBA 3GCUA 2F2UA 2XM9A 2PU8A 3NNXA 3LXLA 1Q62A 3T9TA 1TKIA 2Y4PA 3MTFA 4FGBA 4UMUA 3PSDA 4WSYA 3QLGA 4E26A 4D9UA 4MK0A 3DLSA 4AZTA 4OTIA 4DCEA 5HG7A 4FI1A 1XMLA 3VNTA 4ZSAA 3GFWA 3KN6A 1YXUA 3DGKA 5HNGA 4IB1A 4IDTA 3RMFA 4UX9A 2JEDA 2NNWB 3AKKA 3BGZA 4GEOA 4YR8A 3TM0A 2IZTA 2O8YA 2Y7JA 3FI2A 5AMNA 1Q5KA 5K3YA 3NNUA 3CIKA 1XH6A 4IX6A 4IW0A 2VRXA 5JGDA 4RGJA 2UZEA 4M67A 3IOPA 4WNOA 4WG3A 2GS7A 3WBLA 3AC1A 2XIZA 3KVXA 3AC2A 3ZO1A 4W4VA 3TJCA 3KA0A 3WF5A 2JIIA 4JG7A 4FIIA 4B7TA 3GENA 4EQUA 2HZ0A 3KIOC 2C1BA 2JFMA 3GCSA 3Q6WA 4J53A